BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20374_g1_i4 len=3242 path=[1427:0-399 1827:400-2428 8301:2429-2445
3872:2446-2458 8330:2459-2469 8341:2470-2485 101:2486-2647
263:2648-2650 266:2651-2684 4107:2685-3241]

Length=3242
                                                                      Score     E

ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                1474   0.0     
gb|AGW47883.1|  beta-galactosidase precursor                           1463   0.0     
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                1461   0.0     
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                1457   0.0     
ref|NP_001234303.1|  beta-galactosidase precursor                      1455   0.0     
gb|ADO34788.1|  beta-galactosidase STBG3                               1453   0.0     
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like                1453   0.0     
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                1434   0.0     
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                1432   0.0     
gb|AHG94611.1|  beta-galactosidase                                     1430   0.0     
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                1426   0.0     
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                     1424   0.0     
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                1420   0.0     
ref|XP_009783993.1|  PREDICTED: beta-galactosidase                     1420   0.0     
gb|ACC60981.1|  beta-galactosidase 1 precursor                         1417   0.0     Petunia x hybrida [garden petunia]
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                1416   0.0     
emb|CDO97918.1|  unnamed protein product                               1415   0.0     
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                1407   0.0     
ref|NP_001234465.1|  beta-galactosidase precursor                      1405   0.0     
ref|XP_010106660.1|  Beta-galactosidase 1                              1389   0.0     
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2          1381   0.0     
gb|ABV32545.1|  beta-galactosidase protein 2                           1380   0.0     Prunus persica
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                   1380   0.0     
emb|CAC44500.1|  beta-galactosidase                                    1379   0.0     Fragaria x ananassa
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg            1378   0.0     
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like              1377   0.0     
ref|XP_002527409.1|  beta-galactosidase, putative                      1376   0.0     Ricinus communis
ref|XP_010262131.1|  PREDICTED: beta-galactosidase isoform X1          1375   0.0     
gb|ABK96254.1|  unknown                                                1372   0.0     Populus trichocarpa x Populus deltoides
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                   1371   0.0     
ref|XP_006385360.1|  beta-galactosidase 1 family protein               1371   0.0     
ref|XP_007024475.1|  Beta galactosidase 1                              1368   0.0     
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                   1367   0.0     
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like              1363   0.0     
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like              1363   0.0     
emb|CBI35944.3|  unnamed protein product                               1363   0.0     
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                   1363   0.0     
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like              1362   0.0     
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like              1360   0.0     
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                  1360   0.0     
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                   1360   0.0     
gb|EYU21377.1|  hypothetical protein MIMGU_mgv1a001631mg               1355   0.0     
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg            1354   0.0     
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                   1352   0.0     
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg            1350   0.0     
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1-like              1349   0.0     
emb|CDY51738.1|  BnaA01g37210D                                         1348   0.0     
ref|NP_187988.1|  beta galactosidase 1                                 1348   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117469.1|  PREDICTED: beta-galactosidase 1-like              1347   0.0     
gb|KDO65275.1|  hypothetical protein CISIN_1g002867mg                  1347   0.0     
gb|AAM13196.1|  galactosidase, putative                                1346   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDY37486.1|  BnaC01g37460D                                         1344   0.0     
gb|ACP18875.1|  beta-galactosidase pBG(a)                              1343   0.0     Carica papaya [mamon]
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                     1342   0.0     
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                     1341   0.0     
ref|XP_009146456.1|  PREDICTED: beta-galactosidase 1                   1341   0.0     
ref|XP_006300095.1|  hypothetical protein CARUB_v10016323mg            1340   0.0     
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                   1339   0.0     
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617            1339   0.0     
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like              1338   0.0     
emb|CDX97513.1|  BnaA05g25660D                                         1338   0.0     
ref|NP_001266102.1|  beta-galactosidase 1-like precursor               1337   0.0     
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like              1336   0.0     
ref|XP_006407174.1|  hypothetical protein EUTSA_v10020056mg            1335   0.0     
gb|KEH18344.1|  beta-galactosidase                                     1335   0.0     
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like              1335   0.0     
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                   1334   0.0     
gb|KHN32687.1|  Beta-galactosidase 1                                   1332   0.0     
emb|CDY23637.1|  BnaC05g39570D                                         1331   0.0     
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like              1331   0.0     
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like              1324   0.0     
gb|KHN30042.1|  Beta-galactosidase 1                                   1321   0.0     
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like              1321   0.0     
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like              1320   0.0     
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g            1320   0.0     
ref|XP_003597608.1|  Beta-galactosidase                                1318   0.0     
ref|XP_006369293.1|  beta-galactosidase 1 family protein               1316   0.0     
gb|KHN39301.1|  Beta-galactosidase 1                                   1315   0.0     
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                     1313   0.0     
gb|KDO65277.1|  hypothetical protein CISIN_1g002867mg                  1310   0.0     
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g            1304   0.0     
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                   1298   0.0     
gb|KHF99404.1|  Beta-galactosidase 1 -like protein                     1297   0.0     
dbj|BAF31233.1|  beta-D-galactosidase                                  1284   0.0     Persea americana
ref|XP_007012844.1|  Beta-galactosidase                                1269   0.0     
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g            1264   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2     1262   0.0     
gb|KDP33829.1|  hypothetical protein JCGZ_07400                        1256   0.0     
ref|XP_011045964.1|  PREDICTED: beta-galactosidase-like isoform X1     1241   0.0     
emb|CBI27912.3|  unnamed protein product                               1241   0.0     
ref|XP_002282132.1|  PREDICTED: beta-galactosidase                     1240   0.0     Vitis vinifera
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2     1237   0.0     
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                     1236   0.0     
ref|XP_002514108.1|  beta-galactosidase, putative                      1236   0.0     Ricinus communis
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1     1232   0.0     
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...   1229   0.0     Asparagus officinalis
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                   1220   0.0     
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2          1218   0.0     
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg            1213   0.0     
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1          1212   0.0     
ref|XP_010047575.1|  PREDICTED: beta-galactosidase-like                1211   0.0     
ref|XP_006646030.1|  PREDICTED: beta-galactosidase 2-like              1210   0.0     
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...   1209   0.0     
ref|XP_009768469.1|  PREDICTED: beta-galactosidase-like                1208   0.0     
gb|ABV32546.1|  beta-galactosidase protein 1                           1206   0.0     Prunus persica
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like              1206   0.0     
gb|ABY71826.1|  beta-galactosidase                                     1204   0.0     Prunus salicina [Japanese plum]
ref|NP_001043405.1|  Os01g0580200                                      1203   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_003566806.1|  PREDICTED: beta-galactosidase 2                   1201   0.0     
ref|XP_010090040.1|  hypothetical protein L484_027271                  1200   0.0     
gb|EYU45851.1|  hypothetical protein MIMGU_mgv1a002308mg               1199   0.0     
ref|XP_008672351.1|  PREDICTED: hypothetical protein isoform X1        1197   0.0     
ref|XP_007154660.1|  hypothetical protein PHAVU_003G137000g            1194   0.0     
gb|EEE54862.1|  hypothetical protein OsJ_02342                         1194   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_003550633.1|  PREDICTED: beta-galactosidase-like                1193   0.0     
ref|XP_008775429.1|  PREDICTED: beta-galactosidase 2-like              1191   0.0     
gb|KHN06610.1|  Beta-galactosidase                                     1185   0.0     
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2     1184   0.0     
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2     1181   0.0     
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1     1179   0.0     
ref|XP_006838689.1|  hypothetical protein AMTR_s00002p00246870         1179   0.0     
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1     1178   0.0     
ref|XP_002455836.1|  hypothetical protein SORBIDRAFT_03g025990         1176   0.0     Sorghum bicolor [broomcorn]
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2     1176   0.0     
gb|EEC70952.1|  hypothetical protein OsI_02561                         1174   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like              1172   0.0     
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1     1170   0.0     
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg            1169   0.0     
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like              1160   0.0     
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like              1160   0.0     
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like              1158   0.0     
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like              1158   0.0     
dbj|BAF31234.1|  beta-D-galactosidase                                  1155   0.0     Persea americana
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like              1154   0.0     
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like              1154   0.0     
gb|KHG01120.1|  Beta-galactosidase                                     1153   0.0     
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                   1153   0.0     
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like              1150   0.0     
gb|AAQ21369.1|  beta-galactosidase                                     1150   0.0     Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2   1148   0.0     
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                   1144   0.0     
ref|XP_002306893.1|  beta-galactosidase family protein                 1142   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like              1141   0.0     
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1   1139   0.0     
emb|CDP01954.1|  unnamed protein product                               1139   0.0     
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3-like              1139   0.0     
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like              1138   0.0     
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like              1137   0.0     
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                   1137   0.0     
dbj|BAD91082.1|  beta-D-galactosidase                                  1137   0.0     Pyrus pyrifolia [sha li]
ref|XP_002310279.2|  beta-galactosidase family protein                 1136   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3-like              1136   0.0     
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                   1135   0.0     
gb|EMS53990.1|  Beta-galactosidase 2                                   1135   0.0     
ref|XP_004158882.1|  PREDICTED: beta-galactosidase 3-like              1135   0.0     
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg               1135   0.0     
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                   1134   0.0     
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                   1134   0.0     
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                    1133   0.0     
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                   1133   0.0     
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                   1132   0.0     
gb|AAW47739.1|  beta-galactosidase                                     1131   0.0     Prunus persica
gb|KHN27041.1|  Beta-galactosidase 3                                   1131   0.0     
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                   1130   0.0     
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like              1130   0.0     
ref|XP_002510455.1|  beta-galactosidase, putative                      1129   0.0     Ricinus communis
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                   1129   0.0     
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like              1129   0.0     
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like              1128   0.0     
gb|KDP33831.1|  hypothetical protein JCGZ_07402                        1128   0.0     
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg            1128   0.0     
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like              1127   0.0     
ref|XP_008230925.1|  PREDICTED: beta-galactosidase-like                1127   0.0     
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                  1127   0.0     
gb|KHN36067.1|  Beta-galactosidase 3                                   1126   0.0     
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg            1125   0.0     
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like              1124   0.0     
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg            1123   0.0     
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                   1122   0.0     
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like              1121   0.0     
dbj|BAJ34544.1|  unnamed protein product                               1121   0.0     
gb|KHN41933.1|  Beta-galactosidase 3                                   1120   0.0     
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                   1120   0.0     
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                  1120   0.0     
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg            1119   0.0     
gb|KDO65278.1|  hypothetical protein CISIN_1g002867mg                  1118   0.0     
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g            1118   0.0     
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000            1118   0.0     
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor             1118   0.0     
emb|CBI19767.3|  unnamed protein product                               1118   0.0     
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like              1117   0.0     
emb|CAN78072.1|  hypothetical protein VITISV_013292                    1117   0.0     Vitis vinifera
gb|KHN00504.1|  Beta-galactosidase 3                                   1117   0.0     
ref|XP_010113483.1|  Beta-galactosidase 3                              1117   0.0     
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like              1116   0.0     
ref|XP_009760187.1|  PREDICTED: beta-galactosidase-like isoform X4     1116   0.0     
ref|NP_568001.1|  beta-galactosidase 3                                 1115   0.0     Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ96054.1|  predicted protein                                     1115   0.0     
gb|KCW53601.1|  hypothetical protein EUGRSUZ_J02867                    1115   0.0     
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1   1115   0.0     
emb|CAB16852.1|  beta-galactosidase like protein                       1115   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDY59693.1|  BnaC07g51120D                                         1114   0.0     
gb|KDP38567.1|  hypothetical protein JCGZ_04492                        1114   0.0     
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like              1114   0.0     
ref|XP_006826783.1|  hypothetical protein AMTR_s00136p00108810         1114   0.0     
gb|ABR16628.1|  unknown                                                1113   0.0     Picea sitchensis
dbj|BAK07157.1|  predicted protein                                     1113   0.0     
ref|NP_001049068.1|  Os03g0165400                                      1113   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                   1112   0.0     Vitis vinifera
gb|KHN17668.1|  Beta-galactosidase                                     1112   0.0     
ref|NP_849506.1|  beta-galactosidase 3                                 1112   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160         1112   0.0     Sorghum bicolor [broomcorn]
ref|XP_009760186.1|  PREDICTED: beta-galactosidase-like isoform X3     1111   0.0     
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                   1111   0.0     
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...   1111   0.0     
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like              1111   0.0     
ref|XP_003612092.1|  Beta-galactosidase                                1110   0.0     
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg            1110   0.0     
ref|XP_003558743.1|  PREDICTED: beta-galactosidase 5                   1108   0.0     
gb|EMT10014.1|  Beta-galactosidase 5                                   1108   0.0     
ref|NP_001234317.1|  TBG6 protein precursor                            1107   0.0     
gb|ADO34791.1|  beta-galactosidase STBG6                               1107   0.0     
ref|XP_011100972.1|  PREDICTED: beta-galactosidase 3-like              1107   0.0     
gb|AAM22973.1|AF499737_1  beta-galactosidase                           1107   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008450853.1|  PREDICTED: beta-galactosidase-like                1107   0.0     
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                   1106   0.0     
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                   1105   0.0     
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like              1105   0.0     
gb|EEE58382.1|  hypothetical protein OsJ_09539                         1104   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004158444.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...   1103   0.0     
gb|EEC74580.1|  hypothetical protein OsI_10152                         1103   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                   1102   0.0     
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 3-like              1098   0.0     
ref|XP_008643999.1|  PREDICTED: uncharacterized protein LOC100382...   1097   0.0     
gb|AGR44466.1|  beta-D-galactosidase 7                                 1097   0.0     
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                   1095   0.0     
dbj|BAD91084.1|  beta-D-galactosidase                                  1095   0.0     Pyrus pyrifolia [sha li]
ref|XP_004135712.1|  PREDICTED: beta-galactosidase-like                1094   0.0     
ref|XP_008450854.1|  PREDICTED: beta-galactosidase-like                1094   0.0     
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg               1093   0.0     
ref|XP_004158465.1|  PREDICTED: beta-galactosidase-like                1093   0.0     
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like              1093   0.0     
dbj|BAD91085.1|  beta-D-galactosidase                                  1093   0.0     Pyrus pyrifolia [sha li]
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg            1092   0.0     
ref|XP_004292017.1|  PREDICTED: beta-galactosidase 3-like              1092   0.0     
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like              1092   0.0     
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like              1090   0.0     
gb|AHL69742.1|  beta-galactosidase                                     1089   0.0     
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like              1089   0.0     
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like              1088   0.0     
ref|XP_002514109.1|  beta-galactosidase, putative                      1088   0.0     Ricinus communis
gb|ADV41669.1|  beta-D-galactosidase                                   1088   0.0     
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                   1087   0.0     
emb|CDP07463.1|  unnamed protein product                               1087   0.0     
gb|KDO71053.1|  hypothetical protein CISIN_1g003044mg                  1086   0.0     
dbj|BAB83260.1|  beta-D-galactosidase                                  1085   0.0     Persea americana
emb|CAA18137.1|  beta-galactosidase like protein                       1083   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006451461.1|  hypothetical protein CICLE_v10007531mg            1080   0.0     
gb|KDO57763.1|  hypothetical protein CISIN_1g004219mg                  1079   0.0     
ref|XP_006283100.1|  hypothetical protein CARUB_v10004117mg            1078   0.0     
ref|XP_009408846.1|  PREDICTED: beta-galactosidase-like                1077   0.0     
gb|ACC78255.1|  beta-galactosidase                                     1077   0.0     Carica papaya [mamon]
gb|EMT02336.1|  Beta-galactosidase 2                                   1076   0.0     
gb|AAC77377.1|  beta-galactosidase precursor                           1076   0.0     Carica papaya [mamon]
gb|KDP32675.1|  hypothetical protein JCGZ_13673                        1075   0.0     
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                   1074   0.0     
emb|CDX75569.1|  BnaA01g01330D                                         1074   0.0     
gb|KDO84690.1|  hypothetical protein CISIN_1g003076mg                  1073   0.0     
tpg|DAA43551.1|  TPA: beta-galactosidase                               1073   0.0     
gb|KDO84689.1|  hypothetical protein CISIN_1g003076mg                  1071   0.0     
ref|NP_001275845.1|  beta-galactosidase                                1070   0.0     
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                   1068   0.0     
gb|KDO57762.1|  hypothetical protein CISIN_1g004219mg                  1066   0.0     
ref|XP_006451460.1|  hypothetical protein CICLE_v10007531mg            1066   0.0     
ref|XP_010110010.1|  Beta-galactosidase 3                              1065   0.0     
emb|CDX69219.1|  BnaC01g02340D                                         1065   0.0     
ref|XP_010536861.1|  PREDICTED: beta-galactosidase 12                  1064   0.0     
gb|AHG94613.1|  beta-galactosidase                                     1064   0.0     
ref|XP_009402923.1|  PREDICTED: beta-galactosidase-like                1063   0.0     
ref|XP_009762312.1|  PREDICTED: beta-galactosidase-like                1062   0.0     
gb|ABF94150.1|  Beta-galactosidase precursor, putative, expressed      1062   0.0     
ref|XP_010049746.1|  PREDICTED: beta-galactosidase-like                1056   0.0     
gb|AAC25984.1|  beta-galactosidase                                     1056   0.0     
ref|XP_009409595.1|  PREDICTED: beta-galactosidase-like                1055   0.0     
ref|XP_009599425.1|  PREDICTED: beta-galactosidase-like                1054   0.0     
ref|XP_010107841.1|  Beta-galactosidase 3                              1053   0.0     
ref|NP_001168664.1|  uncharacterized protein LOC100382452              1053   0.0     
ref|XP_009388558.1|  PREDICTED: beta-galactosidase-like                1052   0.0     
ref|XP_006353531.1|  PREDICTED: beta-galactosidase-like                1052   0.0     
gb|EMS60063.1|  Beta-galactosidase 5                                   1051   0.0     
pdb|3W5F|A  Chain A, Crystal Structure Of Tomato Beta-galactosida...   1051   0.0     
ref|NP_001234842.1|  ss-galactosidase precursor                        1051   0.0     
ref|XP_009372992.1|  PREDICTED: beta-galactosidase 3-like              1050   0.0     
gb|ADO34789.1|  beta-galactosidase STBG4                               1048   0.0     
ref|XP_011077976.1|  PREDICTED: beta-galactosidase-like                1047   0.0     
ref|XP_009409594.1|  PREDICTED: beta-galactosidase-like                1046   0.0     
dbj|BAE72073.1|  pear beta-galactosidase1                              1044   0.0     
ref|XP_007138730.1|  hypothetical protein PHAVU_009G232500g            1043   0.0     
ref|XP_009409593.1|  PREDICTED: beta-galactosidase-like                1043   0.0     
emb|CAH18936.1|  beta-galactosidase                                    1043   0.0     
ref|XP_009352652.1|  PREDICTED: beta-galactosidase                     1043   0.0     
dbj|BAB21492.1|  beta-D-galactosidase                                  1042   0.0     
dbj|BAC10578.2|  beta-galactosidase                                    1042   0.0     
gb|AAK40304.1|  beta-galactosidase                                     1042   0.0     
ref|NP_001265889.1|  beta-galactosidase-like precursor                 1041   0.0     
ref|XP_011093727.1|  PREDICTED: beta-galactosidase-like                1040   0.0     
gb|AAF67341.1|  beta galactosidase                                     1040   0.0     
ref|XP_004150073.1|  PREDICTED: beta-galactosidase 3-like              1040   0.0     
sp|P48981.1|BGAL_MALDO  RecName: Full=Beta-galactosidase; AltName...   1039   0.0     
gb|AFD54987.1|  beta-galactosidase                                     1038   0.0     
ref|NP_001280755.1|  beta-galactosidase precursor                      1036   0.0     
ref|XP_008460995.1|  PREDICTED: beta-galactosidase 5-like              1034   0.0     
ref|XP_006413222.1|  hypothetical protein EUTSA_v10024511mg            1033   0.0     
ref|XP_003595162.1|  Beta-galactosidase                                1033   0.0     
ref|NP_001266133.1|  beta-galactosidase-like                           1032   0.0     
gb|KCW53602.1|  hypothetical protein EUGRSUZ_J02867                    1031   0.0     
ref|NP_849553.1|  beta-galactosidase 12                                1031   0.0     
gb|AES59331.2|  beta-like galactosidase                                1030   0.0     
ref|XP_006285652.1|  hypothetical protein CARUB_v10007108mg            1030   0.0     
ref|XP_002867577.1|  beta-galactosidase 12                             1029   0.0     
ref|XP_010049745.1|  PREDICTED: beta-galactosidase-like                1028   0.0     
gb|ACF22882.1|  beta-galactosidase                                     1028   0.0     
emb|CAB39679.1|  putative beta-galactosidase                           1027   0.0     
ref|XP_003546457.1|  PREDICTED: beta-galactosidase-like isoform X1     1027   0.0     
gb|KHN24609.1|  Beta-galactosidase                                     1026   0.0     
ref|XP_010545348.1|  PREDICTED: beta-galactosidase 12-like isofor...   1026   0.0     
gb|KDO57764.1|  hypothetical protein CISIN_1g004219mg                  1025   0.0     
ref|NP_001289260.1|  beta-galactosidase precursor                      1025   0.0     
gb|KDO57770.1|  hypothetical protein CISIN_1g004219mg                  1025   0.0     
ref|XP_006451459.1|  hypothetical protein CICLE_v10007531mg            1025   0.0     
ref|XP_010438797.1|  PREDICTED: beta-galactosidase 12 isoform X2       1023   0.0     
emb|CDX94367.1|  BnaC01g18170D                                         1023   0.0     
ref|XP_010448320.1|  PREDICTED: beta-galactosidase 12-like isofor...   1020   0.0     
ref|XP_010438795.1|  PREDICTED: beta-galactosidase 12 isoform X1       1019   0.0     
dbj|BAE72074.1|  pear beta-galactosidase2                              1019   0.0     
ref|XP_010433545.1|  PREDICTED: beta-galactosidase 12-like isofor...   1018   0.0     
ref|XP_010448319.1|  PREDICTED: beta-galactosidase 12-like isofor...   1017   0.0     
ref|XP_009139949.1|  PREDICTED: beta-galactosidase 12 isoform X2       1016   0.0     
gb|KHG11296.1|  Beta-galactosidase                                     1015   0.0     
ref|XP_010433544.1|  PREDICTED: beta-galactosidase 12-like isofor...   1014   0.0     
emb|CAC44502.1|  beta-galactosidase                                    1014   0.0     
ref|XP_004287559.1|  PREDICTED: beta-galactosidase-like                1012   0.0     
ref|XP_004144120.1|  PREDICTED: beta-galactosidase-like                1012   0.0     
ref|XP_009139943.1|  PREDICTED: beta-galactosidase 12 isoform X1       1012   0.0     
ref|XP_008450855.1|  PREDICTED: beta-galactosidase-like                1009   0.0     
emb|CDX95380.1|  BnaC04g27780D                                         1007   0.0     
gb|EYU28411.1|  hypothetical protein MIMGU_mgv1a024117mg               1006   0.0     
ref|XP_009148743.1|  PREDICTED: beta-galactosidase 2 isoform X1        1005   0.0     
emb|CAA09467.1|  exo galactanase                                       1005   0.0     
ref|XP_010049744.1|  PREDICTED: beta-galactosidase-like                1004   0.0     
ref|XP_010051543.1|  PREDICTED: beta-galactosidase                     1001   0.0     
ref|NP_190852.2|  beta-galactosidase 2                                 1001   0.0     
ref|XP_004287560.1|  PREDICTED: beta-galactosidase-like                1001   0.0     
ref|XP_002876169.1|  AT3g52840/F8J2_10                                 1000   0.0     
gb|KCW82245.1|  hypothetical protein EUGRSUZ_C03662                    1000   0.0     
ref|XP_002437187.1|  hypothetical protein SORBIDRAFT_10g022620          999   0.0     
ref|XP_004170887.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    999   0.0     
ref|XP_004951447.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    998   0.0     
emb|CAB86888.1|  beta-galactosidase precursor-like protein              998   0.0     
gb|EPS62826.1|  beta-galactosidase                                      997   0.0     
ref|XP_004135819.1|  PREDICTED: beta-galactosidase-like                 997   0.0     
ref|XP_006403764.1|  hypothetical protein EUTSA_v10010152mg             997   0.0     
ref|XP_010515757.1|  PREDICTED: beta-galactosidase 2 isoform X1         996   0.0     
ref|XP_011092826.1|  PREDICTED: beta-galactosidase 3                    995   0.0     
gb|AEG76892.1|  putative beta-galactosidase                             995   0.0     
ref|XP_006342225.1|  PREDICTED: beta-galactosidase 3-like               994   0.0     
gb|KDO65276.1|  hypothetical protein CISIN_1g002867mg                   994   0.0     
ref|NP_001265904.1|  beta-galactosidase 5-like precursor                994   0.0     
ref|XP_009603021.1|  PREDICTED: beta-galactosidase 5                    993   0.0     
gb|KFK36177.1|  hypothetical protein AALP_AA4G088200                    993   0.0     
dbj|BAH20412.1|  AT3G13750                                              993   0.0     
ref|XP_002891311.1|  hypothetical protein ARALYDRAFT_473836             993   0.0     
ref|XP_010552493.1|  PREDICTED: beta-galactosidase 5                    992   0.0     
ref|XP_009761050.1|  PREDICTED: beta-galactosidase 5                    992   0.0     
ref|XP_010426910.1|  PREDICTED: beta-galactosidase 2-like               992   0.0     
gb|KFK34528.1|  hypothetical protein AALP_AA5G157800                    992   0.0     
gb|KCW82506.1|  hypothetical protein EUGRSUZ_C03898                     991   0.0     
emb|CAB64741.1|  putative beta-galactosidase                            991   0.0     
ref|XP_006393673.1|  hypothetical protein EUTSA_v10011265mg             990   0.0     
ref|XP_010483173.1|  PREDICTED: beta-galactosidase 4                    990   0.0     
ref|XP_010451557.1|  PREDICTED: beta-galactosidase 4-like               990   0.0     
ref|NP_200498.1|  beta-galactosidase 4                                  990   0.0     
ref|XP_006306871.1|  hypothetical protein CARUB_v10008424mg             990   0.0     
gb|AAK96780.1|  beta-galactosidase                                      990   0.0     
ref|NP_175127.1|  beta-galactosidase 5                                  989   0.0     
ref|XP_010504030.1|  PREDICTED: beta-galactosidase 2-like               989   0.0     
ref|XP_010315322.1|  PREDICTED: beta-galactosidase 3-like               989   0.0     
gb|KHN20946.1|  Beta-galactosidase 5                                    988   0.0     
emb|CDY47949.1|  BnaA10g28210D                                          988   0.0     
gb|AAL24206.1|  At1g45130/F27F5_20                                      988   0.0     
ref|XP_010234045.1|  PREDICTED: beta-galactosidase 4                    988   0.0     
gb|KHN12675.1|  Beta-galactosidase 5                                    988   0.0     
ref|XP_009137581.1|  PREDICTED: beta-galactosidase 12-like              987   0.0     
ref|NP_001130532.1|  beta-galactosidase isoform 1 precursor             987   0.0     
ref|XP_006362025.1|  PREDICTED: beta-galactosidase 3-like               987   0.0     
ref|XP_010443345.1|  PREDICTED: beta-galactosidase 4-like               986   0.0     
emb|CDY53959.1|  BnaCnng25850D                                          986   0.0     
ref|XP_009129554.1|  PREDICTED: beta-galactosidase 5                    986   0.0     
ref|XP_011037170.1|  PREDICTED: beta-galactosidase 5-like               985   0.0     
ref|XP_002305449.1|  beta-galactosidase family protein                  984   0.0     
ref|XP_004238611.1|  PREDICTED: beta-galactosidase 5                    984   0.0     
ref|XP_008679838.1|  PREDICTED: beta-galactosidase 4                    984   0.0     
ref|XP_002864484.1|  predicted protein                                  984   0.0     
ref|XP_009777047.1|  PREDICTED: beta-galactosidase 3-like               984   0.0     
ref|XP_010667155.1|  PREDICTED: putative beta-galactosidase             983   0.0     
gb|AAB61470.1|  beta-D-galactosidase                                    983   0.0     
ref|XP_002453540.1|  hypothetical protein SORBIDRAFT_04g007660          983   0.0     
ref|XP_003563718.1|  PREDICTED: beta-galactosidase 9                    982   0.0     
ref|XP_009132166.1|  PREDICTED: beta-galactosidase 4                    982   0.0     
ref|XP_006648459.1|  PREDICTED: beta-galactosidase 4-like               982   0.0     
emb|CDY11899.1|  BnaC03g13250D                                          981   0.0     
ref|XP_003589080.1|  Beta-galactosidase                                 981   0.0     
gb|AAF67342.1|  beta galactosidase                                      980   0.0     
ref|XP_004291830.1|  PREDICTED: beta-galactosidase 5-like               979   0.0     
gb|ABK24373.1|  unknown                                                 979   0.0     
ref|XP_010090042.1|  Beta-galactosidase 1                               979   0.0     
ref|XP_006656180.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    979   0.0     
ref|XP_009614464.1|  PREDICTED: beta-galactosidase 3-like               978   0.0     
gb|AES65414.2|  beta-like galactosidase                                 978   0.0     
ref|XP_007160714.1|  hypothetical protein PHAVU_001G010900g             978   0.0     
ref|XP_007042083.1|  Beta-galactosidase 3 isoform 1                     978   0.0     
ref|XP_006280080.1|  hypothetical protein CARUB_v10025963mg             977   0.0     
ref|XP_007017651.1|  Beta-galactosidase 5 isoform 1                     977   0.0     
gb|KEH39519.1|  beta-galactosidase                                      976   0.0     
sp|Q6Z6K4.1|BGAL4_ORYSJ  RecName: Full=Beta-galactosidase 4; Shor...    975   0.0     
gb|KHG23756.1|  Beta-galactosidase 5 -like protein                      975   0.0     
dbj|BAK05933.1|  predicted protein                                      975   0.0     
ref|XP_010061261.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    973   0.0     
gb|EAZ01416.1|  hypothetical protein OsI_23450                          973   0.0     
ref|XP_002512959.1|  beta-galactosidase, putative                       972   0.0     
sp|A2X2H7.1|BGAL4_ORYSI  RecName: Full=Beta-galactosidase 4; Shor...    972   0.0     
ref|XP_003589339.1|  Beta-galactosidase                                 972   0.0     
gb|KHG11061.1|  Beta-galactosidase 5 -like protein                      971   0.0     
ref|NP_001057920.1|  Os06g0573600                                       970   0.0     
gb|ACG30563.1|  beta-galactosidase precursor                            969   0.0     
gb|EYU31167.1|  hypothetical protein MIMGU_mgv1a001956mg                969   0.0     
gb|EAZ22260.1|  hypothetical protein OsJ_05915                          967   0.0     
emb|CDO97013.1|  unnamed protein product                                965   0.0     
ref|XP_011077977.1|  PREDICTED: beta-galactosidase-like                 964   0.0     
gb|EMT13456.1|  Beta-galactosidase 9                                    962   0.0     
gb|EYU42595.1|  hypothetical protein MIMGU_mgv1a001990mg                962   0.0     
emb|CDY32919.1|  BnaC02g12030D                                          961   0.0     
gb|KFK27244.1|  hypothetical protein AALP_AA8G356800                    960   0.0     
ref|XP_003523710.1|  PREDICTED: beta-galactosidase 3-like isoform 1     960   0.0     
gb|KEH36209.1|  beta-galactosidase-like protein                         959   0.0     
ref|XP_007136038.1|  hypothetical protein PHAVU_009G012700g             958   0.0     
sp|Q00662.1|BGAL_DIACA  RecName: Full=Putative beta-galactosidase...    956   0.0     
ref|XP_009126921.1|  PREDICTED: beta-galactosidase 4-like               956   0.0     
emb|CDX92753.1|  BnaC07g40110D                                          956   0.0     
gb|KCW68186.1|  hypothetical protein EUGRSUZ_F01855                     956   0.0     
ref|XP_007046795.1|  Beta-galactosidase 3 isoform 2                     956   0.0     
emb|CDY20708.1|  BnaA02g08480D                                          954   0.0     
ref|XP_010066193.1|  PREDICTED: beta-galactosidase 5-like isoform X2    954   0.0     
ref|XP_010479073.1|  PREDICTED: beta-galactosidase 5                    954   0.0     
ref|XP_004500969.1|  PREDICTED: beta-galactosidase 5-like isoform X1    952   0.0     
ref|XP_004966041.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    952   0.0     
ref|XP_009107461.1|  PREDICTED: beta-galactosidase 5-like isoform X1    951   0.0     
ref|XP_004985589.1|  PREDICTED: beta-galactosidase 5-like isoform X2    951   0.0     
gb|EPS64494.1|  beta-galactosidase                                      950   0.0     
ref|XP_010066191.1|  PREDICTED: beta-galactosidase 5-like isoform X1    950   0.0     
emb|CDY36028.1|  BnaA08g04330D                                          949   0.0     
gb|KDO84691.1|  hypothetical protein CISIN_1g003076mg                   948   0.0     
ref|XP_007204246.1|  hypothetical protein PRUPE_ppa002271mg             947   0.0     
gb|KHN45883.1|  Beta-galactosidase 5                                    944   0.0     
emb|CDY42755.1|  BnaA03g47840D                                          944   0.0     
ref|XP_002285084.2|  PREDICTED: beta-galactosidase 8                    942   0.0     
ref|XP_006401275.1|  hypothetical protein EUTSA_v10012847mg             941   0.0     
ref|XP_010253630.1|  PREDICTED: beta-galactosidase 8                    939   0.0     
ref|XP_007017652.1|  Beta-galactosidase 5 isoform 2                     939   0.0     
gb|KDO73220.1|  hypothetical protein CISIN_1g003095mg                   937   0.0     
ref|XP_009398591.1|  PREDICTED: beta-galactosidase 6-like               937   0.0     
gb|KDO57766.1|  hypothetical protein CISIN_1g004219mg                   936   0.0     
ref|XP_006424599.1|  hypothetical protein CICLE_v10027805mg             936   0.0     
ref|XP_007015421.1|  Beta-galactosidase 8 isoform 1                     936   0.0     
gb|EPS69033.1|  beta-galactosidase                                      934   0.0     
gb|KDP41747.1|  hypothetical protein JCGZ_26765                         932   0.0     
ref|XP_006854486.1|  hypothetical protein AMTR_s00175p00032740          930   0.0     
gb|KDO57765.1|  hypothetical protein CISIN_1g004219mg                   929   0.0     
gb|KGN66238.1|  hypothetical protein Csa_1G587980                       929   0.0     
ref|XP_010910537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    928   0.0     
ref|XP_004135714.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    926   0.0     
gb|EYU18852.1|  hypothetical protein MIMGU_mgv1a001263mg                925   0.0     
ref|XP_011089891.1|  PREDICTED: beta-galactosidase 8-like isoform X1    925   0.0     
gb|KDO73221.1|  hypothetical protein CISIN_1g003095mg                   924   0.0     
ref|XP_006423393.1|  hypothetical protein CICLE_v10030257mg             923   0.0     
dbj|BAF02242.1|  putative galactosidase                                 923   0.0     
emb|CAB64744.1|  putative beta-galactosidase                            921   0.0     
ref|NP_850121.1|  beta-galactosidase 8                                  921   0.0     
ref|NP_001189624.1|  beta-galactosidase 8                               920   0.0     
gb|AAD21482.1|  putative beta-galactosidase                             919   0.0     
ref|XP_011089316.1|  PREDICTED: beta-galactosidase 8-like               919   0.0     
emb|CDY15749.1|  BnaC04g15750D                                          919   0.0     
gb|KEH40195.1|  beta-like galactosidase                                 919   0.0     
ref|XP_009766589.1|  PREDICTED: beta-galactosidase 8                    918   0.0     
ref|XP_002530296.1|  beta-galactosidase, putative                       918   0.0     
ref|XP_009103690.1|  PREDICTED: beta-galactosidase 8                    917   0.0     
ref|XP_009595284.1|  PREDICTED: beta-galactosidase 8                    917   0.0     
gb|KDP44070.1|  hypothetical protein JCGZ_05537                         917   0.0     
ref|XP_008791517.1|  PREDICTED: beta-galactosidase 6 isoform X1         916   0.0     
dbj|BAD20774.2|  beta-galactosidase                                     915   0.0     



>ref|XP_011080179.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =  1474 bits (3815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 712/843 (84%), Positives = 791/843 (94%), Gaps = 2/843 (0%)
 Frame = -2

Query  3004  MGWKHEMWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPE  2825
             MGWK  M +  +V+++VLL +SWVS G ASVSYD  +  +NGQR+IL+SGSIHYPRSTPE
Sbjct  2     MGWKIAMCNAFLVVMLVLL-SSWVSWGEASVSYDHKAISVNGQRRILISGSIHYPRSTPE  60

Query  2824  MWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVG  2645
             MWPDL++KAKEGGLDV+QTYVFWNGHEP+PGKYYFEGRYDLVKFIKL  QAGLYV+LR+G
Sbjct  61    MWPDLIQKAKEGGLDVIQTYVFWNGHEPEPGKYYFEGRYDLVKFIKLVHQAGLYVNLRIG  120

Query  2644  PYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPII  2465
             PYACAEWNFGGFPVWLKYVPG+SFRT+NGPFKAAMQKFTT IVNMMK++RLYE+QGGPII
Sbjct  121   PYACAEWNFGGFPVWLKYVPGISFRTNNGPFKAAMQKFTTKIVNMMKAERLYETQGGPII  180

Query  2464  LSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYC  2285
             LSQIENEYGPMEYELGAPG++Y++WAAKMAV LGTGVPW+MCKQDDAPDP++N CNGFYC
Sbjct  181   LSQIENEYGPMEYELGAPGRAYSEWAAKMAVDLGTGVPWIMCKQDDAPDPIINTCNGFYC  240

Query  2284  DWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGG  2105
             D+FSPNKAYKPKMWTEAWT WFT+FGGPVPYRPAEDLA++VA+FI KGGSFINYYM+HGG
Sbjct  241   DYFSPNKAYKPKMWTEAWTGWFTQFGGPVPYRPAEDLAFSVARFIQKGGSFINYYMYHGG  300

Query  2104  TNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISL  1925
             TNFGRTAGGPFIATSYDYDAP+DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V+SL
Sbjct  301   TNFGRTAGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVMSL  360

Query  1924  GNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR  1745
             GNYQEA VFKS+SG+CAAFLAN NQHSFAKV+F NMHYNLPPWSISILPDCKNTVYNTAR
Sbjct  361   GNYQEAHVFKSRSGSCAAFLANYNQHSFAKVSFWNMHYNLPPWSISILPDCKNTVYNTAR  420

Query  1744  VGAQSSRMKMTPVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVR  1565
             +GAQS++MKMTPVS+GF+WQSYNEE  SY+DN+FT  GL EQINTTRD +DYLWY TDV+
Sbjct  421   IGAQSAQMKMTPVSKGFAWQSYNEELMSYEDNSFTMVGLREQINTTRDNTDYLWYTTDVK  480

Query  1564  IDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNK  1385
             IDPRE FL+GGKWP LTV+SAGHALHVFINGQL GT+YGSLE+PKVTFSK+V LRAGVNK
Sbjct  481   IDPREGFLRGGKWPVLTVFSAGHALHVFINGQLSGTAYGSLESPKVTFSKSVNLRAGVNK  540

Query  1384  ISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhs  1205
             ISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKW+YK+GLKGE LSLHS
Sbjct  541   ISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWTYKVGLKGESLSLHS  600

Query  1204  lsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYW  1025
             LSGSSSVEWVEGS+IAQ+QPLTWYKTTF+AP+GNEPLALDM+TM KGQ+WINGQS+GRYW
Sbjct  601   LSGSSSVEWVEGSYIAQRQPLTWYKTTFNAPSGNEPLALDMDTMSKGQVWINGQSIGRYW  660

Query  1024  PGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNP  845
               YKASG  CGACNYAGWF+EKKCLS CG+ASQRWYHVPRSWLRPTGNLLV  EEWGGNP
Sbjct  661   NEYKASGN-CGACNYAGWFNEKKCLSNCGKASQRWYHVPRSWLRPTGNLLVVLEEWGGNP  719

Query  844   YGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFAS  665
             YG+SLVKREVASVCADIYEWQP L+NW++QASGK  +PLRPKAHLSC AGQKI+SIKFAS
Sbjct  720   YGISLVKREVASVCADIYEWQPTLVNWQLQASGKVNKPLRPKAHLSCAAGQKISSIKFAS  779

Query  664   FGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEV  485
             FGTP+GSCG+F EG+CHAFHSYD+F++YCIG  SCTVPVTPE FGGDPCPSVMKKLSVE 
Sbjct  780   FGTPQGSCGNFQEGSCHAFHSYDVFERYCIGQQSCTVPVTPEIFGGDPCPSVMKKLSVEA  839

Query  484   VCS  476
             +CS
Sbjct  840   ICS  842



>gb|AGW47883.1| beta-galactosidase precursor [Nicotiana tabacum]
Length=841

 Score =  1463 bits (3787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 702/823 (85%), Positives = 769/823 (93%), Gaps = 1/823 (0%)
 Frame = -2

Query  2944  TSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             +SWVS G ASVSYD  + I+NGQRKIL+SGSIHYPRS PEMWPDL++KAKEGG+DV+QTY
Sbjct  20    SSWVSCGIASVSYDHKAIIVNGQRKILISGSIHYPRSIPEMWPDLIQKAKEGGVDVIQTY  79

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWNGHE + GKYYFEGRYDLVKFIK+ Q+AGLYVHLR+GPYACAEWNFGGFPVWLKYVP
Sbjct  80    VFWNGHESEEGKYYFEGRYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVP  139

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G+SFRTDN PFKAAMQKFTT IV+MMKS+RLY+SQGGPIILSQIENEYGPME+ELG PGK
Sbjct  140   GISFRTDNEPFKAAMQKFTTKIVDMMKSERLYQSQGGPIILSQIENEYGPMEWELGEPGK  199

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y++WAAKMAV LGTGVPW+MCKQDD PDP++N CNGFYCD+F PNKA KPKMWTEAWTA
Sbjct  200   AYSEWAAKMAVDLGTGVPWIMCKQDDVPDPIINTCNGFYCDYFLPNKANKPKMWTEAWTA  259

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             WFTEFGGPVPYRPAED+A+AVA+FI  GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDA
Sbjct  260   WFTEFGGPVPYRPAEDMAFAVARFIQTGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDA  319

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DEFGLLR+PKWGHLKDLHRAIKLCEPALVS DP V  LGNYQEARVFKS+SGACAAFL
Sbjct  320   PLDEFGLLRQPKWGHLKDLHRAIKLCEPALVSADPIVTPLGNYQEARVFKSESGACAAFL  379

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN NQHSFAKVAFGNMHYNLPPWSISILPDCKNTV+NTAR+GAQS++MKMT VSRGFSW 
Sbjct  380   ANYNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTSVSRGFSWD  439

Query  1684  SYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             S+NEET+SY+D++FT  GLLEQINTTRD SDYLWY TDV+ID RE FL+ GKWPWLT+ S
Sbjct  440   SFNEETASYEDSSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREGFLRSGKWPWLTIMS  499

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AGHALHVF+NGQL GT+YGSLE PK+TFSKAV LRAGVNKISLLSIAVGLPN+GPHFETW
Sbjct  500   AGHALHVFVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETW  559

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQP  1145
             NAGVLGPVSLSGLNEGKRDLTWQKWSYK+GLKGE LSLHSLSGSSSVEWVEGSF+AQ+QP
Sbjct  560   NAGVLGPVSLSGLNEGKRDLTWQKWSYKVGLKGEALSLHSLSGSSSVEWVEGSFVAQRQP  619

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTWYKTTF+APAGN+PLALD+NTMGKGQ+WINGQS+GRYWPGYKASG  CGACNYAGWFD
Sbjct  620   LTWYKTTFNAPAGNDPLALDLNTMGKGQVWINGQSIGRYWPGYKASGN-CGACNYAGWFD  678

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
             EKKCLS CGEASQRWYHVPRSWL PTGNLLV FEEWGG P+G+SLVKREVASVCADI EW
Sbjct  679   EKKCLSNCGEASQRWYHVPRSWLYPTGNLLVLFEEWGGEPHGISLVKREVASVCADINEW  738

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
             QPQL+NW+MQASGK  RPLRPKAHLSC +GQKI+SIKFASFGTP+G CGSF EG+CHAFH
Sbjct  739   QPQLVNWQMQASGKVDRPLRPKAHLSCASGQKISSIKFASFGTPQGVCGSFREGSCHAFH  798

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SYD F++YCIG NSC+VPVTPE FGGDPCP VMKKLSVEVVCS
Sbjct  799   SYDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVVCS  841



>ref|XP_009622143.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=840

 Score =  1461 bits (3781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/822 (85%), Positives = 766/822 (93%), Gaps = 1/822 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV  GTASVSYD  + I+ GQR+IL+SGS+HYPRSTPEMWP +++KAKEGG+DV+QTYV
Sbjct  20    SWVFCGTASVSYDHKAIIVKGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGIDVIQTYV  79

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEPQ GKYYFEGRYDLVKFIKL  QAGLYVHLR+GPYACAEWNFGGFPVWLKYVPG
Sbjct  80    FWNGHEPQQGKYYFEGRYDLVKFIKLVHQAGLYVHLRIGPYACAEWNFGGFPVWLKYVPG  139

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDNGPFK AMQKFTT IVNMMK++RLYE+QGGPII+SQIENEYGPME+ELGAPGK+
Sbjct  140   ISFRTDNGPFKVAMQKFTTKIVNMMKAERLYETQGGPIIMSQIENEYGPMEWELGAPGKA  199

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y QWAAKMAVGL TGVPW+MCKQDDAPDP++NACNGFYCD+FSPNKAYKPK+WTEAWTAW
Sbjct  200   YTQWAAKMAVGLNTGVPWIMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKIWTEAWTAW  259

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FT FG PVPYRPAEDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  260   FTGFGDPVPYRPAEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  319

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V  LG+ QEA VF+SKSG CAAFLA
Sbjct  320   LDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTPLGHQQEAHVFRSKSGGCAAFLA  379

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N NQHSFA VAF N HYNLPPWSISILPDCKNTV+NTAR+GAQS++MKMTPVSRGFSW S
Sbjct  380   NYNQHSFATVAFANRHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTPVSRGFSWHS  439

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             +NEET+SY+D++FT  GLLEQINTTRD SDYLWY TDV+ID RE FL+ GKWPWLT+ SA
Sbjct  440   FNEETASYEDSSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREGFLRSGKWPWLTIMSA  499

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHALHVF+NGQL GT+YGSLE PK+TFSKAV LRAGVNKISLLSIAVGLPN+GPHFETWN
Sbjct  500   GHALHVFVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWN  559

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPVSLSGLNEGKRDLTWQKWSYK+GLKGE LSLHSLSGSSSVEWVEGSF+AQ+QPL
Sbjct  560   AGVLGPVSLSGLNEGKRDLTWQKWSYKVGLKGEALSLHSLSGSSSVEWVEGSFVAQRQPL  619

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYKTTF+APAGN+PLALD+NTMGKGQ+WINGQS+GRYWPGYKASG  CGACNYAGWFDE
Sbjct  620   TWYKTTFNAPAGNDPLALDLNTMGKGQVWINGQSIGRYWPGYKASGN-CGACNYAGWFDE  678

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
             KKCLS CGEASQRWYHVPRSWL PTGNLLV FEEWGG P+G+SLVKREVASVCADI EWQ
Sbjct  679   KKCLSNCGEASQRWYHVPRSWLYPTGNLLVLFEEWGGEPHGISLVKREVASVCADINEWQ  738

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             PQL+NW+MQASGK  RPLRPKAHLSC +GQKI+SIKFASFGTP+G CGSF EG+CHAFHS
Sbjct  739   PQLVNWQMQASGKVDRPLRPKAHLSCASGQKISSIKFASFGTPQGVCGSFREGSCHAFHS  798

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F++YCIG NSC+VPVTPE FGGDPCP VMKKLSVEVVCS
Sbjct  799   YDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVVCS  840



>ref|XP_009769408.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=840

 Score =  1457 bits (3773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/822 (85%), Positives = 765/822 (93%), Gaps = 1/822 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV  G ASVSYD  + I+ GQR+IL+SGS+HYPRSTPEMWP +++KAKEGG+DV+QTYV
Sbjct  20    SWVFCGKASVSYDHKAIIVKGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGIDVIQTYV  79

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEPQ GKYYFEGRYDLVKFIKL  QAGLYVHLR+GPYACAEWNFGGFPVWLKYVPG
Sbjct  80    FWNGHEPQQGKYYFEGRYDLVKFIKLVHQAGLYVHLRIGPYACAEWNFGGFPVWLKYVPG  139

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDNGPFKAAMQ+FTT IVNMMK++RLYE+QGGPII+SQIENEYGPME+ELGAPGK+
Sbjct  140   ISFRTDNGPFKAAMQRFTTKIVNMMKAERLYETQGGPIIMSQIENEYGPMEWELGAPGKA  199

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             YAQWAAKMAVGL TGVPW+MCKQDDAPDP++NACNGFYCD+FSPNKAYKPK+WTEAWTAW
Sbjct  200   YAQWAAKMAVGLDTGVPWIMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKIWTEAWTAW  259

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FT FG PVPYRPAEDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  260   FTGFGNPVPYRPAEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  319

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V  LG+ QEA VF+SKSG CAAFLA
Sbjct  320   LDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTPLGHQQEAHVFRSKSGTCAAFLA  379

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N NQHSFA V F N HYNLPPWSISILPDCKNTV+NTAR+GAQS++MKMT VSRGFSW S
Sbjct  380   NYNQHSFATVTFANRHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTSVSRGFSWDS  439

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             +NEET+SY+D++FT  GLLEQINTTRD SDYLWY TDV+ID RE FL+ GKWPWLT+ SA
Sbjct  440   FNEETASYEDSSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREGFLRSGKWPWLTIMSA  499

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHALHVF+NGQL GT+YGSLE PK+TFSKAV LRAGVNKISLLSIAVGLPN+GPHFETWN
Sbjct  500   GHALHVFVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWN  559

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPVSLSGLNEGKRDLTWQKWSYK+GLKGE LSLHSLSGSSSVEWVEGSF+AQ+QPL
Sbjct  560   AGVLGPVSLSGLNEGKRDLTWQKWSYKVGLKGEALSLHSLSGSSSVEWVEGSFVAQRQPL  619

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYKTTF+APAGNEPLALD+NTMGKGQ+WINGQS+GRYWPGYKASG  CGACNYAGWFDE
Sbjct  620   TWYKTTFNAPAGNEPLALDLNTMGKGQVWINGQSIGRYWPGYKASGN-CGACNYAGWFDE  678

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
             KKCLS CGEASQRWYHVPRSWL PTGNLLV FEEWGG P+G+SLVKREVASVCADI EWQ
Sbjct  679   KKCLSNCGEASQRWYHVPRSWLYPTGNLLVLFEEWGGEPHGISLVKREVASVCADINEWQ  738

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             PQL+NW+MQASGK  RPLRPKAHLSC +GQKI+SIKFASFGTP+G CGSF EG+CHAFHS
Sbjct  739   PQLVNWQMQASGKVDRPLRPKAHLSCASGQKISSIKFASFGTPQGVCGSFREGSCHAFHS  798

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F++YCIG NSC+VPVTPE FGGDPCP VMKKLSVEVVCS
Sbjct  799   YDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVVCS  840



>ref|NP_001234303.1| beta-galactosidase precursor [Solanum lycopersicum]
 gb|AAF70822.1|AF154421_1 beta-galactosidase [Solanum lycopersicum]
 emb|CAA10173.1| ss-galactosidase [Solanum lycopersicum]
Length=838

 Score =  1455 bits (3767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/822 (85%), Positives = 769/822 (94%), Gaps = 1/822 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV  GTASVSYD  + I+NGQR+IL+SGS+HYPRSTPEMWP +++KAKEGG+DV+QTYV
Sbjct  18    SWVFSGTASVSYDHRAIIVNGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGVDVIQTYV  77

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEPQ GKYYFEGRYDLVKFIKL  QAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG
Sbjct  78    FWNGHEPQQGKYYFEGRYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  137

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDNGPFKAAMQKFT  IVNMMK++RLYE+QGGPIILSQIENEYGPME+ELGAPGKS
Sbjct  138   ISFRTDNGPFKAAMQKFTAKIVNMMKAERLYETQGGPIILSQIENEYGPMEWELGAPGKS  197

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             YAQWAAKMAVGL TGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPK+WTEAWTAW
Sbjct  198   YAQWAAKMAVGLDTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKIWTEAWTAW  257

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FT FG PVPYRPAEDLA++VAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  258   FTGFGNPVPYRPAEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  317

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V +LG+ QEA VF+SK+G+CAAFLA
Sbjct  318   LDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPAVTALGHQQEAHVFRSKAGSCAAFLA  377

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N +QHSFA V+F N HYNLPPWSISILPDCKNTV+NTAR+GAQS++MKMTPVSRG  WQS
Sbjct  378   NYDQHSFATVSFANRHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTPVSRGLPWQS  437

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             +NEETSSY+D++FT  GLLEQINTTRD SDYLWY TDV+ID RE FL+GGKWPWLT+ SA
Sbjct  438   FNEETSSYEDSSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREKFLRGGKWPWLTIMSA  497

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHALHVF+NGQL GT+YGSLE PK+TFSKAV LRAGVNKISLLSIAVGLPN+GPHFETWN
Sbjct  498   GHALHVFVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWN  557

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPVSL+GL+EGKRDLTWQKWSYK+GLKGE LSLHSLSGSSSVEWVEGS +AQ+QPL
Sbjct  558   AGVLGPVSLTGLDEGKRDLTWQKWSYKVGLKGEALSLHSLSGSSSVEWVEGSLVAQRQPL  617

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYK+TF+APAGN+PLALD+NTMGKGQ+WINGQS+GRYWPGYKASG  CGACNYAGWF+E
Sbjct  618   TWYKSTFNAPAGNDPLALDLNTMGKGQVWINGQSLGRYWPGYKASGN-CGACNYAGWFNE  676

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
             KKCLS CGEASQRWYHVPRSWL PTGNLLV FEEWGG P+G+SLVKREVASVCADI EWQ
Sbjct  677   KKCLSNCGEASQRWYHVPRSWLYPTGNLLVLFEEWGGEPHGISLVKREVASVCADINEWQ  736

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             PQL+NW+MQASGK  +PLRPKAHLSC +GQKITSIKFASFGTP+G CGSF EG+CHAFHS
Sbjct  737   PQLVNWQMQASGKVDKPLRPKAHLSCASGQKITSIKFASFGTPQGVCGSFREGSCHAFHS  796

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F++YCIG NSC+VPVTPE FGGDPCP VMKKLSVEV+CS
Sbjct  797   YDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVICS  838



>gb|ADO34788.1| beta-galactosidase STBG3 [Solanum lycopersicum]
Length=838

 Score =  1453 bits (3762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/822 (85%), Positives = 768/822 (93%), Gaps = 1/822 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV  GTASVSYD  + I+NGQR+IL+SGS+HYPRSTPEMWP +++KAKEGG+DV+QTYV
Sbjct  18    SWVFSGTASVSYDHRAIIVNGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGVDVIQTYV  77

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEPQ GKYYFEGRYDLVKFIKL  QAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG
Sbjct  78    FWNGHEPQQGKYYFEGRYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  137

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDNGPFKAAMQKFT  IVNMMK++RLYE+QGGPIILSQIENEYGPME+ELGAPGKS
Sbjct  138   ISFRTDNGPFKAAMQKFTAKIVNMMKAERLYETQGGPIILSQIENEYGPMEWELGAPGKS  197

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             YAQWAAKMAVGL TGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPK+WTEAWTAW
Sbjct  198   YAQWAAKMAVGLDTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKIWTEAWTAW  257

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FT FG PVPYRPAEDLA++VAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  258   FTGFGNPVPYRPAEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  317

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V +LG+ QEA VF+SK+G+CAAFLA
Sbjct  318   LDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPAVTALGHQQEAHVFRSKAGSCAAFLA  377

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N +QHSFA V+F N HYNLPPWSISILPDCKNTV+NTAR+GAQS++MKMTPVSRG  WQS
Sbjct  378   NYDQHSFATVSFANRHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTPVSRGLPWQS  437

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             +NEETSSY+D++FT  GLLEQINTTRD SDYLWY TDV+ID RE FL+GGKWPWLT+ SA
Sbjct  438   FNEETSSYEDSSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREKFLRGGKWPWLTIMSA  497

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHALHVF+NGQL GT+YGSLE PK+TFSKAV LRAGVNKISLLSIAVGLPN+GPHFETWN
Sbjct  498   GHALHVFVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWN  557

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPVSL+GL+EGKRDLTWQKWSYK+GLKGE LSLHSLSGSSSVEWVEGS +AQ+QPL
Sbjct  558   AGVLGPVSLTGLDEGKRDLTWQKWSYKVGLKGEALSLHSLSGSSSVEWVEGSLVAQRQPL  617

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYK+TF+APAGN+PLALD+NTMGKGQ+WINGQS+GRYWPGYKASG  CGACNYAGWF+E
Sbjct  618   TWYKSTFNAPAGNDPLALDLNTMGKGQVWINGQSLGRYWPGYKASGN-CGACNYAGWFNE  676

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
             KKCLS CGEASQRWYHVPRSWL PTGNLLV FEEWGG P+G+SLVKREVASVCADI EWQ
Sbjct  677   KKCLSNCGEASQRWYHVPRSWLYPTGNLLVLFEEWGGEPHGISLVKREVASVCADINEWQ  736

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             PQL+NW+MQASGK  +PLRPKAHLSC  GQKITSIKFASFGTP+G CGSF EG+CHAFHS
Sbjct  737   PQLVNWQMQASGKVDKPLRPKAHLSCAPGQKITSIKFASFGTPQGVCGSFREGSCHAFHS  796

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F++YCIG NSC+VPVTPE FGGDPCP VMKKLSVEV+CS
Sbjct  797   YDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVICS  838



>ref|XP_006342989.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=838

 Score =  1453 bits (3761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/822 (85%), Positives = 768/822 (93%), Gaps = 1/822 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV  GTASVSYD  + I+NGQR+IL+SGS+HYPRSTPEMWP +++KAKEGG+DV+QTYV
Sbjct  18    SWVFSGTASVSYDHRAIIVNGQRRILISGSVHYPRSTPEMWPGIIQKAKEGGVDVIQTYV  77

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEPQ GKYYFEGRYDLVKFIKL  QAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG
Sbjct  78    FWNGHEPQQGKYYFEGRYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  137

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRT+NGPFKAAMQKFTT IVNMMK++RLYE+QGGPIILSQIENEYGPME+ELGAPGKS
Sbjct  138   ISFRTNNGPFKAAMQKFTTKIVNMMKAERLYETQGGPIILSQIENEYGPMEWELGAPGKS  197

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             YAQWAAKMAVGL TGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPK+WTEAWTAW
Sbjct  198   YAQWAAKMAVGLDTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKIWTEAWTAW  257

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FT FG PVPYRPAEDLA+AVAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  258   FTGFGNPVPYRPAEDLAFAVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  317

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V +LG+ QEA VF+SKSG+CAAFLA
Sbjct  318   LDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPAVTALGHQQEAHVFRSKSGSCAAFLA  377

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N +QHSFA V+F N HYNLPPWSISILPDCKNTV+NTAR+GAQS++MKMTPVSRG  WQS
Sbjct  378   NYDQHSFATVSFANRHYNLPPWSISILPDCKNTVFNTARIGAQSAQMKMTPVSRGLPWQS  437

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             +NEETSSY+D++FT  GLLEQINTTRD SDYLWY TDV+ID RE FL+GGKWPWLT+ SA
Sbjct  438   FNEETSSYEDSSFTVVGLLEQINTTRDVSDYLWYSTDVKIDSREEFLRGGKWPWLTIMSA  497

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHALHVF+NGQL GT+YGSLE PK++FSKAV LRAGVNKISLLSIAVGLPN+GPHFETWN
Sbjct  498   GHALHVFVNGQLAGTAYGSLEKPKLSFSKAVNLRAGVNKISLLSIAVGLPNIGPHFETWN  557

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPVSLSGL+EGKRDLTWQKWSYK+GLKGE LSLHSLSGSSSVEWVEGS +AQ+QPL
Sbjct  558   AGVLGPVSLSGLDEGKRDLTWQKWSYKVGLKGEALSLHSLSGSSSVEWVEGSLVAQRQPL  617

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYK+TF+APAGN+PLALD+NTMGKGQ+WINGQS+GRYWPGYKASG  CGACNYAGWF+E
Sbjct  618   TWYKSTFNAPAGNDPLALDLNTMGKGQVWINGQSLGRYWPGYKASGN-CGACNYAGWFNE  676

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
             KKCLS CGEASQR YHVPRSWL PTGNLLV FEE GG P+G+SLVKREVASVCADI EWQ
Sbjct  677   KKCLSNCGEASQRMYHVPRSWLYPTGNLLVLFEESGGEPHGISLVKREVASVCADINEWQ  736

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             PQLMNW+MQASGK  +PLRPKAHLSC +GQKITSIKFASFGTP+G CGSF EG+CHAFHS
Sbjct  737   PQLMNWQMQASGKVDKPLRPKAHLSCASGQKITSIKFASFGTPQGVCGSFREGSCHAFHS  796

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F++YCIG NSC+VPVTPE FGGDPCP VMKKLSVEV+CS
Sbjct  797   YDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKKLSVEVICS  838



>ref|XP_009789773.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=842

 Score =  1434 bits (3712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/822 (84%), Positives = 751/822 (91%), Gaps = 1/822 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV  G ASVSYD++S I+NGQ++IL+SGSIHYPRSTPEMWPDL++KAK+GG+DV+QTYV
Sbjct  22    SWVFSGLASVSYDRNSIIVNGQKRILISGSIHYPRSTPEMWPDLIQKAKKGGIDVIQTYV  81

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP+ GKYYFE RYDLVKFIKL  QAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG
Sbjct  82    FWNGHEPEQGKYYFEERYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  141

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDNGPFKAAMQKFTT IVNMMK++RLYESQGGPIILSQIENEYGPME  LG  GKS
Sbjct  142   ISFRTDNGPFKAAMQKFTTKIVNMMKAERLYESQGGPIILSQIENEYGPMELRLGEAGKS  201

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y++WAAKMA+ LGTGVPWVMCKQDDAPDPV+N CNGFYCD FSPNK YKPKMWTEAWTAW
Sbjct  202   YSEWAAKMALDLGTGVPWVMCKQDDAPDPVINTCNGFYCDTFSPNKDYKPKMWTEAWTAW  261

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FTEFGGPVPYRP EDLA+ VAKFI  GGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  262   FTEFGGPVPYRPVEDLAFGVAKFIQTGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  321

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DEFGLLR+PKWGHLKDLHRAIKLCEPALVSGDP V SLG+YQEARVF+SKSGACAAFLA
Sbjct  322   LDEFGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTSLGHYQEARVFRSKSGACAAFLA  381

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N NQHSFA VAF N HYNLPPWSISILPDC+NTVYNTARVGAQS+ MKMTP +RGFSWQS
Sbjct  382   NYNQHSFATVAFANRHYNLPPWSISILPDCRNTVYNTARVGAQSALMKMTPANRGFSWQS  441

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             YN+E +SY+DNTFT  GLLEQINTTRD SDYLWYMTDV+IDPRE FL  GKWPWL V SA
Sbjct  442   YNDEPASYEDNTFTVVGLLEQINTTRDVSDYLWYMTDVKIDPREGFLSSGKWPWLRVSSA  501

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             G ALHVF+N QL GT YGSL++ K+TF+KAV LRAGVNKISLLSIAVGLPN+GPHFETWN
Sbjct  502   GPALHVFVNDQLAGTVYGSLKSQKLTFNKAVNLRAGVNKISLLSIAVGLPNIGPHFETWN  561

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
              GVLGPVSLSGL+EGKRDLTWQKWSYK+GLKGE L+LHSLSGSSSVEWVEGS +AQ+QPL
Sbjct  562   TGVLGPVSLSGLDEGKRDLTWQKWSYKVGLKGEALNLHSLSGSSSVEWVEGSLVAQRQPL  621

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TW+KTTF+APAGNEPLALDMN MGKGQ+WINGQS+GRYWPGYKAS G CGACNYAG+F+E
Sbjct  622   TWFKTTFNAPAGNEPLALDMNAMGKGQVWINGQSIGRYWPGYKAS-GTCGACNYAGYFNE  680

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
              KC S CGEASQRWYHVPRSWL PTGNLLV FEEWGG+P  +SL+KRE+ASVCADI EWQ
Sbjct  681   DKCQSNCGEASQRWYHVPRSWLHPTGNLLVVFEEWGGDPNAISLIKRELASVCADINEWQ  740

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             PQL+NW+MQASGK  +PLRP+AHLSC  GQKITSIKFASFGTP+G CGSF EG+CHA HS
Sbjct  741   PQLVNWQMQASGKVDKPLRPRAHLSCAPGQKITSIKFASFGTPQGVCGSFREGSCHAHHS  800

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F+KYCIG  SCTVPVTPE FGGDPCP VMKKLSVE +CS
Sbjct  801   YDAFEKYCIGQESCTVPVTPEIFGGDPCPGVMKKLSVEAICS  842



>ref|XP_011072510.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =  1432 bits (3708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/823 (83%), Positives = 761/823 (92%), Gaps = 1/823 (0%)
 Frame = -2

Query  2944  TSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             +SW+S G  SVSYD  S  ING+RKIL+SGSIHYPRSTPEMWPDL++KAKEGG+DV+QTY
Sbjct  21    SSWISCGEGSVSYDSKSISINGRRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTY  80

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWNGHEP+PGKYYFEGRYDLVKFIKL Q+AGLYVHLR+GPYACAEWNFGGFPVWLKYVP
Sbjct  81    VFWNGHEPEPGKYYFEGRYDLVKFIKLVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVP  140

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G+SFRTDNGPFKAAMQKFTT IVNMMKS++LYE+QGGPIILSQIENEYGPMEYELG PG+
Sbjct  141   GISFRTDNGPFKAAMQKFTTKIVNMMKSEKLYETQGGPIILSQIENEYGPMEYELGEPGR  200

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y +WAAKMAV LGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT 
Sbjct  201   AYTEWAAKMAVDLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTG  260

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             WFTEFGGPVPYRP EDLA++VAKFI KGGS+INYYM+HGGTNFGRTAGGPFIATSYDYDA
Sbjct  261   WFTEFGGPVPYRPVEDLAFSVAKFIQKGGSYINYYMYHGGTNFGRTAGGPFIATSYDYDA  320

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DE+GLLR+PKWGHLKDLHRAIKLCEPALVS DP V SLGN QEA VFKSKSGACAAFL
Sbjct  321   PLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSADPTVTSLGNNQEAHVFKSKSGACAAFL  380

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN +QHSFAKV+FGNMHYNLPPWSISILPDCKNTVYNTAR+GAQS++MKMTPVS+GFSW+
Sbjct  381   ANYDQHSFAKVSFGNMHYNLPPWSISILPDCKNTVYNTARIGAQSAQMKMTPVSKGFSWE  440

Query  1684  SYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             SYNEET+S+DDN+FT  GL+EQINTTRD +DYLWY TDV+IDP E F++GGKWP LTV S
Sbjct  441   SYNEETASHDDNSFTMVGLVEQINTTRDNTDYLWYTTDVKIDPSEGFMRGGKWPVLTVLS  500

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AGHALHVFINGQL GT+YGSLE+P++TFS+ V L+AGVN+I+LLSIAVGLPNVGPHFETW
Sbjct  501   AGHALHVFINGQLSGTAYGSLEDPRLTFSEGVNLKAGVNQIALLSIAVGLPNVGPHFETW  560

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQP  1145
              AGVLGPVSLSGLNEGKRDLTWQKWSYK+GL+GE LSLHSLSGSSSVEWVEG++++++QP
Sbjct  561   KAGVLGPVSLSGLNEGKRDLTWQKWSYKVGLRGESLSLHSLSGSSSVEWVEGTYVSERQP  620

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTWYKTTF+AP G+EPLALDMN+M KGQ+WINGQS+GRYW  YKASG  C  CNYAGWF+
Sbjct  621   LTWYKTTFNAPEGDEPLALDMNSMSKGQVWINGQSIGRYWNQYKASGD-CVPCNYAGWFN  679

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
             EKKCL  CGEASQRWYHVPRSWL PTGNLLV FEEWGGNPY +SLVKREVASVCADI+EW
Sbjct  680   EKKCLGNCGEASQRWYHVPRSWLYPTGNLLVVFEEWGGNPYEISLVKREVASVCADIFEW  739

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
             QP L+NW+M ASG+  +PLRPKAHLSC +GQKI+SIKFASFGTP G CG F +G+CHAFH
Sbjct  740   QPTLVNWQMLASGEVNKPLRPKAHLSCASGQKISSIKFASFGTPEGVCGDFRQGSCHAFH  799

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SYD+F++YC+G  SCTVPVTPE FGGDPCP++MKKL VE VCS
Sbjct  800   SYDVFERYCVGQQSCTVPVTPEIFGGDPCPNIMKKLFVEAVCS  842



>gb|AHG94611.1| beta-galactosidase [Camellia sinensis]
Length=843

 Score =  1430 bits (3701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/824 (83%), Positives = 758/824 (92%), Gaps = 3/824 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWVS  TASVSY+  + +INGQR+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYV
Sbjct  21    SWVSSCTASVSYNSKAIVINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYV  80

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEPQPGKYYFEGR+DLV FIKL +QAGLY HLR+GPYACAEWNFGGFPVWLKYVPG
Sbjct  81    FWNGHEPQPGKYYFEGRFDLVNFIKLVKQAGLYXHLRIGPYACAEWNFGGFPVWLKYVPG  140

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDNGPFKAAMQKFT  IVNMMK++RLYESQGGP+ILSQIENEYGPMEYELGAPG++
Sbjct  141   ISFRTDNGPFKAAMQKFTMKIVNMMKAERLYESQGGPVILSQIENEYGPMEYELGAPGQA  200

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             YA+WAA+MAVGLGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W
Sbjct  201   YAKWAAQMAVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGW  260

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FTEFGG VPYRPAEDLA++VA+FI KGGSFINYYM+HGGTNFGRT+GGPFIATSYDYDAP
Sbjct  261   FTEFGGAVPYRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTSGGPFIATSYDYDAP  320

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V SLGN QEA VFK+KSGACAAFL 
Sbjct  321   LDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVFSLGNNQEAYVFKTKSGACAAFLT  380

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSW  1688
             N++  SFAKV+F N+HYNLPPWSISILPDCKNTVYNTARVGAQS++MKM P     GFSW
Sbjct  381   NHDSKSFAKVSFANLHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMIPAVYGIGFSW  440

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             QS+NEE +SY+DN+FT  GLLEQINTTRD SDYLWYMTDV+IDP E FLK G +P LTV 
Sbjct  441   QSFNEEPASYNDNSFTTAGLLEQINTTRDMSDYLWYMTDVKIDPYEGFLKSGNYPVLTVL  500

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVFINGQL GT+YGSLE+P++TF++ V LRAGVN I+LLSIAVGLPNVGPHFET
Sbjct  501   SAGHALHVFINGQLSGTAYGSLEDPRLTFNQGVNLRAGVNTIALLSIAVGLPNVGPHFET  560

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGPVSL+GLNEG RDL+WQKW+YKIGLKGE LSLHSLSGSSSVEW +GSF+AQKQ
Sbjct  561   WNAGVLGPVSLNGLNEGSRDLSWQKWTYKIGLKGEALSLHSLSGSSSVEWAQGSFVAQKQ  620

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYKT F+AP GNEPLALDMNTMGKG +WING+S+GRYWPGYKA+ G+C ACNYAGWF
Sbjct  621   PLTWYKTAFNAPVGNEPLALDMNTMGKGNVWINGKSIGRYWPGYKAT-GSCSACNYAGWF  679

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
              EKKCLS CGEASQRWYHVPRSWL PTGNLLV FEEWGGNPYG+SLVKR+V SVCADI+E
Sbjct  680   YEKKCLSNCGEASQRWYHVPRSWLYPTGNLLVVFEEWGGNPYGISLVKRQVGSVCADIFE  739

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP L+NW++QASGK  RPLRPKAHLSC  GQKI+SIKFASFGTP G CGSF +G+CHAF
Sbjct  740   WQPTLVNWQLQASGKVNRPLRPKAHLSCSPGQKISSIKFASFGTPEGVCGSFRQGSCHAF  799

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             HSYDIF+KYCIG  SC+VPV PEAFGGDPCPSVMKKLSVEV+CS
Sbjct  800   HSYDIFEKYCIGQQSCSVPVVPEAFGGDPCPSVMKKLSVEVICS  843



>ref|XP_009606115.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=844

 Score =  1426 bits (3692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/822 (84%), Positives = 751/822 (91%), Gaps = 1/822 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             S V  G ASVSYD+++ I+NGQ++IL+SGSIHYPRSTPEMWPDL++KAK+GG+DV+QTYV
Sbjct  24    SCVFSGLASVSYDRNAIIVNGQKRILISGSIHYPRSTPEMWPDLIQKAKKGGIDVIQTYV  83

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP+ GKYYFE RYDLVKFIKL  QAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG
Sbjct  84    FWNGHEPEQGKYYFEERYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  143

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDNGPFKAAMQKFTT IVNMMK++RLYESQGGPIILSQIENEYGP+E  LG  GKS
Sbjct  144   ISFRTDNGPFKAAMQKFTTKIVNMMKAERLYESQGGPIILSQIENEYGPIELRLGEAGKS  203

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y++WAAKMA+ LGTGVPWVMCKQ+DAPDPV+N CNGFYCD FSPNKAYKPKMWTEAWTAW
Sbjct  204   YSEWAAKMALDLGTGVPWVMCKQNDAPDPVINTCNGFYCDTFSPNKAYKPKMWTEAWTAW  263

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FTEFGGPVPYRP EDLA+ VAKFI  GGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  264   FTEFGGPVPYRPVEDLAFGVAKFIQTGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  323

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DEFGLLR+PKWGHLKDLHRAIKLCEPALVSGDP V SLG+YQEARVF+SKSGACAAFLA
Sbjct  324   LDEFGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTSLGHYQEARVFRSKSGACAAFLA  383

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N NQHSFA VAF N HYNLPPWSISILPDCKNTVYNTARVGAQS+ MKMTPV+RGFSWQS
Sbjct  384   NYNQHSFATVAFANRHYNLPPWSISILPDCKNTVYNTARVGAQSALMKMTPVNRGFSWQS  443

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             YN+E +SY+DNTFT  GLLEQINTTRD SDYLWYMTDV+IDPRE FL  GKWPWL V SA
Sbjct  444   YNDEPASYEDNTFTVVGLLEQINTTRDVSDYLWYMTDVKIDPREGFLSSGKWPWLRVSSA  503

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             G ALHVF+N QL GT YGSL++ K+TF+KAV LRAGVNKISLLSIAVGLPN+GPHFETWN
Sbjct  504   GPALHVFVNDQLAGTVYGSLKSQKLTFNKAVNLRAGVNKISLLSIAVGLPNIGPHFETWN  563

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
              GVLGPVSLSGL+EGKRDLTW+KWSYK+GLKGE L+LHSLSGSSSVEWVEGS +AQ+QPL
Sbjct  564   TGVLGPVSLSGLDEGKRDLTWRKWSYKVGLKGEALNLHSLSGSSSVEWVEGSLVAQRQPL  623

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TW+KTTF+APAGNEPLALDMN MGKGQ+WINGQS+GRYWPGYKAS G CGACNYAG+F E
Sbjct  624   TWFKTTFNAPAGNEPLALDMNVMGKGQVWINGQSLGRYWPGYKAS-GTCGACNYAGFFSE  682

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
              KC S CGEASQRWYHVPRSWL PTGNLLV FEEWGG+P  +SLVKRE+ASVCADI EWQ
Sbjct  683   DKCQSNCGEASQRWYHVPRSWLHPTGNLLVVFEEWGGDPNAISLVKRELASVCADINEWQ  742

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             PQL+NW+MQASGK  +PLRP+AHLSC  GQKITSIKFASFG+P+G CGSF EG+CHA HS
Sbjct  743   PQLVNWQMQASGKVDKPLRPRAHLSCAPGQKITSIKFASFGSPQGVCGSFREGSCHAHHS  802

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F+KYCIG  SCTVPVTPE FGGDPCP VMKKLSVE +CS
Sbjct  803   YDAFEKYCIGQESCTVPVTPEIFGGDPCPGVMKKLSVEAICS  844



>ref|XP_009627536.1| PREDICTED: beta-galactosidase [Nicotiana tomentosiformis]
Length=845

 Score =  1424 bits (3686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/823 (83%), Positives = 749/823 (91%), Gaps = 1/823 (0%)
 Frame = -2

Query  2944  TSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             +SWVS GTASVSYD  + I+NGQRKIL+SGSIHYPRSTPEMWPDL++KAKEGG+DV+QTY
Sbjct  24    SSWVSCGTASVSYDHKAIIVNGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTY  83

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWNGHEP+ GKYYFEGRYDLVKFIK+ Q+AGLYVHLR+GPYACAEWNFGGFPVWLKYVP
Sbjct  84    VFWNGHEPEEGKYYFEGRYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVP  143

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G+SFRTDN PFKAAMQKFTT IV M+KS+RLYESQGGPIILSQIENEYGPME+ELG PGK
Sbjct  144   GISFRTDNEPFKAAMQKFTTKIVEMIKSERLYESQGGPIILSQIENEYGPMEWELGEPGK  203

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y++WAAKMAV LGTGVPW+MCKQDD PDP++N CNGFYCD+FSPNKA KPKMWTEAWTA
Sbjct  204   AYSEWAAKMAVDLGTGVPWIMCKQDDVPDPIINTCNGFYCDYFSPNKANKPKMWTEAWTA  263

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             WFTEFGGPVPYRPAED+A+AVA+FI  GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDA
Sbjct  264   WFTEFGGPVPYRPAEDMAFAVARFIQTGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDA  323

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DEFGLLR+PKWGHLKDLHRAIKLCEPALVS DP V  LGNYQEARVFKS+SGACAAFL
Sbjct  324   PLDEFGLLRQPKWGHLKDLHRAIKLCEPALVSADPIVTPLGNYQEARVFKSESGACAAFL  383

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQS++MKM+PV RGFSWQ
Sbjct  384   ANYNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMSPVIRGFSWQ  443

Query  1684  SYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             SYNE+ + Y+DNT+T  GLLEQINTTRD SDYLWYMTDV IDP E FL  G WPWLTV+S
Sbjct  444   SYNEDAALYEDNTYTVVGLLEQINTTRDVSDYLWYMTDVEIDPTEGFLNSGNWPWLTVFS  503

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AGHALHVF+NGQL GT YGSLENPK+TFS  + LRAGVNKISLLSIAVGLPNVGPHFETW
Sbjct  504   AGHALHVFVNGQLAGTVYGSLENPKLTFSNGINLRAGVNKISLLSIAVGLPNVGPHFETW  563

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQP  1145
             NAGVLGPVSLSGLN+G RDLTWQKW YK+GLKGE LSLHSLSGS SVEWVEGS +AQKQP
Sbjct  564   NAGVLGPVSLSGLNKGTRDLTWQKWCYKVGLKGEALSLHSLSGSPSVEWVEGSLVAQKQP  623

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             L+WYK+TF+APAGNEPLALDMNTM KGQ+WINGQS+GR+WP YK+SG  C ACNY GWFD
Sbjct  624   LSWYKSTFNAPAGNEPLALDMNTMSKGQVWINGQSLGRHWPAYKSSGN-CTACNYKGWFD  682

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
             EKKCLS CGE SQRWYHVPRSWL PTGNLLV FEEWGG+PYG++LVKREVASVCADIYEW
Sbjct  683   EKKCLSNCGEGSQRWYHVPRSWLHPTGNLLVVFEEWGGDPYGITLVKREVASVCADIYEW  742

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
             QPQL+NW+  ASGK  RPLRPKAHL C  GQKI+SIKFASFGTP G CGSF +G+CHA  
Sbjct  743   QPQLLNWQRLASGKFDRPLRPKAHLRCAPGQKISSIKFASFGTPEGVCGSFQQGSCHARR  802

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SYD F+K C+G   C+V VTPE FGGDPC +V+KKLSVE +CS
Sbjct  803   SYDAFEKNCVGQEFCSVSVTPENFGGDPCRNVLKKLSVEAICS  845



>ref|XP_004241849.1| PREDICTED: beta-galactosidase-like [Solanum lycopersicum]
Length=841

 Score =  1420 bits (3676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/822 (83%), Positives = 746/822 (91%), Gaps = 1/822 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV  G  SVSYD+++ I+NGQR+IL+SGSIHYPRSTPEMWPDL++KAKEGG+DV+QTYV
Sbjct  21    SWVLSGMCSVSYDRNAIIVNGQRRILVSGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYV  80

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP+ GKYYFE RYDLVKFIK+  QAGLYVHLR+GPYACAEWNFGGFPVWLKYVPG
Sbjct  81    FWNGHEPEQGKYYFEERYDLVKFIKIVHQAGLYVHLRIGPYACAEWNFGGFPVWLKYVPG  140

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDN PFK+AMQKFTT IVNMMK++RLYESQGGPIILSQIENEYGP+E  LG PGKS
Sbjct  141   ISFRTDNAPFKSAMQKFTTKIVNMMKAERLYESQGGPIILSQIENEYGPIEKRLGEPGKS  200

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y+ WAAKMA+ LGTGVPWVMCKQDDAPDPV+N CNGFYCD+FSPNKAYKPK+WTEAWTAW
Sbjct  201   YSDWAAKMALDLGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKIWTEAWTAW  260

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FTEFGGP+PYRP EDLA+ VAKFI  GGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  261   FTEFGGPIPYRPVEDLAFGVAKFIQNGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  320

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             IDEFGLLR+PKWGHLKDLHRAIKLCEPALVSGDP V SLGN+Q+A VF SKSG CAAFLA
Sbjct  321   IDEFGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTSLGNFQQAHVFTSKSGVCAAFLA  380

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N NQHSFA V FGN HYNLPPWSISILPDCKNTVYNTARVGAQS+ MKMTP  RGFSWQS
Sbjct  381   NYNQHSFATVTFGNRHYNLPPWSISILPDCKNTVYNTARVGAQSALMKMTPAVRGFSWQS  440

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             YN+E SSY+D+TFT  GLLEQINTTRD SDYLWYMTDV+IDP E FL+ G+WPWL V SA
Sbjct  441   YNDEPSSYEDSTFTVVGLLEQINTTRDVSDYLWYMTDVKIDPSEGFLRSGQWPWLKVSSA  500

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             G ALHVF+NGQL GT YGSL++ K+TF+KAV LRAG+NKISLLSIAVGLPN+GPHFETWN
Sbjct  501   GPALHVFVNGQLAGTVYGSLKSQKITFNKAVNLRAGINKISLLSIAVGLPNIGPHFETWN  560

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
              GVLGPVSLSGLNEGKRDL WQKWSYK+GLKGE L+LHSLSGSSSVEWVEGS + Q+QPL
Sbjct  561   TGVLGPVSLSGLNEGKRDLAWQKWSYKVGLKGEALNLHSLSGSSSVEWVEGSLVTQRQPL  620

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TW+KTTF+APAGNEPLALDMNTMGKGQ+WINGQS+GRYWPGYK+S G C ACNYAG+F+E
Sbjct  621   TWFKTTFNAPAGNEPLALDMNTMGKGQMWINGQSLGRYWPGYKSS-GTCSACNYAGYFNE  679

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
              KCLS CGEASQRWYHVPRSWL PTGNLLV FEEWGG+P  +SLVKRE+ASVCADI EWQ
Sbjct  680   NKCLSNCGEASQRWYHVPRSWLHPTGNLLVVFEEWGGDPNAISLVKRELASVCADINEWQ  739

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             PQL+N++MQASG+  RPLRPKAHL C  GQKITSIKFASFGTP G CGSFSEG+CHA HS
Sbjct  740   PQLVNYKMQASGEVDRPLRPKAHLRCATGQKITSIKFASFGTPVGVCGSFSEGSCHAHHS  799

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F+KYCIG  SC+VPVTPE FGGDPCP VMKKLSVE +CS
Sbjct  800   YDAFEKYCIGQESCSVPVTPEIFGGDPCPGVMKKLSVEALCS  841



>ref|XP_009783993.1| PREDICTED: beta-galactosidase [Nicotiana sylvestris]
Length=844

 Score =  1420 bits (3675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/823 (83%), Positives = 749/823 (91%), Gaps = 2/823 (0%)
 Frame = -2

Query  2944  TSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             +SWVS G ASVSYD  + I+NGQRKIL+SGSIHYPRS PEMWPDL++KAKEGG+DV+QTY
Sbjct  24    SSWVSCGIASVSYDHKAIIVNGQRKILISGSIHYPRSIPEMWPDLIQKAKEGGVDVIQTY  83

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWNGHE + GKYYFEGRYDLVKFIK+ Q+AGLYVHLR+GPYACAEWNFGGFPVWLKYVP
Sbjct  84    VFWNGHESEEGKYYFEGRYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVP  143

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G+SFRTDN PFKAAMQKFTT IV+MMKS+RLY+SQGGPIILSQIENEYGPME+ELG PGK
Sbjct  144   GISFRTDNEPFKAAMQKFTTKIVDMMKSERLYQSQGGPIILSQIENEYGPMEWELGEPGK  203

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y++WAAKMAV LGTGVPW+MCKQDD PDP++N CNGFYCD+F PNKA KPKMWTEAWTA
Sbjct  204   AYSEWAAKMAVDLGTGVPWIMCKQDDVPDPIINTCNGFYCDYFLPNKANKPKMWTEAWTA  263

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             WFTEFGGPVPYRPAED+A+AVA+FI  GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDA
Sbjct  264   WFTEFGGPVPYRPAEDMAFAVARFIQTGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDA  323

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DEFGLLR+PKWGHLKDLHRAIKLCEPALVS DP V  LGNYQEAR+FKS+SGACAAFL
Sbjct  324   PLDEFGLLRQPKWGHLKDLHRAIKLCEPALVSADPTVTPLGNYQEARIFKSESGACAAFL  383

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQS++MKM+PV RGFSWQ
Sbjct  384   ANYNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMSPVIRGFSWQ  443

Query  1684  SYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             SYNE+ + ++DNT+T  GLLEQINTTRD SDYLWYMTDV IDP E FL  G WPWLTV+S
Sbjct  444   SYNEDAALHEDNTYT-VGLLEQINTTRDVSDYLWYMTDVEIDPTEGFLNSGNWPWLTVFS  502

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AGHALHVF+NGQL GT YGSLENPK+TFS  + LRAGVNKISLLSIAVGLPNVGPHFETW
Sbjct  503   AGHALHVFVNGQLAGTVYGSLENPKLTFSNGINLRAGVNKISLLSIAVGLPNVGPHFETW  562

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQP  1145
             NAGVLGPVSLSGLNEG RDLTWQKW YK+GLKGE LSLHSLSGS SVEWVEGS +AQKQP
Sbjct  563   NAGVLGPVSLSGLNEGTRDLTWQKWFYKVGLKGEALSLHSLSGSPSVEWVEGSLVAQKQP  622

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             L+WYKTTF+APAGNEPLALDMNTMGKGQ+WINGQS+GR+WPGYK+SG  C AC Y GWFD
Sbjct  623   LSWYKTTFNAPAGNEPLALDMNTMGKGQVWINGQSLGRHWPGYKSSGN-CTACYYTGWFD  681

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
             EKKCLS CGE SQRWYHVPRSWL PTGNLLV FEEWGG+PYG++LVKRE+ASVCADIYEW
Sbjct  682   EKKCLSNCGEGSQRWYHVPRSWLHPTGNLLVVFEEWGGDPYGITLVKREIASVCADIYEW  741

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
             QPQL+NW+  ASGK  RPLRPKAHL C  GQKI+SIKFASFGTP G CGSF +G+CHA H
Sbjct  742   QPQLLNWQRLASGKFDRPLRPKAHLRCAPGQKISSIKFASFGTPEGVCGSFQQGSCHARH  801

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SYD F+K C+G  SC+V VTPE FGGDPC +V+KKLSVE +CS
Sbjct  802   SYDAFEKNCVGQESCSVSVTPENFGGDPCRNVLKKLSVEAICS  844



>gb|ACC60981.1| beta-galactosidase 1 precursor [Petunia x hybrida]
Length=842

 Score =  1417 bits (3669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 689/846 (81%), Positives = 761/846 (90%), Gaps = 6/846 (1%)
 Frame = -2

Query  3013  TLNMGWKHEMWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRS  2834
              +NM  +  MW+V++VLL     +S V  G ASVSYD  + I+NGQR+IL+SGSIHYPRS
Sbjct  3     VINMVSRLVMWNVLLVLL-----SSCVFSGLASVSYDHKAIIVNGQRRILISGSIHYPRS  57

Query  2833  TPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHL  2654
             TPEMWPDL++KAKEGG+DV+QTYVFWNGHEP+ GKYYFE RYDLVKFIKL  QAGLYV+L
Sbjct  58    TPEMWPDLIQKAKEGGVDVIQTYVFWNGHEPEQGKYYFEERYDLVKFIKLVHQAGLYVNL  117

Query  2653  RVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGG  2474
             RVGPYACAEWNFGGFPVWLKYVPG+SFRTDN PFKAAMQKFTT IVNMMK++RLYESQGG
Sbjct  118   RVGPYACAEWNFGGFPVWLKYVPGISFRTDNEPFKAAMQKFTTKIVNMMKAERLYESQGG  177

Query  2473  PIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNG  2294
             PIILSQIENEYGP+E   G  GKSYA+WAAKMA+ LGTGVPW+MCKQDDAPDPV+N CNG
Sbjct  178   PIILSQIENEYGPLEVRFGEQGKSYAEWAAKMALDLGTGVPWLMCKQDDAPDPVINTCNG  237

Query  2293  FYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMF  2114
             FYCD+F PNKAYKPK+WTEAWTAWFTEFG PVPYRP EDLA+ VA FI  GGSFINYYM+
Sbjct  238   FYCDYFYPNKAYKPKIWTEAWTAWFTEFGSPVPYRPVEDLAFGVANFIQTGGSFINYYMY  297

Query  2113  HGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNV  1934
             HGGTNFGRTAGGPF+ATSYDYDAP+DEFGLLR+PKWGHLKDLHRAIKLCEPALVSGDP V
Sbjct  298   HGGTNFGRTAGGPFVATSYDYDAPLDEFGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTV  357

Query  1933  ISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYN  1754
              +LGNYQ+A VF+S SGACAAFLANN+ +SFA VAFGN HYNLPPWSISILPDCK+TVYN
Sbjct  358   TALGNYQKAHVFRSTSGACAAFLANNDPNSFATVAFGNKHYNLPPWSISILPDCKHTVYN  417

Query  1753  TARVGAQSSRMKMTPVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMT  1574
             TARVGAQS+ MKMTP + G+SWQSYN++T+ YDDN FT  GLLEQ+NTTRD SDYLWYMT
Sbjct  418   TARVGAQSALMKMTPANEGYSWQSYNDQTAFYDDNAFTVVGLLEQLNTTRDVSDYLWYMT  477

Query  1573  DVRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAG  1394
             DV+IDP E FL+ G WPWLTV SAG ALHVF+NGQL GT YGSL+  K+TFSKAV LRAG
Sbjct  478   DVKIDPSEGFLRSGNWPWLTVSSAGDALHVFVNGQLAGTVYGSLKKQKITFSKAVNLRAG  537

Query  1393  VNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevls  1214
             VNKISLLSIAVGLPN+GPHFETWN GVLGPVSLSGL+EGKRDLTWQKWSYK+GLKGE L+
Sbjct  538   VNKISLLSIAVGLPNIGPHFETWNTGVLGPVSLSGLDEGKRDLTWQKWSYKVGLKGEALN  597

Query  1213  lhslsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVG  1034
             LHSLSGSSSVEWVEGS +AQ+QPLTWYKTTF+APAGNEPLALDMN+MGKGQ+WINGQS+G
Sbjct  598   LHSLSGSSSVEWVEGSLVAQRQPLTWYKTTFNAPAGNEPLALDMNSMGKGQVWINGQSIG  657

Query  1033  RYWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWG  854
             RYWPGYKAS G C ACNYAG F+EKKCLS CG+ASQRWYHVPRSWL PTGNLLV FEEWG
Sbjct  658   RYWPGYKAS-GTCDACNYAGPFNEKKCLSNCGDASQRWYHVPRSWLHPTGNLLVVFEEWG  716

Query  853   GNPYGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIK  674
             G+P G+SLVKRE+ASVCADI EWQPQL+NW++QASGK  +PLRPKAHLSC +GQKITSIK
Sbjct  717   GDPNGISLVKRELASVCADINEWQPQLVNWQLQASGKVDKPLRPKAHLSCTSGQKITSIK  776

Query  673   FASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLS  494
             FASFGTP+G CGSFSEG+CHA HSYD F+KYCIG  SCTVPVTPE FGGDPCPSVMKKLS
Sbjct  777   FASFGTPQGVCGSFSEGSCHAHHSYDAFEKYCIGQESCTVPVTPEIFGGDPCPSVMKKLS  836

Query  493   VEVVCS  476
             VE VCS
Sbjct  837   VEAVCS  842



>ref|XP_006357461.1| PREDICTED: beta-galactosidase-like, partial [Solanum tuberosum]
Length=866

 Score =  1416 bits (3666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/822 (83%), Positives = 745/822 (91%), Gaps = 1/822 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV  G  SVSYD+++ I+NGQR+IL+SGSIHYPRSTPEMWPDL++KAKEGG+DV+QTYV
Sbjct  46    SWVFSGMCSVSYDRNAIIVNGQRRILVSGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYV  105

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP+ GKYYFE RYDLVKFIK+  QAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG
Sbjct  106   FWNGHEPEQGKYYFEERYDLVKFIKIVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  165

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDN PFK+AMQKFTT IVNMMK++RLYESQGGPIILSQIENEYGP+E  LG PGKS
Sbjct  166   ISFRTDNEPFKSAMQKFTTKIVNMMKAERLYESQGGPIILSQIENEYGPIEKRLGEPGKS  225

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y+ WAAKMA+ LGTGVPWVMCKQDDAPDPV+N CNGFYCD+FSPNKAYKPK+WTEAWTAW
Sbjct  226   YSDWAAKMALDLGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKIWTEAWTAW  285

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FTEFGGP+PYRP EDLA+ VAKFI  GGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  286   FTEFGGPIPYRPVEDLAFGVAKFIQNGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  345

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DEFGLLR+PKWGHLKDLHRAIKLCEPALVSGDP V SLGN+QEA VF SKSG CAAFLA
Sbjct  346   LDEFGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTSLGNFQEAHVFSSKSGVCAAFLA  405

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N NQHSFA V FGN HYNLPPWSISILPDCKNTVYNTARVGAQS+ MKMTP  +GFSWQS
Sbjct  406   NYNQHSFATVTFGNRHYNLPPWSISILPDCKNTVYNTARVGAQSALMKMTPADKGFSWQS  465

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             YN+E SSY+D+TFT  GLLEQINTTRD SDYLWYMTDV+IDP E FL+ G+WPWL V SA
Sbjct  466   YNDEPSSYEDSTFTVVGLLEQINTTRDVSDYLWYMTDVKIDPSEGFLRSGQWPWLRVSSA  525

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             G ALHVF+NGQL GT YGSL++ K+TF+KAV LRAGVNKISLLSIAVGLPN+GPHFETWN
Sbjct  526   GPALHVFVNGQLAGTVYGSLKSQKITFNKAVNLRAGVNKISLLSIAVGLPNIGPHFETWN  585

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
              GVLGPVSLSGLNEGKRDL WQKWSYK+GLKGE L+LHSLSGSSSVEWVEGS + Q+QPL
Sbjct  586   TGVLGPVSLSGLNEGKRDLAWQKWSYKVGLKGEALNLHSLSGSSSVEWVEGSLVTQRQPL  645

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TW+KTTF+APAGNEPLALDMNTMGKGQ+WINGQS+GRYWPGYK+S G C ACNYAG+F+E
Sbjct  646   TWFKTTFNAPAGNEPLALDMNTMGKGQMWINGQSLGRYWPGYKSS-GTCSACNYAGYFNE  704

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
              KCLS CGEASQRWYHVPRSWL PTGNLLV FEEWGG+P  +SLVKRE+ASVCADI EWQ
Sbjct  705   NKCLSNCGEASQRWYHVPRSWLHPTGNLLVVFEEWGGDPNAISLVKRELASVCADINEWQ  764

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             PQL+N++MQASG+  RPLRPKAHL C  GQKITSIKFASFGTP G CGSFSEG+C A HS
Sbjct  765   PQLVNYKMQASGEVDRPLRPKAHLRCAPGQKITSIKFASFGTPVGVCGSFSEGSCRAHHS  824

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F+KYCIG  SC+VPVTPE FGGDPCP VMKKLSVE +CS
Sbjct  825   YDAFEKYCIGKESCSVPVTPEIFGGDPCPGVMKKLSVEALCS  866



>emb|CDO97918.1| unnamed protein product [Coffea canephora]
Length=835

 Score =  1415 bits (3663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/822 (82%), Positives = 753/822 (92%), Gaps = 1/822 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWVS GTASVSYD  + I+NGQR+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV++TYV
Sbjct  15    SWVSCGTASVSYDNTAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIETYV  74

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEPQPGKYYFEGRYDLVKF+ L ++AGLYV+LR+GPY CAEWNFGGFPVWLKYVPG
Sbjct  75    FWNGHEPQPGKYYFEGRYDLVKFVNLVKEAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPG  134

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRT+NGPFKAAMQKFTT IVNMMK++RLYE QGGPIILSQ+ENEYGPMEYELGAPG++
Sbjct  135   ISFRTNNGPFKAAMQKFTTKIVNMMKAERLYEPQGGPIILSQVENEYGPMEYELGAPGRA  194

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y +WAAKMAV LGTGVPWVMCKQDDAPDPV+N CNGFYCD+FSPNKAYKPK+WTEAWT W
Sbjct  195   YTEWAAKMAVDLGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKIWTEAWTGW  254

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FTEFGG  PYRPAEDLA++VAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  255   FTEFGGAQPYRPAEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  314

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRA+KLCEPALVSG+P V  LGNYQEA VFKSKSGACAAFLA
Sbjct  315   LDEYGLLRQPKWGHLKDLHRALKLCEPALVSGNPTVTPLGNYQEAHVFKSKSGACAAFLA  374

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N N  SFA+VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQS++MKM PV +GFSW+S
Sbjct  375   NYNSQSFARVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMNPVIKGFSWES  434

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             YNEET+S +DN FT +GLLEQIN TRD SDYLWY T+VRI   E FLKGGKWP LTV SA
Sbjct  435   YNEETASNEDNAFTVSGLLEQINVTRDNSDYLWYSTEVRIYHTEGFLKGGKWPVLTVMSA  494

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHALHVFINGQL GT+YGSLENPK+TFS+ V LRAGVNKISLLSIAVGLPNVGPHFETWN
Sbjct  495   GHALHVFINGQLSGTTYGSLENPKITFSQGVNLRAGVNKISLLSIAVGLPNVGPHFETWN  554

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AG+LGPVSL GLNEG+RDLTWQKWSYK+GLKGE LSLHSLSGSS+VEW EGSF+A++QPL
Sbjct  555   AGILGPVSLYGLNEGRRDLTWQKWSYKVGLKGEALSLHSLSGSSAVEWGEGSFVAERQPL  614

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYKTTF AP+GNEPLALDM+ M KGQ+WINGQS+GRY+P YKASG  CGAC+YAG F+E
Sbjct  615   TWYKTTFSAPSGNEPLALDMSAMSKGQVWINGQSIGRYYPAYKASGN-CGACSYAGSFNE  673

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
             KKCLS CGEASQ+WYHVPRSWL PTGNLLV FEEWGGNPYG+SLVKREV+SVCADIYEWQ
Sbjct  674   KKCLSNCGEASQKWYHVPRSWLYPTGNLLVVFEEWGGNPYGISLVKREVSSVCADIYEWQ  733

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             P L+NW++Q+SGK ++PLRPKAHLSC  GQ+I+SIKFASFGTP G+CG+F +G CHAFHS
Sbjct  734   PTLVNWQLQSSGKVSKPLRPKAHLSCAPGQRISSIKFASFGTPEGTCGNFRQGGCHAFHS  793

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F+ YCIG  +C+V V P  FGGDPCP+VMKKLSVE VCS
Sbjct  794   YDAFETYCIGQQTCSVTVAPALFGGDPCPNVMKKLSVEAVCS  835



>ref|XP_006366152.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=839

 Score =  1407 bits (3641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/821 (82%), Positives = 745/821 (91%), Gaps = 1/821 (0%)
 Frame = -2

Query  2938  WVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVF  2759
             WVS G ASVSYD  + IINGQRKIL+SGSIHYPRSTPEMWPDL++KAKEGG+DV+QTYVF
Sbjct  20    WVSCGIASVSYDHKAIIINGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVF  79

Query  2758  WNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGV  2579
             WNGHEP+ GKYYFE RYDLVKFIK+ Q+AGLYVHLR+GPYACAEWNFGGFPVWLKYVPG+
Sbjct  80    WNGHEPEEGKYYFEERYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGI  139

Query  2578  SFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSY  2399
             SFRTDN PFKAAMQKFTT IV+MMK+++LYE+QGGPIILSQIENEYGPME+ELG PGK Y
Sbjct  140   SFRTDNEPFKAAMQKFTTKIVDMMKAEKLYETQGGPIILSQIENEYGPMEWELGEPGKVY  199

Query  2398  AQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWF  2219
             ++WAAKMAV LGTGVPW+MCKQDD PDP++N CNGFYCD+F+PNKA KPKMWTEAWTAWF
Sbjct  200   SEWAAKMAVDLGTGVPWIMCKQDDVPDPIINTCNGFYCDYFTPNKANKPKMWTEAWTAWF  259

Query  2218  TEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPI  2039
             TEFGGPVPYRPAED+A++VA+FI  GGSFINYYM+HGGTNFGRT+GGPFIATSYDYDAP+
Sbjct  260   TEFGGPVPYRPAEDMAFSVARFIQTGGSFINYYMYHGGTNFGRTSGGPFIATSYDYDAPL  319

Query  2038  DEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLAN  1859
             DEFG LR+PKWGHLKDLHRAIKLCEPALVS DP V SLGNYQEARVFKS+SGACAAFLAN
Sbjct  320   DEFGSLRQPKWGHLKDLHRAIKLCEPALVSADPTVTSLGNYQEARVFKSESGACAAFLAN  379

Query  1858  NNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSY  1679
              NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQS++MKMTPVSRGFSW+SY
Sbjct  380   YNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMTPVSRGFSWESY  439

Query  1678  NEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAG  1499
             NE+ + ++D+TFT  GLLEQIN TRD SDYLWYMTD++IDP E FL  G WPWLTV+SAG
Sbjct  440   NEDAALHEDDTFTVVGLLEQINITRDVSDYLWYMTDIQIDPTEGFLNSGNWPWLTVFSAG  499

Query  1498  HALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNA  1319
             HALHVF+NGQL GT YGSLE+PK+TFS  + LRAGVNKISLLSIAVGLPNVGPHFETWNA
Sbjct  500   HALHVFVNGQLAGTVYGSLEDPKLTFSNGINLRAGVNKISLLSIAVGLPNVGPHFETWNA  559

Query  1318  GVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLT  1139
             GVLGPVSL+GLNEG RDLTWQKW YK+GLKGE LSLHSLSGS SVEWVEGS +AQKQPL+
Sbjct  560   GVLGPVSLNGLNEGTRDLTWQKWFYKVGLKGEALSLHSLSGSPSVEWVEGSLVAQKQPLS  619

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             WYKTTF+AP GNEPLALDMNTMGKGQ+WINGQS+GR+WP YK+S G+C  CNY GWFDEK
Sbjct  620   WYKTTFNAPDGNEPLALDMNTMGKGQVWINGQSLGRHWPAYKSS-GSCSVCNYTGWFDEK  678

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KCL+ CGE SQRWYHVPRSWL PTGNLLV FEEWGG+PYG++LVKRE+ASVCA+IYEWQP
Sbjct  679   KCLTNCGEGSQRWYHVPRSWLYPTGNLLVVFEEWGGDPYGITLVKREIASVCANIYEWQP  738

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
             QL+NW+   SGK  RPLRPK HL C  GQKI+SIKFASFGTP G CGSF +G+CHA  SY
Sbjct  739   QLLNWQRLVSGKFDRPLRPKVHLKCAPGQKISSIKFASFGTPGGVCGSFQQGSCHAPRSY  798

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             D F+K C+G  SC+V VTPE FGGDPC +V+KKLSVE +CS
Sbjct  799   DAFKKNCVGQESCSVQVTPENFGGDPCRNVLKKLSVEAICS  839



>ref|NP_001234465.1| beta-galactosidase precursor [Solanum lycopersicum]
 sp|P48980.1|BGAL_SOLLC RecName: Full=Beta-galactosidase; AltName: Full=Acid beta-galactosidase; 
Short=Lactase; AltName: Full=Exo-(1-->4)-beta-D-galactanase; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAF21626.1|AF023847_1 beta-galactosidase precursor [Solanum lycopersicum]
 emb|CAA58734.1| putative beta-galactosidase/galactanase [Solanum lycopersicum]
 emb|CAA10174.1| ss-galactosidase [Solanum lycopersicum]
Length=835

 Score =  1405 bits (3638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/821 (82%), Positives = 745/821 (91%), Gaps = 1/821 (0%)
 Frame = -2

Query  2938  WVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVF  2759
             WVS G ASVSYD  + I+NGQRKIL+SGSIHYPRSTPEMWPDL++KAKEGG+DV+QTYVF
Sbjct  16    WVSCGIASVSYDHKAIIVNGQRKILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVF  75

Query  2758  WNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGV  2579
             WNGHEP+ GKYYFE RYDLVKFIK+ Q+AGLYVHLR+GPYACAEWNFGGFPVWLKYVPG+
Sbjct  76    WNGHEPEEGKYYFEERYDLVKFIKVVQEAGLYVHLRIGPYACAEWNFGGFPVWLKYVPGI  135

Query  2578  SFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSY  2399
             SFRT+N PFKAAMQKFTT IV+MMK+++LYE+QGGPIILSQIENEYGPME+ELG PGK Y
Sbjct  136   SFRTNNEPFKAAMQKFTTKIVDMMKAEKLYETQGGPIILSQIENEYGPMEWELGEPGKVY  195

Query  2398  AQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWF  2219
             ++WAAKMAV LGTGVPW+MCKQDD PDP++N CNGFYCD+F+PNKA KPKMWTEAWTAWF
Sbjct  196   SEWAAKMAVDLGTGVPWIMCKQDDVPDPIINTCNGFYCDYFTPNKANKPKMWTEAWTAWF  255

Query  2218  TEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPI  2039
             TEFGGPVPYRPAED+A+AVA+FI  GGSFINYYM+HGGTNFGRT+GGPFIATSYDYDAP+
Sbjct  256   TEFGGPVPYRPAEDMAFAVARFIQTGGSFINYYMYHGGTNFGRTSGGPFIATSYDYDAPL  315

Query  2038  DEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLAN  1859
             DEFG LR+PKWGHLKDLHRAIKLCEPALVS DP V SLGNYQEARVFKS+SGACAAFLAN
Sbjct  316   DEFGSLRQPKWGHLKDLHRAIKLCEPALVSVDPTVTSLGNYQEARVFKSESGACAAFLAN  375

Query  1858  NNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSY  1679
              NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQS++MKMTPVSRGFSW+S+
Sbjct  376   YNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMTPVSRGFSWESF  435

Query  1678  NEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAG  1499
             NE+ +S++D+TFT  GLLEQIN TRD SDYLWYMTD+ IDP E FL  G WPWLTV+SAG
Sbjct  436   NEDAASHEDDTFTVVGLLEQINITRDVSDYLWYMTDIEIDPTEGFLNSGNWPWLTVFSAG  495

Query  1498  HALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNA  1319
             HALHVF+NGQL GT YGSLENPK+TFS  + LRAGVNKISLLSIAVGLPNVGPHFETWNA
Sbjct  496   HALHVFVNGQLAGTVYGSLENPKLTFSNGINLRAGVNKISLLSIAVGLPNVGPHFETWNA  555

Query  1318  GVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLT  1139
             GVLGPVSL+GLNEG RDLTWQKW YK+GLKGE LSLHSLSGS SVEWVEGS +AQKQPL+
Sbjct  556   GVLGPVSLNGLNEGTRDLTWQKWFYKVGLKGEALSLHSLSGSPSVEWVEGSLVAQKQPLS  615

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             WYKTTF+AP GNEPLALDMNTMGKGQ+WINGQS+GR+WP YK+S G+C  CNY GWFDEK
Sbjct  616   WYKTTFNAPDGNEPLALDMNTMGKGQVWINGQSLGRHWPAYKSS-GSCSVCNYTGWFDEK  674

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KCL+ CGE SQRWYHVPRSWL PTGNLLV FEEWGG+PYG++LVKRE+ SVCADIYEWQP
Sbjct  675   KCLTNCGEGSQRWYHVPRSWLYPTGNLLVVFEEWGGDPYGITLVKREIGSVCADIYEWQP  734

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
             QL+NW+   SGK  RPLRPKAHL C  GQKI+SIKFASFGTP G CG+F +G+CHA  SY
Sbjct  735   QLLNWQRLVSGKFDRPLRPKAHLKCAPGQKISSIKFASFGTPEGVCGNFQQGSCHAPRSY  794

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             D F+K C+G  SC+V VTPE FGGDPC +V+KKLSVE +CS
Sbjct  795   DAFKKNCVGKESCSVQVTPENFGGDPCRNVLKKLSVEAICS  835



>ref|XP_010106660.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXC11109.1| Beta-galactosidase 1 [Morus notabilis]
Length=845

 Score =  1389 bits (3595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/818 (80%), Positives = 747/818 (91%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             +ASVSYD  + +INGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYVFWNGHE
Sbjct  29    SASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  88

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEG YDLVKF+KL QQAGLY+HLR+GPY CAEWNFGGFPVWLKY+PG+ FRTD
Sbjct  89    PSPGKYYFEGNYDLVKFVKLVQQAGLYMHLRIGPYVCAEWNFGGFPVWLKYIPGIRFRTD  148

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKA M+KFT  IVNMMK++RL+ S+GGPIILSQIENEYGPMEYELGAPGK+Y+ WAA
Sbjct  149   NGPFKAQMEKFTRKIVNMMKAERLFASEGGPIILSQIENEYGPMEYELGAPGKAYSNWAA  208

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
              MAVGLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWTAW+TEFGG
Sbjct  209   HMAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTAWYTEFGG  268

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVP RPAEDLA+AVA+FI KGG+FINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  269   PVPKRPAEDLAFAVARFIQKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  328

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
             LR+PKWGHLKDLHRAIKLCEPALVSGDP V  LGNY++A VFKSKSGACAAFLAN N +S
Sbjct  329   LRQPKWGHLKDLHRAIKLCEPALVSGDPTVTQLGNYEQAHVFKSKSGACAAFLANYNPNS  388

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMT--PVSRGFSWQSYNEE  1670
             FAKV+FGNMHYNLPPWSISILPDC+NTVYNTARVGAQSS MKMT  P+  G SWQ+YNE+
Sbjct  389   FAKVSFGNMHYNLPPWSISILPDCENTVYNTARVGAQSSTMKMTRVPIHGGLSWQAYNEQ  448

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
             T+SY++ +FT +GLLEQINTTRDASDYLWYMTDV+IDP E FL+ GK+P LTV SAGHAL
Sbjct  449   TASYEETSFTVSGLLEQINTTRDASDYLWYMTDVKIDPSEEFLRSGKYPVLTVSSAGHAL  508

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVF+NGQL GTSYGSLE PK+T SK V LRAG+N I+LLSIAVGLPNVGPHFETWNAGVL
Sbjct  509   HVFVNGQLAGTSYGSLEFPKLTLSKGVNLRAGINTIALLSIAVGLPNVGPHFETWNAGVL  568

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPV+L+GLNEG+RDL+WQKWSYK+GL+GE LSLHSL+GSSSV+W++GS +A+KQPLTW+K
Sbjct  569   GPVTLNGLNEGRRDLSWQKWSYKVGLRGEALSLHSLTGSSSVDWIQGSLVARKQPLTWFK  628

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             T+FDAPAG  PLALDM +MGKGQIWINGQS+GRYWP YKA  G+CG C+YAG ++EKKCL
Sbjct  629   TSFDAPAGYAPLALDMGSMGKGQIWINGQSLGRYWPAYKAQ-GSCGGCDYAGTYNEKKCL  687

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             S CG+ASQRWYHVP+SWL+PTGNLLV FEEWGG+P GV LV+R+V +VCADIYEWQP LM
Sbjct  688   SNCGDASQRWYHVPKSWLKPTGNLLVVFEEWGGDPNGVFLVRRDVDTVCADIYEWQPTLM  747

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW+MQ+SGK  +PLRPKAHLSCGAGQKI+ IKFASFGTP G+CGSF EG+CHA HSYD F
Sbjct  748   NWQMQSSGKVDKPLRPKAHLSCGAGQKISKIKFASFGTPEGACGSFREGSCHAHHSYDAF  807

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             ++ C+G NSC+V V  E FGGDPCPSVMKKLSVE +C+
Sbjct  808   ERLCVGQNSCSVTVAAEMFGGDPCPSVMKKLSVEAICT  845



>ref|XP_010262132.1| PREDICTED: beta-galactosidase isoform X2 [Nelumbo nucifera]
Length=842

 Score =  1381 bits (3574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/816 (81%), Positives = 736/816 (90%), Gaps = 2/816 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASV+YD+ + +ING+R+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYVFWNGHE
Sbjct  29    TASVTYDQKAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  88

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEGRYDLV+FIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFRTD
Sbjct  89    PSPGKYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTD  148

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             N PFKAAMQ FT  IV+MMK++RL++SQGGPIILSQIENEYGP+E+E+GAPG++Y +WAA
Sbjct  149   NQPFKAAMQGFTKKIVDMMKAERLFQSQGGPIILSQIENEYGPVEWEIGAPGRAYTKWAA  208

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             +MAVGLGTGVPWVMCKQDDAPDPV+NACNGFYCDWF+PNKAYKPKMWTEAWT W+TEFGG
Sbjct  209   QMAVGLGTGVPWVMCKQDDAPDPVINACNGFYCDWFTPNKAYKPKMWTEAWTGWYTEFGG  268

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVP+RPAEDLA++VAKFI KGGSF+NYYM+HGGTNFGRTAGGPFI+TSYDYDAP+DE+GL
Sbjct  269   PVPHRPAEDLAFSVAKFIQKGGSFVNYYMYHGGTNFGRTAGGPFISTSYDYDAPLDEYGL  328

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
             LREPK+GHL+DLH+AIKLCEPALVS DP VISLGN QEA VFKS+SGACAAFLAN +  S
Sbjct  329   LREPKYGHLRDLHKAIKLCEPALVSTDPTVISLGNNQEAHVFKSRSGACAAFLANYDSRS  388

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETS  1664
             +A VAFGNMHYNLPPWSISILPDCKNTV+NTARVGAQSS+MKMTPV RGFSWQSYNEET+
Sbjct  389   YATVAFGNMHYNLPPWSISILPDCKNTVFNTARVGAQSSQMKMTPVYRGFSWQSYNEETA  448

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             SYDDN+FT  GLLEQIN TRDASDYLWYMTDV+IDP EAFL+ G++P LTV SAGHALHV
Sbjct  449   SYDDNSFTTVGLLEQINVTRDASDYLWYMTDVKIDPNEAFLRNGQYPVLTVLSAGHALHV  508

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT YGSLENPK+TFS  V L AG+NKISLLSIAVGLPNVGPHFETWNAGVLGP
Sbjct  509   FINGQLSGTVYGSLENPKLTFSDKVKLIAGINKISLLSIAVGLPNVGPHFETWNAGVLGP  568

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             ++L GLNEG+RDL+WQKWSYKIGLKGE + + SLSGSSSVEW   S +AQKQP+TWYKTT
Sbjct  569   ITLKGLNEGQRDLSWQKWSYKIGLKGETVGIQSLSGSSSVEWEVSS-VAQKQPMTWYKTT  627

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F+AP GNEPLALDM +MGKGQIWING+S+GRYWP YKA  G+CG CNYAG +DEKKC S 
Sbjct  628   FNAPGGNEPLALDMGSMGKGQIWINGESIGRYWPAYKAY-GSCGGCNYAGTYDEKKCRSN  686

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CGEASQRWYHVPRSWLRPTGN LV FEEWGG P  +SL KR V SVCADIYEWQP L NW
Sbjct  687   CGEASQRWYHVPRSWLRPTGNQLVIFEEWGGYPNWISLDKRTVQSVCADIYEWQPTLTNW  746

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             E+Q+SGK  RPLRPKAHL C  G KI+SIKFASFGTP+G CGSF EG+CHA  SYD FQ+
Sbjct  747   ELQSSGKVQRPLRPKAHLWCSPGTKISSIKFASFGTPQGVCGSFQEGSCHAHKSYDAFQR  806

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CIG  +C+V V PE FGGDPCPS MKKLSVE +CS
Sbjct  807   NCIGQQTCSVTVAPEVFGGDPCPSTMKKLSVEAICS  842



>gb|ABV32545.1| beta-galactosidase protein 2 [Prunus persica]
Length=841

 Score =  1380 bits (3573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/845 (79%), Positives = 754/845 (89%), Gaps = 6/845 (1%)
 Frame = -2

Query  3004  MGWKHEMWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPE  2825
             MG +  MW+V+V+L+V+    SWV    ASVSYD  + +INGQR+IL+SGSIHYPRS+PE
Sbjct  1     MGLRLVMWNVLVLLVVL---CSWVGSAKASVSYDSKAIVINGQRRILISGSIHYPRSSPE  57

Query  2824  MWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVG  2645
             MWPDL++KAKEGGLDV+QTYVFWNGHEP PGKYYFE  YDLVKFIKL QQAGLYVHLR+G
Sbjct  58    MWPDLIQKAKEGGLDVIQTYVFWNGHEPSPGKYYFEDNYDLVKFIKLIQQAGLYVHLRIG  117

Query  2644  PYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPII  2465
             PY CAEWNFGGFPVWLKY+PG+ FRTDNGPFKA MQ+FTT IVNMMK++RL++SQGGPII
Sbjct  118   PYVCAEWNFGGFPVWLKYIPGIQFRTDNGPFKAQMQRFTTKIVNMMKAERLFQSQGGPII  177

Query  2464  LSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYC  2285
             LSQIENEYGPMEYELGAPGK Y  WAA MA+GLGTGVPWVMCKQDDAPDP++NACNGFYC
Sbjct  178   LSQIENEYGPMEYELGAPGKVYTDWAAHMALGLGTGVPWVMCKQDDAPDPIINACNGFYC  237

Query  2284  DWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGG  2105
             D+FSPNKAYKPKMWTEAWT W+TEFGG VP RPAEDLA++VA+FI KGGSFINYYM+HGG
Sbjct  238   DYFSPNKAYKPKMWTEAWTGWYTEFGGAVPSRPAEDLAFSVARFIQKGGSFINYYMYHGG  297

Query  2104  TNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISL  1925
             TNFGRTAGGPFIATSYDYDAP+DE+GLLR+PKWGHLKDLHRAIKLCEPALVS DP V  L
Sbjct  298   TNFGRTAGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSADPTVTPL  357

Query  1924  GNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR  1745
             G YQEA VFKSKSGACAAFLAN N  SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR
Sbjct  358   GTYQEAHVFKSKSGACAAFLANYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR  417

Query  1744  VGAQSSRMKM--TPVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTD  1571
             VGAQS++MKM   P+   FSWQ+YN+ET++Y D +FT  GLLEQINTTRD+SDYLWY+TD
Sbjct  418   VGAQSAQMKMPRVPLHGAFSWQAYNDETATYADTSFTTAGLLEQINTTRDSSDYLWYLTD  477

Query  1570  VRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGV  1391
             V+IDP E FL+ GK+P LT+ SAGHAL VFINGQL GTSYGSLE PK+TFS+ V LRAG+
Sbjct  478   VKIDPNEEFLRSGKYPVLTILSAGHALRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAGI  537

Query  1390  NKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlsl  1211
             N+I+LLSIAVGLPNVGPHFETWNAGVLGPV L+GLNEG+RDL+WQKWSYK+GLKGE LSL
Sbjct  538   NQIALLSIAVGLPNVGPHFETWNAGVLGPVILNGLNEGRRDLSWQKWSYKVGLKGEALSL  597

Query  1210  hslsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGR  1031
             HSLSGSSSVEW++GS + ++QPLTWYKTTF+APAGN PLALDM +MGKGQ+WING+S+GR
Sbjct  598   HSLSGSSSVEWIQGSLVTRRQPLTWYKTTFNAPAGNSPLALDMGSMGKGQVWINGRSIGR  657

Query  1030  YWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGG  851
             YWP YKAS G+CGACNYAG + EKKCLS CGEASQRWYHVPR+WL PTGNLLV  EEWGG
Sbjct  658   YWPAYKAS-GSCGACNYAGSYHEKKCLSNCGEASQRWYHVPRTWLNPTGNLLVVLEEWGG  716

Query  850   NPYGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKF  671
             +P G+ LV+RE+ S+CADIYEWQP LM+W+MQASGK  +P+RPKAHLSCG GQKI+SIKF
Sbjct  717   DPNGIFLVRREIDSICADIYEWQPNLMSWQMQASGKVKKPVRPKAHLSCGPGQKISSIKF  776

Query  670   ASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSV  491
             ASFGTP G CGSF EG+CHA +SYD FQ+ CIG NSC+V V PE FGGDPCP+VMKKLSV
Sbjct  777   ASFGTPEGGCGSFREGSCHAHNSYDAFQRSCIGQNSCSVTVAPENFGGDPCPNVMKKLSV  836

Query  490   EVVCS  476
             E +CS
Sbjct  837   EAICS  841



>ref|XP_008228300.1| PREDICTED: beta-galactosidase 1 [Prunus mume]
Length=841

 Score =  1380 bits (3571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/824 (80%), Positives = 739/824 (90%), Gaps = 3/824 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV    ASVSYD  + +INGQR+IL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYV
Sbjct  19    SWVGSAKASVSYDSKAIVINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  78

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP PGKYYFE  YDLVK+IKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKY+PG
Sbjct  79    FWNGHEPSPGKYYFEDNYDLVKYIKLIQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  138

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             + FRTDNGPFKA MQ+FTT IVNMMK++RL++SQGGPIILSQIENEYGPMEYELGAPGK 
Sbjct  139   IQFRTDNGPFKAQMQRFTTKIVNMMKAERLFQSQGGPIILSQIENEYGPMEYELGAPGKV  198

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y  WAA MA+GLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT W
Sbjct  199   YTDWAAHMALGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGW  258

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             +TEFGG VP RPAEDLA++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  259   YTEFGGAVPSRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  318

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCEPALVS DP V  LG Y EA VFKSKSGACAAFLA
Sbjct  319   LDEYGLLRQPKWGHLKDLHRAIKLCEPALVSADPTVTPLGTYGEAHVFKSKSGACAAFLA  378

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSW  1688
             N N  SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQS+RMKM   P+   FSW
Sbjct  379   NYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMPRVPLHGAFSW  438

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             Q+YN+ET++Y D +FT  GLLEQINTTRD+SDYLWY+TDV+IDP E FL+ GK+P LT+ 
Sbjct  439   QAYNDETATYADTSFTTAGLLEQINTTRDSSDYLWYLTDVKIDPNEEFLRSGKYPVLTIL  498

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHAL VFINGQL GTSYGSLE PK+TFS+ V LRAG+N+I+LLSIAVGLPNVGPHFET
Sbjct  499   SAGHALRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAGINQIALLSIAVGLPNVGPHFET  558

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGPV L+GLNEG+RDL+WQKWSYK+GLKGE LSLHSLSGSSSVEW++GS + ++Q
Sbjct  559   WNAGVLGPVILNGLNEGRRDLSWQKWSYKVGLKGEALSLHSLSGSSSVEWIQGSLVTRRQ  618

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYKTTF+APAGN PLALDM +MGKGQ+WING+S+GRYWP YKAS G+CGACNYAG +
Sbjct  619   PLTWYKTTFNAPAGNSPLALDMGSMGKGQVWINGRSIGRYWPAYKAS-GSCGACNYAGTY  677

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
              EKKCLS CGEASQRWYHVPR+WL PTGNLLV  EEWGG+P G+ LV+RE+ S+CADIYE
Sbjct  678   HEKKCLSNCGEASQRWYHVPRTWLNPTGNLLVVLEEWGGDPNGIFLVRREIDSICADIYE  737

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP LM+W+MQASGK  +P+RPKAHLSCG GQKI+SIKFASFGTP G CGSF EG+CHA 
Sbjct  738   WQPNLMSWQMQASGKVKKPVRPKAHLSCGPGQKISSIKFASFGTPEGGCGSFREGSCHAH  797

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +SYD FQ+ CIG NSC+V V PE FGGDPCP+VMKKLSVE +CS
Sbjct  798   NSYDAFQRSCIGQNSCSVTVAPENFGGDPCPNVMKKLSVEAICS  841



>emb|CAC44500.1| beta-galactosidase [Fragaria x ananassa]
Length=843

 Score =  1379 bits (3568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/845 (79%), Positives = 748/845 (89%), Gaps = 4/845 (0%)
 Frame = -2

Query  3004  MGWKHEMWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPE  2825
             MG +  MW+V+V   +V+L + + S+  ASVSYD  + +INGQR+IL+SGSIHYPRSTPE
Sbjct  1     MGLRLVMWNVVVAAALVVLCSCFASV-RASVSYDSKAIVINGQRRILISGSIHYPRSTPE  59

Query  2824  MWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVG  2645
             MWPDL+++AK+GGLDV+QTYVFWNGHEP PGKYYFE  YDLVKFIKL QQAGLYVHLR+G
Sbjct  60    MWPDLIQRAKDGGLDVIQTYVFWNGHEPSPGKYYFEDNYDLVKFIKLVQQAGLYVHLRIG  119

Query  2644  PYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPII  2465
             PY CAEWNFGGFPVWLKYVPG+ FRTDNGPFK  MQ+FTT IVNMMK++RL+ES GGPII
Sbjct  120   PYVCAEWNFGGFPVWLKYVPGIQFRTDNGPFKDQMQRFTTKIVNMMKAERLFESHGGPII  179

Query  2464  LSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYC  2285
             LSQIENEYGPMEYE+GAPGK+Y  WAA+MAVGLGTGVPWVMCKQDDAPDPV+NACNGFYC
Sbjct  180   LSQIENEYGPMEYEIGAPGKAYTDWAAQMAVGLGTGVPWVMCKQDDAPDPVINACNGFYC  239

Query  2284  DWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGG  2105
             D+FSPNKAYKPKMWTEAWT WFTEFGG VPYRPAEDLA++VAKF+ KGG+FINYYM+HGG
Sbjct  240   DYFSPNKAYKPKMWTEAWTGWFTEFGGAVPYRPAEDLAFSVAKFLQKGGAFINYYMYHGG  299

Query  2104  TNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISL  1925
             TNFGRTAGGPFIATSYDYDAP+DE+GLLR+PKWGHLKDLHRAIKLCEPALVS DP V  L
Sbjct  300   TNFGRTAGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSSDPTVTPL  359

Query  1924  GNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR  1745
             G YQEA VFKS SGACAAFLAN N+ SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR
Sbjct  360   GTYQEAHVFKSNSGACAAFLANYNRKSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR  419

Query  1744  VGAQSSRMKM--TPVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTD  1571
             +GAQ++RMKM   P+  GFSWQ+YN+ET++Y D +FT  GLLEQIN TRDA+DYLWYMTD
Sbjct  420   IGAQTARMKMPRVPIHGGFSWQAYNDETATYSDTSFTTAGLLEQINITRDATDYLWYMTD  479

Query  1570  VRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGV  1391
             V+IDP E FL+ G +P LTV SAGHAL VFINGQL GT+YGSLE PK+TF + V LRAG+
Sbjct  480   VKIDPSEDFLRSGNYPVLTVLSAGHALRVFINGQLAGTAYGSLETPKLTFKQGVNLRAGI  539

Query  1390  NKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlsl  1211
             N+I+LLSIAVGLPNVGPHFETWNAG+LGPV L+GLNEG+RDL+WQKWSYKIGLKGE LSL
Sbjct  540   NQIALLSIAVGLPNVGPHFETWNAGILGPVILNGLNEGRRDLSWQKWSYKIGLKGEALSL  599

Query  1210  hslsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGR  1031
             HSL+GSSSVEW EGSF+AQ+QPLTWYKTTF+ PAGN PLALDM +MGKGQ+WIN +S+GR
Sbjct  600   HSLTGSSSVEWTEGSFVAQRQPLTWYKTTFNRPAGNSPLALDMGSMGKGQVWINDRSIGR  659

Query  1030  YWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGG  851
             YWP YKAS G CG CNYAG F EKKCLS CGEASQRWYHVPRSWL PTGNLLV  EEWGG
Sbjct  660   YWPAYKAS-GTCGECNYAGTFSEKKCLSNCGEASQRWYHVPRSWLNPTGNLLVVLEEWGG  718

Query  850   NPYGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKF  671
             +P G+ LV+REV SVCADIYEWQP LM+W+MQ SG+  +PLRPKAHLSCG GQKI+SIKF
Sbjct  719   DPNGIFLVRREVDSVCADIYEWQPNLMSWQMQVSGRVNKPLRPKAHLSCGPGQKISSIKF  778

Query  670   ASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSV  491
             ASFGTP G CGSF EG CHA  SY+ F++ CIG NSC+V V+PE FGGDPCP+VMKKLSV
Sbjct  779   ASFGTPEGVCGSFREGGCHAHKSYNAFERSCIGQNSCSVTVSPENFGGDPCPNVMKKLSV  838

Query  490   EVVCS  476
             E +CS
Sbjct  839   EAICS  843



>ref|XP_007217146.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
 gb|EMJ18345.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
Length=841

 Score =  1378 bits (3566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/845 (79%), Positives = 753/845 (89%), Gaps = 6/845 (1%)
 Frame = -2

Query  3004  MGWKHEMWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPE  2825
             MG +  MW+V+V+L+V+    SWV    ASVSYD  + +INGQR+IL+SGSIHYPRS+PE
Sbjct  1     MGLRLVMWNVLVLLVVL---CSWVGSAKASVSYDSKAIVINGQRRILISGSIHYPRSSPE  57

Query  2824  MWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVG  2645
             MWPDL++KAKEGGLDV+QTYVFWNGHEP PGKYYFE  YDLVKFIKL QQAGLYVHLR+G
Sbjct  58    MWPDLIQKAKEGGLDVIQTYVFWNGHEPSPGKYYFEDNYDLVKFIKLIQQAGLYVHLRIG  117

Query  2644  PYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPII  2465
             PY CAEWNFGGFPVWLKY+PG+ FRTDNGPFKA MQ+FTT IVN MK++RL++SQGGPII
Sbjct  118   PYVCAEWNFGGFPVWLKYIPGIQFRTDNGPFKAQMQRFTTKIVNTMKAERLFQSQGGPII  177

Query  2464  LSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYC  2285
             LSQIENEYGPMEYELGAPGK Y  WAA MA+GLGTGVPWVMCKQDDAPDP++NACNGFYC
Sbjct  178   LSQIENEYGPMEYELGAPGKVYTDWAAHMALGLGTGVPWVMCKQDDAPDPIINACNGFYC  237

Query  2284  DWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGG  2105
             D+FSPNKAYKPKMWTEAWT W+TEFGG VP RPAEDLA++VA+FI KGGSFINYYM+HGG
Sbjct  238   DYFSPNKAYKPKMWTEAWTGWYTEFGGAVPSRPAEDLAFSVARFIQKGGSFINYYMYHGG  297

Query  2104  TNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISL  1925
             TNFGRTAGGPFIATSYDYDAP+DE+GLLR+PKWGHLKDLHRAIKLCEPALVS DP V  L
Sbjct  298   TNFGRTAGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSADPTVTPL  357

Query  1924  GNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR  1745
             G YQEA VFKSKSGACAAFLAN N  SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR
Sbjct  358   GTYQEAHVFKSKSGACAAFLANYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR  417

Query  1744  VGAQSSRMKM--TPVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTD  1571
             VGAQS++MKM   P+   FSWQ+YN+ET++Y D +FT  GLLEQINTTRD+SDYLWY+TD
Sbjct  418   VGAQSAQMKMPRVPLHGAFSWQAYNDETATYADTSFTTAGLLEQINTTRDSSDYLWYLTD  477

Query  1570  VRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGV  1391
             V+IDP E FL+ GK+P LT+ SAGHAL VFINGQL GTSYGSLE PK+TFS+ V LRAG+
Sbjct  478   VKIDPNEEFLRSGKYPVLTILSAGHALRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAGI  537

Query  1390  NKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlsl  1211
             N+I+LLSIAVGLPNVGPHFETWNAGVLGPV L+GLNEG+RDL+WQKWSYK+GLKGE LSL
Sbjct  538   NQIALLSIAVGLPNVGPHFETWNAGVLGPVILNGLNEGRRDLSWQKWSYKVGLKGEALSL  597

Query  1210  hslsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGR  1031
             HSLSGSSSVEW++GS + ++QPLTWYKTTF+APAGN PLALDM +MGKGQ+WING+S+GR
Sbjct  598   HSLSGSSSVEWIQGSLVTRRQPLTWYKTTFNAPAGNSPLALDMGSMGKGQVWINGRSIGR  657

Query  1030  YWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGG  851
             YWP YKAS G+CGACNYAG + EKKCLS CGEASQRWYHVPR+WL PTGNLLV  EEWGG
Sbjct  658   YWPAYKAS-GSCGACNYAGTYHEKKCLSNCGEASQRWYHVPRTWLNPTGNLLVVLEEWGG  716

Query  850   NPYGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKF  671
             +P G+ LV+RE+ S+CADIYEWQP LM+W+MQASGK  +P+RPKAHLSCG GQKI+SIKF
Sbjct  717   DPNGIFLVRREIDSICADIYEWQPNLMSWQMQASGKVKKPVRPKAHLSCGPGQKISSIKF  776

Query  670   ASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSV  491
             ASFGTP G CGSF EG+CHA +SYD FQ+ CIG NSC+V V PE FGGDPCP+VMKKLSV
Sbjct  777   ASFGTPEGGCGSFREGSCHAHNSYDAFQRSCIGQNSCSVTVAPENFGGDPCPNVMKKLSV  836

Query  490   EVVCS  476
             E +CS
Sbjct  837   EAICS  841



>ref|XP_010033786.1| PREDICTED: beta-galactosidase 1-like [Eucalyptus grandis]
 gb|KCW53599.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
 gb|KCW53600.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=844

 Score =  1377 bits (3565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 661/818 (81%), Positives = 740/818 (90%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASVSYD  +  INGQR+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  28    TASVSYDAKAITINGQRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHE  87

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKY FEG YD+VKF+KLAQQAGLYVHLRVGPY CAEWNFGGFPVWLKYV G+SFRTD
Sbjct  88    PSPGKYNFEGNYDIVKFVKLAQQAGLYVHLRVGPYVCAEWNFGGFPVWLKYVRGISFRTD  147

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFK  MQKFTT IVNMMK++ L+ESQGGPIILSQIENEYGPMEYE+GA G++Y +WAA
Sbjct  148   NGPFKYYMQKFTTKIVNMMKAEWLFESQGGPIILSQIENEYGPMEYEIGASGRAYTKWAA  207

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             +MAVGLGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W+TEFGG
Sbjct  208   EMAVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  267

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVP RP EDLA++VA+FI KGG+FINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  268   PVPNRPVEDLAFSVARFIKKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  327

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
             LR+PKWGHLKDLHRAIKLCEPALVSG+P V  LGNY+EA VF+SKSGACAAFL+N + ++
Sbjct  328   LRQPKWGHLKDLHRAIKLCEPALVSGNPTVTKLGNYEEAHVFRSKSGACAAFLSNYHSNA  387

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSWQSYNEE  1670
             FAKV++GNMHYNLPPWSISILPDCKNTVYNTARVGAQS+RMKMTPV    GFSWQ+YNEE
Sbjct  388   FAKVSWGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPVPIHGGFSWQAYNEE  447

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              + Y+DN+FT  GLLEQINTTRD SDYLWY+TDV I+ +E FL+ GK+P LTV SAGHAL
Sbjct  448   PAGYEDNSFTMAGLLEQINTTRDVSDYLWYITDVYINSKEGFLRSGKYPTLTVQSAGHAL  507

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVF+NGQ  GT+YGSLE PK+TF++ V LRAG N+I+LLSIAVGLPNVGPHFE WNAGVL
Sbjct  508   HVFVNGQASGTAYGSLEFPKLTFNQGVKLRAGSNRIALLSIAVGLPNVGPHFERWNAGVL  567

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPV+L GL+EGKRDL+ QKWSYK+GLKGE L+LHSL+GSSSVEW EGS +A+KQPLTW+K
Sbjct  568   GPVTLYGLDEGKRDLSRQKWSYKVGLKGEALNLHSLTGSSSVEWAEGSLVARKQPLTWFK  627

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF APAGN PLALDMN+MGKGQIWINGQS+GRYWP YKAS G CG CNYAG + EKKCL
Sbjct  628   TTFSAPAGNTPLALDMNSMGKGQIWINGQSIGRYWPAYKAS-GTCGGCNYAGTYGEKKCL  686

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             S CGEASQRWYHVPRSWL PTGNLLV FEEWGG+P G+SLV+R+V SVCADIYEWQP LM
Sbjct  687   SNCGEASQRWYHVPRSWLNPTGNLLVVFEEWGGDPNGISLVRRDVDSVCADIYEWQPTLM  746

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N++MQASGK  +PLRPKAHLSC  GQKI+SIKFASFGTP G CGSF EG+CHAFHSYD+F
Sbjct  747   NYQMQASGKVNKPLRPKAHLSCSPGQKISSIKFASFGTPEGICGSFREGSCHAFHSYDVF  806

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             QK C+G NSCTVPVTPE FGGDPCPSVMKKLSVE +CS
Sbjct  807   QKTCVGQNSCTVPVTPEIFGGDPCPSVMKKLSVEAICS  844



>ref|XP_002527409.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF34975.1| beta-galactosidase, putative [Ricinus communis]
Length=845

 Score =  1376 bits (3562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 661/823 (80%), Positives = 741/823 (90%), Gaps = 3/823 (0%)
 Frame = -2

Query  2938  WVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVF  2759
             WV   ++SVSYD  +  INGQR+IL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYVF
Sbjct  24    WVCSVSSSVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVF  83

Query  2758  WNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGV  2579
             WNGHEP PGKYYFEG YDLVKFIKL +QAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG+
Sbjct  84    WNGHEPSPGKYYFEGNYDLVKFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGI  143

Query  2578  SFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSY  2399
             +FRTDNGPFKA MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG++Y
Sbjct  144   NFRTDNGPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGQAY  203

Query  2398  AQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWF  2219
             ++WAAKMAVGLGTGVPWVMCKQDDAPDPV+N CNGFYCD+FSPNK YKPKMWTEAWT WF
Sbjct  204   SKWAAKMAVGLGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKPYKPKMWTEAWTGWF  263

Query  2218  TEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPI  2039
             TEFGG VPYRPAEDLA++VA+FI KGG+FINYYM+HGGTNFGRTAGGPFIATSYDYDAP+
Sbjct  264   TEFGGAVPYRPAEDLAFSVARFIQKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAPL  323

Query  2038  DEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLAN  1859
             DE+GLLR+PKWGHLKDLHRAIKLCEPALVSG P+V+ LGNYQEA VFKSKSGACAAFLAN
Sbjct  324   DEYGLLRQPKWGHLKDLHRAIKLCEPALVSGAPSVMPLGNYQEAHVFKSKSGACAAFLAN  383

Query  1858  NNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSR--GFSWQ  1685
              NQ SFAKV+FGNMHYNLPPWSISILPDCKNTVYNTAR+GAQS+RMKM+P+    GFSWQ
Sbjct  384   YNQRSFAKVSFGNMHYNLPPWSISILPDCKNTVYNTARIGAQSARMKMSPIPMRGGFSWQ  443

Query  1684  SYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             +Y+EE S+  DNTF   GLLEQINTTRD SDYLWY TDVRID  E FL+ GK+P LTV S
Sbjct  444   AYSEEASTEGDNTFMMVGLLEQINTTRDVSDYLWYSTDVRIDSNEGFLRSGKYPVLTVLS  503

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AGHALHVF+NGQL GT+YGSLE+PK+TFS+ V +RAG+N+I LLSIAVGLPNVGPHFETW
Sbjct  504   AGHALHVFVNGQLSGTAYGSLESPKLTFSQGVKMRAGINRIYLLSIAVGLPNVGPHFETW  563

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQP  1145
             NAGVLGPV+L+GLNEG+RDL+WQKW+YKIGL GE LSLHSLSGSSSVEW +GSF+++KQP
Sbjct  564   NAGVLGPVTLNGLNEGRRDLSWQKWTYKIGLHGEALSLHSLSGSSSVEWAQGSFVSRKQP  623

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             L WYKTTF+APAGN PLALDM +MGKGQ+WINGQSVGRYWP YKASG  CG CNYAG F+
Sbjct  624   LMWYKTTFNAPAGNSPLALDMGSMGKGQVWINGQSVGRYWPAYKASGN-CGVCNYAGTFN  682

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
             EKKCL+ CGEASQRWYHVPRSWL   GNLLV FEEWGG+P G+SLV+REV SVCADIYEW
Sbjct  683   EKKCLTNCGEASQRWYHVPRSWLNTAGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEW  742

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
             QP LMN+ MQ+SGK  +PLRPK HL CGAGQKI+ IKFASFGTP G CGS+ +G+CHAFH
Sbjct  743   QPTLMNYMMQSSGKVNKPLRPKVHLQCGAGQKISLIKFASFGTPEGVCGSYRQGSCHAFH  802

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SYD F + C+G N C+V V PE FGGDPCP+VMKKL+VE VCS
Sbjct  803   SYDAFNRLCVGQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCS  845



>ref|XP_010262131.1| PREDICTED: beta-galactosidase isoform X1 [Nelumbo nucifera]
Length=847

 Score =  1375 bits (3559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/821 (80%), Positives = 736/821 (90%), Gaps = 7/821 (1%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASV+YD+ + +ING+R+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYVFWNGHE
Sbjct  29    TASVTYDQKAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  88

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEGRYDLV+FIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFRTD
Sbjct  89    PSPGKYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTD  148

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             N PFKAAMQ FT  IV+MMK++RL++SQGGPIILSQIENEYGP+E+E+GAPG++Y +WAA
Sbjct  149   NQPFKAAMQGFTKKIVDMMKAERLFQSQGGPIILSQIENEYGPVEWEIGAPGRAYTKWAA  208

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             +MAVGLGTGVPWVMCKQDDAPDPV+NACNGFYCDWF+PNKAYKPKMWTEAWT W+TEFGG
Sbjct  209   QMAVGLGTGVPWVMCKQDDAPDPVINACNGFYCDWFTPNKAYKPKMWTEAWTGWYTEFGG  268

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVP+RPAEDLA++VAKFI KGGSF+NYYM+HGGTNFGRTAGGPFI+TSYDYDAP+DE+GL
Sbjct  269   PVPHRPAEDLAFSVAKFIQKGGSFVNYYMYHGGTNFGRTAGGPFISTSYDYDAPLDEYGL  328

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
             LREPK+GHL+DLH+AIKLCEPALVS DP VISLGN QEA VFKS+SGACAAFLAN +  S
Sbjct  329   LREPKYGHLRDLHKAIKLCEPALVSTDPTVISLGNNQEAHVFKSRSGACAAFLANYDSRS  388

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETS  1664
             +A VAFGNMHYNLPPWSISILPDCKNTV+NTARVGAQSS+MKMTPV RGFSWQSYNEET+
Sbjct  389   YATVAFGNMHYNLPPWSISILPDCKNTVFNTARVGAQSSQMKMTPVYRGFSWQSYNEETA  448

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             SYDDN+FT  GLLEQIN TRDASDYLWYMTDV+IDP EAFL+ G++P LTV SAGHALHV
Sbjct  449   SYDDNSFTTVGLLEQINVTRDASDYLWYMTDVKIDPNEAFLRNGQYPVLTVLSAGHALHV  508

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT YGSLENPK+TFS  V L AG+NKISLLSIAVGLPNVGPHFETWNAGVLGP
Sbjct  509   FINGQLSGTVYGSLENPKLTFSDKVKLIAGINKISLLSIAVGLPNVGPHFETWNAGVLGP  568

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             ++L GLNEG+RDL+WQKWSYKIGLKGE + + SLSGSSSVEW   S +AQKQP+TWYKTT
Sbjct  569   ITLKGLNEGQRDLSWQKWSYKIGLKGETVGIQSLSGSSSVEWEVSS-VAQKQPMTWYKTT  627

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F+AP GNEPLALDM +MGKGQIWING+S+GRYWP YKA  G+CG CNYAG +DEKKC S 
Sbjct  628   FNAPGGNEPLALDMGSMGKGQIWINGESIGRYWPAYKAY-GSCGGCNYAGTYDEKKCRSN  686

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CGEASQRWYHVPRSWLRPTGN LV FEEWGG P  +SL KR V SVCADIYEWQP L NW
Sbjct  687   CGEASQRWYHVPRSWLRPTGNQLVIFEEWGGYPNWISLDKRTVQSVCADIYEWQPTLTNW  746

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             E+Q+SGK  RPLRPKAHL C  G KI+SIKFASFGTP+G CGSF EG+CHA  SYD FQ+
Sbjct  747   ELQSSGKVQRPLRPKAHLWCSPGTKISSIKFASFGTPQGVCGSFQEGSCHAHKSYDAFQR  806

Query  583   Y-----CIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
                   CIG  +C+V V PE FGGDPCPS MKKLSVE +CS
Sbjct  807   EDLLQNCIGQQTCSVTVAPEVFGGDPCPSTMKKLSVEAICS  847



>gb|ABK96254.1| unknown [Populus trichocarpa x Populus deltoides]
Length=846

 Score =  1372 bits (3551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 653/818 (80%), Positives = 736/818 (90%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASVSYD  +  INGQR+IL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  30    TASVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  89

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEG YDLVKF+KLA++AGLYVHLR+GPY CAEWNFGGFPVWLKY+PG++FRTD
Sbjct  90    PSPGKYYFEGNYDLVKFVKLAKEAGLYVHLRIGPYICAEWNFGGFPVWLKYIPGINFRTD  149

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKA MQKFTT IVNMMK++RL+E+QGGPIILSQIENEYGPMEYE+G+PGK+Y +WAA
Sbjct  150   NGPFKAQMQKFTTKIVNMMKAERLFETQGGPIILSQIENEYGPMEYEIGSPGKAYTKWAA  209

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             +MAVGL TGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG
Sbjct  210   EMAVGLRTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGG  269

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVP+RPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  270   PVPHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
             LR+PKWGHLKDLHRAIKLCEPALVSGD  VI LGNYQEA VF  K+G CAAFLAN +Q S
Sbjct  330   LRQPKWGHLKDLHRAIKLCEPALVSGDATVIPLGNYQEAHVFNYKAGGCAAFLANYHQRS  389

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSR--GFSWQSYNEE  1670
             FAKV+F NMHYNLPPWSISILPDCKNTVYNTARVGAQS+RMKMTPV    GFSWQ+YNEE
Sbjct  390   FAKVSFRNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPVPMHGGFSWQAYNEE  449

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+  D+TFT  GLLEQINTTRD SDYLWYMTDV IDP E FL+ GK+P L V SAGHAL
Sbjct  450   PSASGDSTFTMVGLLEQINTTRDVSDYLWYMTDVHIDPSEGFLRSGKYPVLGVLSAGHAL  509

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQL GT+YGSL+ PK+TF++ V LRAGVNKISLLSIAVGLPNVGPHFETWNAG+L
Sbjct  510   HVFINGQLSGTAYGSLDFPKLTFTQGVKLRAGVNKISLLSIAVGLPNVGPHFETWNAGIL  569

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPV+L+GLNEG+RDL+WQKWSYKIGL GE L LHS+SGSSSVEW EGS +AQ+QPL+WYK
Sbjct  570   GPVTLNGLNEGRRDLSWQKWSYKIGLHGEALGLHSISGSSSVEWAEGSLVAQRQPLSWYK  629

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF+APAGN PLALDM +MGKGQIWINGQ VGR+WP YKAS G CG C+Y G ++EKKC 
Sbjct  630   TTFNAPAGNSPLALDMGSMGKGQIWINGQHVGRHWPAYKAS-GTCGDCSYIGTYNEKKCS  688

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             + CGEASQRWYHVP+SWL+PTGNLLV FEEWGG+P G+SLV+R+V SVCADIYEWQP LM
Sbjct  689   TNCGEASQRWYHVPQSWLKPTGNLLVVFEEWGGDPNGISLVRRDVDSVCADIYEWQPTLM  748

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N++MQASGK  +PLRPKAHLSCG GQKI SIKFASFGTP G CGS+ +G+CHAFHSYD F
Sbjct  749   NYQMQASGKVNKPLRPKAHLSCGPGQKIRSIKFASFGTPEGVCGSYRQGSCHAFHSYDAF  808

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
                C+G NSC+V V PE FGGDPC +VMKKL+VE +CS
Sbjct  809   NNLCVGQNSCSVTVAPEMFGGDPCLNVMKKLAVEAICS  846



>ref|XP_009367552.1| PREDICTED: beta-galactosidase 1 [Pyrus x bretschneideri]
Length=843

 Score =  1371 bits (3549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/824 (80%), Positives = 737/824 (89%), Gaps = 3/824 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV    ASVSYD  + +INGQRKIL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYV
Sbjct  21    SWVGSVRASVSYDSKAIVINGQRKILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  80

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP PGKYYFE  YDLVKFIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKY+PG
Sbjct  81    FWNGHEPSPGKYYFEDNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  140

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             + FRTDNGPFK  MQ+FTT IVNMMK++RL+++QGGPII+SQIENEYGPMEYELGAPGK 
Sbjct  141   IQFRTDNGPFKNQMQRFTTKIVNMMKAERLFQTQGGPIIMSQIENEYGPMEYELGAPGKQ  200

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y  WAA+MA+GLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT W
Sbjct  201   YTDWAAQMALGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGW  260

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             +TEFGG VPYRPAEDLA++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  261   YTEFGGAVPYRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  320

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCEPALVS DP V SLG +QEA VFKS SGAC+AFLA
Sbjct  321   LDEYGLLRQPKWGHLKDLHRAIKLCEPALVSADPTVQSLGRFQEAHVFKSNSGACSAFLA  380

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSW  1688
             N N  SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQS+ MKM   P+  GFSW
Sbjct  381   NYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSALMKMPRVPLHGGFSW  440

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             QSY +E +SY D TFT  GLLEQINTTRD+SDYLWY+TDV IDP E FL+ GK+P LTV 
Sbjct  441   QSYPDEAASYGDTTFTTAGLLEQINTTRDSSDYLWYITDVNIDPNEEFLRSGKYPELTVL  500

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHAL VFINGQL GTSYGSLE PK+TFS+ V LRAG+N+I+LLSIAVGLPNVGPHFET
Sbjct  501   SAGHALRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAGINQIALLSIAVGLPNVGPHFET  560

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGPV L+GLNEG+RDL+WQKWSYK+GLKGE LSLHSLSGSSSVEW++GS++ +KQ
Sbjct  561   WNAGVLGPVILNGLNEGRRDLSWQKWSYKVGLKGEALSLHSLSGSSSVEWIQGSYVTRKQ  620

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTW+KTTF+ PAGN PLALDM +MGKGQ+WING+S+GRYWP Y ASG  CGACNYAG +
Sbjct  621   PLTWFKTTFNEPAGNSPLALDMISMGKGQVWINGRSIGRYWPAYTASGN-CGACNYAGTY  679

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             +EKKCLS CG+ASQRWYHVPRSWL PTGNLLV  EEWGG+P G+ LV+REV S+CADIYE
Sbjct  680   NEKKCLSNCGQASQRWYHVPRSWLNPTGNLLVVLEEWGGDPNGIFLVRREVDSICADIYE  739

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP LM+++MQASGK  +P+RPKAHLSCG GQKI+SIKFASFGTP G+CGSF EG CHA 
Sbjct  740   WQPNLMSYQMQASGKVKKPVRPKAHLSCGPGQKISSIKFASFGTPEGACGSFREGACHAH  799

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +SYD FQ+ CIG NSC+V V PE FGGDPCPSVMKKLSVE +CS
Sbjct  800   NSYDAFQRSCIGQNSCSVTVAPENFGGDPCPSVMKKLSVEAICS  843



>ref|XP_006385360.1| beta-galactosidase 1 family protein [Populus trichocarpa]
 gb|ERP63157.1| beta-galactosidase 1 family protein [Populus trichocarpa]
Length=846

 Score =  1371 bits (3548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/818 (80%), Positives = 736/818 (90%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASVSYD  +  INGQR+IL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  30    TASVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  89

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEG YDLVKF+KLA++AGLYVHLR+GPY CAEWNFGGFPVWLKY+PG++FRTD
Sbjct  90    PSPGKYYFEGNYDLVKFVKLAKEAGLYVHLRIGPYICAEWNFGGFPVWLKYIPGINFRTD  149

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKA MQKFTT +VNMMK++RL+E+QGGPIILSQIENEYGPMEYE+G+PGK+Y +WAA
Sbjct  150   NGPFKAQMQKFTTKVVNMMKAERLFETQGGPIILSQIENEYGPMEYEIGSPGKAYTKWAA  209

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             +MAVGL TGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG
Sbjct  210   EMAVGLRTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGG  269

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVP+RPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  270   PVPHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
             LR+PKWGHLKDLHRAIKLCEPALVSGD  VI LGNYQEA VF  K+G CAAFLAN +Q S
Sbjct  330   LRQPKWGHLKDLHRAIKLCEPALVSGDATVIPLGNYQEAHVFNYKAGGCAAFLANYHQRS  389

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSR--GFSWQSYNEE  1670
             FAKV+F NMHYNLPPWSISILPDCKNTVYNTARVGAQS+RMKMTPV    GFSWQ+YNEE
Sbjct  390   FAKVSFRNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPVPMHGGFSWQAYNEE  449

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+  D+TFT  GLLEQINTTRD SDYLWYMTDV IDP E FL+ GK+P L V SAGHAL
Sbjct  450   PSASGDSTFTMVGLLEQINTTRDVSDYLWYMTDVHIDPSEGFLRSGKYPVLGVLSAGHAL  509

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQL GT+YGSL+ PK+TF++ V LRAGVNKISLLSIAVGLPNVGPHFETWNAG+L
Sbjct  510   HVFINGQLSGTAYGSLDFPKLTFTQGVKLRAGVNKISLLSIAVGLPNVGPHFETWNAGIL  569

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPV+L+GLNEG+RDL+WQKWSYKIGL GE L LHS+SGSSSVEW EGS +AQ+QPL+WYK
Sbjct  570   GPVTLNGLNEGRRDLSWQKWSYKIGLHGEALGLHSISGSSSVEWAEGSLVAQRQPLSWYK  629

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF+APAGN PLALDM +MGKGQIWINGQ VGR+WP YKAS G CG C+Y G ++EKKC 
Sbjct  630   TTFNAPAGNSPLALDMGSMGKGQIWINGQHVGRHWPAYKAS-GTCGDCSYIGTYNEKKCS  688

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             + CGEASQRWYHVP+SWL+PTGNLLV FEEWGG+P G+SLV+R+V SVCADIYEWQP LM
Sbjct  689   TNCGEASQRWYHVPQSWLKPTGNLLVVFEEWGGDPNGISLVRRDVDSVCADIYEWQPTLM  748

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N++MQASGK  +PLRPKAHLSCG GQKI SIKFASFGTP G CGS+ +G+CHAFHSYD F
Sbjct  749   NYQMQASGKVNKPLRPKAHLSCGPGQKIRSIKFASFGTPEGVCGSYRQGSCHAFHSYDAF  808

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
                C+G NSC+V V PE FGGDPC +VMKKL+VE +CS
Sbjct  809   NNLCVGQNSCSVTVAPEMFGGDPCLNVMKKLAVEAICS  846



>ref|XP_007024475.1| Beta galactosidase 1 [Theobroma cacao]
 gb|EOY27097.1| Beta galactosidase 1 [Theobroma cacao]
Length=843

 Score =  1368 bits (3540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/824 (79%), Positives = 738/824 (90%), Gaps = 3/824 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV   +ASVSYD+ +  INGQR+IL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYV
Sbjct  21    SWVCSVSASVSYDRKAITINGQRRILISGSIHYPRSSPEMWPDLVQKAKEGGLDVIQTYV  80

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP PGKYYF+G YDLVKFIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKY+PG
Sbjct  81    FWNGHEPAPGKYYFQGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  140

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             ++FRT+NGPFKA MQ+FT  IV+MMK++RL+ESQGGPIILSQIENEYGPMEYELGAPGK+
Sbjct  141   INFRTNNGPFKAQMQRFTEKIVDMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGKA  200

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y  WAAKMAVGLGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPK+WTEAWT W
Sbjct  201   YTDWAAKMAVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKIWTEAWTGW  260

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             +TEFGG VPYRPAEDLA++VA+FI KGG+FINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  261   YTEFGGAVPYRPAEDLAFSVARFIQKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  320

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCEPALV+GDP V+ LGNYQEA VFK +SG CAAFLA
Sbjct  321   LDEYGLLRQPKWGHLKDLHRAIKLCEPALVNGDPTVMRLGNYQEAHVFKYQSGGCAAFLA  380

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSR--GFSW  1688
             N N  SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQ +R KM PV     FSW
Sbjct  381   NYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQIARKKMVPVPMHGAFSW  440

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             Q+Y+EET+S  D++FT  GLLEQINTT+DA+DYLWY TD++IDP E FLK G  P LT+ 
Sbjct  441   QAYSEETASDVDSSFTMVGLLEQINTTKDATDYLWYTTDIKIDPSEGFLKNGNSPVLTIL  500

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVF+NGQL G++YGSLE PK+TFS+ V LRAGVNKISLLSIAVGLPNVGPHFET
Sbjct  501   SAGHALHVFVNGQLSGSAYGSLEFPKLTFSQGVNLRAGVNKISLLSIAVGLPNVGPHFET  560

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAG+LGPV+L+GLNEG+RDL+WQKWSYKIGL+GE L+LHSLSGSSSVEW +GSF+A++Q
Sbjct  561   WNAGILGPVTLNGLNEGRRDLSWQKWSYKIGLEGEALNLHSLSGSSSVEWAQGSFVARRQ  620

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PL WYKTTF+APAGN PLALDM++MGKGQIWINGQS+GR+WP YKASG  CG CNYAG +
Sbjct  621   PLMWYKTTFNAPAGNAPLALDMHSMGKGQIWINGQSIGRHWPAYKASGN-CGDCNYAGTY  679

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             DEKKC + CGEASQ WYH+PRSWL PTGNLLV FEEWGG+P  +SLV+RE  SVCADIYE
Sbjct  680   DEKKCRTNCGEASQGWYHIPRSWLNPTGNLLVVFEEWGGDPNAISLVRRETDSVCADIYE  739

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP LMN++MQASGK  +PLRPK HL C AGQKI+++KFASFGTP G+CGS+ EG+CHA 
Sbjct  740   WQPTLMNYQMQASGKVNKPLRPKVHLECDAGQKISAVKFASFGTPEGACGSYREGSCHAH  799

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             HSYD F + C+G N C+V V PE FGGDPCPSVMKKLSVEV+CS
Sbjct  800   HSYDAFNRLCVGQNFCSVTVAPEMFGGDPCPSVMKKLSVEVICS  843



>ref|XP_008391326.1| PREDICTED: beta-galactosidase 1 [Malus domestica]
Length=843

 Score =  1367 bits (3537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/824 (80%), Positives = 735/824 (89%), Gaps = 3/824 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV    ASVSYD  + +ING RKIL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYV
Sbjct  21    SWVGSVRASVSYDSKAIVINGHRKILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  80

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP PGKYYFE  YDLVKFIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKY+PG
Sbjct  81    FWNGHEPSPGKYYFEDNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  140

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             + FRTDNGPFK  MQ+FTT IVNMMK++RL+++ GGPII+SQIENEYGPMEYELGAPGK 
Sbjct  141   IQFRTDNGPFKNQMQRFTTKIVNMMKAERLFQTHGGPIIMSQIENEYGPMEYELGAPGKQ  200

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y  WAA+MA+GLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT W
Sbjct  201   YTDWAAQMALGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGW  260

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             +TEFGG VPYRPAEDLA++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  261   YTEFGGAVPYRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  320

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCEPALVS DP V  LG +QEA VFKS SGAC+AFLA
Sbjct  321   LDEYGLLRQPKWGHLKDLHRAIKLCEPALVSADPTVQPLGRFQEAHVFKSNSGACSAFLA  380

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSW  1688
             N N  SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQS+ MKM   P+  GFSW
Sbjct  381   NYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSALMKMPRVPLHGGFSW  440

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             QSY +E +SY D TFT  GLLEQINTTRD+SDYLWY+TDV IDP E FL+ GK+P LTV 
Sbjct  441   QSYPDEAASYSDTTFTTAGLLEQINTTRDSSDYLWYITDVNIDPNEEFLRSGKYPELTVL  500

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHAL VFINGQL GTSYGSLE PK+TFS+ V LRAG+N+I+LLSIAVGLPNVGPHFET
Sbjct  501   SAGHALRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAGINQIALLSIAVGLPNVGPHFET  560

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGPV L+GLNEG+RDL+WQKWSYK+GLKGE LSLHSLSGSSSVEW++GS++ +KQ
Sbjct  561   WNAGVLGPVILNGLNEGRRDLSWQKWSYKVGLKGEALSLHSLSGSSSVEWIQGSYVTRKQ  620

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTW+KTTF+APAGN PLALDM +MGKGQ+WING+S+GRYWP Y ASG  CGACNYAG +
Sbjct  621   PLTWFKTTFNAPAGNSPLALDMGSMGKGQVWINGRSIGRYWPAYTASGN-CGACNYAGTY  679

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             +EKKCLS CG+ASQRWYHVPRSWL PTGNLLV  EEWGG+P G+ LV+REV S+CADIYE
Sbjct  680   NEKKCLSNCGQASQRWYHVPRSWLNPTGNLLVVLEEWGGDPNGIFLVRREVDSICADIYE  739

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP LM+++MQASGK  +P+RPKAHL+CG GQKI+SIKFASFGTP G+CGSF EG CHA 
Sbjct  740   WQPNLMSYQMQASGKVKKPVRPKAHLTCGPGQKISSIKFASFGTPEGACGSFREGACHAH  799

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +SYD FQ+ CIG NSC+V V PE FGGDPCPSVMKKLSVE +CS
Sbjct  800   NSYDAFQRSCIGQNSCSVTVEPENFGGDPCPSVMKKLSVEAICS  843



>ref|XP_011000791.1| PREDICTED: beta-galactosidase 1-like [Populus euphratica]
Length=846

 Score =  1363 bits (3529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 649/818 (79%), Positives = 733/818 (90%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASVSYD  +  INGQR+IL+SGSIHYPRS+PEMWPDL++KAKEGGLD +QTYVFWNGHE
Sbjct  30    TASVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDGIQTYVFWNGHE  89

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYF G YDLVKF+KL ++AGLYVHLR+GPY CAEWNFGGFPVWLKY+PG++FRTD
Sbjct  90    PSPGKYYFGGNYDLVKFVKLVKEAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGINFRTD  149

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKA MQKFTT IVNMMK++RL+E+QGGPIILSQIENEYGP+EYE+G+PGK+Y +WAA
Sbjct  150   NGPFKAQMQKFTTKIVNMMKAERLFETQGGPIILSQIENEYGPLEYEIGSPGKAYTKWAA  209

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             +MAVGL TGVPWVMCKQDDAPDPV+N CNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG
Sbjct  210   EMAVGLRTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGG  269

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVP+RPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  270   PVPHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
             LR+PKWGHLKDLHRAIKLCEPALVSGD  VI LGNYQEA VF  K+G CAAFLAN +Q S
Sbjct  330   LRQPKWGHLKDLHRAIKLCEPALVSGDATVIPLGNYQEAHVFNYKAGGCAAFLANYHQRS  389

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSR--GFSWQSYNEE  1670
             FAKV+F NMHYNLPPWSISILPDCKNTVYNTARVGAQS+RMKMTPV    GFSWQ+YNEE
Sbjct  390   FAKVSFRNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPVPMHGGFSWQAYNEE  449

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+  DNTFT  GLLEQINTTRD SDYLWYMTDV I+P E FL+ GK+P L+V SAGHAL
Sbjct  450   PSASGDNTFTMVGLLEQINTTRDVSDYLWYMTDVHINPSEGFLRSGKYPVLSVLSAGHAL  509

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQL GT+YGSL+ PK+TF++ V LRAGVNKISLLS+AVGLPNVGPHFETWNAG+L
Sbjct  510   HVFINGQLSGTAYGSLDFPKLTFTQGVKLRAGVNKISLLSVAVGLPNVGPHFETWNAGIL  569

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPV+L+GLNEG+RDL+WQKWSYKIGL GE L LHS+SGSSSVEW EGS +AQ+QPL+WYK
Sbjct  570   GPVTLNGLNEGRRDLSWQKWSYKIGLHGEALGLHSISGSSSVEWAEGSLVAQRQPLSWYK  629

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF+APAGN PLALDM +MGKGQ+WINGQ VGR+WP YKAS G CG C+Y G + EKKC 
Sbjct  630   TTFNAPAGNSPLALDMGSMGKGQMWINGQHVGRHWPAYKAS-GTCGDCSYIGTYSEKKCS  688

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             + CGEASQRWYHVP+SWL+PTGNLLV FEEWGG+P G+SLV+R+V SVCADIYEWQP LM
Sbjct  689   TNCGEASQRWYHVPQSWLKPTGNLLVVFEEWGGDPNGISLVRRDVDSVCADIYEWQPTLM  748

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N+EMQASGK  +PLRPKAHLSCG GQKI SIKFASFGTP G CGS+ +G+CHAFHSYD F
Sbjct  749   NYEMQASGKVNKPLRPKAHLSCGPGQKIRSIKFASFGTPEGVCGSYRQGSCHAFHSYDAF  808

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
                C+G NSC+V V PE FGGDPC +VMKKL+VE +CS
Sbjct  809   NNLCVGQNSCSVTVAPEMFGGDPCLNVMKKLAVEAICS  846



>ref|XP_010542431.1| PREDICTED: beta-galactosidase 1-like [Tarenaya hassleriana]
Length=847

 Score =  1363 bits (3529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/813 (79%), Positives = 726/813 (89%), Gaps = 3/813 (0%)
 Frame = -2

Query  2908  YDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGK  2729
             YD  +  INGQR+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHEP PGK
Sbjct  36    YDSRAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEPAPGK  95

Query  2728  YYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPFK  2549
             YYFEG YDLV+FIKL +QAGLY+HLR+GPY CAEWNFGGFPVWLKY+PG+SFRTDNGPFK
Sbjct  96    YYFEGNYDLVRFIKLVKQAGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDNGPFK  155

Query  2548  AAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVG  2369
             A MQ+FTT IVNMMKS+ L+ESQGGPIILSQIENEYGPMEYELG PG++Y  WAAKMAVG
Sbjct  156   AQMQRFTTKIVNMMKSEGLFESQGGPIILSQIENEYGPMEYELGEPGRAYTNWAAKMAVG  215

Query  2368  LGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYR  2189
             LGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGGPVPYR
Sbjct  216   LGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPVPYR  275

Query  2188  PAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPK  2009
             PAED+A+A+A+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL R+PK
Sbjct  276   PAEDMAFAIARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPK  335

Query  2008  WGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVA  1829
             WGHLKDLHRAIKLCEPALVS DP  I LG YQEA VF SKSGACAAFLAN N  S+A V+
Sbjct  336   WGHLKDLHRAIKLCEPALVSADPTRIPLGRYQEAHVFNSKSGACAAFLANYNTKSYATVS  395

Query  1828  FGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEETSSYD  1655
             FGN HYNLPPWSISILPDCKNTVYNTARVGAQ SRMKM   PV+ G SWQ+YNE+ SSYD
Sbjct  396   FGNNHYNLPPWSISILPDCKNTVYNTARVGAQISRMKMVQVPVNGGLSWQAYNEDPSSYD  455

Query  1654  DNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFIN  1475
             + +F+  GLLEQINTTRDASDYLWYMTDV+ID  E FLK GK+P LTV SAGHALHVF+N
Sbjct  456   EESFSMVGLLEQINTTRDASDYLWYMTDVKIDANEGFLKTGKYPTLTVLSAGHALHVFVN  515

Query  1474  GQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSL  1295
             GQL GT+YGSL+ PK+TFS++V LRAG+NKI+ LSIAVGLPNVGPHFE WNAGVLGPVSL
Sbjct  516   GQLSGTAYGSLDFPKLTFSESVNLRAGINKIAFLSIAVGLPNVGPHFERWNAGVLGPVSL  575

Query  1294  SGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDA  1115
             +GLNEG+RDL+WQKW+YK+GLKGE LSLHSLSG++SVEW  G+F+AQKQPLTW+KTTF  
Sbjct  576   NGLNEGRRDLSWQKWTYKVGLKGEALSLHSLSGTTSVEWAAGAFVAQKQPLTWFKTTFSG  635

Query  1114  PAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGE  935
             P GN PLA+DM +MGKGQIWINGQS+GRYWP YKAS G+C  C+YAG FDE KCL  CGE
Sbjct  636   PTGNSPLAIDMGSMGKGQIWINGQSLGRYWPAYKAS-GSCSECSYAGSFDENKCLRNCGE  694

Query  934   ASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQ  755
             ASQRWYHVPRSWL+P+GNLLV FEEWGG+P G+SLV+REV SVCADIYEWQP LMN+EMQ
Sbjct  695   ASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEWQPTLMNYEMQ  754

Query  754   ASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCI  575
             ASGK  +PLRPK HL CG GQK++++KFASFGTP G+CGS+ EG+CHA HSYD F + C+
Sbjct  755   ASGKVNKPLRPKVHLQCGDGQKMSAVKFASFGTPEGTCGSYREGSCHALHSYDAFNRVCV  814

Query  574   GWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             G N C+V V PE FGGDPCP+VMKKL+VEVVCS
Sbjct  815   GQNWCSVTVAPEMFGGDPCPNVMKKLAVEVVCS  847



>emb|CBI35944.3| unnamed protein product [Vitis vinifera]
Length=841

 Score =  1363 bits (3529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/816 (81%), Positives = 734/816 (90%), Gaps = 1/816 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASVSYD+ + +INGQR+IL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  27    TASVSYDRRAIVINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  86

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P  GKYYFEGRYDLV+FIKL +QAGLYV+LR+GPY CAEWNFGGFPVWLKYV G++FRT+
Sbjct  87    PSQGKYYFEGRYDLVRFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVQGINFRTN  146

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             N PFK  MQ+FT  IV+MMKS+ L+ESQGGPIILSQIENEYGPMEYE+GAPG++Y +WAA
Sbjct  147   NEPFKWHMQRFTKKIVDMMKSEGLFESQGGPIILSQIENEYGPMEYEIGAPGRAYTEWAA  206

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             KMAVGLGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT WFTEFGG
Sbjct  207   KMAVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGG  266

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
              VP+RPAEDLA++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DEFGL
Sbjct  267   AVPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGL  326

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
             LR+PKWGHLKDLHRAIKLCEPAL+SGDP V SLGNY+EA VF SKSGACAAFLAN N  S
Sbjct  327   LRQPKWGHLKDLHRAIKLCEPALISGDPTVTSLGNYEEAHVFHSKSGACAAFLANYNPRS  386

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETS  1664
             +AKV+F NMHYNLPPWSISILPDCKNTVYNTAR+GAQS+ MKMTPVS  F WQSYNEET+
Sbjct  387   YAKVSFRNMHYNLPPWSISILPDCKNTVYNTARLGAQSATMKMTPVSGRFGWQSYNEETA  446

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             SYDD++F A GLLEQINTTRD SDYLWY TDV+I   E FLK G++P LTV SAGHALHV
Sbjct  447   SYDDSSFAAVGLLEQINTTRDVSDYLWYSTDVKIGYNEGFLKSGRYPVLTVLSAGHALHV  506

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FING+L GT+YGSLENPK+TFS+ V LRAGVN I+LLSIAVGLPNVGPHFETWNAGVLGP
Sbjct  507   FINGRLSGTAYGSLENPKLTFSQGVKLRAGVNTIALLSIAVGLPNVGPHFETWNAGVLGP  566

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             VSL+GLNEG+RDL+WQKWSYK+GLKGE LSLHSLSGSSSVEWVEGS +A+ QPLTWYKTT
Sbjct  567   VSLNGLNEGRRDLSWQKWSYKVGLKGEALSLHSLSGSSSVEWVEGSLMARGQPLTWYKTT  626

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F+AP GN PLALDM +MGKGQIWINGQ+VGRYWP YKA+GG CG CNYAG + EKKCLS 
Sbjct  627   FNAPGGNTPLALDMGSMGKGQIWINGQNVGRYWPAYKATGG-CGDCNYAGTYSEKKCLSN  685

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CGE SQRWYHVP SWL PTGNLLV FEE GGNP G+SLV+RE+ SVCADIYEWQP LMN+
Sbjct  686   CGEPSQRWYHVPHSWLSPTGNLLVVFEESGGNPAGISLVEREIESVCADIYEWQPTLMNY  745

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             EMQASGK  +PLRPKAHL C  GQKI+SIKFASFGTP G CGS+ EG+CHA  SYD F++
Sbjct  746   EMQASGKVNKPLRPKAHLWCAPGQKISSIKFASFGTPEGVCGSYREGSCHAHKSYDAFER  805

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CIG NSC+V V PE FGGDPCPSVMKKLSVE +CS
Sbjct  806   SCIGMNSCSVTVAPEIFGGDPCPSVMKKLSVEAICS  841



>ref|XP_010654522.1| PREDICTED: beta-galactosidase 1 [Vitis vinifera]
Length=850

 Score =  1363 bits (3528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/816 (81%), Positives = 734/816 (90%), Gaps = 1/816 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASVSYD+ + +INGQR+IL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  36    TASVSYDRRAIVINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHE  95

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P  GKYYFEGRYDLV+FIKL +QAGLYV+LR+GPY CAEWNFGGFPVWLKYV G++FRT+
Sbjct  96    PSQGKYYFEGRYDLVRFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVQGINFRTN  155

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             N PFK  MQ+FT  IV+MMKS+ L+ESQGGPIILSQIENEYGPMEYE+GAPG++Y +WAA
Sbjct  156   NEPFKWHMQRFTKKIVDMMKSEGLFESQGGPIILSQIENEYGPMEYEIGAPGRAYTEWAA  215

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             KMAVGLGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT WFTEFGG
Sbjct  216   KMAVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGG  275

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
              VP+RPAEDLA++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DEFGL
Sbjct  276   AVPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGL  335

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
             LR+PKWGHLKDLHRAIKLCEPAL+SGDP V SLGNY+EA VF SKSGACAAFLAN N  S
Sbjct  336   LRQPKWGHLKDLHRAIKLCEPALISGDPTVTSLGNYEEAHVFHSKSGACAAFLANYNPRS  395

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETS  1664
             +AKV+F NMHYNLPPWSISILPDCKNTVYNTAR+GAQS+ MKMTPVS  F WQSYNEET+
Sbjct  396   YAKVSFRNMHYNLPPWSISILPDCKNTVYNTARLGAQSATMKMTPVSGRFGWQSYNEETA  455

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             SYDD++F A GLLEQINTTRD SDYLWY TDV+I   E FLK G++P LTV SAGHALHV
Sbjct  456   SYDDSSFAAVGLLEQINTTRDVSDYLWYSTDVKIGYNEGFLKSGRYPVLTVLSAGHALHV  515

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FING+L GT+YGSLENPK+TFS+ V LRAGVN I+LLSIAVGLPNVGPHFETWNAGVLGP
Sbjct  516   FINGRLSGTAYGSLENPKLTFSQGVKLRAGVNTIALLSIAVGLPNVGPHFETWNAGVLGP  575

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             VSL+GLNEG+RDL+WQKWSYK+GLKGE LSLHSLSGSSSVEWVEGS +A+ QPLTWYKTT
Sbjct  576   VSLNGLNEGRRDLSWQKWSYKVGLKGEALSLHSLSGSSSVEWVEGSLMARGQPLTWYKTT  635

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F+AP GN PLALDM +MGKGQIWINGQ+VGRYWP YKA+GG CG CNYAG + EKKCLS 
Sbjct  636   FNAPGGNTPLALDMGSMGKGQIWINGQNVGRYWPAYKATGG-CGDCNYAGTYSEKKCLSN  694

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CGE SQRWYHVP SWL PTGNLLV FEE GGNP G+SLV+RE+ SVCADIYEWQP LMN+
Sbjct  695   CGEPSQRWYHVPHSWLSPTGNLLVVFEESGGNPAGISLVEREIESVCADIYEWQPTLMNY  754

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             EMQASGK  +PLRPKAHL C  GQKI+SIKFASFGTP G CGS+ EG+CHA  SYD F++
Sbjct  755   EMQASGKVNKPLRPKAHLWCAPGQKISSIKFASFGTPEGVCGSYREGSCHAHKSYDAFER  814

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CIG NSC+V V PE FGGDPCPSVMKKLSVE +CS
Sbjct  815   SCIGMNSCSVTVAPEIFGGDPCPSVMKKLSVEAICS  850



>ref|XP_011010891.1| PREDICTED: beta-galactosidase 1-like [Populus euphratica]
Length=845

 Score =  1362 bits (3525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/824 (79%), Positives = 733/824 (89%), Gaps = 3/824 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             S V   TASVSYD  +  INGQR+IL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYV
Sbjct  23    SLVCSVTASVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  82

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP PGKYYFEG YDLVKF+KL ++AGLYV+LR+GPY CAEWNFGGFPVWLKY+PG
Sbjct  83    FWNGHEPSPGKYYFEGSYDLVKFVKLVKEAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPG  142

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             ++FRTDNGPFKA M+KFTT IV MMK++RL+ESQGGPIILSQIENEYGPMEYELG+PG++
Sbjct  143   INFRTDNGPFKAQMRKFTTKIVKMMKAERLFESQGGPIILSQIENEYGPMEYELGSPGQA  202

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y +WAA+MAVGL TGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W
Sbjct  203   YTKWAAQMAVGLRTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGW  262

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FT+FGGPVP+RPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  263   FTQFGGPVPHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  322

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGD  VI LGNYQEA VF  K+G CAAFLA
Sbjct  323   LDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDATVIPLGNYQEAHVFNYKAGGCAAFLA  382

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSR--GFSW  1688
             N +Q SFAKV+F NMHYNLPPWSISILPDCKNTVYNTARVGAQS+ +KMTPV    G SW
Sbjct  383   NYHQRSFAKVSFRNMHYNLPPWSISILPDCKNTVYNTARVGAQSATIKMTPVPMHGGLSW  442

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             Q+Y EE SS  DNTFT  GLLEQINTTRD SDYLWYMTDV ID  E FLK GK+P LTV 
Sbjct  443   QTYTEEPSSSGDNTFTMVGLLEQINTTRDVSDYLWYMTDVHIDHSEGFLKNGKYPVLTVL  502

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVFINGQL GT+YGSL+ PK+TFS+ V LRAGVNKISLLSIAVGLPNVGPHFET
Sbjct  503   SAGHALHVFINGQLSGTAYGSLDFPKLTFSQGVRLRAGVNKISLLSIAVGLPNVGPHFET  562

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAG+LGPV+L+GLNEG+RDL+WQKWSYKIGL GE LSLHS+SGSSSVEW EGS +AQKQ
Sbjct  563   WNAGILGPVTLNGLNEGRRDLSWQKWSYKIGLHGEALSLHSISGSSSVEWAEGSLVAQKQ  622

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PL+WYKTTF+APAGN PLALDM +MGKGQIWINGQ VGR+WP YKAS G CG C Y G +
Sbjct  623   PLSWYKTTFNAPAGNSPLALDMGSMGKGQIWINGQHVGRHWPAYKAS-GTCGECTYIGTY  681

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             +EKKC + CGEASQRWYHVP+SWL+PTGNLLV FEEWGG+P GVSLV+REV SVCADIYE
Sbjct  682   NEKKCSTNCGEASQRWYHVPQSWLKPTGNLLVVFEEWGGDPNGVSLVRREVDSVCADIYE  741

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP LMN++M+ASGK  +PLRPKAHLSCG GQKI SIKFASFGTP G CG++ +G+CHAF
Sbjct  742   WQPTLMNYQMRASGKVNKPLRPKAHLSCGPGQKIRSIKFASFGTPEGVCGNYHQGSCHAF  801

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             HSYD F   C+G NSC+V V PE FGGDPCPSVMKKL+ E +CS
Sbjct  802   HSYDAFNNLCVGQNSCSVTVAPEMFGGDPCPSVMKKLAAEAICS  845



>ref|XP_006466038.1| PREDICTED: beta-galactosidase 1-like [Citrus sinensis]
Length=845

 Score =  1360 bits (3521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/815 (79%), Positives = 737/815 (90%), Gaps = 4/815 (0%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SVSYD  +  ING+R+IL+SGSIHYPRS+PEMWPDL++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  32    SVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  91

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PGKYYFEG YDLVKFIKLA+QAGLYV+LR+GPY CAEWNFGGFPVWLKY+PG++FRT+NG
Sbjct  92    PGKYYFEGNYDLVKFIKLAKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTENG  151

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKA M KFT  IV+MMK++RL+ESQGGPIILSQIENEYGPMEYE+GAPG+SY +WAAKM
Sbjct  152   PFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAAKM  211

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGLGTGVPW+MCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W+TEFGGPV
Sbjct  212   AVGLGTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGGPV  271

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
             P+RP EDLA++VAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GLLR
Sbjct  272   PHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  331

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PKWGHLKDLHRAIKLCEPALVSG+P V+ LGNYQEA VFKSKS ACAAFLAN NQ +FA
Sbjct  332   QPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRTFA  390

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSWQSYNEETS  1664
             KVAFGN HYNLPPWSISILPDCKNTVYNTARVG QS++MKMTPV    GFSWQ++NE  S
Sbjct  391   KVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFNEVPS  450

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y D++FT +GLLEQINTTRDA+DYLWYMTDV+IDP E FL+ G +P LTV SAGHALHV
Sbjct  451   AYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHALHV  510

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             F+NGQL GT+YGSLE PK+TF++ V +RAG+NKI+LLSIAVGLPNVGPHFETWNAGVLGP
Sbjct  511   FVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGVLGP  570

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L+GLNEG+RDL+WQKW+YKIGL+GE L+LHSLSG SSVEW EGS +AQ+QPLTWY+TT
Sbjct  571   VTLNGLNEGRRDLSWQKWTYKIGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTT  630

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F APAGN PLALDM +MGKGQ+W+NGQS+GR+WP YKAS G+CG C+Y G + EKKCLS 
Sbjct  631   FSAPAGNAPLALDMGSMGKGQVWVNGQSIGRHWPAYKAS-GSCGYCSYTGTYTEKKCLSN  689

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CGEASQRWYHVPRSWL+PTGNLLV FEEWGGNP G+SLV+RE+ SVCA +YEWQP L+NW
Sbjct  690   CGEASQRWYHVPRSWLKPTGNLLVVFEEWGGNPNGISLVRREIDSVCAYMYEWQPTLINW  749

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++ ASGK  +PLRPKAHL CG GQKI SIKFASFGTP G CGS+ +G+CHAFHSYD FQ+
Sbjct  750   QLHASGKVNKPLRPKAHLMCGPGQKIKSIKFASFGTPEGVCGSYRQGSCHAFHSYDAFQR  809

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
              C+G N CTV V PE FGGDPCPSVMK+L+VE +C
Sbjct  810   LCVGQNMCTVTVAPEMFGGDPCPSVMKQLAVEAIC  844



>gb|KDO65274.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=845

 Score =  1360 bits (3520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/815 (79%), Positives = 737/815 (90%), Gaps = 4/815 (0%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SVSYD  +  ING+R+IL+SGSIHYPRS+PEMWPDL++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  32    SVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  91

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PGKYYFEG YDLVKFIKLA+QAGLYV+LR+GPY CAEWNFGGFPVWLKY+PG++FRT+NG
Sbjct  92    PGKYYFEGNYDLVKFIKLAKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTENG  151

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKA M KFT  IV+MMK++RL+ESQGGPIILSQIENEYGPMEYE+GAPG+SY +WAAKM
Sbjct  152   PFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAAKM  211

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGLGTGVPW+MCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W+TEFGGPV
Sbjct  212   AVGLGTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGGPV  271

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
             P+RP EDLA++VAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GLLR
Sbjct  272   PHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  331

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PKWGHLKDLHRAIKLCEPALVSG+P V+ LGNYQEA VFKSKS ACAAFLAN NQ +FA
Sbjct  332   QPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRTFA  390

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSWQSYNEETS  1664
             KVAFGN HYNLPPWSISILPDCKNTVYNTARVG QS++MKMTPV    GFSWQ++NE  S
Sbjct  391   KVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFNEVPS  450

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y D++FT +GLLEQINTTRDA+DYLWYMTDV+IDP E FL+ G +P LTV SAGHALHV
Sbjct  451   AYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHALHV  510

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             F+NGQL GT+YGSLE PK+TF++ V +RAG+NKI+LLSIAVGLPNVGPHFETWNAGVLGP
Sbjct  511   FVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGVLGP  570

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L+GLNEG+RDL+WQKW+YKIGL+GE L+LHSLSG SSVEW EGS +AQ+QPLTWY+TT
Sbjct  571   VTLNGLNEGRRDLSWQKWTYKIGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTT  630

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F APAGN PLALDM +MGKGQ+W+NGQS+GR+WP YKAS G+CG C+Y G + EKKCLS 
Sbjct  631   FSAPAGNAPLALDMGSMGKGQVWVNGQSIGRHWPAYKAS-GSCGYCSYTGTYTEKKCLSN  689

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CGEASQRWYHVPRSWL+PTGNLLV FEEWGGNP G+SLV+RE+ SVCA +YEWQP L+NW
Sbjct  690   CGEASQRWYHVPRSWLKPTGNLLVVFEEWGGNPNGISLVRREIDSVCAYMYEWQPTLINW  749

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++ ASGK  +PLRPKAHL CG GQKI SIKFASFGTP G CGS+ +G+CHAFHSYD FQ+
Sbjct  750   QLHASGKVNKPLRPKAHLMCGPGQKIKSIKFASFGTPEGVCGSYRQGSCHAFHSYDAFQR  809

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
              C+G N CTV V PE FGGDPCPS+MK+L+VE +C
Sbjct  810   LCVGQNMCTVTVAPEMFGGDPCPSIMKQLAVEAIC  844



>ref|XP_010534899.1| PREDICTED: beta-galactosidase 1 [Tarenaya hassleriana]
Length=847

 Score =  1360 bits (3519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/813 (79%), Positives = 725/813 (89%), Gaps = 3/813 (0%)
 Frame = -2

Query  2908  YDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGK  2729
             YD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHEP PGK
Sbjct  36    YDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPAPGK  95

Query  2728  YYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPFK  2549
             YYFEG YDLV+FIKL ++AGLYVHLR+GPY CAEWNFGGFPVWLKY+PG+SFRTDNGPFK
Sbjct  96    YYFEGNYDLVRFIKLVKEAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDNGPFK  155

Query  2548  AAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVG  2369
             A MQ+FTT IVNMMKS+RL+ESQGGPIILSQIENEYGPMEYELGAPGK+Y  WAAKMAVG
Sbjct  156   AQMQRFTTKIVNMMKSERLFESQGGPIILSQIENEYGPMEYELGAPGKAYTNWAAKMAVG  215

Query  2368  LGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYR  2189
             LGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNK YKPKMWTEAWT WFT+FGGPVPYR
Sbjct  216   LGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKGYKPKMWTEAWTGWFTKFGGPVPYR  275

Query  2188  PAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPK  2009
             PAED+A+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL R+PK
Sbjct  276   PAEDMAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPK  335

Query  2008  WGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVA  1829
             WGHLKDLHRAIKLCEPALVSGDP  + LG +QEA VFKSKSGACAAFLAN N  S+A V+
Sbjct  336   WGHLKDLHRAIKLCEPALVSGDPTRVPLGRFQEAHVFKSKSGACAAFLANYNPRSYATVS  395

Query  1828  FGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEETSSYD  1655
             FG  HYN+PPWSISILPDC NTVYNTARVGAQ+SRMKM   PV  G SWQ+YNE+ S+YD
Sbjct  396   FGKNHYNIPPWSISILPDCMNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNEDPSAYD  455

Query  1654  DNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFIN  1475
             D +F+  GLLEQINTTRDASDYLWYMTDV+ID  E FLK GK+P LTV SAGHALHVF+N
Sbjct  456   DESFSMVGLLEQINTTRDASDYLWYMTDVKIDANEGFLKTGKYPTLTVLSAGHALHVFVN  515

Query  1474  GQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSL  1295
             GQL GT+YGSL+ PK++FSKAV LRAG+N+I+LLSIAVGLPNVGPHFE WNAGVLGPVSL
Sbjct  516   GQLSGTAYGSLDFPKLSFSKAVNLRAGINRIALLSIAVGLPNVGPHFERWNAGVLGPVSL  575

Query  1294  SGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDA  1115
             +GLNEG+RDL+WQKW+YK+GLKGE LSLHSLSG++SVEW  G+F+A+KQPLTW+KTTF A
Sbjct  576   NGLNEGRRDLSWQKWTYKVGLKGEALSLHSLSGTTSVEWAAGAFVARKQPLTWFKTTFSA  635

Query  1114  PAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGE  935
             PAGN PLALDM +MGKGQIWINGQS+GRYWP YKAS G+C  C+YAG F+E KCL  CGE
Sbjct  636   PAGNSPLALDMESMGKGQIWINGQSLGRYWPAYKAS-GSCSECSYAGSFNENKCLRNCGE  694

Query  934   ASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQ  755
             ASQRWYHVP SWL+P GNLLV FEEWGG+P G+SLV+REV SVCADIYEWQP LMN++MQ
Sbjct  695   ASQRWYHVPHSWLKPNGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEWQPTLMNYQMQ  754

Query  754   ASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCI  575
             ASGK  +PL PK HL CG GQK+ ++KFASFGTP G+CGS+ EG CHA HSYD F + C+
Sbjct  755   ASGKVNKPLHPKVHLQCGFGQKMRTVKFASFGTPEGTCGSYREGNCHAHHSYDAFNRLCV  814

Query  574   GWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             G N C+V V PE FGGDPCP+VMKKLSVEVVCS
Sbjct  815   GQNWCSVTVAPEMFGGDPCPNVMKKLSVEVVCS  847



>gb|EYU21377.1| hypothetical protein MIMGU_mgv1a001631mg [Erythranthe guttata]
Length=782

 Score =  1355 bits (3506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/783 (82%), Positives = 720/783 (92%), Gaps = 1/783 (0%)
 Frame = -2

Query  2824  MWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVG  2645
             MWPDL++KAKEGGLDV+QTYVFWNGHEP+PGKYYFE RYDLVKFIKL QQAGLYV+LR+G
Sbjct  1     MWPDLIEKAKEGGLDVIQTYVFWNGHEPEPGKYYFEERYDLVKFIKLVQQAGLYVNLRIG  60

Query  2644  PYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPII  2465
             PYACAEWNFGGFPVWLKYVPG+SFRT+N PFKAAMQ FTT IVNMMK + LYE+QGGPII
Sbjct  61    PYACAEWNFGGFPVWLKYVPGISFRTNNEPFKAAMQNFTTKIVNMMKDEELYETQGGPII  120

Query  2464  LSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYC  2285
             LSQIENEYGPMEYELG PGK+Y +WAAKMAV L TGVPW+MCKQDDAPDP++N CNGFYC
Sbjct  121   LSQIENEYGPMEYELGEPGKAYTEWAAKMAVDLDTGVPWIMCKQDDAPDPIINTCNGFYC  180

Query  2284  DWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGG  2105
             D+FSPNKAYKPKMWTEAWT WFTEFGGPVPYRPAEDLA++VAKFI KGGSFINYYM+HGG
Sbjct  181   DYFSPNKAYKPKMWTEAWTGWFTEFGGPVPYRPAEDLAFSVAKFIQKGGSFINYYMYHGG  240

Query  2104  TNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISL  1925
             TNFGRTAGGPFIATSYDYDAP+DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V  L
Sbjct  241   TNFGRTAGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPIVTPL  300

Query  1924  GNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR  1745
             GNYQEA VFKS++GACAAFLAN NQHSFAKV+FGNMHYNLPPWSISILPDCKNTVYNTAR
Sbjct  301   GNYQEAHVFKSRAGACAAFLANYNQHSFAKVSFGNMHYNLPPWSISILPDCKNTVYNTAR  360

Query  1744  VGAQSSRMKMTPVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVR  1565
             +G+QS++MKMTPVS+ FSWQSY+EET+S ++N+FT  GL+EQINTTRD +DYLWY T+V 
Sbjct  361   IGSQSAQMKMTPVSKEFSWQSYDEETASLEENSFTMVGLVEQINTTRDNTDYLWYTTEVT  420

Query  1564  IDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNK  1385
             ID  E F +GG+ P LTV SAGHALHVFINGQ+ GT+YGSLENP++TF++AV LRAGVN+
Sbjct  421   IDTSEGFFRGGQLPSLTVLSAGHALHVFINGQISGTAYGSLENPRLTFNEAVNLRAGVNQ  480

Query  1384  ISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhs  1205
             ISLLSIAVGLPN+GPHFETWNAG+LGPVS+SGLNEGKRDLTWQKWSYK+GL GE LSLHS
Sbjct  481   ISLLSIAVGLPNIGPHFETWNAGILGPVSVSGLNEGKRDLTWQKWSYKVGLTGESLSLHS  540

Query  1204  lsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYW  1025
             LSGSSSVEWVEG ++ ++QPLTWYKTTF+AP G+EPLALDMNTM KGQIWING+S+GRYW
Sbjct  541   LSGSSSVEWVEGLYVTERQPLTWYKTTFNAPEGDEPLALDMNTMSKGQIWINGESIGRYW  600

Query  1024  PGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNP  845
               YKAS G C  CNY GWFDEKKCLSKC EASQRWYHVPRSWLRP+GNLLV FEEWGGNP
Sbjct  601   NQYKAS-GECVPCNYTGWFDEKKCLSKCDEASQRWYHVPRSWLRPSGNLLVVFEEWGGNP  659

Query  844   YGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFAS  665
              G+SLVKREV SVCADIYEWQP LMNW+MQ+SGK T+ LRPKAHLSC  GQKI+S+KFAS
Sbjct  660   NGISLVKREVESVCADIYEWQPNLMNWQMQSSGKVTKALRPKAHLSCAPGQKISSVKFAS  719

Query  664   FGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEV  485
             FGTP G+CGSF +G+CHAFHSYD+F++YC+G  SC+VP+TPE FGGDPCP++MKKLSVE 
Sbjct  720   FGTPEGACGSFRQGSCHAFHSYDVFERYCVGQQSCSVPITPEIFGGDPCPNIMKKLSVEA  779

Query  484   VCS  476
             VCS
Sbjct  780   VCS  782



>ref|XP_006426535.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
 gb|ESR39775.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
Length=845

 Score =  1354 bits (3504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/815 (79%), Positives = 735/815 (90%), Gaps = 4/815 (0%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SVSYD  +  ING+R+IL+SGSIHYPRS+PEMWPDL++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  32    SVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  91

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PGKYYFEG YDLVKFIKL +QAGLYV+LR+GPY CAEWNFGGFPVWLKY+PG++FRT+NG
Sbjct  92    PGKYYFEGNYDLVKFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTNNG  151

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKA M KFT  IV+MMK++RL+ESQGGPIILSQIENEYGPMEYE+GAPG+SY +WAAKM
Sbjct  152   PFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAAKM  211

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPW+MCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W+TEFGGPV
Sbjct  212   AVGLDTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGGPV  271

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
             P+RP EDLA++VAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GLLR
Sbjct  272   PHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  331

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PKWGHLKDLHRAIKLCEPALVSG+P V+ LGNYQEA VFKSKS ACAAFLAN NQ +FA
Sbjct  332   QPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRTFA  390

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSWQSYNEETS  1664
             KVAFGN HYNLPPWSISILPDCKNTVYNTARVG QS++MKMTPV    GFSWQ++NE  S
Sbjct  391   KVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFNEVPS  450

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y D++FT +GLLEQINTTRDA+DYLWYMTDV+IDP E FL+ G +P LTV SAGHALHV
Sbjct  451   AYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHALHV  510

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             F+NGQL GT+YGSLE PK+TF++ V +RAG+NKI+LLSIAVGLPNVGPHFETWNAGVLGP
Sbjct  511   FVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGVLGP  570

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L+GLNEG+RDL+WQKW+YK+GL+GE L+LHSLSG SSVEW EGS +AQ+QPLTWY+TT
Sbjct  571   VTLNGLNEGRRDLSWQKWTYKVGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTT  630

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F APAGN PLALDM +MGKGQ+W+NGQS+GR+WP YKAS G+CG C+Y G + EKKCLS 
Sbjct  631   FSAPAGNAPLALDMGSMGKGQVWVNGQSIGRHWPAYKAS-GSCGYCSYTGTYTEKKCLSN  689

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CGEASQRWYHVPRSWL+PTGNLLV FEEWGGNP G+SLV+RE+ SVCA +YEWQP L+NW
Sbjct  690   CGEASQRWYHVPRSWLKPTGNLLVVFEEWGGNPNGISLVRREIDSVCAYMYEWQPTLINW  749

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++ ASGK  +PLRPKAHL CG GQKI SIKFASFGTP G CGS+ +G+CHAFHSYD FQ+
Sbjct  750   QLHASGKVNKPLRPKAHLMCGPGQKIKSIKFASFGTPEGVCGSYRQGSCHAFHSYDAFQR  809

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
              C+G N CTV V PE FGGDPCPS+MK+L+VE +C
Sbjct  810   LCVGQNMCTVTVAPEMFGGDPCPSIMKQLAVEAIC  844



>ref|XP_008447606.1| PREDICTED: beta-galactosidase 1 [Cucumis melo]
Length=844

 Score =  1352 bits (3499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/817 (78%), Positives = 734/817 (90%), Gaps = 3/817 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASVSYD  + IINGQR+IL+SGSIHYPRST EMWPDL++KAKEGGLDV++TYVFWNGHEP
Sbjct  29    ASVSYDSKAIIINGQRRILISGSIHYPRSTSEMWPDLIQKAKEGGLDVIETYVFWNGHEP  88

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
             +PGKYYFEG YDLV+F+KL  QAGLYVHLR+GPY CAEWNFGGFPVWLKY+PG+SFRTDN
Sbjct  89    EPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  148

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK  M++FT  IVNMMK++RLYESQGGPIILSQIENEYGPMEYELGAPGK+Y++WAA+
Sbjct  149   APFKFQMERFTRKIVNMMKAERLYESQGGPIILSQIENEYGPMEYELGAPGKAYSKWAAQ  208

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MA+GLGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG 
Sbjct  209   MALGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGGA  268

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP+RPAED+A+AVA+FI KGG+ INYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GLL
Sbjct  269   VPHRPAEDMAFAVARFIQKGGALINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLL  328

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PKWGHLKDL+RAIKLCEPALVSGDP V  LGNYQEA VFKSKSGACAAFL+N N  S+
Sbjct  329   RQPKWGHLKDLNRAIKLCEPALVSGDPIVTRLGNYQEAHVFKSKSGACAAFLSNYNPRSY  388

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSR--GFSWQSYNEET  1667
             A VAFGNMHYN+PPWSISILPDCKNTV+NTARVGAQ++ MKM+PV     FSWQ+YNEE 
Sbjct  389   ATVAFGNMHYNIPPWSISILPDCKNTVFNTARVGAQTAIMKMSPVPMHGSFSWQAYNEEP  448

Query  1666  SSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             +SY++  FT  GLLEQINTTRDA+DYLWY TDV ID  E FL+ GK+P LTV SAGHA+H
Sbjct  449   ASYNEKAFTTVGLLEQINTTRDATDYLWYTTDVHIDANEGFLRSGKYPVLTVLSAGHAMH  508

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VF+NGQL GT+YGSL+ PK+TFS+ V LRAG NKI+LLSIAVGLPNVGPHFE WNAG+LG
Sbjct  509   VFVNGQLAGTAYGSLDFPKLTFSREVNLRAGNNKIALLSIAVGLPNVGPHFEMWNAGILG  568

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKT  1127
             PV+L+GL+EG+RDLTWQKW+YKIGL GE +SLHSLSGSSSVEW++GS +AQKQPLTW+KT
Sbjct  569   PVNLNGLDEGRRDLTWQKWTYKIGLDGEAMSLHSLSGSSSVEWIQGSLVAQKQPLTWFKT  628

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
             TF+APAGN PLALDM +MGKGQIW+NGQS+GRYWP YK++ G+CG+C+Y G ++EKKC S
Sbjct  629   TFNAPAGNSPLALDMGSMGKGQIWLNGQSLGRYWPAYKST-GSCGSCDYTGTYNEKKCSS  687

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CGEASQRWYHVPRSWL+PTGNLLV FEEWGG+P G+ LV+R+V SVC +I EWQP LMN
Sbjct  688   NCGEASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGIHLVRRDVDSVCVNINEWQPTLMN  747

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W+MQ+SGK  +PLRPKAHLSCG GQKI+S+KFASFGTP G CGSF EG+CHA HSYD FQ
Sbjct  748   WQMQSSGKVNKPLRPKAHLSCGPGQKISSVKFASFGTPEGECGSFREGSCHAHHSYDAFQ  807

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             + C+G N CTV V PE FGGDPCP+VMKKLSVEV+CS
Sbjct  808   RTCVGQNFCTVTVAPEMFGGDPCPNVMKKLSVEVICS  844



>ref|XP_006426534.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
 gb|ESR39774.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
Length=846

 Score =  1350 bits (3494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/816 (78%), Positives = 735/816 (90%), Gaps = 5/816 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SVSYD  +  ING+R+IL+SGSIHYPRS+PEMWPDL++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  32    SVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  91

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PGKYYFEG YDLVKFIKL +QAGLYV+LR+GPY CAEWNFGGFPVWLKY+PG++FRT+NG
Sbjct  92    PGKYYFEGNYDLVKFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTNNG  151

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKA M KFT  IV+MMK++RL+ESQGGPIILSQIENEYGPMEYE+GAPG+SY +WAAKM
Sbjct  152   PFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAAKM  211

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPW+MCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W+TEFGGPV
Sbjct  212   AVGLDTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGGPV  271

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
             P+RP EDLA++VAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GLLR
Sbjct  272   PHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  331

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PKWGHLKDLHRAIKLCEPALVSG+P V+ LGNYQEA VFKSKS ACAAFLAN NQ +FA
Sbjct  332   QPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRTFA  390

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSWQSYNEETS  1664
             KVAFGN HYNLPPWSISILPDCKNTVYNTARVG QS++MKMTPV    GFSWQ++NE  S
Sbjct  391   KVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFNEVPS  450

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y D++FT +GLLEQINTTRDA+DYLWYMTDV+IDP E FL+ G +P LTV SAGHALHV
Sbjct  451   AYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHALHV  510

Query  1483  FINGQL-VGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             F+NGQL  GT+YGSLE PK+TF++ V +RAG+NKI+LLSIAVGLPNVGPHFETWNAGVLG
Sbjct  511   FVNGQLAAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGVLG  570

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKT  1127
             PV+L+GLNEG+RDL+WQKW+YK+GL+GE L+LHSLSG SSVEW EGS +AQ+QPLTWY+T
Sbjct  571   PVTLNGLNEGRRDLSWQKWTYKVGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRT  630

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
             TF APAGN PLALDM +MGKGQ+W+NGQS+GR+WP YKAS G+CG C+Y G + EKKCLS
Sbjct  631   TFSAPAGNAPLALDMGSMGKGQVWVNGQSIGRHWPAYKAS-GSCGYCSYTGTYTEKKCLS  689

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CGEASQRWYHVPRSWL+PTGNLLV FEEWGGNP G+SLV+RE+ SVCA +YEWQP L+N
Sbjct  690   NCGEASQRWYHVPRSWLKPTGNLLVVFEEWGGNPNGISLVRREIDSVCAYMYEWQPTLIN  749

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W++ ASGK  +PLRPKAHL CG GQKI SIKFASFGTP G CGS+ +G+CHAFHSYD FQ
Sbjct  750   WQLHASGKVNKPLRPKAHLMCGPGQKIKSIKFASFGTPEGVCGSYRQGSCHAFHSYDAFQ  809

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             + C+G N CTV V PE FGGDPCPS+MK+L+VE +C
Sbjct  810   RLCVGQNMCTVTVAPEMFGGDPCPSIMKQLAVEAIC  845



>ref|XP_004146823.1| PREDICTED: beta-galactosidase 1-like [Cucumis sativus]
 ref|XP_004164891.1| PREDICTED: beta-galactosidase 1-like [Cucumis sativus]
Length=841

 Score =  1349 bits (3492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/817 (78%), Positives = 732/817 (90%), Gaps = 3/817 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASVSYD  + IING R+IL+SGSIHYPRST EMWPDL++KAKEGGLDV++TYVFWNGHEP
Sbjct  26    ASVSYDSKAIIINGHRRILISGSIHYPRSTSEMWPDLIQKAKEGGLDVIETYVFWNGHEP  85

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
             +PGKYYFEG YDLV+F+KL  QAGLYVHLR+GPY CAEWNFGGFPVWLKY+PG+SFRTDN
Sbjct  86    EPGKYYFEGNYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  145

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK  M++FT  IVNMMK++RLYESQGGPIILSQIENEYGPMEYELGAPGK+Y++WAA+
Sbjct  146   APFKFQMERFTRKIVNMMKAERLYESQGGPIILSQIENEYGPMEYELGAPGKAYSKWAAQ  205

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MA+GLGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG 
Sbjct  206   MALGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTQFGGA  265

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP+RPAED+A+AVA+FI KGG+ INYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GLL
Sbjct  266   VPHRPAEDMAFAVARFIQKGGALINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLL  325

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PKWGHLKDL+RAIKLCEPALVSGDP V  LGNYQEA VFKSKSGACAAFL+N N  S+
Sbjct  326   RQPKWGHLKDLNRAIKLCEPALVSGDPIVTRLGNYQEAHVFKSKSGACAAFLSNYNPRSY  385

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSWQSYNEET  1667
             A VAFGNMHYN+PPWSISILPDCKNTV+NTARVGAQ++ MKM+PV     FSWQ+YNEE 
Sbjct  386   ATVAFGNMHYNIPPWSISILPDCKNTVFNTARVGAQTAIMKMSPVPMHESFSWQAYNEEP  445

Query  1666  SSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             +SY++  FT  GLLEQINTTRDA+DYLWY TDV ID  E FL+ GK+P LTV SAGHA+H
Sbjct  446   ASYNEKAFTTVGLLEQINTTRDATDYLWYTTDVHIDANEGFLRSGKYPVLTVLSAGHAMH  505

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VF+NGQL GT+YGSL+ PK+TFS+ V LRAG NKI+LLSIAVGLPNVGPHFE WNAG+LG
Sbjct  506   VFVNGQLAGTAYGSLDFPKLTFSRGVNLRAGNNKIALLSIAVGLPNVGPHFEMWNAGILG  565

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKT  1127
             PV+L+GL+EG+RDLTWQKW+YKIGL GE +SLHSLSGSSSVEW++GS +AQKQPLTW+KT
Sbjct  566   PVNLNGLDEGRRDLTWQKWTYKIGLDGEAMSLHSLSGSSSVEWIQGSLVAQKQPLTWFKT  625

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
             TF+APAGN PLALDM +MGKGQIW+NGQS+GRYWP YK++ G+CG+C+Y G ++EKKC S
Sbjct  626   TFNAPAGNSPLALDMGSMGKGQIWLNGQSLGRYWPAYKST-GSCGSCDYTGTYNEKKCSS  684

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CGEASQRWYHVPRSWL PTGNLLV FEEWGG+P G+ LV+R+V SVC +I EWQP LMN
Sbjct  685   NCGEASQRWYHVPRSWLNPTGNLLVVFEEWGGDPNGIHLVRRDVDSVCVNINEWQPTLMN  744

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W+MQ+SGK  +PLRPKAHLSCG GQKI+S+KFASFGTP G CGSF EG+CHA HSYD FQ
Sbjct  745   WQMQSSGKVNKPLRPKAHLSCGPGQKISSVKFASFGTPEGECGSFREGSCHAHHSYDAFQ  804

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             + C+G N CTV V PE FGGDPCP+VMKKLSVEV+CS
Sbjct  805   RTCVGQNFCTVTVAPEMFGGDPCPNVMKKLSVEVICS  841



>emb|CDY51738.1| BnaA01g37210D [Brassica napus]
Length=839

 Score =  1348 bits (3488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/822 (78%), Positives = 729/822 (89%), Gaps = 3/822 (0%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
             VSL +ASVSYD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFW
Sbjct  19    VSLVSASVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFW  78

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             NGHEP PGKYYFEG YDLVKF+KL +Q+GLY+HLR+GPY CAEWNFGGFPVWLKYVPG+S
Sbjct  79    NGHEPSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGIS  138

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDNGPFKA MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY 
Sbjct  139   FRTDNGPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYT  198

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAAKMAVGLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT
Sbjct  199   NWAAKMAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFT  258

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
             +FGGPVPYRPAED+A++VA+FI KGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP+D
Sbjct  259   KFGGPVPYRPAEDMAFSVARFIQKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPLD  318

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             E+GL R+PKWGHLKDLHRAIKLCEPALVSG    I LGNYQEA  +KSKSGAC+AFLAN 
Sbjct  319   EYGLERQPKWGHLKDLHRAIKLCEPALVSGQLTRIPLGNYQEAHQYKSKSGACSAFLANY  378

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQS  1682
             NQ S+AKV FG  HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+
Sbjct  379   NQRSYAKVTFGKNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQA  438

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             YNE+ SSY D +FT  GLLEQINTTRD SDYLWYMTDV+I+  E FL+GG  P LT+ SA
Sbjct  439   YNEDPSSYVDESFTMVGLLEQINTTRDTSDYLWYMTDVKINSNEGFLRGGNLPTLTILSA  498

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHA+HVFINGQL G++YGSL++PK+TF + V LRAG NKI++LSIAVGLPNVGPHFETWN
Sbjct  499   GHAMHVFINGQLSGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWN  558

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPVSL+GLN G+RDL+WQKW+YK+GL+GE LSLHSLSGSSSVEW EG+F+AQKQPL
Sbjct  559   AGVLGPVSLNGLNGGRRDLSWQKWTYKVGLRGESLSLHSLSGSSSVEWAEGAFVAQKQPL  618

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYKTTF APAG+ PLA+DM +MGKGQIWINGQSVGR+WP YKA  G C  C+Y G F+E
Sbjct  619   TWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSVGRHWPAYKAV-GTCRECSYIGTFNE  677

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
              KCL  CGEASQRWYHVPRSWL+PTGNLLV FEEWGG+P G+SLV+REV +VCADIYEWQ
Sbjct  678   NKCLRNCGEASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGISLVRREVDTVCADIYEWQ  737

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
               L+N+++ ASGK  +PL PK HL CG GQKIT++KFASFGTP+G+CGS+ +G+CHA HS
Sbjct  738   STLVNYQLHASGKVNKPLHPKVHLQCGPGQKITTVKFASFGTPQGTCGSYRQGSCHAHHS  797

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F + C+G N C+V V P  FGGDPCP+VMKKL+VE VC+
Sbjct  798   YDAFNRLCVGQNWCSVTVAPAMFGGDPCPNVMKKLAVEAVCA  839



>ref|NP_187988.1| beta galactosidase 1 [Arabidopsis thaliana]
 sp|Q9SCW1.1|BGAL1_ARATH RecName: Full=Beta-galactosidase 1; Short=Lactase 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64737.1| putative beta-galactosidase [Arabidopsis thaliana]
 dbj|BAB01923.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AEE75407.1| beta galactosidase 1 [Arabidopsis thaliana]
Length=847

 Score =  1348 bits (3488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/818 (78%), Positives = 729/818 (89%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             + SVSYD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  31    SGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHE  90

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEG YDLVKF+KL QQ+GLY+HLR+GPY CAEWNFGGFPVWLKY+PG+SFRTD
Sbjct  91    PSPGKYYFEGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  150

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKA MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY  WAA
Sbjct  151   NGPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAA  210

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             KMAVGLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG
Sbjct  211   KMAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGG  270

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVPYRPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  271   PVPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  330

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
              R+PKWGHLKDLHRAIKLCEPALVSG+P  + LGNYQEA V+KSKSGAC+AFLAN N  S
Sbjct  331   ERQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKSKSGACSAFLANYNPKS  390

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEE  1670
             +AKV+FGN HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+YNE+
Sbjct  391   YAKVSFGNNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNED  450

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+Y D +FT  GL+EQINTTRD SDYLWYMTDV++D  E FL+ G  P LTV SAGHA+
Sbjct  451   PSTYIDESFTMVGLVEQINTTRDTSDYLWYMTDVKVDANEGFLRNGDLPTLTVLSAGHAM  510

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQL G++YGSL++PK+TF K V LRAG NKI++LSIAVGLPNVGPHFETWNAGVL
Sbjct  511   HVFINGQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  570

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPVSL+GLN G+RDL+WQKW+YK+GLKGE LSLHSLSGSSSVEW EG+F+AQKQPLTWYK
Sbjct  571   GPVSLNGLNGGRRDLSWQKWTYKVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYK  630

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF APAG+ PLA+DM +MGKGQIWINGQS+GR+WP YKA  G+C  C+Y G F E KCL
Sbjct  631   TTFSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAV-GSCSECSYTGTFREDKCL  689

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CGEASQRWYHVPRSWL+P+GNLLV FEEWGG+P G++LV+REV SVCADIYEWQ  L+
Sbjct  690   RNCGEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGITLVRREVDSVCADIYEWQSTLV  749

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N+++ ASGK  +PL PKAHL CG GQKIT++KFASFGTP G+CGS+ +G+CHA HSYD F
Sbjct  750   NYQLHASGKVNKPLHPKAHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAF  809

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              K C+G N C+V V PE FGGDPCP+VMKKL+VE VC+
Sbjct  810   NKLCVGQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCA  847



>ref|XP_009117469.1| PREDICTED: beta-galactosidase 1-like [Brassica rapa]
Length=839

 Score =  1347 bits (3487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/822 (78%), Positives = 729/822 (89%), Gaps = 3/822 (0%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
             VSL +ASVSYD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFW
Sbjct  19    VSLVSASVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFW  78

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             NGHEP PGKYYFEG YDLVKF+KL +Q+GLY+HLR+GPY CAEWNFGGFPVWLKYVPG+S
Sbjct  79    NGHEPSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGIS  138

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDNGPFKA MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY 
Sbjct  139   FRTDNGPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYT  198

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAAKMAVGLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT
Sbjct  199   NWAAKMAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFT  258

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
             +FGGPVPYRPAED+A++VA+FI KGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP+D
Sbjct  259   KFGGPVPYRPAEDMAFSVARFIQKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPLD  318

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             E+GL R+PKWGHLKDLHRAIKLCEPALVSG    I LGNYQEA  +KSKSGAC+AFLAN 
Sbjct  319   EYGLERQPKWGHLKDLHRAIKLCEPALVSGQLTRIPLGNYQEAHQYKSKSGACSAFLANY  378

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQS  1682
             NQ S+AKV FG  HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+
Sbjct  379   NQRSYAKVTFGKNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQA  438

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             YNE+ SSY D +FT  GL+EQINTTRD SDYLWYMTDV+I+  E FL+GG  P LT+ SA
Sbjct  439   YNEDPSSYVDESFTMVGLVEQINTTRDTSDYLWYMTDVKINSNEGFLRGGNLPTLTILSA  498

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHA+HVFINGQL G++YGSL++PK+TF + V LRAG NKI++LSIAVGLPNVGPHFETWN
Sbjct  499   GHAMHVFINGQLTGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWN  558

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPVSL+GLN G+RDL+WQKW+YK+GL+GE LSLHSLSGSSSVEW EG+F+AQKQPL
Sbjct  559   AGVLGPVSLNGLNGGRRDLSWQKWTYKVGLRGESLSLHSLSGSSSVEWAEGAFVAQKQPL  618

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYKTTF APAG+ PLA+DM +MGKGQIWINGQSVGR+WP YKA  G C  C+Y G F+E
Sbjct  619   TWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSVGRHWPAYKAV-GTCRECSYIGTFNE  677

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
              KCL  CGEASQRWYHVPRSWL+PTGNLLV FEEWGG+P G+SLV+REV +VCADIYEWQ
Sbjct  678   NKCLRNCGEASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGISLVRREVDTVCADIYEWQ  737

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
               L+N+++ ASGK  +PL PK HL CG GQKIT++KFASFGTP+G+CGS+ +G+CHA HS
Sbjct  738   STLVNYQLHASGKVNKPLHPKVHLQCGPGQKITTVKFASFGTPQGTCGSYRQGSCHAHHS  797

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F + C+G N C+V V P  FGGDPCP+VMKKLSVE VC+
Sbjct  798   YDAFNRLCVGQNWCSVTVAPAMFGGDPCPNVMKKLSVEAVCA  839



>gb|KDO65275.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=872

 Score =  1347 bits (3485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/842 (76%), Positives = 737/842 (88%), Gaps = 31/842 (4%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SVSYD  +  ING+R+IL+SGSIHYPRS+PEMWPDL++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  32    SVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  91

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PGKYYFEG YDLVKFIKLA+QAGLYV+LR+GPY CAEWNFGGFPVWLKY+PG++FRT+NG
Sbjct  92    PGKYYFEGNYDLVKFIKLAKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTENG  151

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKA M KFT  IV+MMK++RL+ESQGGPIILSQIENEYGPMEYE+GAPG+SY +WAAKM
Sbjct  152   PFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAAKM  211

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGLGTGVPW+MCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W+TEFGGPV
Sbjct  212   AVGLGTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGGPV  271

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
             P+RP EDLA++VAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GLLR
Sbjct  272   PHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  331

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PKWGHLKDLHRAIKLCEPALVSG+P V+ LGNYQEA VFKSKS ACAAFLAN NQ +FA
Sbjct  332   QPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRTFA  390

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSWQSYNEETS  1664
             KVAFGN HYNLPPWSISILPDCKNTVYNTARVG QS++MKMTPV    GFSWQ++NE  S
Sbjct  391   KVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFNEVPS  450

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y D++FT +GLLEQINTTRDA+DYLWYMTDV+IDP E FL+ G +P LTV SAGHALHV
Sbjct  451   AYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHALHV  510

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             F+NGQL GT+YGSLE PK+TF++ V +RAG+NKI+LLSIAVGLPNVGPHFETWNAGVLGP
Sbjct  511   FVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGVLGP  570

Query  1303  VSLSGLNEGKRDLTWQKWSYK---------------------------IGLKgevlslhs  1205
             V+L+GLNEG+RDL+WQKW+YK                           IGL+GE L+LHS
Sbjct  571   VTLNGLNEGRRDLSWQKWTYKVCLQSLKYGFLVSLTFWILIEVCLLNQIGLEGEKLNLHS  630

Query  1204  lsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYW  1025
             LSG SSVEW EGS +AQ+QPLTWY+TTF APAGN PLALDM +MGKGQ+W+NGQS+GR+W
Sbjct  631   LSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKGQVWVNGQSIGRHW  690

Query  1024  PGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNP  845
             P YKAS G+CG C+Y G + EKKCLS CGEASQRWYHVPRSWL+PTGNLLV FEEWGGNP
Sbjct  691   PAYKAS-GSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGNLLVVFEEWGGNP  749

Query  844   YGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFAS  665
              G+SLV+RE+ SVCA +YEWQP L+NW++ ASGK  +PLRPKAHL CG GQKI SIKFAS
Sbjct  750   NGISLVRREIDSVCAYMYEWQPTLINWQLHASGKVNKPLRPKAHLMCGPGQKIKSIKFAS  809

Query  664   FGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEV  485
             FGTP G CGS+ +G+CHAFHSYD FQ+ C+G N CTV V PE FGGDPCPS+MK+L+VE 
Sbjct  810   FGTPEGVCGSYRQGSCHAFHSYDAFQRLCVGQNMCTVTVAPEMFGGDPCPSIMKQLAVEA  869

Query  484   VC  479
             +C
Sbjct  870   IC  871



>gb|AAM13196.1| galactosidase, putative [Arabidopsis thaliana]
Length=847

 Score =  1346 bits (3484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/818 (78%), Positives = 729/818 (89%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             + SVSYD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  31    SGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHE  90

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEG YDLVKF+KL QQ+GLY+HLR+GPY CAEWNFGGFPVWLKY+PG+SFRTD
Sbjct  91    PSPGKYYFEGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  150

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKA MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY  WAA
Sbjct  151   NGPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAA  210

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             KMAVGLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG
Sbjct  211   KMAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGG  270

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVPYRPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  271   PVPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  330

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
              R+PKWGHLKDLHRAIKLCEPALVSG+P  + LGNYQEA V+KSKSGAC+AFLAN N  S
Sbjct  331   ERQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKSKSGACSAFLANYNPKS  390

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEE  1670
             +AKV+FGN HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+YNE+
Sbjct  391   YAKVSFGNNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNED  450

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+Y D +FT  GL+EQINTTRD SDYLWYMTDV++D  E FL+ G  P LTV SAGHA+
Sbjct  451   PSTYIDESFTMVGLVEQINTTRDTSDYLWYMTDVKVDANEGFLRNGDLPTLTVLSAGHAM  510

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             H+FINGQL G++YGSL++PK+TF K V LRAG NKI++LSIAVGLPNVGPHFETWNAGVL
Sbjct  511   HLFINGQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  570

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPVSL+GLN G+RDL+WQKW+YK+GLKGE LSLHSLSGSSSVEW EG+F+AQKQPLTWYK
Sbjct  571   GPVSLNGLNGGRRDLSWQKWTYKVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYK  630

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF APAG+ PLA+DM +MGKGQIWINGQS+GR+WP YKA  G+C  C+Y G F E KCL
Sbjct  631   TTFSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAV-GSCSECSYTGTFREDKCL  689

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CGEASQRWYHVPRSWL+P+GNLLV FEEWGG+P G++LV+REV SVCADIYEWQ  L+
Sbjct  690   RNCGEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGITLVRREVDSVCADIYEWQSTLV  749

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N+++ ASGK  +PL PKAHL CG GQKIT++KFASFGTP G+CGS+ +G+CHA HSYD F
Sbjct  750   NYQLHASGKVNKPLHPKAHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAF  809

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              K C+G N C+V V PE FGGDPCP+VMKKL+VE VC+
Sbjct  810   NKLCVGQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCA  847



>emb|CDY37486.1| BnaC01g37460D [Brassica napus]
Length=839

 Score =  1344 bits (3479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/822 (78%), Positives = 728/822 (89%), Gaps = 3/822 (0%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
             VSL +ASVSYD  +  ING+R+IL+SGSIHYPRS PEMWPDL++KAKEGGLDV+QTYVFW
Sbjct  19    VSLVSASVSYDSRAITINGKRRILISGSIHYPRSAPEMWPDLIRKAKEGGLDVIQTYVFW  78

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             NGHEP PGKYYFEG YDLVKF+KL +Q+GLY+HLR+GPY CAEWNFGGFPVWLKYVPG+S
Sbjct  79    NGHEPSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGIS  138

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDNGPFKA MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SYA
Sbjct  139   FRTDNGPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYA  198

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAAKMAVGLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT
Sbjct  199   NWAAKMAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFT  258

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
             +FGGPVPYRPAED+A++VA+FI KGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP+D
Sbjct  259   KFGGPVPYRPAEDMAFSVARFIQKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPLD  318

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             E+GL R+PKWGHLKDLHRAI LCEPALVSG    I LGNYQEA  +KSKSGAC+AFLAN 
Sbjct  319   EYGLERQPKWGHLKDLHRAINLCEPALVSGQLTRIPLGNYQEAHQYKSKSGACSAFLANY  378

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQS  1682
             NQ S+AKV+FG  HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+
Sbjct  379   NQRSYAKVSFGKNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHAGLSWQA  438

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             YNE+ SSY D +FT  GL+EQINTTRD SDYLWYMTDV+I+  E FL+GG  P LTV SA
Sbjct  439   YNEDPSSYVDESFTMVGLVEQINTTRDTSDYLWYMTDVKINSNEGFLRGGNLPTLTVLSA  498

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHA+HVFING L G++YGSL++PK+TF + V LRAG NKI++LSIAVGLPNVGPHFETWN
Sbjct  499   GHAMHVFINGHLTGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWN  558

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPVSL+GLN G+RDL+WQKW+YK+GL+GE LSLHSLSGSSSVEW EG+F+AQKQPL
Sbjct  559   AGVLGPVSLNGLNGGRRDLSWQKWTYKVGLRGESLSLHSLSGSSSVEWAEGAFVAQKQPL  618

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYKTTF APAG+ PLA+DM +MGKGQIWINGQSVGR+WP YKA  G C  C+Y G F+E
Sbjct  619   TWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSVGRHWPAYKAV-GTCRECSYIGTFNE  677

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
              KCL  CGEASQRWYHVPRSWL+PTGNLLV FEEWGG+P G+SLV+REV +VCADIYEWQ
Sbjct  678   NKCLRNCGEASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGISLVRREVDTVCADIYEWQ  737

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
               L+N+++ ASGK  +PL PK HL CG GQKIT++KFASFGTP+G+CGS+ +G+CHA HS
Sbjct  738   STLVNYQLHASGKVNKPLHPKVHLQCGPGQKITTVKFASFGTPQGTCGSYRQGSCHAHHS  797

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F + CIG N C+V V P  FGGDPCP+VMKKL+VE VC+
Sbjct  798   YDAFNRLCIGQNWCSVTVAPAMFGGDPCPNVMKKLAVEAVCA  839



>gb|ACP18875.1| beta-galactosidase pBG(a) [Carica papaya]
Length=836

 Score =  1343 bits (3476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 648/819 (79%), Positives = 734/819 (90%), Gaps = 5/819 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASVSYD  +  ING+R+ILLSGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHEP
Sbjct  19    ASVSYDHKAITINGKRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  78

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGKYYF G YDLV+FIKL +QAGLYVHLR+GPY CAEWNFGGFPVWLKY+PG++FRT+N
Sbjct  79    SPGKYYFGGNYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGIAFRTNN  138

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFKA MQ+FT  IV+MMK++ L+ESQGGPIILSQIENEYGPMEYELGA G++Y+QWAA+
Sbjct  139   GPFKAYMQRFTKKIVDMMKAEGLFESQGGPIILSQIENEYGPMEYELGAAGRAYSQWAAQ  198

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGLGTGVPWVMCKQDDAPDP++N+CNGFYCD+FSPNKAYKPKMWTEAWT WFTEFGG 
Sbjct  199   MAVGLGTGVPWVMCKQDDAPDPIINSCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGA  258

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VPYRP EDLA++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL+
Sbjct  259   VPYRPVEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLV  318

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PKWGHLKDLHRAIKLCEPALVSGDP+V+ LG +QEA VFKSK G CAAFLAN N  SF
Sbjct  319   RQPKWGHLKDLHRAIKLCEPALVSGDPSVMPLGRFQEAHVFKSKYGHCAAFLANYNPRSF  378

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSWQSYNEET  1667
             AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQS+RMKM PV     FSWQ+YNEE 
Sbjct  379   AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMVPVPIHGAFSWQAYNEEA  438

Query  1666  -SSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              SS  + +FT  GL+EQINTTRD SDYLWY TDV+IDP E FLK GK+P LTV SAGHAL
Sbjct  439   PSSNGERSFTTVGLVEQINTTRDVSDYLWYSTDVKIDPDEGFLKTGKYPTLTVLSAGHAL  498

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVF+N QL GT+YGSLE PK+TFSK V LRAG+NKIS+LSIAVGLPNVGPHFETWNAGVL
Sbjct  499   HVFVNDQLSGTAYGSLEFPKITFSKGVNLRAGINKISILSIAVGLPNVGPHFETWNAGVL  558

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPV+L+GLNEG+RDL+WQKWSYK+G++GE +SLHSLSGSSSVEW  GSF+A++QPLTW+K
Sbjct  559   GPVTLNGLNEGRRDLSWQKWSYKVGVEGEAMSLHSLSGSSSVEWTAGSFVARRQPLTWFK  618

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF+APAGN PLALDMN+MGKGQIWING+S+GR+WP YKAS G+CG C+YAG F+EKKCL
Sbjct  619   TTFNAPAGNSPLALDMNSMGKGQIWINGKSIGRHWPAYKAS-GSCGWCDYAGTFNEKKCL  677

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             S CGEASQRWYHVPRSW  PTGNLLV FEEWGG+P G+SLV+REV SVCADIYEWQP LM
Sbjct  678   SNCGEASQRWYHVPRSWPNPTGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEWQPTLM  737

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N++MQASGK  +PLRPKAHL CG GQKI+S+KFASFGTP G+CGS+ EG+CHA HSYD F
Sbjct  738   NYQMQASGKVNKPLRPKAHLQCGPGQKISSVKFASFGTPEGACGSYREGSCHAHHSYDAF  797

Query  589   QKYCIGWNSCTVPVTPEAFGGD-PCPSVMKKLSVEVVCS  476
             ++ C+G N C+V V P    G+ P PSVMKKL+VEVVCS
Sbjct  798   ERLCVGQNWCSVTVVPRNVSGEIPAPSVMKKLAVEVVCS  836



>gb|KHF98342.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=846

 Score =  1342 bits (3473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/824 (78%), Positives = 725/824 (88%), Gaps = 3/824 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             S V L + SVSYD  +  INGQR+ILLSGSIHYPRSTPEMWPDL++K KEGGLDV+QTYV
Sbjct  24    SGVCLVSGSVSYDHKAITINGQRRILLSGSIHYPRSTPEMWPDLIQKGKEGGLDVIQTYV  83

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP PGKYYF+G YDLVKFIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKY+PG
Sbjct  84    FWNGHEPAPGKYYFQGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  143

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             + FRT+NGPFKA MQ+FT  IV+MMK++RLYESQGGPIILSQIENEYGPMEYELGAPGK+
Sbjct  144   IIFRTNNGPFKAQMQRFTKKIVDMMKAERLYESQGGPIILSQIENEYGPMEYELGAPGKA  203

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y+ W+AKMA+GL TGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKA KPKMWTEAWT W
Sbjct  204   YSYWSAKMALGLATGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKANKPKMWTEAWTGW  263

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             +TEFGG VPYRPAEDLA++VA+FI KGGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  264   YTEFGGAVPYRPAEDLAFSVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAP  323

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GL R+PKWGHLKDLHRAIKLCEPALV GDP +I LGNYQEA +FK K+G CAAFLA
Sbjct  324   LDEYGLKRQPKWGHLKDLHRAIKLCEPALVYGDPTMIRLGNYQEAHLFKYKAGGCAAFLA  383

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSR--GFSW  1688
             N N   +A V+F N HYNLPPWSISILPDCKNTVYNTAR+GAQ +R KM PV    G SW
Sbjct  384   NYNSRDYATVSFRNNHYNLPPWSISILPDCKNTVYNTARIGAQIARKKMVPVPMHGGLSW  443

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             Q+YNEET+S  D++FT  GLLEQINTTRDA+DYLWY T+V+ID RE FL+ GK P LTV 
Sbjct  444   QAYNEETASDADSSFTMAGLLEQINTTRDATDYLWYTTEVKIDSREGFLRNGKSPVLTVL  503

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVF+NGQL G+SYGSLE PK+TFS+ V LRAG+NKISLLSIAVGLPNVGPHFET
Sbjct  504   SAGHALHVFVNGQLSGSSYGSLEFPKLTFSQGVNLRAGINKISLLSIAVGLPNVGPHFET  563

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGPV+L+GLNEG+RDL+WQKWSYKIGLKGE L+L SLSGSSSVEW + SF++Q+Q
Sbjct  564   WNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALNLLSLSGSSSVEWAQRSFVSQRQ  623

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYKTTF+APAGN PLALDM +MGKGQIWING+S+GR+WP YKASG  CG C+YAG F
Sbjct  624   PLTWYKTTFNAPAGNSPLALDMGSMGKGQIWINGKSIGRHWPAYKASGN-CGICSYAGTF  682

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             +EKKC + CG ASQRWYHVPRSWL PTGNLLV FEEWGG+P G++LV+RE  SVCADIYE
Sbjct  683   NEKKCGTNCGGASQRWYHVPRSWLNPTGNLLVVFEEWGGDPNGITLVRRETDSVCADIYE  742

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP LMN+ M+ASGK  +PLRPK HL C AGQKI+++KFASFGTP G CGS+ EG+CHA 
Sbjct  743   WQPNLMNYLMKASGKVNKPLRPKVHLECDAGQKISAVKFASFGTPGGVCGSYREGSCHAH  802

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             HSYD F + C+G N CTV V PE FGGDPCP+VMKKLSVEV+CS
Sbjct  803   HSYDAFTRLCVGQNFCTVTVAPEMFGGDPCPNVMKKLSVEVICS  846



>gb|KHG25378.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=843

 Score =  1341 bits (3471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/824 (78%), Positives = 725/824 (88%), Gaps = 3/824 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV   +++VSYD  +  INGQR+IL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYV
Sbjct  21    SWVCSVSSTVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  80

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP PGKYYFEG YDLVKFIKL +QAGLYVHLR+GPY CAEWNFGGFPVWLKY+PG
Sbjct  81    FWNGHEPAPGKYYFEGNYDLVKFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  140

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             ++FRT+NGPFKA M++FT MIVNMMK++RL+ESQGGPIILSQIENEYGP+EYE+G PGK+
Sbjct  141   INFRTNNGPFKAQMRRFTKMIVNMMKAERLFESQGGPIILSQIENEYGPVEYEIGEPGKA  200

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y  WAAKMAV LGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W
Sbjct  201   YTDWAAKMAVRLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGW  260

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FTEFGG VPYRPAED+A++VA+FI  GGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  261   FTEFGGAVPYRPAEDMAFSVARFIQTGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAP  320

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKLCE ALVSGDP V+ LG +QEA VF  KSG CAAFLA
Sbjct  321   LDEYGLLRQPKWGHLKDLHRAIKLCESALVSGDPTVMQLGVHQEAHVFNYKSGGCAAFLA  380

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSR--GFSW  1688
             N +  SFAKVAF +M+YNLPPWSISILPDCKNTVYNTARVGAQ +R KM PV    GFSW
Sbjct  381   NYDPKSFAKVAFRDMNYNLPPWSISILPDCKNTVYNTARVGAQIARKKMVPVPLHGGFSW  440

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             Q+Y+EET+S  D++FT  GLLEQINTTRDA+DYLWY TD+ IDP E F + GK P LT+ 
Sbjct  441   QAYSEETASDADSSFTMVGLLEQINTTRDATDYLWYTTDIEIDPDEEFFRNGKSPILTIL  500

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVF+NGQL G+SYGSLE PK+TFS+ V +RAG+NKI+LLSIAVGLPNVGPHFET
Sbjct  501   SAGHALHVFVNGQLSGSSYGSLEFPKLTFSQGVNMRAGINKIALLSIAVGLPNVGPHFET  560

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGPV+L+GLNEG+RDL+WQKWSYKIGLKGE L+LHSLSGSSSVEW EGS +AQ+Q
Sbjct  561   WNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALNLHSLSGSSSVEWAEGSLVAQRQ  620

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYKTTF+AP GN PLALDM +MGKGQIWINGQS+GR+WP YKASG  C  CNYAG +
Sbjct  621   PLTWYKTTFNAPTGNAPLALDMRSMGKGQIWINGQSIGRHWPAYKASGN-CSVCNYAGTY  679

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             DE KC + CGEASQRWYHVPRSWL PTGNLLV  EEWGG+P  +SLV RE  SVCADIYE
Sbjct  680   DEYKCRTNCGEASQRWYHVPRSWLNPTGNLLVVIEEWGGDPNAISLVHRETDSVCADIYE  739

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP LMN++M ASGKA +PLRPK HL C  GQKI+++KFASFGTP G CGS+ EG+CHA+
Sbjct  740   WQPTLMNYQMHASGKADKPLRPKVHLECDMGQKISAVKFASFGTPEGVCGSYREGSCHAY  799

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             HSYD F + C+G N C+V V PE FGGDPCP+VMKKLSVEV+CS
Sbjct  800   HSYDAFNRLCVGQNFCSVTVAPEMFGGDPCPNVMKKLSVEVICS  843



>ref|XP_009146456.1| PREDICTED: beta-galactosidase 1 [Brassica rapa]
Length=839

 Score =  1341 bits (3471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/813 (78%), Positives = 726/813 (89%), Gaps = 3/813 (0%)
 Frame = -2

Query  2908  YDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGK  2729
             YD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHEP PGK
Sbjct  28    YDSRAITINGERRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPSPGK  87

Query  2728  YYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPFK  2549
             YYFEG YDLVKF+KL QQ+GLY+HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDNGPFK
Sbjct  88    YYFEGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNGPFK  147

Query  2548  AAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVG  2369
             A MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY  WAAKMAVG
Sbjct  148   AQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAKMAVG  207

Query  2368  LGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYR  2189
             LGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGGPVPYR
Sbjct  208   LGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPVPYR  267

Query  2188  PAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPK  2009
             PAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL R+PK
Sbjct  268   PAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPK  327

Query  2008  WGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVA  1829
             WGHLKDLHRAIKLCEPALVSG+P  +SLGNYQEA V+KSKSGAC+AFLAN N  S+AKV+
Sbjct  328   WGHLKDLHRAIKLCEPALVSGEPTRMSLGNYQEAHVYKSKSGACSAFLANYNPRSYAKVS  387

Query  1828  FGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEETSSYD  1655
             FG+ HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+YNE+ S+Y 
Sbjct  388   FGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVEVPVHGGLSWQAYNEDPSTYI  447

Query  1654  DNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFIN  1475
             D +FT  GL+EQINTTRD SDYLWYMTDV+ID  E FL+ G  P LTV SAGHA+HVFIN
Sbjct  448   DESFTMVGLVEQINTTRDTSDYLWYMTDVKIDSNEGFLRTGDLPTLTVLSAGHAMHVFIN  507

Query  1474  GQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSL  1295
             GQL G++YGSL++PK+TF K V LRAG NKI++LSIAVGLPNVGPHFETWNAGVLGPV+L
Sbjct  508   GQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLGPVNL  567

Query  1294  SGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDA  1115
             +GLN G+RDL+WQKW+YK+GL+GE LSLHSL GSSSVEW EG+++AQKQPLTWYKTTF A
Sbjct  568   NGLNGGRRDLSWQKWTYKVGLRGESLSLHSLGGSSSVEWAEGAYVAQKQPLTWYKTTFSA  627

Query  1114  PAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGE  935
             PAG+ PLA+DM +MGKGQIWINGQSVGR+WP YKA  G+CG C+Y G F+E KCL  CGE
Sbjct  628   PAGDSPLAVDMGSMGKGQIWINGQSVGRHWPAYKAV-GSCGECSYTGTFNENKCLRNCGE  686

Query  934   ASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQ  755
             ASQRWYHVPRSWL+PTGNLLV FEEWGG+P G+SLV+REV SVCADIYEWQ  L+N+++ 
Sbjct  687   ASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEWQSTLVNYQLH  746

Query  754   ASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCI  575
             +SGK  +PL PK HL CG GQK+T++KFASFGTP G+CGS+ +G+CHA HSYD F + C+
Sbjct  747   SSGKVNKPLHPKVHLQCGPGQKMTTVKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRLCV  806

Query  574   GWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             G N C+V V PE FGGDPCP+VMKKL+VE VC+
Sbjct  807   GQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCA  839



>ref|XP_006300095.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
 gb|EOA32993.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
Length=846

 Score =  1340 bits (3469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/818 (78%), Positives = 727/818 (89%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             + SVSYD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  30    SGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHE  89

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEG YDLVKF+KL +Q+GLY+HLR+GPY CAEWNFGGFPVWLKY+PG+SFRTD
Sbjct  90    PSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  149

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKA MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY  WAA
Sbjct  150   NGPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAA  209

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             KMAVGLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG
Sbjct  210   KMAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGG  269

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVPYRPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  270   PVPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
              R+PKWGHLKDLHRAIKLCEPALVSG+P  + LGNYQEA V+KSKSGAC+AFLAN N  S
Sbjct  330   ERQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKSKSGACSAFLANYNPRS  389

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEE  1670
             +AKV+FGN HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+YNE+
Sbjct  390   YAKVSFGNNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNED  449

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+Y D +FT  GL+EQINTTRD SDYLWYMTDV+ID  E FL+ G  P LTV SAGHA+
Sbjct  450   PSTYIDESFTMVGLVEQINTTRDTSDYLWYMTDVKIDNNEGFLRNGDLPTLTVLSAGHAM  509

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFING L G++YGSL++PK+TF K V LRAG NKI++LSIAVGLPNVGPHFETWNAGVL
Sbjct  510   HVFINGHLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  569

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPVSL+GLN G+RDL+WQKW+YK+GLKGE LSLHSLSGSSSVEW EG+F+AQKQPLTWYK
Sbjct  570   GPVSLNGLNGGRRDLSWQKWTYKVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYK  629

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF APAG+ PLA+DM +MGKGQIWINGQS+GR+WP YKA  G+C  C+YAG F E KCL
Sbjct  630   TTFSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAV-GSCSECSYAGTFKEDKCL  688

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CGEASQRWYHVPRSWL+P+GNLLV FEEWGG+P G+SLV+REV +VCADIYEWQ  L+
Sbjct  689   RNCGEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGISLVRREVDTVCADIYEWQSTLV  748

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N+++ ASGK  +PL PK HL CG GQKIT++KFASFGTP G+CGS+ +G+CHA HSYD F
Sbjct  749   NYQLHASGKVNKPLHPKVHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAF  808

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + C+G N C+V V P  FGGDPCP+VMKKL+VE VC+
Sbjct  809   NRLCVGQNWCSVTVAPAMFGGDPCPNVMKKLAVEAVCA  846



>ref|XP_010465236.1| PREDICTED: beta-galactosidase 1 [Camelina sativa]
Length=846

 Score =  1339 bits (3466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/818 (78%), Positives = 729/818 (89%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             + SVSYD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  30    SGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHE  89

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEG YDLVKF+KL +Q+GLY+HLR+GPY CAEWNFGGFPVWLKY+PG+SFRTD
Sbjct  90    PSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  149

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKA MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY  WAA
Sbjct  150   NGPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAA  209

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             KMAVGLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG
Sbjct  210   KMAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGG  269

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVPYRPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  270   PVPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
              R+PKWGHLKDLHRAIKLCEPALVSG+P  + LGNYQEA V+K+KSGAC+AFLAN N  +
Sbjct  330   ERQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKAKSGACSAFLANYNPKA  389

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEE  1670
             +AKV+FG+ HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+YNE+
Sbjct  390   YAKVSFGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNED  449

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+Y D +FT  GL+EQINTTRD SDYLWYMTDV+ID  E FL+ G  P LTV SAGHA+
Sbjct  450   PSTYIDESFTMVGLVEQINTTRDTSDYLWYMTDVKIDNNEGFLRNGDLPTLTVLSAGHAM  509

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQL G++YGSL++PK+TF + V LRAG NKI++LSIAVGLPNVGPHFETWNAGVL
Sbjct  510   HVFINGQLSGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  569

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPVSL+GLN G+RDL+WQKW+YK+GLKGE LSLHSLSGSSSVEW EG+F+AQKQPLTWYK
Sbjct  570   GPVSLNGLNGGRRDLSWQKWTYKVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYK  629

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF APAG+ PLA+DM +MGKGQIWINGQS+GR+WP YKA  G+C  C+YAG F+E KCL
Sbjct  630   TTFSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAV-GSCSECSYAGTFNEDKCL  688

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CGEASQRWYHVPRSWL+P+GNLLV FEEWGG+P G+SLV+REV +VCADIYEWQ  L+
Sbjct  689   RNCGEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGISLVRREVDTVCADIYEWQSTLV  748

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N+++ ASGK  +PL PK HL CGAGQKIT++KFASFGTP G+CGS+ +G CHA HSYD F
Sbjct  749   NYQLHASGKVNKPLHPKVHLQCGAGQKITTVKFASFGTPEGTCGSYRQGGCHAHHSYDAF  808

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + C+G N C+V V P  FGGDPCP+VMKKL+VE VC+
Sbjct  809   NRLCVGQNWCSVTVAPAMFGGDPCPNVMKKLAVEAVCA  846



>ref|XP_002882842.1| hypothetical protein ARALYDRAFT_897617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59101.1| hypothetical protein ARALYDRAFT_897617 [Arabidopsis lyrata subsp. 
lyrata]
Length=847

 Score =  1339 bits (3466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/818 (78%), Positives = 727/818 (89%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             + SVSYD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  31    SGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHE  90

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEG YDLV+F+KL QQ+GLY+HLR+GPY CAEWNFGGFPVWLKY+PG+SFRTD
Sbjct  91    PSPGKYYFEGNYDLVRFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  150

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKA MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY  WAA
Sbjct  151   NGPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAA  210

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             KMAVGLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG
Sbjct  211   KMAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGG  270

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVPYRPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  271   PVPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  330

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
              R+PKWGHLKDLHRAIKLCEPALVSG+P  + LGNYQEA V+K+KSGAC+AFLAN N  S
Sbjct  331   ERQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKAKSGACSAFLANYNPKS  390

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEE  1670
             +AKV+FG+ HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+YNE+
Sbjct  391   YAKVSFGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNED  450

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+Y D +FT  GL+EQINTTRD SDYLWYMTDV+ID  E FL+ G  P LTV SAGHA+
Sbjct  451   PSTYIDESFTMVGLVEQINTTRDTSDYLWYMTDVKIDANEGFLRNGDLPTLTVLSAGHAM  510

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQL G++YGSL++PK+TF K V LRAG NKI++LSIAVGLPNVGPHFETWNAGVL
Sbjct  511   HVFINGQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  570

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPVSL+GL+ G+RDL+WQKW+YK+GLKGE LSLHSLSGSSSVEW EG+F+AQKQPLTWYK
Sbjct  571   GPVSLNGLSGGRRDLSWQKWTYKVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYK  630

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF APAG+ PLA+DM +MGKGQIWINGQS+GR+WP YKA  G+C  C+Y G F E KCL
Sbjct  631   TTFSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAV-GSCSECSYTGTFREDKCL  689

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CGEASQRWYHVPRSWL+P+GNLLV FEEWGG+P G+SLV+REV SVCADIYEWQ  L+
Sbjct  690   RNCGEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEWQSTLV  749

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N+++ ASGK  +PL PK HL CG GQKIT++KFASFGTP G+CGS+ +G+CH  HSYD F
Sbjct  750   NYQLHASGKVNKPLHPKVHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHDHHSYDAF  809

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              K C+G N C+V V PE FGGDPCP+VMKKL+VE VC+
Sbjct  810   NKLCVGQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCA  847



>ref|XP_010487145.1| PREDICTED: beta-galactosidase 1-like [Camelina sativa]
Length=846

 Score =  1338 bits (3463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/818 (77%), Positives = 728/818 (89%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             + SVSYD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  30    SGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHE  89

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEG YDLVKF+KL +Q+GLY+HLR+GPY CAEWNFGGFPVWLKY+PG+SFRTD
Sbjct  90    PSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  149

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKA MQ FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY  WAA
Sbjct  150   NGPFKAQMQSFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAA  209

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             KMAVGLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG
Sbjct  210   KMAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGG  269

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVPYRPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  270   PVPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
              R+PKWGHLKDLHRAIKLCEPALVSG+P  + LGNYQEA V+K+KSGAC+AFLAN N  +
Sbjct  330   ERQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKAKSGACSAFLANYNPKA  389

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEE  1670
             +AKV+FG+ HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+YNE+
Sbjct  390   YAKVSFGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNED  449

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+Y D +FT  GL+EQINTTRD SDYLWYMTDV+ID  E FL+ G  P LTV SAGHA+
Sbjct  450   PSTYIDESFTMVGLVEQINTTRDTSDYLWYMTDVKIDNNEGFLRNGDLPTLTVLSAGHAM  509

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFING L G++YGSL++PK+TF + V LRAG NKI++LSIAVGLPNVGPHFETWNAGVL
Sbjct  510   HVFINGHLSGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  569

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPVSL+GLN G+RDL+WQKW+YK+GLKGE LSLHSLSGSSSVEW EG+F+AQKQPLTWYK
Sbjct  570   GPVSLNGLNGGRRDLSWQKWTYKVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYK  629

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF APAG+ PLA+DM +MGKGQIWINGQS+GR+WP YKA  G+C  C+YAG F+E KCL
Sbjct  630   TTFSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAV-GSCSECSYAGTFNEDKCL  688

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CGEASQRWYHVPRSWL+P+GNLLV FEEWGG+P G+SLV+REV +VCADIYEWQ  L+
Sbjct  689   RNCGEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGISLVRREVDTVCADIYEWQSTLV  748

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N+++ ASGK  +PL PK HL CGAGQKIT++KFASFGTP G+CGS+ +G+CHA HSYD F
Sbjct  749   NYQLHASGKVNKPLHPKVHLQCGAGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAF  808

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + C+G N C+V V P  FGGDPCP+VMKKL+VE VC+
Sbjct  809   NRLCVGQNWCSVTVAPAMFGGDPCPNVMKKLAVEAVCA  846



>emb|CDX97513.1| BnaA05g25660D [Brassica napus]
Length=840

 Score =  1338 bits (3462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/813 (78%), Positives = 725/813 (89%), Gaps = 3/813 (0%)
 Frame = -2

Query  2908  YDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGK  2729
             YD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHEP PGK
Sbjct  29    YDSRAITINGERRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPSPGK  88

Query  2728  YYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPFK  2549
             YYFEG YDLVKF+KL QQ+GLY+HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN PFK
Sbjct  89    YYFEGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNAPFK  148

Query  2548  AAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVG  2369
             A MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY  WAAKMAVG
Sbjct  149   AQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAKMAVG  208

Query  2368  LGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYR  2189
             LGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGGPVPYR
Sbjct  209   LGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPVPYR  268

Query  2188  PAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPK  2009
             PAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL R+PK
Sbjct  269   PAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPK  328

Query  2008  WGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVA  1829
             WGHLKDLHRAIKLCEPALVSG+P  +SLGNYQEA V+KSKSGAC+AFLAN N  S+AKV+
Sbjct  329   WGHLKDLHRAIKLCEPALVSGEPTRMSLGNYQEAHVYKSKSGACSAFLANYNPRSYAKVS  388

Query  1828  FGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEETSSYD  1655
             FG+ HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+YNE+ S+Y 
Sbjct  389   FGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVEVPVHGGLSWQAYNEDPSTYI  448

Query  1654  DNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFIN  1475
             D +FT  GL+EQINTTRD SDYLWYMTDV+ID  E FL+ G  P LTV SAGHA+HVFIN
Sbjct  449   DESFTMVGLVEQINTTRDTSDYLWYMTDVKIDSNEGFLRTGDLPTLTVLSAGHAMHVFIN  508

Query  1474  GQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSL  1295
             GQL G++YGSL++PK+TF K V LRAG NKI++LSIAVGLPNVGPHFETWNAGVLGPV+L
Sbjct  509   GQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLGPVNL  568

Query  1294  SGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDA  1115
             +GLN G+RDL+WQKW+YK+GL+GE LSLHSL GSSSVEW EG+++AQKQPLTWYKTTF A
Sbjct  569   NGLNGGRRDLSWQKWTYKVGLRGESLSLHSLGGSSSVEWAEGAYVAQKQPLTWYKTTFSA  628

Query  1114  PAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGE  935
             PAG+ PLA+DM +MGKGQIWINGQSVGR+WP YKA  G+CG C+Y G F+E KCL  CGE
Sbjct  629   PAGDSPLAVDMGSMGKGQIWINGQSVGRHWPAYKAV-GSCGECSYTGTFNENKCLRNCGE  687

Query  934   ASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQ  755
             ASQRWYHVPRSWL+PTGNLLV FEEWGG+P G+SLV+REV SVCADIYEWQ  L+N+++ 
Sbjct  688   ASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEWQSTLVNYQLH  747

Query  754   ASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCI  575
             +SGK  +PL PK HL CG GQK+T++KFASFGTP G+CGS+ +G+CHA HSYD F + C+
Sbjct  748   SSGKVNKPLHPKVHLQCGPGQKMTTVKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRLCV  807

Query  574   GWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             G N C+V V PE FGGDPCP+VMKKL+VE VC+
Sbjct  808   GQNWCSVTVAPEMFGGDPCPNVMKKLAVEAVCA  840



>ref|NP_001266102.1| beta-galactosidase 1-like precursor [Cicer arietinum]
 emb|CAA07236.2| beta-galactosidase precursor [Cicer arietinum]
Length=839

 Score =  1337 bits (3461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 648/817 (79%), Positives = 738/817 (90%), Gaps = 3/817 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASVSYD  +  INGQRKILLSGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHEP
Sbjct  24    ASVSYDYKAITINGQRKILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGKYYFEG YDLVKFI+L QQAGLYVHLR+GPYACAEWNFGGFPVWLKY+PG+SFRTDN
Sbjct  84    SPGKYYFEGNYDLVKFIRLVQQAGLYVHLRIGPYACAEWNFGGFPVWLKYIPGISFRTDN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFK  MQKFTT IVN+MK++RLYESQGGPIILSQIENEYGPMEYELGAPGK+YAQWAA 
Sbjct  144   GPFKFQMQKFTTKIVNIMKAERLYESQGGPIILSQIENEYGPMEYELGAPGKAYAQWAAH  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MA+GLGTGVPWVMCKQDDAPDPV+N CNGFYCD+FSPNKAYKPKMWTEAWT WFT FGG 
Sbjct  204   MAIGLGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTGFGGT  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP+RPAEDLA++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GLL
Sbjct  264   VPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLL  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PKWGHLKDLHRAIKLCEPALVS DP V  LGNYQEA VFKSKSGACAAFLAN N HS+
Sbjct  324   RQPKWGHLKDLHRAIKLCEPALVSADPTVTRLGNYQEAHVFKSKSGACAAFLANYNPHSY  383

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMT--PVSRGFSWQSYNEET  1667
             + VAFGN HYNLPPWSISILP+CK+TVYNTAR+G+QS++MKMT  P+  G SW+++NEET
Sbjct  384   STVAFGNQHYNLPPWSISILPNCKHTVYNTARLGSQSAQMKMTRVPIHGGLSWKAFNEET  443

Query  1666  SSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             ++ DD++FT TGLLEQIN TRD SDYLWY TDV I+P E + + GK P LTV SAGHALH
Sbjct  444   TTTDDSSFTVTGLLEQINATRDLSDYLWYSTDVVINPDEGYFRNGKNPVLTVLSAGHALH  503

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQL GT YGSL+ PK+TFS++V LRAGVNKISLLS+AVGLPNVGPHFETWNAGVLG
Sbjct  504   VFINGQLSGTVYGSLDFPKLTFSESVNLRAGVNKISLLSVAVGLPNVGPHFETWNAGVLG  563

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKT  1127
             P++L+GLNEG+RDLTWQKWSYK+GLKGE LSLHSLSGSSSV+W++G  ++++QPLTWYKT
Sbjct  564   PITLNGLNEGRRDLTWQKWSYKVGLKGEDLSLHSLSGSSSVDWLQGYLVSRRQPLTWYKT  623

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
             TFDAPAG  PLALDMN+MGKGQ+W+NGQS+GRYWP YKA+ G+C  CNYAG ++EKKC +
Sbjct  624   TFDAPAGVAPLALDMNSMGKGQVWLNGQSLGRYWPAYKAT-GSCDYCNYAGTYNEKKCGT  682

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CGEASQRWYHVP SWL+PTGNLLV FEE GG+P GV LV+R++ SVCADIYEWQP L++
Sbjct  683   NCGEASQRWYHVPHSWLKPTGNLLVMFEELGGDPNGVFLVRRDIDSVCADIYEWQPNLVS  742

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             ++MQASGK +RP+ PKAHLSCG GQKI+SIKFASFGTP GSCG++ EG+CHA  SYD FQ
Sbjct  743   YQMQASGKVSRPVSPKAHLSCGPGQKISSIKFASFGTPVGSCGNYREGSCHAHKSYDAFQ  802

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             + C+G +SCTV V+PE FGGDPCP+VMKKLSVE +C+
Sbjct  803   RNCVGQSSCTVTVSPEIFGGDPCPNVMKKLSVEAICT  839



>ref|XP_010501131.1| PREDICTED: beta-galactosidase 1-like [Camelina sativa]
Length=846

 Score =  1336 bits (3458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/818 (77%), Positives = 728/818 (89%), Gaps = 3/818 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             + SVSYD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  30    SGSVSYDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHE  89

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFEG YDLVKF+KL +Q+GLY+HLR+GPY CAEWNFGGFPVWLKY+PG+SFRTD
Sbjct  90    PSPGKYYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTD  149

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKA MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY  WAA
Sbjct  150   NGPFKAQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAA  209

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             KMAVGLGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGG
Sbjct  210   KMAVGLGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGG  269

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVPYRPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  270   PVPYRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  329

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
              R+PKWGHLKDLHRAIKLCEPALVSG+P  + LGNYQEA V+K+KSGAC+AFLAN N  +
Sbjct  330   ERQPKWGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKAKSGACSAFLANYNPKA  389

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEE  1670
             +AKV+FG+ HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+YNE+
Sbjct  390   YAKVSFGSNHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVRVPVHGGLSWQAYNED  449

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+Y D +FT  GL+EQINTTRD SDYLWYMTDV+ID  E FL+ G  P LTV SAGHA+
Sbjct  450   PSTYIDESFTMVGLVEQINTTRDTSDYLWYMTDVKIDNNEGFLRNGDLPTLTVLSAGHAM  509

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFING L G++YGSL++PK+TF + V LRAG NKI++LSIAVGLPNVGPHFETWNAGVL
Sbjct  510   HVFINGHLSGSAYGSLDSPKLTFRRGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVL  569

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPVSL+GLN G+RDL+WQKW+YK+GLKGE LSLHSLSGSSSVEW EG+F+AQKQPLTWYK
Sbjct  570   GPVSLNGLNGGRRDLSWQKWTYKVGLKGESLSLHSLSGSSSVEWAEGAFVAQKQPLTWYK  629

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF APAG+ PLA+DM +MGKGQIWINGQS+GR+WP YKA  G+C  C+YAG F+E KCL
Sbjct  630   TTFSAPAGDSPLAVDMGSMGKGQIWINGQSLGRHWPAYKAV-GSCSECSYAGTFNEDKCL  688

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CGEASQRWYHVPRSWL+P+GNLLV FEEWGG+P G+SLV+REV +VCADIYEWQ  L+
Sbjct  689   RNCGEASQRWYHVPRSWLKPSGNLLVVFEEWGGDPNGISLVRREVDTVCADIYEWQSTLV  748

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N+++ A+GK  +PL PK HL CGAGQKIT++KFASFGTP G+CGS+ +G CHA HSYD F
Sbjct  749   NYQLHAAGKVNKPLHPKVHLQCGAGQKITNVKFASFGTPEGTCGSYRQGGCHAHHSYDAF  808

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + C+G N C+V V P  FGGDPCP+VMKKL+VE VC+
Sbjct  809   NRLCVGQNWCSVTVAPAMFGGDPCPNVMKKLAVEAVCA  846



>ref|XP_006407174.1| hypothetical protein EUTSA_v10020056mg [Eutrema salsugineum]
 gb|ESQ48627.1| hypothetical protein EUTSA_v10020056mg [Eutrema salsugineum]
Length=846

 Score =  1335 bits (3456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/813 (78%), Positives = 724/813 (89%), Gaps = 3/813 (0%)
 Frame = -2

Query  2908  YDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGK  2729
             YD  +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHEP PGK
Sbjct  35    YDSRAITINGKRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPSPGK  94

Query  2728  YYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPFK  2549
             YYFEG YDLVKF+KL +Q+GLY+HLR+GPY CAEWNFGGFPVWLKY+PG+SFRTDNGPFK
Sbjct  95    YYFEGNYDLVKFVKLVKQSGLYLHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDNGPFK  154

Query  2548  AAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVG  2369
             A MQ+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY  WAAKMAVG
Sbjct  155   AQMQRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAKMAVG  214

Query  2368  LGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYR  2189
             LGTGVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGGPVPYR
Sbjct  215   LGTGVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPVPYR  274

Query  2188  PAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPK  2009
             PAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL R+PK
Sbjct  275   PAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPK  334

Query  2008  WGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVA  1829
             WGHLKDLHRAIKLCEPALVSG+P  + LGNYQEA V+KSKSGAC+AFLAN N  S+AKV+
Sbjct  335   WGHLKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKSKSGACSAFLANYNPRSYAKVS  394

Query  1828  FGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEETSSYD  1655
             FG+ HYNLPPWSISILPDCKNTVYNTARVG+Q+SRMKM   PV  G SWQ+YNE+ S+Y 
Sbjct  395   FGSNHYNLPPWSISILPDCKNTVYNTARVGSQTSRMKMVRVPVHGGLSWQAYNEDPSTYV  454

Query  1654  DNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFIN  1475
             D +FT  GL+EQINTTRD SDYLWYMTD++ID  E FL+ G  P LTV SAGHA+HVFIN
Sbjct  455   DESFTMVGLVEQINTTRDTSDYLWYMTDLKIDSNEGFLRTGDLPTLTVLSAGHAMHVFIN  514

Query  1474  GQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSL  1295
             GQL G++YGSL++PK+TF K V LRAG NKI++LSIAVGLPNVGPHFETWNAGVLGPVSL
Sbjct  515   GQLSGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLGPVSL  574

Query  1294  SGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDA  1115
             +GLN G+RDL+WQKW+YK+GL+GE LSLHSLSGS+SVEW EG+F+AQKQPLTWYKTTF A
Sbjct  575   NGLNGGRRDLSWQKWTYKVGLRGESLSLHSLSGSTSVEWAEGAFVAQKQPLTWYKTTFSA  634

Query  1114  PAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGE  935
             PAG+ PLA+DM +MGKGQIWINGQSVGR+WP YKA  G+C  C+Y G F+E KCL  CGE
Sbjct  635   PAGDSPLAVDMGSMGKGQIWINGQSVGRHWPAYKAV-GSCSECSYKGTFNENKCLRNCGE  693

Query  934   ASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQ  755
             ASQRWYHVPRSWL+PTGNLLV FEEWGG+P G+SLV+REV SVCADIYEWQ  L+N+++ 
Sbjct  694   ASQRWYHVPRSWLKPTGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEWQSTLVNYQLH  753

Query  754   ASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCI  575
             ASGK  +PL PK HL CG GQKIT++KFASFGTP G+CGS+ +G+CHA HSYD F + C+
Sbjct  754   ASGKVNKPLHPKVHLQCGPGQKITTVKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRLCV  813

Query  574   GWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             G N C+V V P  FGGDPCP+VMKKL+VE VC+
Sbjct  814   GQNWCSVTVAPAMFGGDPCPNVMKKLAVEAVCA  846



>gb|KEH18344.1| beta-galactosidase [Medicago truncatula]
Length=838

 Score =  1335 bits (3455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/825 (78%), Positives = 735/825 (89%), Gaps = 3/825 (0%)
 Frame = -2

Query  2944  TSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             +S +  G ASVSYD  +  INGQR+ILLSGSIHYPRSTPEMWPDL++KAKEGGLDV+QTY
Sbjct  15    SSLIGYGEASVSYDHKAITINGQRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTY  74

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWNGHEP PGKYYFEG YDLVKFIKL  QAGLYVHLRVGPYACAEWNFGGFPVWLKY+P
Sbjct  75    VFWNGHEPSPGKYYFEGNYDLVKFIKLVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYIP  134

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G+SFRTDNGPFK  MQ+FTT IVN+MK++RLYESQGGPIILSQIENEYGPMEYELGAP K
Sbjct  135   GISFRTDNGPFKIQMQRFTTKIVNIMKAERLYESQGGPIILSQIENEYGPMEYELGAPAK  194

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y QWAA MAVGL TGVPWVMCKQDDAPDPV+N CNGFYCD+FSPNKAYKPKMWTEAWT 
Sbjct  195   AYTQWAAHMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKMWTEAWTG  254

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             WFT FG PVP+RPAEDLA+++A+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDA
Sbjct  255   WFTGFGTPVPHRPAEDLAFSIARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDA  314

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DE+GLLR+PKWGHLKDLHRAIKLCEPALVS DP V  LGNYQEA VFKSKSGACAAFL
Sbjct  315   PLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSADPTVTRLGNYQEAHVFKSKSGACAAFL  374

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMT--PVSRGFS  1691
             AN N  S+A V+FGN HYNLPPWSISILP+CK+TVYNTARVG+QS++MKM+  P+  G S
Sbjct  375   ANYNPRSYATVSFGNQHYNLPPWSISILPNCKHTVYNTARVGSQSAQMKMSRVPIHGGLS  434

Query  1690  WQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTV  1511
             WQ++NEET++ DD++FT TGLLEQ+N TRD SDYLWY TDV I+  E F + GK P LTV
Sbjct  435   WQAFNEETTTTDDSSFTVTGLLEQVNATRDLSDYLWYSTDVVINSNEGFFRNGKNPVLTV  494

Query  1510  YSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFE  1331
              SAGHALHVFINGQL GT+YGS++ PK+TFS++V LRAGVNKISLLS+AVGLPN+GPHFE
Sbjct  495   LSAGHALHVFINGQLSGTAYGSVDFPKLTFSESVKLRAGVNKISLLSVAVGLPNIGPHFE  554

Query  1330  TWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK  1151
             TWNAGVLGP+SL+GLNEG+RDLTWQKWSYK+GLKGE LSLHSL+GSSSV+W++G  +++K
Sbjct  555   TWNAGVLGPISLNGLNEGRRDLTWQKWSYKVGLKGEALSLHSLTGSSSVDWLQGYLVSRK  614

Query  1150  QPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGW  971
             QPLTWYKTTFDAPAG  PLALDMN+MGKGQ+W+NGQ++GRYWP YKAS G+C  CNYAG 
Sbjct  615   QPLTWYKTTFDAPAGVAPLALDMNSMGKGQMWLNGQNLGRYWPAYKAS-GSCDYCNYAGT  673

Query  970   FDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIY  791
             ++EKKC S CGEASQRWYHVP+SWL+PTGNLLV FEE GG+P GVSLV+R++ SVCADIY
Sbjct  674   YNEKKCGSNCGEASQRWYHVPKSWLKPTGNLLVMFEELGGDPNGVSLVRRDIDSVCADIY  733

Query  790   EWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHA  611
             EWQP L++++MQASGK   P+ PKAHLSCG GQKI+SIKFASFGTP GSCG++ EG+CHA
Sbjct  734   EWQPNLVSYQMQASGKVKIPVSPKAHLSCGPGQKISSIKFASFGTPVGSCGNYREGSCHA  793

Query  610   FHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
               SYD FQK C+G +SCTV V+P  FGGDPCP VMKKLSVE +C+
Sbjct  794   HKSYDAFQKNCVGQSSCTVTVSPGIFGGDPCPHVMKKLSVEAICT  838



>ref|XP_004486826.1| PREDICTED: beta-galactosidase 1-like [Cicer arietinum]
Length=847

 Score =  1335 bits (3455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/824 (78%), Positives = 725/824 (88%), Gaps = 3/824 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             S +   TASVSYD  +  INGQR+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYV
Sbjct  25    SLIHSATASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYV  84

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP P KYYFEG YDLVKFIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKY+PG
Sbjct  85    FWNGHEPSPDKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPG  144

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDN PFK  MQKFT  IV MMK +RLYESQGGPIILSQIENEYGP+EYE+GAPGKS
Sbjct  145   ISFRTDNEPFKFQMQKFTEKIVGMMKEERLYESQGGPIILSQIENEYGPVEYEIGAPGKS  204

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y +WAA MA+GLGTGVPW+MCKQDDAPDPV+N CNGFYCD+FSPNKAYKPKMWTEAWT W
Sbjct  205   YTKWAADMAIGLGTGVPWIMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKMWTEAWTGW  264

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FTEFGGPVP+RPAEDLA++VA+FI KGGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  265   FTEFGGPVPHRPAEDLAFSVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAP  324

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GLLR+PKWGHLKDLHRAIKL EPALVSGDP V  +GNYQEA VFKSKSGACAAFLA
Sbjct  325   LDEYGLLRQPKWGHLKDLHRAIKLSEPALVSGDPTVTRIGNYQEAHVFKSKSGACAAFLA  384

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMT--PVSRGFSW  1688
             N N  S+A VAFGNMHYNLPPWSISILPDCKNTVYNTARVG+QS++MKMT  P+  G SW
Sbjct  385   NYNPKSYATVAFGNMHYNLPPWSISILPDCKNTVYNTARVGSQSAQMKMTRVPIHGGLSW  444

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             Q + E+T+S DD++FT TGLLEQ+NTTRD +DYLWY TDV ID  E FL  GK P LTV 
Sbjct  445   QVFTEQTASTDDSSFTMTGLLEQLNTTRDLTDYLWYSTDVVIDTDEGFLSSGKDPVLTVL  504

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVF+N QL GT YGSLE PK+TFS+ V LR GVNKISLLS+AVGLPNVGPHFET
Sbjct  505   SAGHALHVFVNDQLSGTIYGSLEFPKLTFSQNVKLRPGVNKISLLSVAVGLPNVGPHFET  564

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGP++L+GLNEG+RDLTWQKWSYK+GL GE LSLHSLSGSSSV+W++GS ++Q+Q
Sbjct  565   WNAGVLGPITLNGLNEGRRDLTWQKWSYKVGLNGESLSLHSLSGSSSVDWIQGSLVSQRQ  624

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYKTTFDAP G  P ALDM +MGKGQ+W+NGQ++GRYWP YKAS G C  C+YAG +
Sbjct  625   PLTWYKTTFDAPDGIAPFALDMGSMGKGQVWLNGQNIGRYWPAYKAS-GTCDDCDYAGTY  683

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             +E KC S CGEASQ WYHVPRSWL PTGNLLV FEE GG+P G+SLV+R++ SVCADIYE
Sbjct  684   NENKCRSNCGEASQTWYHVPRSWLIPTGNLLVVFEELGGDPNGISLVRRDIDSVCADIYE  743

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP L++++MQ SGK ++P+RPKAHLSCG GQKI+SIKFASFGTP GSCG+F EG+CHA 
Sbjct  744   WQPNLISYQMQTSGKVSKPVRPKAHLSCGPGQKISSIKFASFGTPVGSCGNFHEGSCHAH  803

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              SY+ F++ CIG N CTV V+PE FGGDPCP+VMKKLSVE +C+
Sbjct  804   KSYNAFERNCIGQNLCTVTVSPENFGGDPCPNVMKKLSVEAICT  847



>ref|XP_010686091.1| PREDICTED: beta-galactosidase 1 [Beta vulgaris subsp. vulgaris]
Length=841

 Score =  1334 bits (3452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/818 (78%), Positives = 720/818 (88%), Gaps = 1/818 (0%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   SV YD  +  INGQR+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNG
Sbjct  25    LVNGSVGYDHKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNG  84

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEPQ GKYYFE RYDLVKFIKL QQAGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  85    HEPQQGKYYFEERYDLVKFIKLVQQAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  144

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDNGPFKAAMQ+FT  IVNMMK+++LYE+QGGPIILSQIENEYGPMEYELGAPGK+Y  W
Sbjct  145   TDNGPFKAAMQRFTEKIVNMMKAEKLYETQGGPIILSQIENEYGPMEYELGAPGKTYTHW  204

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MA+GL TGVPWVMCKQDDAPDPV+N CNGFYCD+FSPNKAYKPKMWTEAWT W+TEF
Sbjct  205   AANMALGLRTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEF  264

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGPVP RPAEDLA+ +A+FI KGGS++NYYM+HGGTNF RTAGGPFIATSYDYDAP+DEF
Sbjct  265   GGPVPTRPAEDLAFGIARFIQKGGSYVNYYMYHGGTNFDRTAGGPFIATSYDYDAPLDEF  324

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GLL++PKWGHLKDLHRAIKLCEPALVS DP V+ LG+ QEA VFKS SGACAAFLAN N 
Sbjct  325   GLLKQPKWGHLKDLHRAIKLCEPALVSSDPTVVRLGSSQEAHVFKSGSGACAAFLANYNP  384

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEE  1670
              S+AKVA+GN HYNLPPWSISILPDCKNTVYNTARVGAQS++MK TPV   FSWQSYNEE
Sbjct  385   SSYAKVAYGNNHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKFTPVYNHFSWQSYNEE  444

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
             T+S DD+ FT  GLLEQ+NTTRD +DYLWYMTDV+ID  E FLKGGK P L V SAGHAL
Sbjct  445   TASTDDSAFTVLGLLEQVNTTRDMTDYLWYMTDVKIDSNEGFLKGGKEPVLNVMSAGHAL  504

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HV+INGQLVGT+YGSLENPK++F + V +RAG NKISLLSIAVGLPNVGP+FE WNAG+L
Sbjct  505   HVYINGQLVGTAYGSLENPKISFGEGVNMRAGTNKISLLSIAVGLPNVGPNFERWNAGIL  564

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPVSLSGLNEG+RDLTWQKWSYKIG+KGE LSLHSLSG S+VEWVEG F+AQ+QPLTWYK
Sbjct  565   GPVSLSGLNEGRRDLTWQKWSYKIGMKGETLSLHSLSGVSNVEWVEGKFLAQRQPLTWYK  624

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF+AP+GNEPLALDM  MGKGQ+WINGQ++GRYWP Y A  G+C  C+YAG+F EKKCL
Sbjct  625   TTFNAPSGNEPLALDMGAMGKGQVWINGQNIGRYWPAYTAK-GSCSDCSYAGYFSEKKCL  683

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             + CG+ASQRWYHVPRSWL+P GNL+V FEE  G P  +SL+K+E++S+CADI EWQP L+
Sbjct  684   TYCGDASQRWYHVPRSWLKPRGNLMVVFEEMSGAPNFISLMKKEISSICADINEWQPTLV  743

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW +++SG+  +PLRPKAHL C  GQKI+SIKFASFGTP GSCG++ +G CHA +SYDIF
Sbjct  744   NWHLKSSGRIDKPLRPKAHLWCAPGQKISSIKFASFGTPEGSCGNYKQGNCHAHNSYDIF  803

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             QK C+G   C + V P  FGGDPCP+VMKKL+VE +CS
Sbjct  804   QKDCVGQPGCAITVEPRLFGGDPCPNVMKKLAVEAICS  841



>gb|KHN32687.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =  1332 bits (3448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/839 (78%), Positives = 750/839 (89%), Gaps = 10/839 (1%)
 Frame = -2

Query  2986  MWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLL  2807
             MW+V ++L+  L+G++      ASVSYD  +  INGQR+IL+SGSIHYPRSTPEMWPDL+
Sbjct  1     MWNVALLLVFSLIGSA-----KASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLI  55

Query  2806  KKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAE  2627
             +KAK+GGLDV+QTYVFWNGHEP PGKYYFEG YDLVKFIKL QQAGLYVHLR+GPY CAE
Sbjct  56    QKAKDGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAE  115

Query  2626  WNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIEN  2447
             WNFGGFPVWLKY+PG+SFRTDN PFK  MQKFTT IV++MK++RLYESQGGPII+SQIEN
Sbjct  116   WNFGGFPVWLKYIPGISFRTDNEPFKHQMQKFTTKIVDLMKAERLYESQGGPIIMSQIEN  175

Query  2446  EYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPN  2267
             EYGPMEYE+GA GK+Y +WAA+MA+GLGTGVPWVMCKQDD PDP++N CNGFYCD+FSPN
Sbjct  176   EYGPMEYEIGAAGKAYTKWAAEMAMGLGTGVPWVMCKQDDTPDPLINTCNGFYCDYFSPN  235

Query  2266  KAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRT  2087
             KAYKPKMWTEAWT WFTEFGGPVP+RPAEDLA++VA+FI KGGSFINYYM+HGGTNFGRT
Sbjct  236   KAYKPKMWTEAWTGWFTEFGGPVPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRT  295

Query  2086  AGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEA  1907
             AGGPFIATSYDYDAP+DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V  +GNYQEA
Sbjct  296   AGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTKIGNYQEA  355

Query  1906  RVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSS  1727
              VFKSKSGACAAFLAN N  S+A VAFGNMHYNLPPWSISILPDCKNTVYNTARVG+QS+
Sbjct  356   HVFKSKSGACAAFLANYNPKSYATVAFGNMHYNLPPWSISILPDCKNTVYNTARVGSQSA  415

Query  1726  RMKMT--PVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPR  1553
             +MKMT  P+  GFSW S+NEET++ DD++FT TGLLEQ+NTTRD SDYLWY TDV +DP 
Sbjct  416   QMKMTRVPIHGGFSWLSFNEETTTTDDSSFTMTGLLEQLNTTRDLSDYLWYSTDVVLDPN  475

Query  1552  EAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLL  1373
             E FL+ GK P LTV+SAGHALHVFINGQL GT+YGSLE PK+TF++ V LRAGVNKISLL
Sbjct  476   EGFLRNGKDPVLTVFSAGHALHVFINGQLSGTAYGSLEFPKLTFNEGVKLRAGVNKISLL  535

Query  1372  SIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgs  1193
             S+AVGLPNVGPHFETWNAGVLGP+SLSGLNEG+RDL+WQKWSYK+GLKGE+LSLHSLSGS
Sbjct  536   SVAVGLPNVGPHFETWNAGVLGPISLSGLNEGRRDLSWQKWSYKVGLKGEILSLHSLSGS  595

Query  1192  ssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYK  1013
             SSVEW++GS ++Q+QPLTWYKTTFDAPAG  PLALDM++MGKGQ+W+NGQ++GRYWP YK
Sbjct  596   SSVEWIQGSLVSQRQPLTWYKTTFDAPAGTAPLALDMDSMGKGQVWLNGQNLGRYWPAYK  655

Query  1012  ASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVS  833
             AS G C  C+YAG ++E KC S CGEASQRWYHVP+SWL+PTGNLLV FEE GG+P G+ 
Sbjct  656   AS-GTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGNLLVVFEELGGDPNGIF  714

Query  832   LVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTP  653
             LV+R++ SVCADIYEWQP L++++MQ SGKA  P+RPK HLSC  GQKI+SIKFASFGTP
Sbjct  715   LVRRDIDSVCADIYEWQPNLISYQMQTSGKA--PVRPKVHLSCSPGQKISSIKFASFGTP  772

Query  652   RGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              GSCG+F EG+CHA  SYD F++ C+G N CTV V+PE FGGDPCP+V+KKLSVE +CS
Sbjct  773   AGSCGNFHEGSCHAHKSYDAFERNCVGQNWCTVTVSPENFGGDPCPNVLKKLSVEAICS  831



>emb|CDY23637.1| BnaC05g39570D [Brassica napus]
Length=839

 Score =  1331 bits (3445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/810 (78%), Positives = 723/810 (89%), Gaps = 3/810 (0%)
 Frame = -2

Query  2899  HSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYF  2720
              +  ING+R+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHEP PGKYYF
Sbjct  31    RAITINGERRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEPSPGKYYF  90

Query  2719  EGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAM  2540
             EG YDLVKF+KL QQ+GLY+HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDNGPFKA M
Sbjct  91    EGNYDLVKFVKLVQQSGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNGPFKAQM  150

Query  2539  QKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGT  2360
             Q+FTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELGAPG+SY  WAAKMAVGLGT
Sbjct  151   QRFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGAPGRSYTNWAAKMAVGLGT  210

Query  2359  GVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAE  2180
             GVPWVMCKQDDAPDP++NACNGFYCD+FSPNKAYKPKMWTEAWT WFT+FGGPVPYRPAE
Sbjct  211   GVPWVMCKQDDAPDPIINACNGFYCDYFSPNKAYKPKMWTEAWTGWFTKFGGPVPYRPAE  270

Query  2179  DLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGH  2000
             D+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL R+PKWGH
Sbjct  271   DMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLERQPKWGH  330

Query  1999  LKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGN  1820
             LKDLHRAIKLCEPALVSG+P  + LGNYQEA V+KSKSGAC+AFL+N N  S+AKV+FG+
Sbjct  331   LKDLHRAIKLCEPALVSGEPTRMPLGNYQEAHVYKSKSGACSAFLSNYNPRSYAKVSFGS  390

Query  1819  MHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM--TPVSRGFSWQSYNEETSSYDDNT  1646
              HYNLPPWSISILPDCKNTVYNTARVGAQ+SRMKM   PV  G SWQ+YNE+ S+Y D +
Sbjct  391   NHYNLPPWSISILPDCKNTVYNTARVGAQTSRMKMVEVPVHGGLSWQAYNEDPSTYIDES  450

Query  1645  FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQL  1466
             FT  GL+EQINTTRD SDYLWYMTDV+ID  E FL+ G  P LTV SAGHA+HVFINGQL
Sbjct  451   FTMVGLVEQINTTRDTSDYLWYMTDVKIDSNEGFLRTGDLPTLTVLSAGHAMHVFINGQL  510

Query  1465  VGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGL  1286
              G++YGSL++PK+TF K V LRAG NKI++LSIAVGLPNVGPHFETWNAGVLGPV+L+GL
Sbjct  511   SGSAYGSLDSPKLTFRKGVNLRAGFNKIAILSIAVGLPNVGPHFETWNAGVLGPVNLNGL  570

Query  1285  NEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDAPAG  1106
             N G+RDL+WQKW+YK+GL+GE LSLHSL GSSSVEW EG+++A+KQPLTWYKTTF APAG
Sbjct  571   NGGRRDLSWQKWTYKVGLRGESLSLHSLGGSSSVEWAEGAYVAEKQPLTWYKTTFSAPAG  630

Query  1105  NEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQ  926
             + PLA+DM +MGKGQIWINGQSVGR+WP YKA  G+CG C+Y G F+E KCL  CGEASQ
Sbjct  631   DSPLAVDMGSMGKGQIWINGQSVGRHWPAYKAV-GSCGECSYTGTFNENKCLRNCGEASQ  689

Query  925   RWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQASG  746
             RWYHVPRSWL+PTGNLLV FEEWGG+P G+SLV+REV SVCADIYEWQ  L+N+++ +SG
Sbjct  690   RWYHVPRSWLKPTGNLLVVFEEWGGDPNGISLVRREVDSVCADIYEWQSTLVNYQLHSSG  749

Query  745   KATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWN  566
             K  +PL PK HL CG GQK+T++KFASFGTP G+CGS+ +G+CHA HSYD F + C+G N
Sbjct  750   KVNKPLHPKVHLQCGPGQKMTTVKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRLCVGQN  809

Query  565   SCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              C+V V PE FGGDPCP+VMKKL+VE VC+
Sbjct  810   WCSVTVAPEMFGGDPCPNVMKKLAVEAVCA  839



>ref|XP_003546676.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=840

 Score =  1331 bits (3445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/839 (78%), Positives = 750/839 (89%), Gaps = 10/839 (1%)
 Frame = -2

Query  2986  MWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLL  2807
             MW+V ++L+  L+G++      ASVSYD  +  INGQR+IL+SGSIHYPRSTPEMWPDL+
Sbjct  10    MWNVALLLVFSLIGSA-----KASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLI  64

Query  2806  KKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAE  2627
             +KAK+GGLDV+QTYVFWNGHEP PGKYYFEG YDLVKFIKL QQAGLYVHLR+GPY CAE
Sbjct  65    QKAKDGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAE  124

Query  2626  WNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIEN  2447
             WNFGGFPVWLKY+PG+SFRTDN PFK  MQKFTT IV++MK++RLYESQGGPII+SQIEN
Sbjct  125   WNFGGFPVWLKYIPGISFRTDNEPFKHQMQKFTTKIVDLMKAERLYESQGGPIIMSQIEN  184

Query  2446  EYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPN  2267
             EYGPMEYE+GA GK+Y +WAA+MA+GLGTGVPWVMCKQDD PDP++N CNGFYCD+FSPN
Sbjct  185   EYGPMEYEIGAAGKAYTKWAAEMAMGLGTGVPWVMCKQDDTPDPLINTCNGFYCDYFSPN  244

Query  2266  KAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRT  2087
             KAYKPKMWTEAWT WFTEFGGPVP+RPAEDLA++VA+FI KGGSFINYYM+HGGTNFGRT
Sbjct  245   KAYKPKMWTEAWTGWFTEFGGPVPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRT  304

Query  2086  AGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEA  1907
             AGGPFIATSYDYDAP+DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V  +GNYQEA
Sbjct  305   AGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTKIGNYQEA  364

Query  1906  RVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSS  1727
              VFKSKSGACAAFLAN N  S+A VAFGNMHYNLPPWSISILPDCKNTVYNTARVG+QS+
Sbjct  365   HVFKSKSGACAAFLANYNPKSYATVAFGNMHYNLPPWSISILPDCKNTVYNTARVGSQSA  424

Query  1726  RMKMT--PVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPR  1553
             +MKMT  P+  GFSW S+NEET++ DD++FT TGLLEQ+NTTRD SDYLWY TDV +DP 
Sbjct  425   QMKMTRVPIHGGFSWLSFNEETTTTDDSSFTMTGLLEQLNTTRDLSDYLWYSTDVVLDPN  484

Query  1552  EAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLL  1373
             E FL+ GK P LTV+SAGHALHVFINGQL GT+YGSLE PK+TF++ V LRAGVNKISLL
Sbjct  485   EGFLRNGKDPVLTVFSAGHALHVFINGQLSGTAYGSLEFPKLTFNEGVKLRAGVNKISLL  544

Query  1372  SIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgs  1193
             S+AVGLPNVGPHFETWNAGVLGP+SLSGLNEG+RDL+WQKWSYK+GLKGE+LSLHSLSGS
Sbjct  545   SVAVGLPNVGPHFETWNAGVLGPISLSGLNEGRRDLSWQKWSYKVGLKGEILSLHSLSGS  604

Query  1192  ssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYK  1013
             SSVEW++GS ++Q+QPLTWYKTTFDAPAG  PLALDM++MGKGQ+W+NGQ++GRYWP YK
Sbjct  605   SSVEWIQGSLVSQRQPLTWYKTTFDAPAGTAPLALDMDSMGKGQVWLNGQNLGRYWPAYK  664

Query  1012  ASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVS  833
             AS G C  C+YAG ++E KC S CGEASQRWYHVP+SWL+PTGNLLV FEE GG+P G+ 
Sbjct  665   AS-GTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGNLLVVFEELGGDPNGIF  723

Query  832   LVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTP  653
             LV+R++ SVCADIYEWQP L++++MQ SGKA  P+RPK HLSC  GQKI+SIKFASFGTP
Sbjct  724   LVRRDIDSVCADIYEWQPNLISYQMQTSGKA--PVRPKVHLSCSPGQKISSIKFASFGTP  781

Query  652   RGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              GSCG+F EG+CHA  SYD F++ C+G N CTV V+PE FGGDPCP+V+KKLSVE +CS
Sbjct  782   AGSCGNFHEGSCHAHKSYDAFERNCVGQNWCTVTVSPENFGGDPCPNVLKKLSVEAICS  840



>ref|XP_003543598.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=841

 Score =  1324 bits (3427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/839 (77%), Positives = 742/839 (88%), Gaps = 10/839 (1%)
 Frame = -2

Query  2986  MWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLL  2807
             MW+V ++L   L+G++      ASVSYD  +  INGQR+IL+SGSIHYPRSTPEMWPDL+
Sbjct  11    MWNVALLLAFSLIGSA-----KASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLI  65

Query  2806  KKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAE  2627
             +KAK+GGLDV+QTYVFWNGHEP PGKYYFEG YDLVKFIKL QQAGLYVHLR+GPY CAE
Sbjct  66    QKAKDGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAE  125

Query  2626  WNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIEN  2447
             WNFGGFPVWLKY+PG+SFRTDN PFK  MQKFTT IV++MK++RLYESQGGPII+SQIEN
Sbjct  126   WNFGGFPVWLKYIPGISFRTDNEPFKVQMQKFTTKIVDLMKAERLYESQGGPIIMSQIEN  185

Query  2446  EYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPN  2267
             EYGPMEYE+GA GK+Y +WAA+MA+ LGTGVPW+MCKQDD PDP++N CNGFYCD+FSPN
Sbjct  186   EYGPMEYEIGAAGKAYTKWAAEMAMELGTGVPWIMCKQDDTPDPLINTCNGFYCDYFSPN  245

Query  2266  KAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRT  2087
             KAYKPKMWTEAWT WFTEFGGPVP+RPAEDLA++VA+FI KGGSFINYYM+HGGTNFGRT
Sbjct  246   KAYKPKMWTEAWTGWFTEFGGPVPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRT  305

Query  2086  AGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEA  1907
             AGGPFIATSYDYDAP+DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V  +GNYQEA
Sbjct  306   AGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTKIGNYQEA  365

Query  1906  RVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSS  1727
              VFKS SGACAAFLAN N  S+A VAFGNMHYNLPPWSISILP+CKNTVYNTARVG+QS+
Sbjct  366   HVFKSMSGACAAFLANYNPKSYATVAFGNMHYNLPPWSISILPNCKNTVYNTARVGSQSA  425

Query  1726  RMKMT--PVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPR  1553
             +MKMT  P+  G SW S+NEET++ DD++FT TGLLEQ+NTTRD SDYLWY TDV +DP 
Sbjct  426   QMKMTRVPIHGGLSWLSFNEETTTTDDSSFTMTGLLEQLNTTRDLSDYLWYSTDVVLDPN  485

Query  1552  EAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLL  1373
             E FL+ GK P LTV+SAGHALHVFINGQL GT+YGSLE PK+TF++ V LR GVNKISLL
Sbjct  486   EGFLRNGKDPVLTVFSAGHALHVFINGQLSGTAYGSLEFPKLTFNEGVKLRTGVNKISLL  545

Query  1372  SIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgs  1193
             S+AVGLPNVGPHFETWNAGVLGP+SLSGLNEG+RDL+WQKWSYK+GLKGE LSLHSL GS
Sbjct  546   SVAVGLPNVGPHFETWNAGVLGPISLSGLNEGRRDLSWQKWSYKVGLKGETLSLHSLGGS  605

Query  1192  ssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYK  1013
             SSVEW++GS ++Q+QPLTWYKTTFDAP G  PLALDMN+MGKGQ+W+NGQ++GRYWP YK
Sbjct  606   SSVEWIQGSLVSQRQPLTWYKTTFDAPDGTAPLALDMNSMGKGQVWLNGQNLGRYWPAYK  665

Query  1012  ASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVS  833
             AS G C  C+YAG ++E KC S CGEASQRWYHVP+SWL+PTGNLLV FEE GG+  G+S
Sbjct  666   AS-GTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGNLLVVFEELGGDLNGIS  724

Query  832   LVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTP  653
             LV+R++ SVCADIYEWQP L++++MQ SGKA  P+RPK HLSC  GQKI+SIKFASFGTP
Sbjct  725   LVRRDIDSVCADIYEWQPNLISYQMQTSGKA--PVRPKVHLSCSPGQKISSIKFASFGTP  782

Query  652   RGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              GSCG+F EG+CHA  SYD F++ C+G N CTV V+PE FGGDPCP+V+KKLSVE +CS
Sbjct  783   VGSCGNFHEGSCHAHMSYDAFERNCVGQNLCTVAVSPENFGGDPCPNVLKKLSVEAICS  841



>gb|KHN30042.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =  1321 bits (3419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/839 (77%), Positives = 742/839 (88%), Gaps = 10/839 (1%)
 Frame = -2

Query  2986  MWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLL  2807
             MW+V ++L   L+G++      ASVSYD  +  INGQR+IL+SGSIHYPRSTPEMWPDL+
Sbjct  1     MWNVALLLAFSLIGSA-----KASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLI  55

Query  2806  KKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAE  2627
             +KAK+G LDV+QTYVFWNGHEP PGKYYFEG YDLVKFIKL QQAGLYVHLR+GPY CAE
Sbjct  56    QKAKDGSLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAE  115

Query  2626  WNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIEN  2447
             WNFGGFPVWLKY+PG+SFRTDN PFK  MQKFTT IV++MK++RLYESQGGPII+SQIEN
Sbjct  116   WNFGGFPVWLKYIPGISFRTDNEPFKVQMQKFTTKIVDLMKAERLYESQGGPIIMSQIEN  175

Query  2446  EYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPN  2267
             EYGPM+YE+GA GK+Y +WAA+MA+ LGTGVPW+MCKQDD PDP++N CNGFYCD+FSPN
Sbjct  176   EYGPMQYEIGAAGKAYTKWAAEMAMELGTGVPWIMCKQDDTPDPLINTCNGFYCDYFSPN  235

Query  2266  KAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRT  2087
             KAYKPKMWTEAWT WFTEFGGPVP+RPAEDLA++VA+FI KGGSFINYYM+HGGTNFGRT
Sbjct  236   KAYKPKMWTEAWTGWFTEFGGPVPHRPAEDLAFSVARFIQKGGSFINYYMYHGGTNFGRT  295

Query  2086  AGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEA  1907
             AGGPFIATSYDYDAP+DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V  +GNYQEA
Sbjct  296   AGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTKIGNYQEA  355

Query  1906  RVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSS  1727
              VFKS SGACAAFLAN N  S+A VAFGNMHYNLPPWSISILPDCKNTVYNTARVG+QS+
Sbjct  356   HVFKSMSGACAAFLANYNPKSYATVAFGNMHYNLPPWSISILPDCKNTVYNTARVGSQSA  415

Query  1726  RMKMT--PVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPR  1553
             +MKMT  P+  G SW S+NEET++ DD++FT TGLLEQ+NTTRD SDYLWY TDV +DP 
Sbjct  416   QMKMTRVPIHGGLSWLSFNEETTTTDDSSFTMTGLLEQLNTTRDLSDYLWYSTDVVLDPN  475

Query  1552  EAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLL  1373
             E FL+ GK P LTV+SAGHALHVFINGQL GT+YGSLE PK+TF++ V LR GVNKISLL
Sbjct  476   EGFLRNGKDPVLTVFSAGHALHVFINGQLSGTAYGSLEFPKLTFNEGVKLRTGVNKISLL  535

Query  1372  SIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgs  1193
             S+AVGLPNVGPHFETWNAGVLGP+SLSGLNEG+RDL+WQKWSYK+GLKGE LSLHSLSGS
Sbjct  536   SVAVGLPNVGPHFETWNAGVLGPISLSGLNEGRRDLSWQKWSYKVGLKGETLSLHSLSGS  595

Query  1192  ssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYK  1013
             SSVEW++GS ++Q+QPLTWYKTTFDAP G  PLALDMN+MGKGQ+W+NGQ++GRYWP YK
Sbjct  596   SSVEWIQGSLVSQRQPLTWYKTTFDAPDGTAPLALDMNSMGKGQVWLNGQNLGRYWPAYK  655

Query  1012  ASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVS  833
             AS G C  C+YAG ++E KC S CGEASQRWYHVP+SWL+PTGNLLV FEE GG+  G+S
Sbjct  656   AS-GTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGNLLVVFEELGGDLNGIS  714

Query  832   LVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTP  653
             LV+R++ SVCADIYEWQP L++++MQ SGKA  P+RPK HLSC  GQKI+SIKFASFGTP
Sbjct  715   LVRRDIDSVCADIYEWQPNLISYQMQTSGKA--PVRPKVHLSCSPGQKISSIKFASFGTP  772

Query  652   RGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              GSCG+F EG+CHA  SYD F++ C+G N CTV V+PE FGGDPCP+V+KKLSVE +CS
Sbjct  773   VGSCGNFHEGSCHAHMSYDAFERNCVGQNLCTVAVSPENFGGDPCPNVLKKLSVEAICS  831



>ref|XP_003531618.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
 gb|KHN11289.1| Beta-galactosidase 1 [Glycine soja]
Length=843

 Score =  1321 bits (3418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/824 (78%), Positives = 731/824 (89%), Gaps = 3/824 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             S +   +ASVSYD  + IINGQR+ILLSGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYV
Sbjct  21    SLLGQASASVSYDHKAIIINGQRRILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYV  80

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP PGKYYF G YDLV+FIKL QQAGLYV+LR+GPY CAEWNFGGFPVWLKY+PG
Sbjct  81    FWNGHEPSPGKYYFGGNYDLVRFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPG  140

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDNGPFK  M+KFT  IV+MMK++RL+ESQGGPIILSQIENEYGPMEYE+GAPG+S
Sbjct  141   ISFRTDNGPFKFQMEKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRS  200

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y QWAA MAVGLGTGVPW+MCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W
Sbjct  201   YTQWAAHMAVGLGTGVPWIMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGW  260

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FTEFGG VP+RPAEDLA+++A+FI KGGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  261   FTEFGGAVPHRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAP  320

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GL R+PKWGHLKDLHRAIKLCEPALVSGD  V  LGNY+EA VF+SKSGACAAFLA
Sbjct  321   LDEYGLARQPKWGHLKDLHRAIKLCEPALVSGDSTVQRLGNYEEAHVFRSKSGACAAFLA  380

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMT--PVSRGFSW  1688
             N N  S+A VAFGN HYNLPPWSISILP+CK+TVYNTARVG+QS+ MKMT  P+  G SW
Sbjct  381   NYNPQSYATVAFGNQHYNLPPWSISILPNCKHTVYNTARVGSQSTTMKMTRVPIHGGLSW  440

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             +++NEET++ DD++FT TGLLEQIN TRD SDYLWY TDV I+  E FL+ GK P LTV 
Sbjct  441   KAFNEETTTTDDSSFTVTGLLEQINATRDLSDYLWYSTDVVINSNEGFLRNGKNPVLTVL  500

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVFIN QL GT+YGSLE PK+TFS++V LRAGVNKISLLS+AVGLPNVGPHFE 
Sbjct  501   SAGHALHVFINNQLSGTAYGSLEAPKLTFSESVRLRAGVNKISLLSVAVGLPNVGPHFER  560

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGP++LSGLNEG+RDLTWQKWSYK+GLKGE L+LHSLSGSSSVEW++G  ++++Q
Sbjct  561   WNAGVLGPITLSGLNEGRRDLTWQKWSYKVGLKGEALNLHSLSGSSSVEWLQGFLVSRRQ  620

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYKTTFDAPAG  PLALDM +MGKGQ+WINGQS+GRYWP YKAS G+CG CNYAG +
Sbjct  621   PLTWYKTTFDAPAGVAPLALDMGSMGKGQVWINGQSLGRYWPAYKAS-GSCGYCNYAGTY  679

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             +EKKC S CGEASQRWYHVP SWL+P+GNLLV FEE GG+P G+ LV+R++ SVCADIYE
Sbjct  680   NEKKCGSNCGEASQRWYHVPHSWLKPSGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYE  739

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP L+++EMQASGK   P+RPKAHLSCG GQKI+SIKFASFGTP GSCGS+ EG+CHA 
Sbjct  740   WQPNLVSYEMQASGKVRSPVRPKAHLSCGPGQKISSIKFASFGTPVGSCGSYREGSCHAH  799

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              SYD F K C+G + CTV V+PE FGGDPCP VMKKLSVE +C+
Sbjct  800   KSYDAFLKNCVGQSWCTVTVSPEIFGGDPCPRVMKKLSVEAICT  843



>ref|XP_003529875.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=845

 Score =  1320 bits (3417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/839 (77%), Positives = 743/839 (89%), Gaps = 3/839 (0%)
 Frame = -2

Query  2986  MWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLL  2807
             MW+V ++L+VV+   S +   +ASVSYD  +  INGQR+ILLSGSIHYPRSTPEMWPDL+
Sbjct  8     MWNVPLLLVVVVFACSLIGHASASVSYDHKAITINGQRRILLSGSIHYPRSTPEMWPDLI  67

Query  2806  KKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAE  2627
             +KAKEGGLDV+QTYVFWNGHEP PGKYYF G YDLV+FIKL QQAGLYV+LR+GPY CAE
Sbjct  68    QKAKEGGLDVIQTYVFWNGHEPSPGKYYFGGNYDLVRFIKLVQQAGLYVNLRIGPYVCAE  127

Query  2626  WNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIEN  2447
             WNFGGFPVWLKY+PG+SFRTDNGPFK  M+KFT  IV+MMK++RL+ESQGGPIILSQIEN
Sbjct  128   WNFGGFPVWLKYIPGISFRTDNGPFKFQMEKFTKKIVDMMKAERLFESQGGPIILSQIEN  187

Query  2446  EYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPN  2267
             EYGPMEYE+GAPG++Y QWAA MAVGLGTGVPW+MCKQ+DAPDP++N CNGFYCD+FSPN
Sbjct  188   EYGPMEYEIGAPGRAYTQWAAHMAVGLGTGVPWIMCKQEDAPDPIINTCNGFYCDYFSPN  247

Query  2266  KAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRT  2087
             KAYKPKMWTEAWT WFTEFGG VP+RPAEDLA+++A+FI KGGSF+NYYM+HGGTNFGRT
Sbjct  248   KAYKPKMWTEAWTGWFTEFGGAVPHRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRT  307

Query  2086  AGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEA  1907
             AGGPFIATSYDYDAP+DE+GL R+PKWGHLKDLHRAIKLCEPALVSGDP V  LGNY+EA
Sbjct  308   AGGPFIATSYDYDAPLDEYGLPRQPKWGHLKDLHRAIKLCEPALVSGDPTVQQLGNYEEA  367

Query  1906  RVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSS  1727
              VF+SKSGACAAFLAN N  S+A VAFGN  YNLPPWSISILP+CK+TVYNTARVG+QS+
Sbjct  368   HVFRSKSGACAAFLANYNPQSYATVAFGNQRYNLPPWSISILPNCKHTVYNTARVGSQST  427

Query  1726  RMKMT--PVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPR  1553
              MKMT  P+  G SW+++NEET++ DD++FT TGLLEQIN TRD SDYLWY TDV I+  
Sbjct  428   TMKMTRVPIHGGLSWKAFNEETTTTDDSSFTVTGLLEQINATRDLSDYLWYSTDVVINSN  487

Query  1552  EAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLL  1373
             E FL+ GK P LTV SAGHALHVFIN QL GT+YGSLE PK+TFS++V LRAGVNKISLL
Sbjct  488   EGFLRNGKNPVLTVLSAGHALHVFINNQLSGTAYGSLEAPKLTFSESVRLRAGVNKISLL  547

Query  1372  SIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgs  1193
             S+AVGLPNVGPHFE WNAGVLGP++LSGLNEG+RDLTWQKWSYK+GLKGE L+LHSLSGS
Sbjct  548   SVAVGLPNVGPHFERWNAGVLGPITLSGLNEGRRDLTWQKWSYKVGLKGEALNLHSLSGS  607

Query  1192  ssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYK  1013
             SSVEW++G  ++++QPLTWYKTTFDAPAG  PLALDM +MGKGQ+WINGQS+GRYWP YK
Sbjct  608   SSVEWLQGFLVSRRQPLTWYKTTFDAPAGVAPLALDMGSMGKGQVWINGQSLGRYWPAYK  667

Query  1012  ASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVS  833
             AS G+CG CNYAG ++EKKC S CG+ASQRWYHVP SWL+PTGNLLV FEE GG+P G+ 
Sbjct  668   AS-GSCGYCNYAGTYNEKKCGSNCGQASQRWYHVPHSWLKPTGNLLVVFEELGGDPNGIF  726

Query  832   LVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTP  653
             LV+R++ SVCADIYEWQP L++++MQASGK   P+RPKAHLSCG GQKI+SIKFASFGTP
Sbjct  727   LVRRDIDSVCADIYEWQPNLVSYDMQASGKVRSPVRPKAHLSCGPGQKISSIKFASFGTP  786

Query  652   RGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              GSCG++ EG+CHA  SYD FQK C+G + CTV V+PE FGGDPCPSVMKKLSVE +C+
Sbjct  787   VGSCGNYREGSCHAHKSYDAFQKNCVGQSWCTVTVSPEIFGGDPCPSVMKKLSVEAICT  845



>ref|XP_007135555.1| hypothetical protein PHAVU_010G139300g [Phaseolus vulgaris]
 gb|ESW07549.1| hypothetical protein PHAVU_010G139300g [Phaseolus vulgaris]
Length=844

 Score =  1320 bits (3416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/824 (77%), Positives = 733/824 (89%), Gaps = 3/824 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             S +   +ASVSYD  +  INGQRKILLSGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYV
Sbjct  22    SLIGHASASVSYDHKAITINGQRKILLSGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYV  81

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP  GKYYF G YDLV+FIKL QQAGLYV+LR+GPY CAEWNFGGFPVWLKY+PG
Sbjct  82    FWNGHEPSRGKYYFGGNYDLVRFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPG  141

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             ++FRTDNGPFK  M+KFT  IV+MMK++RL+ESQGGPII+SQIENEYGP+EYE+GAPG++
Sbjct  142   INFRTDNGPFKFEMEKFTKKIVDMMKAERLFESQGGPIIISQIENEYGPLEYEVGAPGRA  201

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y QWAA MAVGLGTGVPW+MCKQDDAPDP+VN CNGFYCD+FSPNKAYKPKMWTEAWT W
Sbjct  202   YTQWAAHMAVGLGTGVPWIMCKQDDAPDPIVNTCNGFYCDYFSPNKAYKPKMWTEAWTGW  261

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FTEFGG VP+RPAEDLA+++A+FI KGGS++NYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  262   FTEFGGAVPHRPAEDLAFSIARFIQKGGSYVNYYMYHGGTNFGRTAGGPFIATSYDYDAP  321

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             +DE+GL R+PKWGHLKDLHRAIKLCEPAL+SGDP V  LGNY+EA VF+SKSGACAAFLA
Sbjct  322   LDEYGLARQPKWGHLKDLHRAIKLCEPALISGDPTVQRLGNYEEAHVFRSKSGACAAFLA  381

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMT--PVSRGFSW  1688
             N N  S+A VAFGN HYNLPPWSISILP+CK+TVYNTARVG+QS+ MKM+  P+  G SW
Sbjct  382   NYNPQSYATVAFGNQHYNLPPWSISILPNCKHTVYNTARVGSQSTTMKMSRVPIHGGLSW  441

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             +++NEET++ DD++FT +GLLEQIN TRD SDYLWY TDV I+P E FL+ GK P+LTV 
Sbjct  442   KAFNEETTTTDDSSFTVSGLLEQINATRDLSDYLWYSTDVVINPNEEFLRNGKNPFLTVL  501

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVFIN QL GT+YGSLE+PK+TFS++V LRAGVNKISLLS+AVGLPNVGPHFE 
Sbjct  502   SAGHALHVFINNQLSGTAYGSLESPKLTFSESVRLRAGVNKISLLSVAVGLPNVGPHFER  561

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGP++LSGLNEG+RDLTWQKWSYK+GLKGE L+LHSLSGSSSVEW++G  ++++Q
Sbjct  562   WNAGVLGPITLSGLNEGRRDLTWQKWSYKVGLKGEALNLHSLSGSSSVEWLQGYLVSKRQ  621

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYKTTFDAP G  PLALDM +MGKGQ+WINGQS+GRYWP YKAS G+CG CNYAG +
Sbjct  622   PLTWYKTTFDAPVGVAPLALDMASMGKGQVWINGQSLGRYWPAYKAS-GSCGYCNYAGTY  680

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             +EKKC S CGEASQRWYHVP SWL+PTGNLLV FEE GG+P G+ LV+R++ SVCADIYE
Sbjct  681   NEKKCASNCGEASQRWYHVPHSWLKPTGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYE  740

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP L+++EMQASGK   P+RPKAHLSCG GQKI+SIKFASFGTP GSCGS+ EG+CHA 
Sbjct  741   WQPNLVSYEMQASGKVRSPVRPKAHLSCGPGQKISSIKFASFGTPVGSCGSYREGSCHAH  800

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              SYD FQK C+G + CTV V PE FGGDPCPSVMKKLSVE +C+
Sbjct  801   KSYDAFQKNCVGQSWCTVTVAPEIFGGDPCPSVMKKLSVEAICT  844



>ref|XP_003597608.1| Beta-galactosidase [Medicago truncatula]
 gb|ABN08398.1| D-galactoside/L-rhamnose binding SUEL lectin; Galactose-binding 
like [Medicago truncatula]
 gb|AES67859.1| beta-galactosidase [Medicago truncatula]
Length=841

 Score =  1318 bits (3410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/817 (77%), Positives = 718/817 (88%), Gaps = 3/817 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASVSYD  +  INGQ +IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHEP
Sbjct  26    ASVSYDSKAITINGQSRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  85

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGKYYFEG YDLVKFIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKY+PG+SFRTDN
Sbjct  86    SPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  145

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK  MQKFT  IV+MMK+ RL+ESQGGPII+SQIENEYGPMEYE+GAPGKSY +WAA 
Sbjct  146   EPFKFQMQKFTEKIVDMMKADRLFESQGGPIIMSQIENEYGPMEYEIGAPGKSYTKWAAD  205

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGLGTGVPW+MCKQDDAPDPV+N CNGFYCD+FSPNK YKPKMWTEAWT WFTEFGGP
Sbjct  206   MAVGLGTGVPWIMCKQDDAPDPVINTCNGFYCDYFSPNKDYKPKMWTEAWTGWFTEFGGP  265

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP+RPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GLL
Sbjct  266   VPHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLL  325

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             ++PKWGHLKDLHRAIKL EPAL+SGDP V  +GNYQEA VFKSKSGACAAFL N N  +F
Sbjct  326   QQPKWGHLKDLHRAIKLSEPALISGDPTVTRIGNYQEAHVFKSKSGACAAFLGNYNPKAF  385

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMT--PVSRGFSWQSYNEET  1667
             A VAFGNMHYNLPPWSISILPDCKNTVYNTARVG+QS++MKMT  P+  G SWQ + E+T
Sbjct  386   ATVAFGNMHYNLPPWSISILPDCKNTVYNTARVGSQSAQMKMTRVPIHGGLSWQVFTEQT  445

Query  1666  SSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             +S DD++FT TGLLEQ+NTTRD +DYLWY TDV IDP E FL+ GK P LTV SAGHALH
Sbjct  446   ASTDDSSFTMTGLLEQLNTTRDLTDYLWYSTDVVIDPNEGFLRSGKDPVLTVLSAGHALH  505

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFIN QL GT YGSLE PK+TFS+ V L  GVNKISLLS+AVGLPNVGPHFETWNAGVLG
Sbjct  506   VFINSQLSGTIYGSLEFPKLTFSQNVKLIPGVNKISLLSVAVGLPNVGPHFETWNAGVLG  565

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKT  1127
             P++L+GL+EG+RDL+WQKWSYK+GL GE LSLHSL GSSSVEWV+GS +++ QPLTWYKT
Sbjct  566   PITLNGLDEGRRDLSWQKWSYKVGLHGEALSLHSLGGSSSVEWVQGSLVSRMQPLTWYKT  625

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
             TFDAP G  P ALDM +MGKGQ+W+NGQ++GRYWP YKAS G C  C+YAG ++E KC S
Sbjct  626   TFDAPDGIAPFALDMGSMGKGQVWLNGQNLGRYWPAYKAS-GTCDNCDYAGTYNENKCRS  684

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CGEASQRWYHVP SWL PTGNLLV FEE GG+P G+ LV+R++ SVCADIYEWQP L++
Sbjct  685   NCGEASQRWYHVPHSWLIPTGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYEWQPNLIS  744

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             ++MQ SGK  +P+RPKAHLSCG GQKI+SIKFASFGTP GSCG+F EG+CHA  SY+ F+
Sbjct  745   YQMQTSGKTNKPVRPKAHLSCGPGQKISSIKFASFGTPVGSCGNFHEGSCHAHKSYNTFE  804

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K C+G NSC V V+PE FGGDPCP+V+KKLSVE +C+
Sbjct  805   KNCVGQNSCKVTVSPENFGGDPCPNVLKKLSVEAICT  841



>ref|XP_006369293.1| beta-galactosidase 1 family protein [Populus trichocarpa]
 gb|ERP65862.1| beta-galactosidase 1 family protein [Populus trichocarpa]
Length=837

 Score =  1316 bits (3407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/827 (78%), Positives = 718/827 (87%), Gaps = 17/827 (2%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             S V   TASVSYD  +  INGQR+IL+SGSIHYPRS+PEMWPDL++KAKEGGLDV+QTYV
Sbjct  23    SLVCSVTASVSYDSKAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYV  82

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP PGKYYFEG YDLVKF+KL ++AGLYV+LR+GPY CAEWNFG           
Sbjct  83    FWNGHEPSPGKYYFEGNYDLVKFVKLVKEAGLYVNLRIGPYICAEWNFGH----------  132

Query  2581  VSFRTDNGPFK---AAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAP  2411
               F+    PF+   A M+KFTT IVNMMK++RL+ESQGGPIILSQIENEYGPMEYELG+P
Sbjct  133   -QFQNGQWPFQGEAAQMRKFTTKIVNMMKAERLFESQGGPIILSQIENEYGPMEYELGSP  191

Query  2410  GKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAW  2231
             G++Y +WAA+MAVGL TGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAW
Sbjct  192   GQAYTKWAAQMAVGLRTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAW  251

Query  2230  TAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDY  2051
             T WFT+FGGPVP+RPAED+A++VA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDY
Sbjct  252   TGWFTQFGGPVPHRPAEDMAFSVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDY  311

Query  2050  DAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAA  1871
             DAP+DE+GLLR+PKWGHLKDLHRAIKLCEPALVSGD  VI LGNYQEA VF  K+G CAA
Sbjct  312   DAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDATVIPLGNYQEAHVFNYKAGGCAA  371

Query  1870  FLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSR--G  1697
             FLAN +Q SFAKV+F NMHYNLPPWSISILPDCKNTVYNTARVGAQS+ +KMTPV    G
Sbjct  372   FLANYHQRSFAKVSFRNMHYNLPPWSISILPDCKNTVYNTARVGAQSATIKMTPVPMHGG  431

Query  1696  FSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWL  1517
              SWQ+YNEE SS  DNTFT  GLLEQINTTRD SDYLWYMTDV IDP E FLK GK+P L
Sbjct  432   LSWQTYNEEPSSSGDNTFTMVGLLEQINTTRDVSDYLWYMTDVHIDPSEGFLKSGKYPVL  491

Query  1516  TVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPH  1337
             TV SAGHALHVFINGQL GT+YGSL+ PK+TFS+ V LRAGVNKISLLSIAVGLPNVGPH
Sbjct  492   TVLSAGHALHVFINGQLSGTAYGSLDFPKLTFSQGVSLRAGVNKISLLSIAVGLPNVGPH  551

Query  1336  FETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIA  1157
             FETWNAG+LGPV+L+GLNEG+ DL+WQKWSYKIGL GE LSLHS+SGSSSVEW EGS +A
Sbjct  552   FETWNAGILGPVTLNGLNEGRMDLSWQKWSYKIGLHGEALSLHSISGSSSVEWAEGSLVA  611

Query  1156  QKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYA  977
             QKQPL+WYKTTF+APAGN PLALDM +MGKGQIWINGQ VGR+WP YKAS G CG C Y 
Sbjct  612   QKQPLSWYKTTFNAPAGNSPLALDMGSMGKGQIWINGQHVGRHWPAYKAS-GTCGECTYI  670

Query  976   GWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCAD  797
             G ++E KC + CGEASQRWYHVP+SWL+PTGNLLV FEEWGG+P GVSLV+REV SVCAD
Sbjct  671   GTYNENKCSTNCGEASQRWYHVPQSWLKPTGNLLVVFEEWGGDPNGVSLVRREVDSVCAD  730

Query  796   IYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTC  617
             IYEWQP LMN++MQASGK  +PLRPKAHLSCG GQKI SIKFASFGTP G CGS+++G+C
Sbjct  731   IYEWQPTLMNYQMQASGKVNKPLRPKAHLSCGPGQKIRSIKFASFGTPEGVCGSYNQGSC  790

Query  616   HAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             HAFHSYD F   C+G NSC+V V PE FGGDPCPSVMKKL+ E +CS
Sbjct  791   HAFHSYDAFNNLCVGQNSCSVTVAPEMFGGDPCPSVMKKLAAEAICS  837



>gb|KHN39301.1| Beta-galactosidase 1 [Glycine soja]
Length=838

 Score =  1315 bits (3403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/839 (77%), Positives = 742/839 (88%), Gaps = 3/839 (0%)
 Frame = -2

Query  2986  MWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLL  2807
             MW+V ++L+VV+   S +   +ASVSYD  +  INGQR+ILLSGSIHYPRSTPEMWPDL+
Sbjct  1     MWNVPLLLVVVVFACSLIGHASASVSYDHKAITINGQRRILLSGSIHYPRSTPEMWPDLI  60

Query  2806  KKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAE  2627
             +KAKEGGLDV+QTYVFWNGHEP PGKYYF G YDLV+FIKL QQAGLYV+LR+GPY CAE
Sbjct  61    QKAKEGGLDVIQTYVFWNGHEPSPGKYYFGGNYDLVRFIKLVQQAGLYVNLRIGPYVCAE  120

Query  2626  WNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIEN  2447
             WNFGGFPVWLKY+ G+SFRTDNGPFK  M+KFT  IV+MMK++RL+ESQGGPIILSQIEN
Sbjct  121   WNFGGFPVWLKYILGISFRTDNGPFKFQMEKFTKKIVDMMKAERLFESQGGPIILSQIEN  180

Query  2446  EYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPN  2267
             EYGPMEYE+GAPG++Y QWAA MAVGLGTGVPW+MCKQ+DAPDP++N CNGFYCD+FSPN
Sbjct  181   EYGPMEYEIGAPGRAYTQWAAHMAVGLGTGVPWIMCKQEDAPDPIINTCNGFYCDYFSPN  240

Query  2266  KAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRT  2087
             KAYKPKMWTEAWT WFTEFGG VP+RPAEDLA+++A+FI KGGSF+NYYM+HGGTNFGRT
Sbjct  241   KAYKPKMWTEAWTGWFTEFGGAVPHRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRT  300

Query  2086  AGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEA  1907
             AGGPFIATSYDYDAP+DE+GL R+PKWGHLKDLHRAIKLCEPALVSGDP V  LGNY+EA
Sbjct  301   AGGPFIATSYDYDAPLDEYGLPRQPKWGHLKDLHRAIKLCEPALVSGDPTVQQLGNYEEA  360

Query  1906  RVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSS  1727
              VF+SKSGACAAFLAN N  S+A VAFGN  YNLPPWSISILP+CK+TVYNTARVG+QS+
Sbjct  361   HVFRSKSGACAAFLANYNPQSYATVAFGNQRYNLPPWSISILPNCKHTVYNTARVGSQST  420

Query  1726  RMKMT--PVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPR  1553
              MKMT  P+  G SW+++NEET++ DD++FT TGLLEQIN TRD SDYLWY TDV I+  
Sbjct  421   TMKMTRVPIHGGLSWKAFNEETTTTDDSSFTVTGLLEQINATRDLSDYLWYSTDVVINSN  480

Query  1552  EAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLL  1373
             E FL+ GK P LTV SAGHALHVFIN QL GT+YGSLE PK+TFS++V LRAGVNKISLL
Sbjct  481   EGFLRNGKNPVLTVLSAGHALHVFINNQLSGTAYGSLEAPKLTFSESVRLRAGVNKISLL  540

Query  1372  SIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgs  1193
             S+AVGLPNVGPHFE WNAGVLGP++LSGLNEG+RDLTWQKWSYK+GLKGE L+LHSLSGS
Sbjct  541   SVAVGLPNVGPHFERWNAGVLGPITLSGLNEGRRDLTWQKWSYKVGLKGEALNLHSLSGS  600

Query  1192  ssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYK  1013
             SSVEW++G  ++++QPLTWYKTTFDAPAG  PLALDM +MGKGQ+WINGQS+GRYWP YK
Sbjct  601   SSVEWLQGFLVSRRQPLTWYKTTFDAPAGVAPLALDMGSMGKGQVWINGQSLGRYWPAYK  660

Query  1012  ASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVS  833
             AS G+CG CNYAG ++EKKC S CG+ASQRWYHVP SWL+PTGNLLV FEE GG+P G+ 
Sbjct  661   AS-GSCGYCNYAGTYNEKKCGSNCGQASQRWYHVPHSWLKPTGNLLVVFEELGGDPNGIF  719

Query  832   LVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTP  653
             LV+R++ SVCADIYEWQP L++++MQASGK   P+RPKAHLSCG GQKI+SIKFASFGTP
Sbjct  720   LVRRDIDSVCADIYEWQPNLVSYDMQASGKVRSPVRPKAHLSCGPGQKISSIKFASFGTP  779

Query  652   RGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              GSCG++ EG+CHA  SYD FQK C+G + CTV V+PE FGGDPCPSVMKKLSVE +C+
Sbjct  780   VGSCGNYREGSCHAHKSYDAFQKNCVGQSWCTVTVSPEIFGGDPCPSVMKKLSVEAICT  838



>ref|XP_010242207.1| PREDICTED: beta-galactosidase [Nelumbo nucifera]
Length=846

 Score =  1313 bits (3397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/822 (77%), Positives = 708/822 (86%), Gaps = 9/822 (1%)
 Frame = -2

Query  2938  WVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVF  2759
             WVS   ASVSYD+ + IINGQR+IL SGSIHYPRSTPEMWPDL++KAK+GGLD +QTYVF
Sbjct  33    WVSSVKASVSYDQKAIIINGQRRILFSGSIHYPRSTPEMWPDLIQKAKDGGLDAIQTYVF  92

Query  2758  WNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGV  2579
             WNGHEP PG+YYFEGRYDLV+FIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG+
Sbjct  93    WNGHEPSPGQYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGI  152

Query  2578  SFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSY  2399
              FRTDN PFK  MQ FT  IV+MMK++ L+E QGGPII+SQIENEYGP+E+E+GAPG++Y
Sbjct  153   EFRTDNEPFKVTMQGFTKKIVDMMKAENLFEPQGGPIIMSQIENEYGPVEWEIGAPGQAY  212

Query  2398  AQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWF  2219
              +WAA+MAV LGTGVPWVMCKQDDAPDP++N+CNGFYCDWFSPNK YKPKMWTE WT W+
Sbjct  213   TKWAAQMAVDLGTGVPWVMCKQDDAPDPMINSCNGFYCDWFSPNKPYKPKMWTEVWTGWY  272

Query  2218  TEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPI  2039
             TEFGGPVP+RP ED+A++VAKF+ K GSFINYYM+HGGTNFGRTAGGPFIATSYD+DAPI
Sbjct  273   TEFGGPVPHRPVEDIAFSVAKFVQKSGSFINYYMYHGGTNFGRTAGGPFIATSYDFDAPI  332

Query  2038  DEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLAN  1859
             DE+GLLREPKWGHL+DLHRAIKLCEPALVS DP VIS GNYQEA VF+S SGACAAFLAN
Sbjct  333   DEYGLLREPKWGHLRDLHRAIKLCEPALVSADPTVISFGNYQEAHVFRSNSGACAAFLAN  392

Query  1858  NNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQS  1682
              + +++AKVAF NMHY+LPPWSISILPDCKNT++NTAR+GAQSS MKMT V S GF WQS
Sbjct  393   YDSNAYAKVAFENMHYDLPPWSISILPDCKNTIFNTARIGAQSSLMKMTAVSSEGFPWQS  452

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             Y EET+SYDDN+FT  GLLEQIN TRDASDYLWYMTDV+IDP E FLK G++P LTV SA
Sbjct  453   YTEETASYDDNSFTMVGLLEQINLTRDASDYLWYMTDVQIDPNEEFLKSGQYPVLTVSSA  512

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHALHVFINGQL GT YGSLENPK+TFS  V L AG+NKISLLSIAVGLPNVG HFETWN
Sbjct  513   GHALHVFINGQLSGTVYGSLENPKLTFSDNVKLIAGINKISLLSIAVGLPNVGTHFETWN  572

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPV L GLNEG RDL+WQKWSYKIGL+GE L LH++SGSSSVEW   S IA++QPL
Sbjct  573   AGVLGPVVLKGLNEGTRDLSWQKWSYKIGLQGEALGLHTVSGSSSVEWEGSS-IAKQQPL  631

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             +WYK  FDAP GNEPLALDM++MGKGQIWINGQS+GRYWP YKAS G CG C+YAG +D+
Sbjct  632   SWYKAIFDAPTGNEPLALDMSSMGKGQIWINGQSIGRYWPAYKAS-GTCGNCSYAGEYDD  690

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
              KC S CGEASQRWYHVPRSWL PTGNL V FEEWGG+P  +SL KR V S+CADI+EWQ
Sbjct  691   SKCQSNCGEASQRWYHVPRSWLNPTGNLFVIFEEWGGDPTWISLNKRTVGSLCADIHEWQ  750

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             P       Q S K  R LRPKAHL C  G KITSIKFASFGTP+G CGSF EG+CHA  S
Sbjct  751   PS------QRSSKIGRLLRPKAHLQCSPGTKITSIKFASFGTPQGICGSFQEGSCHAHKS  804

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F+K CIG   C V V PE FGGDPCP++MKKLSVE +CS
Sbjct  805   YDAFEKNCIGKQMCAVSVAPEVFGGDPCPNIMKKLSVEAICS  846



>gb|KDO65277.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=815

 Score =  1310 bits (3390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 622/783 (79%), Positives = 711/783 (91%), Gaps = 4/783 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SVSYD  +  ING+R+IL+SGSIHYPRS+PEMWPDL++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  32    SVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  91

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PGKYYFEG YDLVKFIKLA+QAGLYV+LR+GPY CAEWNFGGFPVWLKY+PG++FRT+NG
Sbjct  92    PGKYYFEGNYDLVKFIKLAKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTENG  151

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKA M KFT  IV+MMK++RL+ESQGGPIILSQIENEYGPMEYE+GAPG+SY +WAAKM
Sbjct  152   PFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAAKM  211

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGLGTGVPW+MCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W+TEFGGPV
Sbjct  212   AVGLGTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGGPV  271

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
             P+RP EDLA++VAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GLLR
Sbjct  272   PHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  331

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PKWGHLKDLHRAIKLCEPALVSG+P V+ LGNYQEA VFKSKS ACAAFLAN NQ +FA
Sbjct  332   QPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRTFA  390

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSWQSYNEETS  1664
             KVAFGN HYNLPPWSISILPDCKNTVYNTARVG QS++MKMTPV    GFSWQ++NE  S
Sbjct  391   KVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFNEVPS  450

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y D++FT +GLLEQINTTRDA+DYLWYMTDV+IDP E FL+ G +P LTV SAGHALHV
Sbjct  451   AYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHALHV  510

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             F+NGQL GT+YGSLE PK+TF++ V +RAG+NKI+LLSIAVGLPNVGPHFETWNAGVLGP
Sbjct  511   FVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGVLGP  570

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L+GLNEG+RDL+WQKW+YKIGL+GE L+LHSLSG SSVEW EGS +AQ+QPLTWY+TT
Sbjct  571   VTLNGLNEGRRDLSWQKWTYKIGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTT  630

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F APAGN PLALDM +MGKGQ+W+NGQS+GR+WP YKAS G+CG C+Y G + EKKCLS 
Sbjct  631   FSAPAGNAPLALDMGSMGKGQVWVNGQSIGRHWPAYKAS-GSCGYCSYTGTYTEKKCLSN  689

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CGEASQRWYHVPRSWL+PTGNLLV FEEWGGNP G+SLV+RE+ SVCA +YEWQP L+NW
Sbjct  690   CGEASQRWYHVPRSWLKPTGNLLVVFEEWGGNPNGISLVRREIDSVCAYMYEWQPTLINW  749

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++ ASGK  +PLRPKAHL CG GQKI SIKFASFGTP G CGS+ +G+CHAFHSYD FQ+
Sbjct  750   QLHASGKVNKPLRPKAHLMCGPGQKIKSIKFASFGTPEGVCGSYRQGSCHAFHSYDAFQR  809

Query  583   YCI  575
              CI
Sbjct  810   VCI  812



>ref|XP_007150529.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
 gb|ESW22523.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
Length=837

 Score =  1304 bits (3374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/822 (77%), Positives = 730/822 (89%), Gaps = 5/822 (1%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
             ++   ASVSYD  +  INGQR+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFW
Sbjct  19    IASAEASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFW  78

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             NGHEP PG+YYFEG YDLVKFIKL QQAGLYV+LR+GPY CAEWNFGGFPVWLKY+PG+S
Sbjct  79    NGHEPSPGQYYFEGNYDLVKFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGIS  138

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDN PFK  MQKFTT IV++MK++RLYE+QGGPII+SQIENEYGP+EYE+G  GK+Y 
Sbjct  139   FRTDNEPFKYQMQKFTTKIVDLMKAERLYETQGGPIIMSQIENEYGPIEYEIGGAGKAYT  198

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAA MA+ LGTGVPW+MCKQDD PDP++N CNGFYCD+FSPNKAYKPKMWTEAWT WFT
Sbjct  199   NWAADMAMALGTGVPWIMCKQDDTPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFT  258

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
             EFGGPVP+RPAEDLA++VA+F+ KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+D
Sbjct  259   EFGGPVPHRPAEDLAFSVARFLQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLD  318

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             E+GLLR+PKWGHLKDLHRAIKLCEPALVSGDP V  +GNYQEA VFKSK GACAAFLAN 
Sbjct  319   EYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTKIGNYQEAHVFKSKLGACAAFLANY  378

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMT--PVSRGFSWQS  1682
             N  S+A VAFG+MHYNLPPWSISILPDCK+T+YNTARVG+QS++MKMT  P+  G SW S
Sbjct  379   NPKSYATVAFGSMHYNLPPWSISILPDCKHTIYNTARVGSQSAQMKMTAVPIHGGLSWLS  438

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             +NEET++ DD++FT TGLLEQ+NTTRD SDYLWY TDV +DP E FL  GK P LTV+SA
Sbjct  439   FNEETTTTDDSSFTMTGLLEQLNTTRDLSDYLWYSTDVVLDPNEGFLINGKEPVLTVFSA  498

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHALHVFINGQL GTSYGSL  PK+TFS+ V LRAGVNKISLLS+AVGLPNVGPHFETWN
Sbjct  499   GHALHVFINGQLSGTSYGSLNFPKLTFSEGVKLRAGVNKISLLSVAVGLPNVGPHFETWN  558

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGP+SLSGLNEG+RDL+WQKWSYK+GLKGE LSLHSLSGSSSVEW++GS ++++QPL
Sbjct  559   AGVLGPISLSGLNEGRRDLSWQKWSYKVGLKGETLSLHSLSGSSSVEWIQGSLVSRRQPL  618

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYKTTFDAPAG  PLALDM++MGKGQ+W+NGQ++GR+WP YKA+ GAC  C+YAG ++E
Sbjct  619   TWYKTTFDAPAGTAPLALDMDSMGKGQVWLNGQNLGRFWPAYKAA-GACDHCDYAGTYNE  677

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
              KC S CGEASQRWYHVP+SWL+PTGNLLV FEE GG+P G+ LV+R++ SVCADIYEWQ
Sbjct  678   NKCRSNCGEASQRWYHVPQSWLKPTGNLLVVFEELGGDPNGIFLVRRDIDSVCADIYEWQ  737

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             P L++++MQ +GK   P+RPK HL+C  GQKI+SIKFASFGTP GSCG+F EG+CHA  S
Sbjct  738   PNLISYQMQVAGKP--PVRPKVHLTCSPGQKISSIKFASFGTPVGSCGNFHEGSCHAHKS  795

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F++ C+G N CTV V+PE FGGDPCP+VMKKLSVE +C+
Sbjct  796   YDAFERNCVGQNWCTVTVSPENFGGDPCPNVMKKLSVEAICT  837



>ref|XP_010062625.1| PREDICTED: beta-galactosidase 1 [Eucalyptus grandis]
Length=825

 Score =  1298 bits (3360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/849 (73%), Positives = 714/849 (84%), Gaps = 30/849 (4%)
 Frame = -2

Query  3004  MGWKHEMWDVIvvllvvlLGTSWVSLGT------ASVSYDKHSFIINGQRKILLSGSIHY  2843
             MG +  +W+V+            +SLG       ASVSYD  + +INGQR+IL+SGSIHY
Sbjct  1     MGLRLVLWNVLG-----------LSLGVCVFSVLASVSYDSKAIVINGQRRILISGSIHY  49

Query  2842  PRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLY  2663
             PRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHEP PGKYYFEG YDLVKFIKLA+QAGLY
Sbjct  50    PRSTPEMWPDLIEKAKEGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLAKQAGLY  109

Query  2662  VHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYES  2483
             VHLR+GPY CAEWNFGGFPVWLKY+PG++FRTDN PFK  MQKF T IVNMMK++RL+ES
Sbjct  110   VHLRIGPYVCAEWNFGGFPVWLKYIPGINFRTDNEPFKYQMQKFATKIVNMMKAERLFES  169

Query  2482  QGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNA  2303
             QGGPIILSQIENEYGPMEYE+GAPG+ Y QWAAKMA+ L  GVPWVMCKQDDAPDP++N 
Sbjct  170   QGGPIILSQIENEYGPMEYEIGAPGQVYTQWAAKMALNLDIGVPWVMCKQDDAPDPIINT  229

Query  2302  CNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINY  2123
             CNGFYCD+FSPNKAYKP MWTEAWT W+TEFGG VPYRPAED+A++VAKFI KGGSFINY
Sbjct  230   CNGFYCDYFSPNKAYKPTMWTEAWTGWYTEFGGAVPYRPAEDMAFSVAKFIQKGGSFINY  289

Query  2122  YMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGD  1943
             YM+HGGTNFGRT+GGPFIATSYDYDAP+DE+GLLR+PKWGHLKDLHRAIKLCEPALVS +
Sbjct  290   YMYHGGTNFGRTSGGPFIATSYDYDAPLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSAE  349

Query  1942  PNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNT  1763
             P V  LG YQEA VFKS SGACAAFLAN NQ SFAKV+FG+MHYNLPPWSISILPDCKNT
Sbjct  350   PAVTPLGIYQEAHVFKSDSGACAAFLANYNQWSFAKVSFGSMHYNLPPWSISILPDCKNT  409

Query  1762  VYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLW  1583
             VYNTARVGAQSS MKMTPV   FSW+ Y+E +++Y+D++FT TGLLEQINTTRD +DYLW
Sbjct  410   VYNTARVGAQSSHMKMTPVDGNFSWEVYSEASAAYEDSSFTMTGLLEQINTTRDVTDYLW  469

Query  1582  YMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYL  1403
             YMTDV +DP E FLK G +P LTV SAGHALHVF+NG+L G SY            ++ L
Sbjct  470   YMTDVDVDPNEEFLKSGSYPVLTVLSAGHALHVFVNGELAGNSY------------SLRL  517

Query  1402  RAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKge  1223
                +N +S     + + NVG HFETWNAG+LGPV+LSGLN+G RDL+WQ WSY +GLKGE
Sbjct  518   LVPLNDLSSFLHCLNVTNVGVHFETWNAGILGPVTLSGLNDGWRDLSWQNWSYAVGLKGE  577

Query  1222  vlslhslsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQ  1043
              + LHSLSGS SVEW + S +A+KQPLTWYKT F+AP G+ PLALDM++M KGQ+WINGQ
Sbjct  578   AMGLHSLSGSVSVEWAQESLVAEKQPLTWYKTIFNAPGGSAPLALDMDSMSKGQVWINGQ  637

Query  1042  SVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFE  863
             S+GRYWP YKAS G C +CNY G F+E KCLS CGEASQRWYH+PRSWL PTGNLLV  E
Sbjct  638   SLGRYWPAYKAS-GTCNSCNYTGTFNENKCLSNCGEASQRWYHIPRSWLYPTGNLLVVLE  696

Query  862   EWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKIT  683
             EWGG P G+SLVKRE+ SVC+DI+EWQP LMNW+MQASGK T+PLRPK HL C  GQ+I+
Sbjct  697   EWGGEPNGISLVKREIDSVCSDIFEWQPTLMNWQMQASGKVTKPLRPKVHLWCSPGQQIS  756

Query  682   SIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMK  503
             SI+FASFGTP G+CGSF +G+CHAFHSYD+F++ C+G NSC+V V PE FGGDPCP+VMK
Sbjct  757   SIRFASFGTPEGTCGSFRQGSCHAFHSYDVFERTCLGLNSCSVTVAPEIFGGDPCPNVMK  816

Query  502   KLSVEVVCS  476
             KLSVE VCS
Sbjct  817   KLSVEAVCS  825



>gb|KHF99404.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=808

 Score =  1297 bits (3356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/785 (80%), Positives = 698/785 (89%), Gaps = 3/785 (0%)
 Frame = -2

Query  2824  MWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVG  2645
             MWPDL++KAKEGGLDV+QTYVFWNGHEP PG Y+FEG YDLVKFIKL ++AGLYVHLR+G
Sbjct  25    MWPDLIQKAKEGGLDVIQTYVFWNGHEPAPGMYHFEGNYDLVKFIKLVKRAGLYVHLRIG  84

Query  2644  PYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPII  2465
             PY CAEWNFGGFPVWLKY+PG+ FRT+N PFKA MQ+FT  IV MMK++RL+ESQGGPII
Sbjct  85    PYVCAEWNFGGFPVWLKYIPGIKFRTNNRPFKAQMQRFTEKIVGMMKAERLFESQGGPII  144

Query  2464  LSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYC  2285
             LSQIENEYGPMEYELGAPGK+Y+ WAAKMAVGLGTGVPWVMCKQDDAPDP++N CNGFYC
Sbjct  145   LSQIENEYGPMEYELGAPGKAYSDWAAKMAVGLGTGVPWVMCKQDDAPDPIINTCNGFYC  204

Query  2284  DWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGG  2105
             D+FSPNKAYKPKMWTEAWT W+TEFGG VPYRPAED+A+AVA+FI KGG+FINYYM+ GG
Sbjct  205   DYFSPNKAYKPKMWTEAWTGWYTEFGGAVPYRPAEDMAFAVARFIQKGGAFINYYMYQGG  264

Query  2104  TNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISL  1925
             TNFGRTAGGPFIATSYDYDAP+DE+GL R+PKWGHLKDLHRAIKLCEPALV+GDP VI L
Sbjct  265   TNFGRTAGGPFIATSYDYDAPLDEYGLKRQPKWGHLKDLHRAIKLCEPALVNGDPTVIRL  324

Query  1924  GNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR  1745
             GNY+EA VF  K+G CAAFLAN N +S+AKVAF NMHYNLPPWSISILPDCKNTVYNTAR
Sbjct  325   GNYEEAHVFNYKTGGCAAFLANYNPNSYAKVAFRNMHYNLPPWSISILPDCKNTVYNTAR  384

Query  1744  VGAQSSRMKMTPVSR--GFSWQSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTD  1571
             VGAQ SR KM PV    GFSW++ NEET+S  D+TFT  GLLEQINTTRDA+DYLWY T 
Sbjct  385   VGAQISRKKMVPVPMHGGFSWEACNEETASDVDSTFTMVGLLEQINTTRDATDYLWYTTT  444

Query  1570  VRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGV  1391
             V+IDPRE FLK GK P LT++SAGHALHVF+NGQL G+SYGSLE PK+TF++ V LRAGV
Sbjct  445   VKIDPREGFLKNGKSPVLTIFSAGHALHVFVNGQLSGSSYGSLEFPKLTFNQGVNLRAGV  504

Query  1390  NKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlsl  1211
             N ISLLSIAVGLPNVGPHFETWNAG+LGPV+L+GLNEG+RDL+WQKWSYKIGLKGE L+L
Sbjct  505   NTISLLSIAVGLPNVGPHFETWNAGILGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALNL  564

Query  1210  hslsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGR  1031
             HSLSGSSSVEW +GS +AQ+QPLTWYKTTF+APAGN PLALDMN+MGKGQIWINGQS+GR
Sbjct  565   HSLSGSSSVEWAKGSSVAQRQPLTWYKTTFNAPAGNAPLALDMNSMGKGQIWINGQSIGR  624

Query  1030  YWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGG  851
             +WP YKASG  CGACNYAG F E KC + CGEASQRWYHVPRSWL PTGN LV FEE GG
Sbjct  625   HWPAYKASGN-CGACNYAGTFRENKCGTNCGEASQRWYHVPRSWLNPTGNFLVVFEESGG  683

Query  850   NPYGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKF  671
             +P G+SLV+RE  SVCADIYEWQP LMN+EMQASGK  +PLRPK HL C AGQKI+++KF
Sbjct  684   DPNGISLVRRETDSVCADIYEWQPTLMNYEMQASGKVNKPLRPKVHLECDAGQKISAVKF  743

Query  670   ASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSV  491
             ASFGTP G CGS+ EG+CHA HSYD F + C+G N CTV V PE FGGDPCPSVMKKLSV
Sbjct  744   ASFGTPEGVCGSYREGSCHAHHSYDAFNRLCLGQNFCTVTVAPEMFGGDPCPSVMKKLSV  803

Query  490   EVVCS  476
             EV+CS
Sbjct  804   EVICS  808



>dbj|BAF31233.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =  1284 bits (3322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/821 (73%), Positives = 696/821 (85%), Gaps = 4/821 (0%)
 Frame = -2

Query  2938  WVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVF  2759
             ++S  T SVSYD  + IINGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYVF
Sbjct  31    YLSPATCSVSYDHKAIIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVF  90

Query  2758  WNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGV  2579
             WNGHEP PG+YYFEGRYDLVKFIKL ++AGLYVHLR+GPYACAEWNFGGFPVWLKY+PG+
Sbjct  91    WNGHEPSPGEYYFEGRYDLVKFIKLVKEAGLYVHLRIGPYACAEWNFGGFPVWLKYIPGI  150

Query  2578  SFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSY  2399
             SFRTDN PFK AM  FT  IV+MMK + L+E+QGGPIILSQIENEYGP+E+E+GAPG++Y
Sbjct  151   SFRTDNEPFKTAMAGFTKKIVDMMKEEELFETQGGPIILSQIENEYGPVEWEIGAPGQAY  210

Query  2398  AQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWF  2219
              +WAA MAVGLGTGVPWVMCKQDDAPDP++N CN  YCDWFSPNK YKP MWTEAWT+WF
Sbjct  211   TKWAANMAVGLGTGVPWVMCKQDDAPDPIINTCNDHYCDWFSPNKNYKPTMWTEAWTSWF  270

Query  2218  TEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPI  2039
             T FGGPVPYRPAED+A+A+AKFI +GGSFINYYM+HGGTNFGRTAGGPF+ATSYDYDAPI
Sbjct  271   TAFGGPVPYRPAEDMAFAIAKFIQRGGSFINYYMYHGGTNFGRTAGGPFVATSYDYDAPI  330

Query  2038  DEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLAN  1859
             DE+GL+R+PKWGHLKDLH+AIK+CE ALVSGDP V SLG+ QE+ VFKS+SG CAAFLAN
Sbjct  331   DEYGLIRQPKWGHLKDLHKAIKMCEAALVSGDPIVTSLGSSQESHVFKSESGDCAAFLAN  390

Query  1858  NNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVS-RGFSWQS  1682
              ++ SFAKVAF  MHYNLPPWSISILPDC NTV+NTARVGAQ+S M MT V+  GFSW++
Sbjct  391   YDEKSFAKVAFQGMHYNLPPWSISILPDCVNTVFNTARVGAQTSSMTMTSVNPDGFSWET  450

Query  1681  YNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             YNEET+SYDD + T  GLLEQIN TRD +DYLWY TD+ IDP E FLK G++P LTV SA
Sbjct  451   YNEETASYDDASITMEGLLEQINVTRDVTDYLWYTTDITIDPNEGFLKNGEYPVLTVMSA  510

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHALH+FING+L GT YGS++NPK+T++ +V L AG NKIS+LSIAVGLPN+G HFETWN
Sbjct  511   GHALHIFINGELSGTVYGSVDNPKLTYTGSVKLLAGNNKISVLSIAVGLPNIGAHFETWN  570

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
              GVLGPV L+GLNEG+RDL+WQ WSYKIGLK    +L   S + S      S IAQKQPL
Sbjct  571   TGVLGPVVLNGLNEGRRDLSWQNWSYKIGLK--GEALQLHSLTGSSSVEWSSLIAQKQPL  628

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYKTTF+AP GN P ALDM+ MGKGQIWINGQS+GRYWP YKA G  CG C+Y G ++E
Sbjct  629   TWYKTTFNAPEGNGPFALDMSMMGKGQIWINGQSIGRYWPAYKAYGN-CGECSYTGRYNE  687

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
             KKCL+ CGEASQRWYHVP SWL PT NLLV FEEWGG+P G+SLV+R   S CA I EW 
Sbjct  688   KKCLANCGEASQRWYHVPSSWLYPTANLLVVFEEWGGDPTGISLVRRTTGSACAFISEWH  747

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             P L  W ++  G+A RP RPKAHLSC  GQKI+SIKFASFGTP+G CG+F+EG+CHA  S
Sbjct  748   PTLRKWHIKDYGRAERPRRPKAHLSCADGQKISSIKFASFGTPQGVCGNFTEGSCHAHKS  807

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             YDIF+K C+G   C+V ++P+ FGGDPCP+VMK L+VE +C
Sbjct  808   YDIFEKNCVGQQWCSVTISPDVFGGDPCPNVMKNLAVEAIC  848



>ref|XP_007012844.1| Beta-galactosidase [Theobroma cacao]
 gb|EOY30463.1| Beta-galactosidase [Theobroma cacao]
Length=847

 Score =  1269 bits (3283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 622/850 (73%), Positives = 715/850 (84%), Gaps = 13/850 (2%)
 Frame = -2

Query  2998  WKHEMWDVIvvllvvlLGTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMW  2819
             W  +M   + V ++ LL +SWV   +A+VSYD  + IING+R+ILLSGSIHYPRSTP+MW
Sbjct  2     WNRDMLSRVTVFMLWLLFSSWVFSVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMW  61

Query  2818  PDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPY  2639
             PDL+ KAKEGGLDV+QTYVFWNGHEP PGKYYF+ RYDLV+FIKL QQAGLYVHLR+GPY
Sbjct  62    PDLIAKAKEGGLDVIQTYVFWNGHEPSPGKYYFDDRYDLVRFIKLVQQAGLYVHLRIGPY  121

Query  2638  ACAEWNFGGFPVWLKYVPGVSFRTDNGPFK--------AAMQKFTTMIVNMMKSQRLYES  2483
              CAEWNFGGFPVWLKYVPG+ FRTDNGPFK        AAMQKFT  IV+MMK+++L+++
Sbjct  122   VCAEWNFGGFPVWLKYVPGIVFRTDNGPFKVENFDYLIAAMQKFTEKIVSMMKAEKLFQT  181

Query  2482  QGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNA  2303
             QGGPII+SQIENE+GP+E+E+GAPGK+Y +WAA+MAVGLGTGVPW+MCKQDDAPDPV+N 
Sbjct  182   QGGPIIMSQIENEFGPVEWEIGAPGKAYTKWAAQMAVGLGTGVPWIMCKQDDAPDPVINT  241

Query  2302  CNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINY  2123
             CNGFYC+ F+PN  YKPKMWTE WT WFTEFGG VP RPAED+A++VA+FI  GGSF+NY
Sbjct  242   CNGFYCENFTPNAKYKPKMWTENWTGWFTEFGGAVPTRPAEDIAFSVARFIQNGGSFVNY  301

Query  2122  YMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGD  1943
             YM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GL REPKWGHL+DLH+AIKL EPALVS D
Sbjct  302   YMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLPREPKWGHLRDLHKAIKLSEPALVSAD  361

Query  1942  PNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNT  1763
             P V SLG+ QEA VFK+KSGACAAFLAN +     KV FGN+ Y+LP WSISILPDCK  
Sbjct  362   PTVTSLGSNQEAHVFKAKSGACAAFLANYDTKYSVKVTFGNVQYDLPAWSISILPDCKTA  421

Query  1762  VYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSYDDNTFTA-TGLLEQINTTRDASDYL  1586
             V+NTAR+GAQSS+ KM PV+  FSWQSYNEE+ S DD   T   GLLEQI  TRDASDYL
Sbjct  422   VFNTARLGAQSSQKKMVPVNSAFSWQSYNEESPSADDQDATVKDGLLEQIYVTRDASDYL  481

Query  1585  WYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVY  1406
             WYMTDV+IDP E FL  G+ P LT++SAGHALHVFINGQL GT+YG L+NPK+TFSK V 
Sbjct  482   WYMTDVQIDPNEGFLTSGQDPSLTIWSAGHALHVFINGQLSGTAYGELDNPKLTFSKNVK  541

Query  1405  LRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKg  1226
             LRAG+NKISLLSIAVGLPNVG HFETWNAGVLGPV+L GLNEG RDL+ QKWSYKIGLKG
Sbjct  542   LRAGINKISLLSIAVGLPNVGVHFETWNAGVLGPVTLKGLNEGSRDLSKQKWSYKIGLKG  601

Query  1225  evlslhslsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWING  1046
             E LSLH+++GSSSVEWV+GS + +KQP+TWYKTTF+AP GNEPLALDM++MGKGQIWING
Sbjct  602   EALSLHTVTGSSSVEWVKGSLLVKKQPMTWYKTTFNAPGGNEPLALDMSSMGKGQIWING  661

Query  1045  QSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAF  866
             QS+GR+WPGY A  GACGAC+YAG + +KKC + CGE SQRWYHVPRSWL P+GNL+V F
Sbjct  662   QSIGRHWPGYIAR-GACGACDYAGTYSDKKCRTNCGEPSQRWYHVPRSWLNPSGNLMVVF  720

Query  865   EEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKI  686
             EEWGG+P G+SLVKR   SVCADI+E QP + NW M ASGK     RPKAHL C  GQKI
Sbjct  721   EEWGGDPSGISLVKRTTGSVCADIFEAQPTMKNWGMLASGKIN---RPKAHLWCPPGQKI  777

Query  685   TSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVM  506
             + IKFAS+G P G+CGSFSEG+CHA  SYD FQK CIG  SC+V V PE FGGDPCP  M
Sbjct  778   SEIKFASYGIPEGTCGSFSEGSCHAHRSYDAFQKNCIGKQSCSVTVAPEVFGGDPCPDSM  837

Query  505   KKLSVEVVCS  476
             KKLSVE  C+
Sbjct  838   KKLSVEAACN  847



>ref|XP_002308268.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
 gb|EEE91791.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
Length=837

 Score =  1264 bits (3272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/824 (74%), Positives = 701/824 (85%), Gaps = 4/824 (0%)
 Frame = -2

Query  2944  TSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             +S +S  TASVSYD  + IINGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GG+DV+QTY
Sbjct  17    SSRISTVTASVSYDHKAVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTY  76

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWNGHEP PG YYFE RYDLVKFIKL QQAGLY+HLR+GPY CAEWNFGGFPVWLKYVP
Sbjct  77    VFWNGHEPSPGNYYFEDRYDLVKFIKLVQQAGLYLHLRIGPYICAEWNFGGFPVWLKYVP  136

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G+ FRTDNGPFKAAMQKFT  IV MMKS++L+E+QGGPIILSQIENEYGP+E+E+GAPGK
Sbjct  137   GIEFRTDNGPFKAAMQKFTEKIVGMMKSEKLFENQGGPIILSQIENEYGPVEWEIGAPGK  196

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y +WAA MAV LGTGVPW+MCKQ+DAPDP+++ CNGFYC+ F PNK YKPK+WTEAWT 
Sbjct  197   AYTKWAADMAVKLGTGVPWIMCKQEDAPDPMIDTCNGFYCENFKPNKDYKPKIWTEAWTG  256

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             W+TEFGG VP+RPAED+A++VA+FI  GGS+INYYM+HGGTNFGRTAGGPFIATSYDYDA
Sbjct  257   WYTEFGGAVPHRPAEDMAFSVARFIQNGGSYINYYMYHGGTNFGRTAGGPFIATSYDYDA  316

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DEFGL REPKWGHL+DLH+AIKLCEPALVS DP V SLG+ QEA VFKSKS  CAAFL
Sbjct  317   PLDEFGLPREPKWGHLRDLHKAIKLCEPALVSVDPTVTSLGSNQEAHVFKSKS-VCAAFL  375

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN +     KV FGN  Y LPPWS+SILPDCK  VYNTAR+G+QSS+MKM P S  FSWQ
Sbjct  376   ANYDTKYSVKVTFGNGQYELPPWSVSILPDCKTAVYNTARLGSQSSQMKMVPASSSFSWQ  435

Query  1684  SYNEETSSY-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             SYNEET+S  DD+T T  GL EQIN TRDA+DYLWY+TDV+ID  E FLK G+ P LT++
Sbjct  436   SYNEETASADDDDTTTMNGLWEQINVTRDATDYLWYLTDVKIDADEGFLKSGQNPLLTIF  495

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVFINGQL GT+YG L NPK+TFS+ + L  G+NKISLLS+AVGLPNVG HFET
Sbjct  496   SAGHALHVFINGQLAGTAYGGLSNPKLTFSQNIKLTEGINKISLLSVAVGLPNVGLHFET  555

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGP++L GLNEG RDL+ QKWSYKIGLKGE LSLH+ SGS SVEWVEGS +AQKQ
Sbjct  556   WNAGVLGPITLKGLNEGTRDLSGQKWSYKIGLKGESLSLHTASGSESVEWVEGSLLAQKQ  615

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
              LTWYKT FDAP GN+PLALDM++MGKGQ+WINGQ++GR+WPGY A  G+CG CNYAG F
Sbjct  616   ALTWYKTAFDAPQGNDPLALDMSSMGKGQMWINGQNIGRHWPGYIAH-GSCGDCNYAGTF  674

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             D+KKC + CGE SQRWYHVPRSWL+P+GNLL  FEEWGG+P G+S VKR  ASVCADI+E
Sbjct  675   DDKKCRTNCGEPSQRWYHVPRSWLKPSGNLLAVFEEWGGDPTGISFVKRTTASVCADIFE  734

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
              QP L NW+  ASGK   P +PKAHL C  GQKI+ IKFASFG P+G+CGSF EG+CHA 
Sbjct  735   GQPALKNWQAIASGKVISP-QPKAHLWCPTGQKISQIKFASFGMPQGTCGSFREGSCHAH  793

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              SYD F++ C+G  SC+V V PE FGGDPCP   KKLSVE VCS
Sbjct  794   KSYDAFERNCVGKQSCSVTVAPEVFGGDPCPDSAKKLSVEAVCS  837



>ref|XP_011045966.1| PREDICTED: beta-galactosidase-like isoform X2 [Populus euphratica]
Length=838

 Score =  1262 bits (3266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/824 (74%), Positives = 699/824 (85%), Gaps = 4/824 (0%)
 Frame = -2

Query  2944  TSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             +S +S  TASVSYD  + IINGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GG+DV+QTY
Sbjct  18    SSRISTVTASVSYDHKAVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTY  77

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWNGHEP PG YYFE RYDLVKFIKL QQAGLY+HLR+GPY CAEWNFGGFPVWLKYVP
Sbjct  78    VFWNGHEPSPGNYYFEDRYDLVKFIKLVQQAGLYLHLRIGPYICAEWNFGGFPVWLKYVP  137

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G+ FRTDNGPFKAAMQKFT  IV MMKS++L+E+QGGPIILSQIENEYGP+E+E+GAPGK
Sbjct  138   GIEFRTDNGPFKAAMQKFTEKIVGMMKSEKLFENQGGPIILSQIENEYGPVEWEIGAPGK  197

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y +WAA MAV LGTGVPW+MCKQ+DAPDP+++ CNGFYC+ F PNK YKPK+WTEAWT 
Sbjct  198   AYTKWAADMAVKLGTGVPWIMCKQEDAPDPMIDTCNGFYCENFKPNKDYKPKIWTEAWTG  257

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             W+TEFGG VP+RPAED+A++VA+FI  GGS+INYYM+HGGTNFGRTAGGPFIATSYDYDA
Sbjct  258   WYTEFGGAVPHRPAEDMAFSVARFIQNGGSYINYYMYHGGTNFGRTAGGPFIATSYDYDA  317

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DEFGL REPKWGHL+DLH+AIKLCEPALVS DP V SLG+ QE  VFKSKS  CAAFL
Sbjct  318   PLDEFGLPREPKWGHLRDLHKAIKLCEPALVSVDPTVTSLGSNQEVHVFKSKS-VCAAFL  376

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN +     KV FGN  Y LPPWSISILPDCK  VYNTAR+G+QSS+MKM P S  FSWQ
Sbjct  377   ANYDTKYSVKVTFGNGQYELPPWSISILPDCKTVVYNTARLGSQSSQMKMVPASSSFSWQ  436

Query  1684  SYNEETSSY-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             SYNEET+S  DD+T T  GL EQIN TRDA+DYLWY+TDV+ID  E FLK G+ P LT++
Sbjct  437   SYNEETASADDDDTTTMNGLWEQINVTRDATDYLWYLTDVKIDADEGFLKSGQNPLLTIF  496

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVFINGQL GT+YG L NPK+TFS+ + L  G+NKISLLS+AVGLPNVG HFET
Sbjct  497   SAGHALHVFINGQLAGTAYGGLSNPKLTFSQNIKLTEGINKISLLSVAVGLPNVGLHFET  556

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGPV+L GLNEG RDL+ QKWSYKIGLKGE L LH+ SGS SVEWVEGS +AQKQ
Sbjct  557   WNAGVLGPVTLKGLNEGTRDLSGQKWSYKIGLKGESLGLHTASGSESVEWVEGSLLAQKQ  616

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
              LTWYKT FDAP GN+PLALDM++MGKGQ+WINGQ++GR+WPGY A  G+CG CNYAG F
Sbjct  617   ALTWYKTAFDAPPGNDPLALDMSSMGKGQMWINGQNIGRHWPGYIAH-GSCGDCNYAGTF  675

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             D+KKC + CGE SQRWYHVPRSWL+P+GNLL  FEEWGG+P G+S VKR  ASVCADI+E
Sbjct  676   DDKKCRTNCGEPSQRWYHVPRSWLKPSGNLLAVFEEWGGDPTGISFVKRTTASVCADIFE  735

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
              QP L NW+  ASGK   P +PKAHL C  GQKI+ IKFASFG P+G+CGSF EG+CHA 
Sbjct  736   GQPALKNWQAIASGKVISP-QPKAHLWCPPGQKISQIKFASFGMPQGTCGSFREGSCHAH  794

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              SYD F++ C+G  SC+V V PE FGGDPCP   KKLSVE VCS
Sbjct  795   KSYDAFERNCVGKQSCSVTVAPEVFGGDPCPDSAKKLSVEAVCS  838



>gb|KDP33829.1| hypothetical protein JCGZ_07400 [Jatropha curcas]
Length=838

 Score =  1256 bits (3249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/822 (74%), Positives = 698/822 (85%), Gaps = 4/822 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWV   TASVSYD  +  INGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYV
Sbjct  19    SWVCFVTASVSYDHKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV  78

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP PG YYFE RYDLVKFIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG
Sbjct  79    FWNGHEPSPGNYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPG  138

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             + FRT+NGPFK AMQKFT  IV MMKS++L+E+QGGPIILSQIENE+GP+E+E+GAPGK+
Sbjct  139   IEFRTNNGPFKVAMQKFTEKIVGMMKSEKLFETQGGPIILSQIENEFGPVEWEIGAPGKA  198

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y +WAA+MAVGLGTGVPWVMCKQ+DAPDPV+N CNGFYC+ F PNK YKPKMWTE WT W
Sbjct  199   YTKWAAEMAVGLGTGVPWVMCKQEDAPDPVINTCNGFYCENFKPNKDYKPKMWTENWTGW  258

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             +TEFGG VPYRPAEDLA++VA+FI  GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAP
Sbjct  259   YTEFGGSVPYRPAEDLAFSVARFIQNGGSFMNYYMYHGGTNFGRTAGGPFIATSYDYDAP  318

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             IDE+GL R+PKWGHL+DLH+AIKLCEPALVS DP V SLG+ QEA VF+SKS ACAAFLA
Sbjct  319   IDEYGLPRDPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGDNQEAHVFQSKS-ACAAFLA  377

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N +     KV FGN  Y+LPPWSISILPDCK  V+NTAR+GAQS++MKMTPV  GFSWQS
Sbjct  378   NYDTKYSVKVTFGNGQYDLPPWSISILPDCKTAVFNTARLGAQSTQMKMTPVGSGFSWQS  437

Query  1681  YNEETSS-YDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             Y EE +S Y D+T T  GL EQIN TRDA+DYLWYMT+V+IDP E FLK G+ P LT+ S
Sbjct  438   YIEEAASGYTDDTTTLDGLWEQINVTRDATDYLWYMTNVKIDPDEGFLKNGQDPLLTILS  497

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AGH+LHVFIN QL GT YGSL+NPKVTFSK V L +G+NKISLLS+AVGLPNVG HFE W
Sbjct  498   AGHSLHVFINDQLAGTVYGSLDNPKVTFSKNVKLTSGINKISLLSVAVGLPNVGVHFERW  557

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQP  1145
             N+GVLGPV+L GLNEG +DL+  KWSYKIGLKGE L+LH+++GSSSVEW EGS +A KQP
Sbjct  558   NSGVLGPVTLKGLNEGTKDLSGWKWSYKIGLKGEALNLHTVTGSSSVEWAEGSLLATKQP  617

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTWYKTTFDAP GN+PLALDM++MGKGQIW+NGQS+GR+WP Y A  G+CG CNYAG FD
Sbjct  618   LTWYKTTFDAPEGNDPLALDMSSMGKGQIWVNGQSIGRHWPAYTAR-GSCGDCNYAGTFD  676

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
             +KKC   CGE SQRWYHVPRSWL P+GNLLV FEE+GGNP G+SLVKR   +VCADIYE 
Sbjct  677   DKKCRRNCGEPSQRWYHVPRSWLNPSGNLLVVFEEFGGNPSGISLVKRTTGTVCADIYEG  736

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
             QP L NW+M A GK    L+PKAHL C  GQKI+ IKFAS+G P+G+CGSF EG+CHA  
Sbjct  737   QPALKNWQMIALGKLDH-LQPKAHLWCPPGQKISQIKFASYGVPQGACGSFREGSCHAHK  795

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             SY+ F+K C+G  SC+V V  E FGGDPCP   KKLSVE VC
Sbjct  796   SYNAFEKKCVGKQSCSVTVASEVFGGDPCPDTAKKLSVEAVC  837



>ref|XP_011045964.1| PREDICTED: beta-galactosidase-like isoform X1 [Populus euphratica]
Length=880

 Score =  1241 bits (3212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/866 (71%), Positives = 700/866 (81%), Gaps = 46/866 (5%)
 Frame = -2

Query  2944  TSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             +S +S  TASVSYD  + IINGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GG+DV+QTY
Sbjct  18    SSRISTVTASVSYDHKAVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTY  77

Query  2764  VFWNGHEPQPG------------------------------------------KYYFEGR  2711
             VFWNGHEP PG                                          +YYFE R
Sbjct  78    VFWNGHEPSPGNVMQIPFYSGFCVCCAFFLFFLFCFHFKFLTRLIFTLWGKKNQYYFEDR  137

Query  2710  YDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKF  2531
             YDLVKFIKL QQAGLY+HLR+GPY CAEWNFGGFPVWLKYVPG+ FRTDNGPFKAAMQKF
Sbjct  138   YDLVKFIKLVQQAGLYLHLRIGPYICAEWNFGGFPVWLKYVPGIEFRTDNGPFKAAMQKF  197

Query  2530  TTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVP  2351
             T  IV MMKS++L+E+QGGPIILSQIENEYGP+E+E+GAPGK+Y +WAA MAV LGTGVP
Sbjct  198   TEKIVGMMKSEKLFENQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAADMAVKLGTGVP  257

Query  2350  WVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLA  2171
             W+MCKQ+DAPDP+++ CNGFYC+ F PNK YKPK+WTEAWT W+TEFGG VP+RPAED+A
Sbjct  258   WIMCKQEDAPDPMIDTCNGFYCENFKPNKDYKPKIWTEAWTGWYTEFGGAVPHRPAEDMA  317

Query  2170  YAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKD  1991
             ++VA+FI  GGS+INYYM+HGGTNFGRTAGGPFIATSYDYDAP+DEFGL REPKWGHL+D
Sbjct  318   FSVARFIQNGGSYINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEFGLPREPKWGHLRD  377

Query  1990  LHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHY  1811
             LH+AIKLCEPALVS DP V SLG+ QE  VFKSKS  CAAFLAN +     KV FGN  Y
Sbjct  378   LHKAIKLCEPALVSVDPTVTSLGSNQEVHVFKSKS-VCAAFLANYDTKYSVKVTFGNGQY  436

Query  1810  NLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSY-DDNTFTAT  1634
              LPPWSISILPDCK  VYNTAR+G+QSS+MKM P S  FSWQSYNEET+S  DD+T T  
Sbjct  437   ELPPWSISILPDCKTVVYNTARLGSQSSQMKMVPASSSFSWQSYNEETASADDDDTTTMN  496

Query  1633  GLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTS  1454
             GL EQIN TRDA+DYLWY+TDV+ID  E FLK G+ P LT++SAGHALHVFINGQL GT+
Sbjct  497   GLWEQINVTRDATDYLWYLTDVKIDADEGFLKSGQNPLLTIFSAGHALHVFINGQLAGTA  556

Query  1453  YGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGK  1274
             YG L NPK+TFS+ + L  G+NKISLLS+AVGLPNVG HFETWNAGVLGPV+L GLNEG 
Sbjct  557   YGGLSNPKLTFSQNIKLTEGINKISLLSVAVGLPNVGLHFETWNAGVLGPVTLKGLNEGT  616

Query  1273  RDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPL  1094
             RDL+ QKWSYKIGLKGE L LH+ SGS SVEWVEGS +AQKQ LTWYKT FDAP GN+PL
Sbjct  617   RDLSGQKWSYKIGLKGESLGLHTASGSESVEWVEGSLLAQKQALTWYKTAFDAPPGNDPL  676

Query  1093  ALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYH  914
             ALDM++MGKGQ+WINGQ++GR+WPGY A  G+CG CNYAG FD+KKC + CGE SQRWYH
Sbjct  677   ALDMSSMGKGQMWINGQNIGRHWPGYIAH-GSCGDCNYAGTFDDKKCRTNCGEPSQRWYH  735

Query  913   VPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATR  734
             VPRSWL+P+GNLL  FEEWGG+P G+S VKR  ASVCADI+E QP L NW+  ASGK   
Sbjct  736   VPRSWLKPSGNLLAVFEEWGGDPTGISFVKRTTASVCADIFEGQPALKNWQAIASGKVIS  795

Query  733   PLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTV  554
             P +PKAHL C  GQKI+ IKFASFG P+G+CGSF EG+CHA  SYD F++ C+G  SC+V
Sbjct  796   P-QPKAHLWCPPGQKISQIKFASFGMPQGTCGSFREGSCHAHKSYDAFERNCVGKQSCSV  854

Query  553   PVTPEAFGGDPCPSVMKKLSVEVVCS  476
              V PE FGGDPCP   KKLSVE VCS
Sbjct  855   TVAPEVFGGDPCPDSAKKLSVEAVCS  880



>emb|CBI27912.3| unnamed protein product [Vitis vinifera]
Length=833

 Score =  1241 bits (3210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/823 (73%), Positives = 693/823 (84%), Gaps = 4/823 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWVS G+ASV+YDK SFIINGQRKIL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYV
Sbjct  14    SWVSHGSASVTYDKRSFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV  73

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP  GKYYFEGRYDLV+FIK+ Q AGLYVHLR+GPY CAEWNFGGFPVWLKYVPG
Sbjct  74    FWNGHEPSRGKYYFEGRYDLVRFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPG  133

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             ++FRTDNGPFK AMQ FT  IV+MMKS++L++ QGGPII+SQIENEYGP+EYE+GAPGK+
Sbjct  134   IAFRTDNGPFKVAMQGFTQKIVDMMKSEKLFQPQGGPIIMSQIENEYGPVEYEIGAPGKA  193

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y +WAA+MAV LGTGVPWVMCKQ+DAPDPV++ACNGFYC+ F PNK YKPKM+TEAWT W
Sbjct  194   YTKWAAEMAVQLGTGVPWVMCKQEDAPDPVIDACNGFYCENFFPNKDYKPKMFTEAWTGW  253

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             +TEFGG +P RPAEDLAY+VA+FI   GSFINYYM+HGGTNFGRTAGGPFI+TSYDYDAP
Sbjct  254   YTEFGGAIPNRPAEDLAYSVARFIQNRGSFINYYMYHGGTNFGRTAGGPFISTSYDYDAP  313

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             IDE+GL  EPKWGHL+DLH+AIKLCEPALVS DP V  LG   EA V+K+KSGACAAFLA
Sbjct  314   IDEYGLPSEPKWGHLRDLHKAIKLCEPALVSADPTVTYLGTNLEAHVYKAKSGACAAFLA  373

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N +  S AKV FGN  Y+LPPWS+SILPDCKN V+NTAR+GAQSS+MKM PVS  FSWQS
Sbjct  374   NYDPKSSAKVTFGNTQYDLPPWSVSILPDCKNVVFNTARIGAQSSQMKMNPVST-FSWQS  432

Query  1681  YNEET-SSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             YNEET S+Y ++T T  GLLEQIN TRD +DYLWYMT+V I P E FLK G++P LTV S
Sbjct  433   YNEETASAYTEDTTTMDGLLEQINITRDTTDYLWYMTEVHIKPDEGFLKTGQYPVLTVMS  492

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AGHALHVFINGQL GT YG L NPKVTFS  V L  G NKISLLS+A+GLPNVG HFETW
Sbjct  493   AGHALHVFINGQLSGTVYGELSNPKVTFSDNVKLTVGTNKISLLSVAMGLPNVGLHFETW  552

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQP  1145
             NAGVLGPV+L GLNEG  D++  KWSYKIGLKGE L+L +++GSSS EWVEGS +AQKQP
Sbjct  553   NAGVLGPVTLKGLNEGTVDMSSWKWSYKIGLKGEALNLQAITGSSSDEWVEGSLLAQKQP  612

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTWYKTTF+AP GN+PLALDM++MGKGQIWING+S+GR+WP Y A G  C  CNYAG F+
Sbjct  613   LTWYKTTFNAPGGNDPLALDMSSMGKGQIWINGESIGRHWPAYTAHGN-CNGCNYAGIFN  671

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
             +KKC + CG  SQRWYHVPRSWL+P+GN L+ FEE GGNP G++LVKR +  VCADI+E 
Sbjct  672   DKKCQTGCGGPSQRWYHVPRSWLKPSGNQLIVFEELGGNPAGITLVKRTMDRVCADIFEG  731

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
             QP L N ++  S K    L+ KAHL C  G KI+ I+FASFG P+G+CGSF EG+CHA  
Sbjct  732   QPSLKNSQIIGSSKVNS-LQSKAHLWCAPGLKISKIQFASFGVPQGTCGSFREGSCHAHK  790

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SYD  Q+ CIG  SC+V V PE FGGDPCP  MKKLSVE +CS
Sbjct  791   SYDALQRNCIGKQSCSVSVAPEVFGGDPCPGSMKKLSVEALCS  833



>ref|XP_002282132.1| PREDICTED: beta-galactosidase [Vitis vinifera]
Length=836

 Score =  1240 bits (3208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/823 (73%), Positives = 693/823 (84%), Gaps = 4/823 (0%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             SWVS G+ASV+YDK SFIINGQRKIL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYV
Sbjct  17    SWVSHGSASVTYDKRSFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV  76

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWNGHEP  GKYYFEGRYDLV+FIK+ Q AGLYVHLR+GPY CAEWNFGGFPVWLKYVPG
Sbjct  77    FWNGHEPSRGKYYFEGRYDLVRFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPG  136

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             ++FRTDNGPFK AMQ FT  IV+MMKS++L++ QGGPII+SQIENEYGP+EYE+GAPGK+
Sbjct  137   IAFRTDNGPFKVAMQGFTQKIVDMMKSEKLFQPQGGPIIMSQIENEYGPVEYEIGAPGKA  196

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y +WAA+MAV LGTGVPWVMCKQ+DAPDPV++ACNGFYC+ F PNK YKPKM+TEAWT W
Sbjct  197   YTKWAAEMAVQLGTGVPWVMCKQEDAPDPVIDACNGFYCENFFPNKDYKPKMFTEAWTGW  256

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             +TEFGG +P RPAEDLAY+VA+FI   GSFINYYM+HGGTNFGRTAGGPFI+TSYDYDAP
Sbjct  257   YTEFGGAIPNRPAEDLAYSVARFIQNRGSFINYYMYHGGTNFGRTAGGPFISTSYDYDAP  316

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             IDE+GL  EPKWGHL+DLH+AIKLCEPALVS DP V  LG   EA V+K+KSGACAAFLA
Sbjct  317   IDEYGLPSEPKWGHLRDLHKAIKLCEPALVSADPTVTYLGTNLEAHVYKAKSGACAAFLA  376

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQS  1682
             N +  S AKV FGN  Y+LPPWS+SILPDCKN V+NTAR+GAQSS+MKM PVS  FSWQS
Sbjct  377   NYDPKSSAKVTFGNTQYDLPPWSVSILPDCKNVVFNTARIGAQSSQMKMNPVST-FSWQS  435

Query  1681  YNEET-SSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             YNEET S+Y ++T T  GLLEQIN TRD +DYLWYMT+V I P E FLK G++P LTV S
Sbjct  436   YNEETASAYTEDTTTMDGLLEQINITRDTTDYLWYMTEVHIKPDEGFLKTGQYPVLTVMS  495

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AGHALHVFINGQL GT YG L NPKVTFS  V L  G NKISLLS+A+GLPNVG HFETW
Sbjct  496   AGHALHVFINGQLSGTVYGELSNPKVTFSDNVKLTVGTNKISLLSVAMGLPNVGLHFETW  555

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQP  1145
             NAGVLGPV+L GLNEG  D++  KWSYKIGLKGE L+L +++GSSS EWVEGS +AQKQP
Sbjct  556   NAGVLGPVTLKGLNEGTVDMSSWKWSYKIGLKGEALNLQAITGSSSDEWVEGSLLAQKQP  615

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTWYKTTF+AP GN+PLALDM++MGKGQIWING+S+GR+WP Y A G  C  CNYAG F+
Sbjct  616   LTWYKTTFNAPGGNDPLALDMSSMGKGQIWINGESIGRHWPAYTAHGN-CNGCNYAGIFN  674

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
             +KKC + CG  SQRWYHVPRSWL+P+GN L+ FEE GGNP G++LVKR +  VCADI+E 
Sbjct  675   DKKCQTGCGGPSQRWYHVPRSWLKPSGNQLIVFEELGGNPAGITLVKRTMDRVCADIFEG  734

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
             QP L N ++  S K    L+ KAHL C  G KI+ I+FASFG P+G+CGSF EG+CHA  
Sbjct  735   QPSLKNSQIIGSSKVNS-LQSKAHLWCAPGLKISKIQFASFGVPQGTCGSFREGSCHAHK  793

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SYD  Q+ CIG  SC+V V PE FGGDPCP  MKKLSVE +CS
Sbjct  794   SYDALQRNCIGKQSCSVSVAPEVFGGDPCPGSMKKLSVEALCS  836



>ref|XP_008805774.1| PREDICTED: beta-galactosidase-like isoform X2 [Phoenix dactylifera]
Length=841

 Score =  1237 bits (3201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/822 (73%), Positives = 692/822 (84%), Gaps = 11/822 (1%)
 Frame = -2

Query  2944  TSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
              +++SLG A+VSYD  + IINGQR+IL+SGSIHYPRSTP+MWPDL++KAK GGLDV+QTY
Sbjct  24    VAFLSLGDAAVSYDHKAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKVGGLDVIQTY  83

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWN HEP PG+YYFEGRYDLV+FIKL +QAGLYVHLR+GPY CAEWNFGGFP+WLKYVP
Sbjct  84    VFWNAHEPSPGQYYFEGRYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVP  143

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G+SFRT+NGPFKAAM+KFT  IV+MMK++ L+E QGGPIILSQIENE+GPMEY  GAP K
Sbjct  144   GISFRTENGPFKAAMEKFTGKIVSMMKAEGLFEWQGGPIILSQIENEFGPMEYNGGAPAK  203

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
              YA WAA+MAVGL TGVPWVMCKQ+DAPDPV+N CNGFYCD FSPNK YKP +WTEAWT 
Sbjct  204   VYANWAAQMAVGLKTGVPWVMCKQEDAPDPVINTCNGFYCDDFSPNKPYKPMIWTEAWTG  263

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             WFT FGGPVP+RP EDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSY+YDA
Sbjct  264   WFTAFGGPVPHRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYEYDA  323

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             PIDE+GLLREPKWGHL+D+H+AIK+CE ALVSGDP   SLG+YQEA VF+SKSG CAAFL
Sbjct  324   PIDEYGLLREPKWGHLRDMHKAIKMCESALVSGDPTATSLGSYQEAHVFRSKSGVCAAFL  383

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN N  S+ +V F  +HY+LPPWSISILPDCK  V+NTARVGAQSS MKM  V  GFSW+
Sbjct  384   ANYNPSSYGRVTFNGIHYDLPPWSISILPDCKTAVFNTARVGAQSSHMKMERVG-GFSWK  442

Query  1684  SYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             SYNEE +S D + FT  GL+EQI+ T D SDYLWY T + I   E FLK GK+P L V S
Sbjct  443   SYNEEINSLDADAFTKDGLIEQISITWDRSDYLWYTTYINIGQDEQFLKNGKYPVLNVLS  502

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AGH +HVFINGQ  G  YGSL +PK+T+S  V L AG NKIS+LS+AVGLPNVG HFETW
Sbjct  503   AGHGMHVFINGQPAGNVYGSLNSPKLTYSGNVKLWAGSNKISILSVAVGLPNVGDHFETW  562

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQP  1145
             NAGVLGPV+L GLNEG+RDL+ QKW+Y+IGLKGE LSLHSLSGSS+VEW +    +  QP
Sbjct  563   NAGVLGPVTLDGLNEGERDLSRQKWTYQIGLKGEALSLHSLSGSSTVEWGD---TSNMQP  619

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTWYKT F+APAGNEPLALDM +MGKGQIWING+S+GRYWPG KA  G+CG C+Y G +D
Sbjct  620   LTWYKTFFNAPAGNEPLALDMRSMGKGQIWINGESIGRYWPGNKAY-GSCGVCDYRGTYD  678

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
             EKKC + CGE SQRWYHVPRSWL PTGNLLV  EEWGG+P G+S+VKR+V SVCA+I EW
Sbjct  679   EKKCQTNCGEPSQRWYHVPRSWLNPTGNLLVVLEEWGGDPTGISMVKRKVGSVCAEISEW  738

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
             QP   NW+ + +G      RPKAHLSC  GQ++TSIKFASFGTP+G+CGSFSEG+CHAFH
Sbjct  739   QPSFNNWKTKGNG------RPKAHLSCPTGQQMTSIKFASFGTPQGACGSFSEGSCHAFH  792

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             SYDIFQK CIG   C+VPV  E FGGDPCP  MKKL+VE +C
Sbjct  793   SYDIFQKKCIGQQRCSVPVVSEMFGGDPCPGTMKKLAVEAIC  834



>ref|XP_008793242.1| PREDICTED: beta-galactosidase [Phoenix dactylifera]
Length=840

 Score =  1236 bits (3198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/814 (74%), Positives = 693/814 (85%), Gaps = 11/814 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             A+VSYD  + II GQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYVFWNGHEP
Sbjct  37    AAVSYDHKAVIIGGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEP  96

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG+YYF GRYDLV+FIKL +QAGLYVHLR+GPY CAEWNFGGFP+WLKYVPG+SFRT+N
Sbjct  97    SPGQYYFGGRYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVPGISFRTNN  156

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFKAAM+KFT  IV+MMK++ L+E QGGPIILSQIENE+GP+EY+ GAP KSYA WAA+
Sbjct  157   GPFKAAMEKFTEKIVSMMKAEGLFEWQGGPIILSQIENEFGPLEYDGGAPAKSYANWAAQ  216

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPWVMCKQDDAPDPV+N CNGFYCD+FSPNK YKP MWTEAWT WFT FGGP
Sbjct  217   MAVGLKTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKPYKPTMWTEAWTGWFTAFGGP  276

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP+RPAED+A+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GLL
Sbjct  277   VPHRPAEDMAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLL  336

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             REPKWGHL+DLH+AIKLCEPALVSGDP V+SLG+ QEA VF+SKSGACAAFLAN N  S+
Sbjct  337   REPKWGHLRDLHKAIKLCEPALVSGDPTVMSLGSNQEAHVFRSKSGACAAFLANYNPSSY  396

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSS  1661
              ++ F  MHY+LPPWSISILP+CK TV+NTARVGAQSS+MKM  V  GFSW SYNE+T+S
Sbjct  397   GRITFNGMHYDLPPWSISILPNCKTTVFNTARVGAQSSQMKMERVG-GFSWNSYNEDTNS  455

Query  1660  YDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
              D + FT  GL+EQI+ T D SDYLWY T V I   E FLK GK+P LTV SAGHA+HVF
Sbjct  456   LDADAFTKDGLVEQISMTWDRSDYLWYTTYVNIGQNEQFLKNGKYPVLTVLSAGHAMHVF  515

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             INGQL G  +G L+NPK+T+S  V L AG NKIS+LS+AVGLPNVG HFETWNAGVLGPV
Sbjct  516   INGQLAGNVFGGLDNPKLTYSGNVKLWAGSNKISILSVAVGLPNVGNHFETWNAGVLGPV  575

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTF  1121
             +L GLN+GKRDL+ QKW+Y+IGLKGE LSLHSLSGSSSVEW +    ++KQPLTWYKT F
Sbjct  576   TLDGLNQGKRDLSRQKWTYQIGLKGEALSLHSLSGSSSVEWGQA---SKKQPLTWYKTVF  632

Query  1120  DAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKC  941
              APAGNEPLALDM++MGKGQIWING+S+GRYWPGYKA  G+CG C+Y G + EKKC + C
Sbjct  633   SAPAGNEPLALDMSSMGKGQIWINGESIGRYWPGYKAY-GSCGGCDYRGTYSEKKCQTNC  691

Query  940   GEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWE  761
             GE+SQ WYHVPRSWL PTGNLLV FEEWGG+P G+S+VKR V SV A+I E QP + NW 
Sbjct  692   GESSQTWYHVPRSWLNPTGNLLVVFEEWGGDPTGISMVKRIVGSVGAEISELQPSVDNWN  751

Query  760   MQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKY  581
              +  G      RPKAHLSC  GQK+T+IKFASFGTP+G  G+FSEG CHAFHSYD F K 
Sbjct  752   AKVYG------RPKAHLSCPPGQKMTNIKFASFGTPQGVHGNFSEGACHAFHSYDAFDKN  805

Query  580   CIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             C+G   C+V V+PE FGGDPCP  MKKL+VE VC
Sbjct  806   CVGQQHCSVSVSPEMFGGDPCPGTMKKLAVEAVC  839



>ref|XP_002514108.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF48062.1| beta-galactosidase, putative [Ricinus communis]
Length=840

 Score =  1236 bits (3197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/822 (73%), Positives = 691/822 (84%), Gaps = 4/822 (0%)
 Frame = -2

Query  2938  WVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVF  2759
             WV    A+VSYD  +  INGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYVF
Sbjct  22    WVCSILATVSYDHRAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVF  81

Query  2758  WNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGV  2579
             WNGHEP PG YYFE RYDLVKFIK+ Q AGLYVHLR+GPY CAEWNFGGFPVWLKYVPG+
Sbjct  82    WNGHEPSPGNYYFEDRYDLVKFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGI  141

Query  2578  SFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSY  2399
              FRTDNGPFKAAMQKFT  IV+MMKS++L+ESQGGPIILSQIENE+GP+E+E+GAPGK+Y
Sbjct  142   EFRTDNGPFKAAMQKFTEKIVSMMKSEKLFESQGGPIILSQIENEFGPVEWEIGAPGKAY  201

Query  2398  AQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWF  2219
              +WAA MAV LGTGVPWVMCKQDDAPDPV+N CNGFYC+ F PNK YKPK+WTE WT W+
Sbjct  202   TKWAADMAVKLGTGVPWVMCKQDDAPDPVINTCNGFYCENFKPNKDYKPKLWTENWTGWY  261

Query  2218  TEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPI  2039
             TEFGG VPYRPAEDLA++VA+FI  GGSF+NYYM+HGGTNFGRT+ G FIATSYDYDAP+
Sbjct  262   TEFGGAVPYRPAEDLAFSVARFIQNGGSFMNYYMYHGGTNFGRTSAGLFIATSYDYDAPL  321

Query  2038  DEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLAN  1859
             DE+GL R+PKWGHL+DLH+AIKLCEPALVS DP V SLG+ QEA VF+SKS +CAAFLAN
Sbjct  322   DEYGLTRDPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGSNQEAHVFQSKS-SCAAFLAN  380

Query  1858  NNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSY  1679
              +     KV FGN  Y+LPPWSISILPDCK  V+NTAR+GAQSS+MKMTPV    SWQSY
Sbjct  381   YDTKYSVKVTFGNGQYDLPPWSISILPDCKTAVFNTARLGAQSSQMKMTPVGGALSWQSY  440

Query  1678  NEETSS-YDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
              EE ++ Y D+T T  GL EQIN TRDASDYLWYMT+V ID  E FLK G  P LT++SA
Sbjct  441   IEEAATGYTDDTTTLEGLWEQINVTRDASDYLWYMTNVNIDSDEGFLKNGDSPVLTIFSA  500

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GH+LHVFINGQL GT YGSLENPK+TFS+ V L AG+NKISLLS+AVGLPNVG HFE WN
Sbjct  501   GHSLHVFINGQLAGTVYGSLENPKLTFSQNVKLTAGINKISLLSVAVGLPNVGVHFEKWN  560

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AG+LGPV+L GLNEG RDL+  KWSYKIGLKGE LSLH+++GSSSVEWVEGS  A+KQPL
Sbjct  561   AGILGPVTLKGLNEGTRDLSGWKWSYKIGLKGEALSLHTVTGSSSVEWVEGSLSAKKQPL  620

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYK TFDAP GN+P+ALDM++MGKGQIW+NGQS+GR+WP Y A  G+C ACNYAG +D+
Sbjct  621   TWYKATFDAPEGNDPVALDMSSMGKGQIWVNGQSIGRHWPAYTAR-GSCSACNYAGTYDD  679

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
             KKC S CGE SQRWYHVPRSWL P+GNLLV FEEWGG P G+SLVKR   SVCADI+E Q
Sbjct  680   KKCRSNCGEPSQRWYHVPRSWLNPSGNLLVVFEEWGGEPSGISLVKRTTGSVCADIFEGQ  739

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             P L NW+M A G+    L+PKAHL C  GQKI+ IKFAS+G+P+G+CGSF  G+CHA  S
Sbjct  740   PALKNWQMIALGRLDH-LQPKAHLWCPHGQKISKIKFASYGSPQGTCGSFKAGSCHAHKS  798

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD F+K CIG  SC+V V  E FGGDPCP   KKLSVE VC+
Sbjct  799   YDAFEKKCIGKQSCSVTVAAEVFGGDPCPDSSKKLSVEAVCT  840



>ref|XP_008805772.1| PREDICTED: beta-galactosidase-like isoform X1 [Phoenix dactylifera]
Length=846

 Score =  1232 bits (3187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/827 (73%), Positives = 692/827 (84%), Gaps = 16/827 (2%)
 Frame = -2

Query  2944  TSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
              +++SLG A+VSYD  + IINGQR+IL+SGSIHYPRSTP+MWPDL++KAK GGLDV+QTY
Sbjct  24    VAFLSLGDAAVSYDHKAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKVGGLDVIQTY  83

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWN HEP PG+YYFEGRYDLV+FIKL +QAGLYVHLR+GPY CAEWNFGGFP+WLKYVP
Sbjct  84    VFWNAHEPSPGQYYFEGRYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVP  143

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G+SFRT+NGPFKAAM+KFT  IV+MMK++ L+E QGGPIILSQIENE+GPMEY  GAP K
Sbjct  144   GISFRTENGPFKAAMEKFTGKIVSMMKAEGLFEWQGGPIILSQIENEFGPMEYNGGAPAK  203

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
              YA WAA+MAVGL TGVPWVMCKQ+DAPDPV+N CNGFYCD FSPNK YKP +WTEAWT 
Sbjct  204   VYANWAAQMAVGLKTGVPWVMCKQEDAPDPVINTCNGFYCDDFSPNKPYKPMIWTEAWTG  263

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             WFT FGGPVP+RP EDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFIATSY+YDA
Sbjct  264   WFTAFGGPVPHRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYEYDA  323

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             PIDE+GLLREPKWGHL+D+H+AIK+CE ALVSGDP   SLG+YQEA VF+SKSG CAAFL
Sbjct  324   PIDEYGLLREPKWGHLRDMHKAIKMCESALVSGDPTATSLGSYQEAHVFRSKSGVCAAFL  383

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN N  S+ +V F  +HY+LPPWSISILPDCK  V+NTARVGAQSS MKM  V  GFSW+
Sbjct  384   ANYNPSSYGRVTFNGIHYDLPPWSISILPDCKTAVFNTARVGAQSSHMKMERVG-GFSWK  442

Query  1684  SYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             SYNEE +S D + FT  GL+EQI+ T D SDYLWY T + I   E FLK GK+P L V S
Sbjct  443   SYNEEINSLDADAFTKDGLIEQISITWDRSDYLWYTTYINIGQDEQFLKNGKYPVLNVLS  502

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AGH +HVFINGQ  G  YGSL +PK+T+S  V L AG NKIS+LS+AVGLPNVG HFETW
Sbjct  503   AGHGMHVFINGQPAGNVYGSLNSPKLTYSGNVKLWAGSNKISILSVAVGLPNVGDHFETW  562

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQP  1145
             NAGVLGPV+L GLNEG+RDL+ QKW+Y+IGLKGE LSLHSLSGSS+VEW +    +  QP
Sbjct  563   NAGVLGPVTLDGLNEGERDLSRQKWTYQIGLKGEALSLHSLSGSSTVEWGD---TSNMQP  619

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTWYKT F+APAGNEPLALDM +MGKGQIWING+S+GRYWPG KA  G+CG C+Y G +D
Sbjct  620   LTWYKTFFNAPAGNEPLALDMRSMGKGQIWINGESIGRYWPGNKAY-GSCGVCDYRGTYD  678

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
             EKKC + CGE SQRWYHVPRSWL PTGNLLV  EEWGG+P G+S+VKR+V SVCA+I EW
Sbjct  679   EKKCQTNCGEPSQRWYHVPRSWLNPTGNLLVVLEEWGGDPTGISMVKRKVGSVCAEISEW  738

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
             QP   NW+ + +G      RPKAHLSC  GQ++TSIKFASFGTP+G+CGSFSEG+CHAFH
Sbjct  739   QPSFNNWKTKGNG------RPKAHLSCPTGQQMTSIKFASFGTPQGACGSFSEGSCHAFH  792

Query  604   SYDIFQK-----YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             SYDIFQK      CIG   C+VPV  E FGGDPCP  MKKL+VE +C
Sbjct  793   SYDIFQKESLSQKCIGQQRCSVPVVSEMFGGDPCPGTMKKLAVEAIC  839



>sp|P45582.1|BGAL_ASPOF RecName: Full=Beta-galactosidase; Short=Lactase; Flags: Precursor 
[Asparagus officinalis]
 emb|CAA54525.1| beta-galactosidase [Asparagus officinalis]
Length=832

 Score =  1229 bits (3181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/820 (73%), Positives = 693/820 (85%), Gaps = 17/820 (2%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASV+YD  S IINGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYVFWNGHE
Sbjct  24    TASVTYDHKSVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  83

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PG+YYF GRYDLV+F+KL +QAGLY HLR+GPY CAEWNFGGFPVWLKYVPG+ FRTD
Sbjct  84    PSPGQYYFGGRYDLVRFLKLVKQAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGIHFRTD  143

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFKAAM KFT  IV+MMK++ LYE+QGGPIILSQIENEYGP+EY  GA GKSY  WAA
Sbjct  144   NGPFKAAMGKFTEKIVSMMKAEGLYETQGGPIILSQIENEYGPVEYYDGAAGKSYTNWAA  203

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             KMAVGL TGVPWVMCKQDDAPDPV+N CNGFYCD+FSPNK  KPKMWTEAWT WFT FGG
Sbjct  204   KMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKDNKPKMWTEAWTGWFTGFGG  263

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
              VP RPAED+A+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI+TSYDYDAPIDE+GL
Sbjct  264   AVPQRPAEDMAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFISTSYDYDAPIDEYGL  323

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
             LR+PKWGHL+DLH+AIKLCEPALVSG+P + SLG  QE+ V++SKS +CAAFLAN N   
Sbjct  324   LRQPKWGHLRDLHKAIKLCEPALVSGEPTITSLGQNQESYVYRSKS-SCAAFLANFNSRY  382

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETS  1664
             +A V F  MHYNLPPWS+SILPDCK TV+NTARVGAQ++ MKM  +  GFSW++Y E+T 
Sbjct  383   YATVTFNGMHYNLPPWSVSILPDCKTTVFNTARVGAQTTTMKMQYLG-GFSWKAYTEDTD  441

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             + +DNTFT  GL+EQ++TT D SDYLWY T V I   E FLK GK+P+LTV SAGHA+HV
Sbjct  442   ALNDNTFTKDGLVEQLSTTWDRSDYLWYTTYVDIAKNEEFLKTGKYPYLTVMSAGHAVHV  501

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT+YGSL+NPK+T+S +  L AG NKIS+LS++VGLPNVG HFETWN GVLGP
Sbjct  502   FINGQLSGTAYGSLDNPKLTYSGSAKLWAGSNKISILSVSVGLPNVGNHFETWNTGVLGP  561

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L+GLNEGKRDL+ QKW+Y+IGL GE LSLHSL+GSS+VEW E    +QKQPLTWYKT 
Sbjct  562   VTLTGLNEGKRDLSLQKWTYQIGLHGETLSLHSLTGSSNVEWGEA---SQKQPLTWYKTF  618

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F+AP GNEPLALDMNTMGKGQIWINGQS+GRYWP YKAS G+CG+C+Y G ++EKKCLS 
Sbjct  619   FNAPPGNEPLALDMNTMGKGQIWINGQSIGRYWPAYKAS-GSCGSCDYRGTYNEKKCLSN  677

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CGEASQRWYHVPRSWL PTGN LV  EEWGG+P G+S+VKR VASVCA++ E QP + NW
Sbjct  678   CGEASQRWYHVPRSWLIPTGNFLVVLEEWGGDPTGISMVKRSVASVCAEVEELQPTMDNW  737

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
               +A G      RPK HLSC  GQK++ IKFASFGTP+G+CGSFSEG+CHA  SYD F++
Sbjct  738   RTKAYG------RPKVHLSCDPGQKMSKIKFASFGTPQGTCGSFSEGSCHAHKSYDAFEQ  791

Query  583   Y-----CIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
                   C+G   C+V V PE FGGDPCP  MKKL+VE +C
Sbjct  792   EGLMQNCVGQEFCSVNVAPEVFGGDPCPGTMKKLAVEAIC  831



>ref|XP_009407297.1| PREDICTED: beta-galactosidase 2 [Musa acuminata subsp. malaccensis]
Length=836

 Score =  1220 bits (3156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/817 (73%), Positives = 689/817 (84%), Gaps = 11/817 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L +ASVSYD  +  I+G+R+IL+SGSIHYPRS PEMWPDL++KAK+GGLDV+QTYVFWNG
Sbjct  30    LASASVSYDHKAIAIDGRRRILISGSIHYPRSVPEMWPDLIQKAKDGGLDVIQTYVFWNG  89

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG+YYFEGRYDLV+FIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG+ FR
Sbjct  90    HEPSPGEYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIVFR  149

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFKAAMQKFT  IV+MMKS+ L+E QGGPIILSQIENE+GP+EY+ G P K+YA W
Sbjct  150   TDNEPFKAAMQKFTEKIVSMMKSEGLFEWQGGPIILSQIENEFGPLEYDQGEPAKAYAAW  209

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AAKMA+GL TGVPWVMCK+DDAPDPV+N CNGFYCD+FSPN+ YKP MWTEAWTAWFT F
Sbjct  210   AAKMAIGLDTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNQPYKPNMWTEAWTAWFTGF  269

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGPVP+RP EDLA+AV KFI KGGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+
Sbjct  270   GGPVPHRPVEDLAFAVTKFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEY  329

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GLLR+PKWGHLKDLH+AIKLCE ALVSGDP V SLG+ QE+RVF+S SG CAAFLAN + 
Sbjct  330   GLLRQPKWGHLKDLHKAIKLCESALVSGDPVVTSLGSSQESRVFRSNSGDCAAFLANYDT  389

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEE  1670
              S+A+VAF  MHY+LPPWSISILPDC+ TVYNTARVG Q+S+++M  V  GFSW SYNE+
Sbjct  390   SSYARVAFNGMHYDLPPWSISILPDCRTTVYNTARVGVQTSQIRMDSVG-GFSWASYNED  448

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
             T++ D+  FT  GLLEQ+N TRD +DYLWYMT V ID  E FL  G++P LTV SAGH+L
Sbjct  449   TNAIDEEAFTTDGLLEQVNVTRDTTDYLWYMTYVNIDQDEQFLLTGQYPVLTVMSAGHSL  508

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQ  GT YGSL+NPK+T++  V LRAG N IS+LS++VGLPNVG HFETWNAGVL
Sbjct  509   HVFINGQPTGTVYGSLDNPKLTYAGNVKLRAGSNTISILSVSVGLPNVGEHFETWNAGVL  568

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPV L GLNEG+RDLTWQKWSY+IGL+GE L+LHSLSGSSSVEW E    ++ QPLTWYK
Sbjct  569   GPVMLKGLNEGRRDLTWQKWSYQIGLRGETLNLHSLSGSSSVEWQEA---SRNQPLTWYK  625

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               F+AP GNEPLALDM++MGKGQ+WINGQS+GRYWPGY A  G+CG C+Y G +DEKKC 
Sbjct  626   AFFNAPDGNEPLALDMSSMGKGQVWINGQSIGRYWPGYMAY-GSCGDCDYRGTYDEKKCQ  684

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             + CGE SQ+WYHVPRSWL PTGNLLV FEEW G+P G+S+VKR V SVCADI EWQP + 
Sbjct  685   TNCGEPSQKWYHVPRSWLNPTGNLLVVFEEWAGDPTGISMVKRSVGSVCADISEWQPSMS  744

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW  +  GK      PK  L CG  Q IT+IKFASFGTP+G+CGSFSEG+CHA  SYD F
Sbjct  745   NWHTRDYGK------PKVRLFCGTAQNITAIKFASFGTPQGACGSFSEGSCHAHKSYDAF  798

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             +K C+G   C+V ++PE FGGDPCP  MK+++VE VC
Sbjct  799   EKNCLGEQRCSVTISPEVFGGDPCPGTMKRITVEAVC  835



>ref|XP_010915229.1| PREDICTED: beta-galactosidase isoform X2 [Elaeis guineensis]
Length=836

 Score =  1218 bits (3151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/818 (72%), Positives = 688/818 (84%), Gaps = 11/818 (1%)
 Frame = -2

Query  2932  SLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWN  2753
             S G A+VSYD  + IINGQR+IL+SGSIHYPRSTP+MWPDL++KAK+GGLDV+QTYVFWN
Sbjct  29    SSGDAAVSYDHRAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKDGGLDVIQTYVFWN  88

Query  2752  GHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSF  2573
             GHEP PG+YYFEGRYDLV+F+KL +QAGLYV+LR+GPY CAEWNFGGFP+WLKYVPG+SF
Sbjct  89    GHEPFPGQYYFEGRYDLVRFVKLVKQAGLYVNLRIGPYVCAEWNFGGFPIWLKYVPGISF  148

Query  2572  RTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQ  2393
             RTDNGPFKAAM+KFT  IV+MMK++ L+E QGGPIILSQ+ENE+GPMEY  GA  + YA 
Sbjct  149   RTDNGPFKAAMEKFTAKIVSMMKAEGLFEWQGGPIILSQVENEFGPMEYNGGAAARVYAN  208

Query  2392  WAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTE  2213
             WAA+MAV L TGVPWVMCKQDDAPDPV+N CNGFYCD FSPNK YKP +WTEAWT WFT 
Sbjct  209   WAAQMAVSLKTGVPWVMCKQDDAPDPVINTCNGFYCDDFSPNKPYKPMIWTEAWTGWFTA  268

Query  2212  FGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDE  2033
             FGGPVP RP EDLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFIATSY+YDAPIDE
Sbjct  269   FGGPVPRRPVEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYEYDAPIDE  328

Query  2032  FGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNN  1853
             +GLLREPKWGHL+DLH+AIKLCEPALVSGDP V SLG+Y EA VF+SKSGACAAFL+N N
Sbjct  329   YGLLREPKWGHLRDLHKAIKLCEPALVSGDPTVTSLGSYHEAHVFQSKSGACAAFLSNYN  388

Query  1852  QHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNE  1673
               S+ +V F  MH++LPPWSI+ILPDC+  V+NTARVGAQSS+MKM  V  GFSW+SYNE
Sbjct  389   PSSYGRVTFNGMHHDLPPWSITILPDCRTAVFNTARVGAQSSQMKMELVG-GFSWESYNE  447

Query  1672  ETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHA  1493
             + +S D + FT  GLLEQI+ T D SDYLWY T V I   E FLK G +P L+V SAGH 
Sbjct  448   DINSLDSDAFTKDGLLEQISMTWDRSDYLWYTTYVNIGQDEQFLKNGNYPVLSVLSAGHG  507

Query  1492  LHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGV  1313
             +HVF+NG+  G  YG L++PK+T+S+ V L AG NKIS+LS+AVGLPNVG HFETWNAGV
Sbjct  508   MHVFVNGRPEGNVYGGLDSPKLTYSRNVKLWAGSNKISILSVAVGLPNVGDHFETWNAGV  567

Query  1312  LGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWY  1133
             LGPV+L GLNEGKRDL+ +KW+Y++GLKGE LSLHSLSGSSSVEW      +  QPLTWY
Sbjct  568   LGPVTLDGLNEGKRDLSREKWTYQVGLKGEALSLHSLSGSSSVEWGGA---SNMQPLTWY  624

Query  1132  KTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKC  953
             KT F+AP+GNEPLALDM +MGKGQIWING+S+GRYWP YKA  G+CG C+Y G ++EKKC
Sbjct  625   KTLFNAPSGNEPLALDMRSMGKGQIWINGESIGRYWPAYKAY-GSCGGCDYRGTYNEKKC  683

Query  952   LSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQL  773
              + CGE SQRWYHVPRSWL PTGNLLV  EEWGG+P G+S+VKR+V SVCA+I+EWQP  
Sbjct  684   QTNCGEPSQRWYHVPRSWLNPTGNLLVVLEEWGGDPTGISMVKRKVGSVCAEIFEWQPSA  743

Query  772   MNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDI  593
              NW+ +  G      RPKAHLSC  GQK++ IKFASFGTP+G CGSFSEG+CHAFHSYD 
Sbjct  744   RNWKTKGYG------RPKAHLSCPPGQKMSKIKFASFGTPQGVCGSFSEGSCHAFHSYDA  797

Query  592   FQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             FQK CIG   C+V V P+ FGGDPCP +MKKL+VE +C
Sbjct  798   FQKNCIGQQWCSVVVAPQMFGGDPCPGIMKKLAVEAIC  835



>ref|XP_007204656.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
 gb|EMJ05855.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
Length=836

 Score =  1213 bits (3139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/817 (72%), Positives = 689/817 (84%), Gaps = 6/817 (1%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASVSYD  + IINGQ++IL+SGSIHYPRSTPEMWPDL++K+K+GGLDV+QTYVFWNGHE
Sbjct  25    TASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTYVFWNGHE  84

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFE RYDLVKFIKL  QAGLYV+LR+GPY CAEWNFGGFPVWLKYVPG+ FRTD
Sbjct  85    PSPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIVFRTD  144

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             N PFKAAMQKFT  IV+MMK+++L++SQGGPIILSQIENE+GP+E+E+GAPGK+Y +WAA
Sbjct  145   NEPFKAAMQKFTEKIVSMMKAEQLFQSQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAA  204

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             +MAVGL TGVPW+MCKQ+DAPDPV++ CNGFYC+ F+PNK YKPKMWTE WT W+TEFGG
Sbjct  205   QMAVGLNTGVPWIMCKQEDAPDPVIDTCNGFYCENFTPNKNYKPKMWTEVWTGWYTEFGG  264

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
              VP RPAEDLA+++A+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ATSYDYDAP+DE+GL
Sbjct  265   AVPTRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGL  324

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
              REPKWGHL+DLH+AIK  E ALVS +P+V SLGN QEA VFKSKSG CAAFLAN +  S
Sbjct  325   PREPKWGHLRDLHKAIKSSESALVSAEPSVTSLGNGQEAHVFKSKSG-CAAFLANYDTKS  383

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETS  1664
              AKV+FGN  Y LPPWSISILPDCK  VYNTAR+G+QSS+MKMTPV     WQS+ EE++
Sbjct  384   SAKVSFGNGQYELPPWSISILPDCKTAVYNTARLGSQSSQMKMTPVKSALPWQSFVEESA  443

Query  1663  SYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S D+ +T T  GL EQIN TRD +DYLWYMTD+ I P E F+K G+ P LT+YSAGHALH
Sbjct  444   SSDESDTTTLDGLWEQINVTRDTTDYLWYMTDITISPDEGFIKRGESPLLTIYSAGHALH  503

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQL GT YG+LENPK+TFS+ V LR+G+NK++LLSI+VGLPNVG HFETWNAGVLG
Sbjct  504   VFINGQLSGTVYGALENPKLTFSQNVKLRSGINKLALLSISVGLPNVGLHFETWNAGVLG  563

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKT  1127
             PV+L GLN G  D++  KW+YKIGLKGE L LH++SGSSSVEW EG  +AQKQPLTWYK 
Sbjct  564   PVTLKGLNSGTWDMSRWKWTYKIGLKGEALGLHTVSGSSSVEWAEGPSMAQKQPLTWYKA  623

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
             TF+AP GN PLALDM++MGKGQIWINGQS+GR+WP Y A G  CG C YAG +D+KKC +
Sbjct  624   TFNAPPGNGPLALDMSSMGKGQIWINGQSIGRHWPAYTARGN-CGNCYYAGTYDDKKCRT  682

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CGE SQRWYHVPRSWL P+GNLLV FEEWGG+P  +SLV+R  +SVCADI+E QP L N
Sbjct  683   HCGEPSQRWYHVPRSWLTPSGNLLVVFEEWGGDPTKISLVERRTSSVCADIFEGQPTLTN  742

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
              +  ASGK     RPKAHL C  GQ I+ IKFAS+G P+G+CGSF EG+CHA  SYD  +
Sbjct  743   SQKLASGKLN---RPKAHLWCPPGQVISDIKFASYGLPQGTCGSFQEGSCHAHKSYDAPK  799

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             + CIG  SC+V V PEAFGGDPCP   KKLSVE VCS
Sbjct  800   RNCIGKQSCSVAVAPEAFGGDPCPGSTKKLSVEAVCS  836



>ref|XP_010915228.1| PREDICTED: beta-galactosidase isoform X1 [Elaeis guineensis]
Length=841

 Score =  1212 bits (3137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/823 (72%), Positives = 688/823 (84%), Gaps = 16/823 (2%)
 Frame = -2

Query  2932  SLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWN  2753
             S G A+VSYD  + IINGQR+IL+SGSIHYPRSTP+MWPDL++KAK+GGLDV+QTYVFWN
Sbjct  29    SSGDAAVSYDHRAVIINGQRRILISGSIHYPRSTPDMWPDLIQKAKDGGLDVIQTYVFWN  88

Query  2752  GHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSF  2573
             GHEP PG+YYFEGRYDLV+F+KL +QAGLYV+LR+GPY CAEWNFGGFP+WLKYVPG+SF
Sbjct  89    GHEPFPGQYYFEGRYDLVRFVKLVKQAGLYVNLRIGPYVCAEWNFGGFPIWLKYVPGISF  148

Query  2572  RTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQ  2393
             RTDNGPFKAAM+KFT  IV+MMK++ L+E QGGPIILSQ+ENE+GPMEY  GA  + YA 
Sbjct  149   RTDNGPFKAAMEKFTAKIVSMMKAEGLFEWQGGPIILSQVENEFGPMEYNGGAAARVYAN  208

Query  2392  WAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTE  2213
             WAA+MAV L TGVPWVMCKQDDAPDPV+N CNGFYCD FSPNK YKP +WTEAWT WFT 
Sbjct  209   WAAQMAVSLKTGVPWVMCKQDDAPDPVINTCNGFYCDDFSPNKPYKPMIWTEAWTGWFTA  268

Query  2212  FGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDE  2033
             FGGPVP RP EDLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFIATSY+YDAPIDE
Sbjct  269   FGGPVPRRPVEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYEYDAPIDE  328

Query  2032  FGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNN  1853
             +GLLREPKWGHL+DLH+AIKLCEPALVSGDP V SLG+Y EA VF+SKSGACAAFL+N N
Sbjct  329   YGLLREPKWGHLRDLHKAIKLCEPALVSGDPTVTSLGSYHEAHVFQSKSGACAAFLSNYN  388

Query  1852  QHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNE  1673
               S+ +V F  MH++LPPWSI+ILPDC+  V+NTARVGAQSS+MKM  V  GFSW+SYNE
Sbjct  389   PSSYGRVTFNGMHHDLPPWSITILPDCRTAVFNTARVGAQSSQMKMELVG-GFSWESYNE  447

Query  1672  ETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHA  1493
             + +S D + FT  GLLEQI+ T D SDYLWY T V I   E FLK G +P L+V SAGH 
Sbjct  448   DINSLDSDAFTKDGLLEQISMTWDRSDYLWYTTYVNIGQDEQFLKNGNYPVLSVLSAGHG  507

Query  1492  LHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGV  1313
             +HVF+NG+  G  YG L++PK+T+S+ V L AG NKIS+LS+AVGLPNVG HFETWNAGV
Sbjct  508   MHVFVNGRPEGNVYGGLDSPKLTYSRNVKLWAGSNKISILSVAVGLPNVGDHFETWNAGV  567

Query  1312  LGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWY  1133
             LGPV+L GLNEGKRDL+ +KW+Y++GLKGE LSLHSLSGSSSVEW      +  QPLTWY
Sbjct  568   LGPVTLDGLNEGKRDLSREKWTYQVGLKGEALSLHSLSGSSSVEWGGA---SNMQPLTWY  624

Query  1132  KTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKC  953
             KT F+AP+GNEPLALDM +MGKGQIWING+S+GRYWP YKA  G+CG C+Y G ++EKKC
Sbjct  625   KTLFNAPSGNEPLALDMRSMGKGQIWINGESIGRYWPAYKAY-GSCGGCDYRGTYNEKKC  683

Query  952   LSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQL  773
              + CGE SQRWYHVPRSWL PTGNLLV  EEWGG+P G+S+VKR+V SVCA+I+EWQP  
Sbjct  684   QTNCGEPSQRWYHVPRSWLNPTGNLLVVLEEWGGDPTGISMVKRKVGSVCAEIFEWQPSA  743

Query  772   MNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDI  593
              NW+ +  G      RPKAHLSC  GQK++ IKFASFGTP+G CGSFSEG+CHAFHSYD 
Sbjct  744   RNWKTKGYG------RPKAHLSCPPGQKMSKIKFASFGTPQGVCGSFSEGSCHAFHSYDA  797

Query  592   FQKY-----CIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             FQK      CIG   C+V V P+ FGGDPCP +MKKL+VE +C
Sbjct  798   FQKESLLQNCIGQQWCSVVVAPQMFGGDPCPGIMKKLAVEAIC  840



>ref|XP_010047575.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW79521.1| hypothetical protein EUGRSUZ_C00898 [Eucalyptus grandis]
Length=874

 Score =  1211 bits (3132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/816 (71%), Positives = 683/816 (84%), Gaps = 3/816 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASV+YD  + I+NG+R+IL+SGSIHYPRSTP MWPDL++KAK+GGLDV+QTYVFWNGHEP
Sbjct  42    ASVTYDHRALIVNGKRRILISGSIHYPRSTPGMWPDLIQKAKDGGLDVIQTYVFWNGHEP  101

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGKYYFE RYDLV+FIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLK+VPG+ FRTDN
Sbjct  102   SPGKYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKFVPGIVFRTDN  161

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFKAAMQ+FT  IVNMMK++ L+ESQGGPIILSQ+ENE+GP+E+E+GAPGK+Y++WAA 
Sbjct  162   EPFKAAMQRFTEKIVNMMKAENLFESQGGPIILSQVENEFGPVEWEIGAPGKAYSKWAAD  221

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGLGTGVPWVMCKQ+DAPDPV++ CNG+YC+ F PN+ YKPKMWTEAWT W+TEFGG 
Sbjct  222   MAVGLGTGVPWVMCKQEDAPDPVIDTCNGYYCENFKPNRDYKPKMWTEAWTGWYTEFGGA  281

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             +P+RP EDLAY+VA+FI  GGSF+NYYM+HGGTNFGRT+GGPFIATSYDYDAPIDEFGL 
Sbjct  282   IPHRPVEDLAYSVARFIQNGGSFVNYYMYHGGTNFGRTSGGPFIATSYDYDAPIDEFGLP  341

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             RE KW HLKDLH AIKLCE ALVS +  V+SLGN QEA VF ++SGACAAFLAN + +  
Sbjct  342   REKKWRHLKDLHEAIKLCESALVSSNATVLSLGNKQEAHVFTAESGACAAFLANYDPNYS  401

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSS  1661
              KV F    Y+LPPWS+SILPDCK  V+NTAR+GAQSS MKMTP+ + FSWQSYNEET S
Sbjct  402   VKVTFRGRQYDLPPWSVSILPDCKTAVFNTARIGAQSSLMKMTPLGKTFSWQSYNEETPS  461

Query  1660  YDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              DD +T    GLLEQIN TRDASDYLWYMTD+ I+P EAFLK G++P LTV+SAGHALHV
Sbjct  462   ADDSDTTEMEGLLEQINITRDASDYLWYMTDIVIEPDEAFLKNGQYPVLTVWSAGHALHV  521

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FIN QL GT YG LENPK+TF+  + L AG+NK+SLLSIAVGLPNVG HFETWNAGVLGP
Sbjct  522   FINSQLSGTVYGGLENPKLTFNDNLKLNAGINKLSLLSIAVGLPNVGLHFETWNAGVLGP  581

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L GLN G  +LT  KWSYK+GLKGE L L+++SGSSSVEW++GS +  K PLTWYKTT
Sbjct  582   VTLKGLNSGTWNLTNWKWSYKLGLKGETLGLNTISGSSSVEWMKGSSVVLKLPLTWYKTT  641

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP G++PLALDM++MGKGQIWINGQS+GR+WP Y A GG+CG CNYAG F E KC + 
Sbjct  642   FDAPEGDDPLALDMSSMGKGQIWINGQSIGRHWPSYVA-GGSCGECNYAGIFVENKCRTN  700

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ SQRWYH+PRSWL PT NLLV FEEWGG P G+SLVKR   SVCADI++ QP L + 
Sbjct  701   CGQPSQRWYHIPRSWLNPTANLLVVFEEWGGEPAGISLVKRMTGSVCADIFDGQPALKDR  760

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
              + +SGK+     PK HL+C  GQ+I+ IKFAS+G P+G+CG++ EG CHA  SYD  +K
Sbjct  761   HLVSSGKSNSTY-PKVHLTCPRGQEISEIKFASYGLPQGTCGNYQEGPCHAHRSYDALRK  819

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CIG   C+V V PE FGGDPCP+  KKLSVE +CS
Sbjct  820   NCIGKQLCSVTVAPEVFGGDPCPNSEKKLSVEAICS  855



>ref|XP_006646030.1| PREDICTED: beta-galactosidase 2-like [Oryza brachyantha]
Length=827

 Score =  1210 bits (3131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/811 (72%), Positives = 677/811 (83%), Gaps = 11/811 (1%)
 Frame = -2

Query  2911  SYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPG  2732
             +YD+ + ++NGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDVVQTYVFWNGHEP PG
Sbjct  27    TYDRKAVVVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVVQTYVFWNGHEPSPG  86

Query  2731  KYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPF  2552
             +YYFEGRYDLV FIKL +QAGLYV+LR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN PF
Sbjct  87    QYYFEGRYDLVHFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPF  146

Query  2551  KAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAV  2372
             KA MQKFTT IV+MMKS+ L+E QGGPIILSQIENE+GP+E++ G P K+YA WAA MAV
Sbjct  147   KAEMQKFTTKIVDMMKSEGLFEWQGGPIILSQIENEFGPLEWDQGEPAKAYASWAASMAV  206

Query  2371  GLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPY  2192
             GL TGVPW+MCK+DDAPDP++N CNGFYCDWFSPN   KP MWTEAWTAW+T FG PVP+
Sbjct  207   GLNTGVPWIMCKEDDAPDPIINTCNGFYCDWFSPNNPDKPTMWTEAWTAWYTGFGIPVPH  266

Query  2191  RPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREP  2012
             RP EDLAY VAKFI KGGSF+NYYM+HGGTNF RTAGGPFIATSYDYDAPIDE+GLLREP
Sbjct  267   RPVEDLAYGVAKFIQKGGSFVNYYMYHGGTNFERTAGGPFIATSYDYDAPIDEYGLLREP  326

Query  2011  KWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKV  1832
             KWGHLK+LH+AIKLCEPALV+GDP V SLGN Q++ VFKS +GACAAFL N ++ S+A+V
Sbjct  327   KWGHLKELHKAIKLCEPALVAGDPIVTSLGNAQKSSVFKSSTGACAAFLENKDKVSYARV  386

Query  1831  AFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSYDD  1652
             AF  MHY+LPPWSISILPDCK TV+NTARVG+Q S+MKM   + GF+WQSYNEE +S+D+
Sbjct  387   AFNGMHYDLPPWSISILPDCKTTVFNTARVGSQISQMKME-WAGGFAWQSYNEEINSFDE  445

Query  1651  NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFING  1472
             + FT  GLLEQIN TRD +DYLWY T+V ++  E FL  G+ P LTV SAGHALHVFING
Sbjct  446   DPFTTVGLLEQINVTRDNTDYLWYTTNVDVEQDEQFLSNGENPKLTVMSAGHALHVFING  505

Query  1471  QLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLS  1292
             QL GT YGS++NPK+T++  V L AG N IS LSIAVGLPNVG HFETWNAG+LGPV+L 
Sbjct  506   QLTGTVYGSVDNPKLTYTGNVKLWAGSNTISCLSIAVGLPNVGEHFETWNAGILGPVTLD  565

Query  1291  GLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDAP  1112
             GLNEG+RDLTWQKW+Y++GLKGE LSLHSLSGSS+VEW E     QKQPLTWYK  F+AP
Sbjct  566   GLNEGRRDLTWQKWTYQVGLKGESLSLHSLSGSSTVEWGEP---VQKQPLTWYKAFFNAP  622

Query  1111  AGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEA  932
              G+EPLALDM++MGKGQIWINGQ +GRYWPGYKA+G  CG C+Y G +DE KC + CG++
Sbjct  623   DGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKATGN-CGTCDYRGEYDESKCQTNCGDS  681

Query  931   SQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQA  752
             SQRWYHVPRSWL PTGNLLV FEEWGG+  G+S+ KR + SVCAD+ EWQP + NW  + 
Sbjct  682   SQRWYHVPRSWLNPTGNLLVIFEEWGGDHTGISMAKRSIGSVCADVSEWQPSMKNWRTKD  741

Query  751   SGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIG  572
               KA      K HL C  GQKIT IKFASFGTP+GSCGS+SEG CHA  SYDIF K C+G
Sbjct  742   YEKA------KVHLQCDNGQKITEIKFASFGTPQGSCGSYSEGGCHAHKSYDIFWKNCVG  795

Query  571   WNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
                C V V PE FGGDPCP  MK+  VE  C
Sbjct  796   QERCGVSVVPEVFGGDPCPGTMKRAVVEATC  826



>ref|XP_008242341.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase [Prunus mume]
Length=836

 Score =  1209 bits (3128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/817 (72%), Positives = 687/817 (84%), Gaps = 6/817 (1%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASVSYD  + IINGQ++IL+SGSIHYPRSTPEMWPDL++K+K+GGLDV+QTYVFWNGHE
Sbjct  25    TASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTYVFWNGHE  84

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFE RYDLVKFIKL  QAGLYV+LR+GPY CAEWNFGGFPVWLKYVPG+ FRTD
Sbjct  85    PSPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIVFRTD  144

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             N PFKAAMQKFT  IV+MMK+++L++SQGGPIILSQIENE+GP+E+E+GAPGK+Y +WAA
Sbjct  145   NEPFKAAMQKFTEKIVSMMKAEQLFQSQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAA  204

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             +MAVGL TGVPW+MCKQ+DAPDPV++ CNGFYC+ F+PNK YKPKMWTE WT W+TEFGG
Sbjct  205   RMAVGLNTGVPWIMCKQEDAPDPVIDTCNGFYCENFTPNKNYKPKMWTEVWTGWYTEFGG  264

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
              VP RPAEDLA+++A+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ATSYDYDAP+DE+GL
Sbjct  265   AVPTRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGL  324

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
              REPKWGHL+DLH+AIK  E ALVS +P+V SLGN QEA VFKSKSG CAAFLAN +  S
Sbjct  325   PREPKWGHLRDLHKAIKSSESALVSAEPSVTSLGNSQEAHVFKSKSG-CAAFLANYDTKS  383

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETS  1664
              AKV+FGN  Y LPPWSISILPDCK  VYNTAR+G+QSS+MKMTPV     WQS+ EE++
Sbjct  384   SAKVSFGNGQYELPPWSISILPDCKTAVYNTARLGSQSSQMKMTPVKSALPWQSFIEESA  443

Query  1663  SYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S D+ +T T  GL EQIN TRD +DYLWYMTD+ I P E F+K G+ P LT+YSAGHALH
Sbjct  444   SXDESDTTTLDGLWEQINVTRDTTDYLWYMTDITISPDEGFIKRGESPLLTIYSAGHALH  503

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQL GT YG+LENPK+TFS+ V LR+G+NK++LLSI+VGLPNVG HFETWNAGVLG
Sbjct  504   VFINGQLSGTVYGALENPKLTFSQNVKLRSGINKLALLSISVGLPNVGLHFETWNAGVLG  563

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKT  1127
             PV+L GLN G  D++  KW+YK+GLKGE L LH++SGSSSVEW EG  +AQKQPLTWYK 
Sbjct  564   PVTLKGLNSGTWDMSRWKWTYKVGLKGEALGLHTVSGSSSVEWAEGPSMAQKQPLTWYKA  623

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
             TF+AP GN PLALDM++MGKGQIWINGQS+GR+WP Y A G  CG C YAG +D+KKC +
Sbjct  624   TFNAPPGNGPLALDMSSMGKGQIWINGQSIGRHWPAYTARGN-CGNCYYAGTYDDKKCRT  682

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CGE SQRWYHVPRSWL P+ NLLV FEEWGG+P  +SLV+R  +SVCADI+E QP L N
Sbjct  683   HCGEPSQRWYHVPRSWLTPSENLLVVFEEWGGDPTKISLVERRTSSVCADIFEGQPTLTN  742

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
              +  ASGK     RPKAHL C  GQ I+ IKFAS+G P+G+CGSF EG+CHA  SYD  +
Sbjct  743   SQKLASGKLN---RPKAHLWCPPGQVISDIKFASYGLPQGTCGSFQEGSCHAHKSYDAPK  799

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             + CIG  SC+V V PE FGGDPCP   KKLSVE VCS
Sbjct  800   RNCIGKQSCSVTVAPEVFGGDPCPGSTKKLSVEAVCS  836



>ref|XP_009768469.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=837

 Score =  1208 bits (3125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/816 (71%), Positives = 682/816 (84%), Gaps = 3/816 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASV+YD  + +ING+R+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV++TYVFWNGHEP
Sbjct  24    ASVTYDDRAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIETYVFWNGHEP  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGK+ FEGRYDLVKFIKL QQAGLYV+LR+GPY CAEWNFGGFPVWLKYVPG+ FR DN
Sbjct  84    SPGKFNFEGRYDLVKFIKLVQQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGMEFRADN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ F   IVNMMKS  L+E QGGPII++QIENEYGP+E+ +G PGK YA+WAA+
Sbjct  144   QPFKVAMQGFVEKIVNMMKSGNLFEPQGGPIIMAQIENEYGPIEWGVGDPGKPYAKWAAE  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPW+MCKQ+DAPDPV++ CNGFYC+ F PNK YKPKMWTE WTAW+T+FGGP
Sbjct  204   MAVGLDTGVPWIMCKQEDAPDPVIDTCNGFYCENFKPNKPYKPKMWTEVWTAWYTKFGGP  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP RPAED+A+AVA+FI   GS+ NYYM+HGGTNFGRTA G FIATSYDYDAP+DE+GLL
Sbjct  264   VPRRPAEDVAFAVARFIQNNGSYFNYYMYHGGTNFGRTAAGRFIATSYDYDAPLDEYGLL  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
              EPK+GHL+DLH+AIKL EPALVS    V  LG  QEA V+ SKSG CAAFL+N +    
Sbjct  324   NEPKYGHLRDLHKAIKLSEPALVSSYATVTWLGKNQEAHVYNSKSGLCAAFLSNYDPTFS  383

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSS  1661
              +V F NM Y+LPPWS+SILPDCK  VYNTAR+ ++SS+MKMT V  G SW+SY+EET S
Sbjct  384   VRVTFQNMLYDLPPWSVSILPDCKTAVYNTARISSRSSQMKMTSVGGGLSWESYSEETPS  443

Query  1660  YDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              DD +T +ATGL EQIN TRD++DYLWYMT+V I   E FLK GK P+LTV SAGHALHV
Sbjct  444   ADDSDTISATGLWEQINVTRDSTDYLWYMTNVNIASDEGFLKNGKEPFLTVMSAGHALHV  503

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT YG L+NPK+T+S  V LRAG+NKIS+LS+AVGLPNVG HFETWNAGVLGP
Sbjct  504   FINGQLSGTVYGGLDNPKLTYSSNVKLRAGINKISMLSVAVGLPNVGLHFETWNAGVLGP  563

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+LSGLNEG RDLT Q+W+YK+G+KGE L+LH+LSGSSSVEW + SF+AQKQPLTWYK T
Sbjct  564   VTLSGLNEGTRDLTKQRWAYKVGMKGESLNLHTLSGSSSVEWAKDSFLAQKQPLTWYKAT  623

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GN+PLALDM +MGKGQIWING+ +GR+WPGY A G  CG CNYAG + EKKC + 
Sbjct  624   FDAPEGNDPLALDMRSMGKGQIWINGEGIGRHWPGYIAQGN-CGECNYAGLYSEKKCHTN  682

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ SQRWYHVPRSWL+P+GNLLV FEEWGG+P G+SLV+R  A VCADI E QP L NW
Sbjct  683   CGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGDPTGISLVRRSTARVCADIVEGQPSLKNW  742

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
              M  SGK+   ++PKAHL C AGQKI++I+FAS+G P+G+CG++ EG+CHA  SYD F+K
Sbjct  743   RMATSGKSNN-MQPKAHLWCSAGQKISNIEFASYGLPQGTCGNYREGSCHAHKSYDAFEK  801

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CIG  SC+V V PE FGGDPCP+  KKLSVE +CS
Sbjct  802   NCIGRQSCSVSVVPEVFGGDPCPNTSKKLSVEAICS  837



>gb|ABV32546.1| beta-galactosidase protein 1 [Prunus persica]
Length=836

 Score =  1206 bits (3121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/817 (72%), Positives = 686/817 (84%), Gaps = 6/817 (1%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASVSYD  + IINGQ++IL+SGSIHYPRSTPEMWPDL++K+K+GGLDV+QTYVFWNGHE
Sbjct  25    TASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTYVFWNGHE  84

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKYYFE RYDLVKFIKL  QAGLYV+LR+GPY CAEWNFGGFPVWLKYVPG+ FRTD
Sbjct  85    PSPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIVFRTD  144

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             N PFKAAMQKFT  IV+MMK+++L++SQGGPIILSQIENE+GP+E+E+GAPGK+Y +WAA
Sbjct  145   NEPFKAAMQKFTEKIVSMMKAEQLFQSQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAA  204

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             +MAVGL TGVPW+MCKQ+DAPDPV++ CNGFYC+ F+PNK YKPKMWTE WT W+TEFGG
Sbjct  205   QMAVGLNTGVPWIMCKQEDAPDPVIDTCNGFYCENFTPNKNYKPKMWTEVWTGWYTEFGG  264

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
              VP RPAEDLA+++A+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ATSYDYDAP+DE+GL
Sbjct  265   AVPTRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGL  324

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
              REPKWGHL+DLH+AIK  E ALVS +P+V SLGN QEA VFKSKSG CAAFLAN +  S
Sbjct  325   PREPKWGHLRDLHKAIKSSESALVSAEPSVTSLGNGQEAHVFKSKSG-CAAFLANYDTKS  383

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETS  1664
              AKV+FGN  Y LPPW ISILPDCK  VYNTAR+G+QSS+MKMTPV     WQS+ EE++
Sbjct  384   SAKVSFGNGQYELPPWPISILPDCKTAVYNTARLGSQSSQMKMTPVKSALPWQSFVEESA  443

Query  1663  SYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S D+ +T T  GL EQIN TRD +DYLWYMTD+ I P E F+K G+ P LT+YSAGHALH
Sbjct  444   SSDESDTTTLDGLWEQINVTRDTTDYLWYMTDITISPDEGFIKRGESPLLTIYSAGHALH  503

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQL GT YG+LENPK+TFS+ V  R+G+NK++LLSI+VGLPNVG HFETWNAGVLG
Sbjct  504   VFINGQLSGTVYGALENPKLTFSQNVKPRSGINKLALLSISVGLPNVGLHFETWNAGVLG  563

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKT  1127
             PV+L GLN G  D++  KW+YKIGLKGE L LH++SGSSSVEW EG  +AQKQPLTWYK 
Sbjct  564   PVTLKGLNSGTWDMSRWKWTYKIGLKGEALGLHTVSGSSSVEWAEGPSMAQKQPLTWYKA  623

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
             TF+AP GN PLALDM++MGKGQIWINGQS+GR+WP Y A G  CG C YAG +D+KKC +
Sbjct  624   TFNAPPGNGPLALDMSSMGKGQIWINGQSIGRHWPAYTARGN-CGNCYYAGTYDDKKCRT  682

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CGE SQRWYHVPRSWL P+GNLLV FEEWGG+P  +SLV+R  +SVCADI+E QP L N
Sbjct  683   HCGEPSQRWYHVPRSWLTPSGNLLVVFEEWGGDPTKISLVERRTSSVCADIFEGQPTLTN  742

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
              +  ASGK     RPKAHL C  GQ I+ IKFAS+G P+G+CGSF EG+CHA  SYD  +
Sbjct  743   SQKLASGKLN---RPKAHLWCPPGQVISDIKFASYGLPQGTCGSFQEGSCHAHKSYDAPK  799

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             + CIG  SC+V V PE FGGDPCP   KKLSVE VCS
Sbjct  800   RNCIGKQSCSVAVAPEVFGGDPCPGSTKKLSVEAVCS  836



>ref|XP_004969419.1| PREDICTED: beta-galactosidase 2-like [Setaria italica]
Length=825

 Score =  1206 bits (3119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/811 (72%), Positives = 673/811 (83%), Gaps = 11/811 (1%)
 Frame = -2

Query  2911  SYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPG  2732
             +YD+ + ++NGQR+ILLSGSIHYPRS PEMWPDL++KAK+GGLDVVQTYVFWNGHEP PG
Sbjct  25    TYDRKAVVVNGQRRILLSGSIHYPRSVPEMWPDLIQKAKDGGLDVVQTYVFWNGHEPSPG  84

Query  2731  KYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPF  2552
             +YYFEGRYDLV FIKL +QAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG+ FRTDN PF
Sbjct  85    QYYFEGRYDLVHFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIRFRTDNEPF  144

Query  2551  KAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAV  2372
             K+ MQKFTT IV+MMKS+ L+E QGGPIILSQIENE+GP+E++ G P K+YA WAA MAV
Sbjct  145   KSEMQKFTTKIVDMMKSEGLFEWQGGPIILSQIENEFGPLEWDQGEPAKAYASWAANMAV  204

Query  2371  GLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPY  2192
              L TGVPW+MCK+DDAPDP++N CNGFYCDWFSPNK +KP MWTEAWTAW+T FG PVP+
Sbjct  205   ALNTGVPWIMCKEDDAPDPIINTCNGFYCDWFSPNKPHKPTMWTEAWTAWYTGFGIPVPH  264

Query  2191  RPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREP  2012
             RP EDLAY VAKFI KGGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GLLREP
Sbjct  265   RPVEDLAYGVAKFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLLREP  324

Query  2011  KWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKV  1832
             KWGHLK+LH+AIKLCEPALV+GDP V SLGN Q+A VF+S +GAC AFL N ++ S+A+V
Sbjct  325   KWGHLKELHKAIKLCEPALVAGDPIVTSLGNAQQASVFRSSTGACVAFLENKDKVSYARV  384

Query  1831  AFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSYDD  1652
             AF  MHY LPPWSISILPDCK TVYNTARVG+Q S+MKM   + G +WQSYNE+ +S  +
Sbjct  385   AFNGMHYGLPPWSISILPDCKTTVYNTARVGSQISQMKME-WAGGLTWQSYNEDINSLGE  443

Query  1651  NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFING  1472
              +FT  GLLEQIN TRD +DYLWY T V I   E FL  GK P LTV SAGHALH+FING
Sbjct  444   ESFTTIGLLEQINVTRDKTDYLWYTTYVEIAQDEQFLSNGKNPTLTVMSAGHALHIFING  503

Query  1471  QLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLS  1292
             QL GT YG++E+P++T+  +V L  G N +S LSIAVGLPNVG HFETWNAG+LGPV+L 
Sbjct  504   QLTGTVYGNVEDPRLTYRGSVKLWPGSNTVSCLSIAVGLPNVGEHFETWNAGILGPVTLD  563

Query  1291  GLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDAP  1112
             GLNEG+RDLTWQKW+Y++GLKGE LSLHSLSGSSSVEW E     QKQPLTWYK  F+AP
Sbjct  564   GLNEGRRDLTWQKWTYQVGLKGETLSLHSLSGSSSVEWGEP---VQKQPLTWYKAFFNAP  620

Query  1111  AGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEA  932
              G+EPLALDM++MGKGQIWINGQ +GRYWPGYKAS G CG C+Y G +DEKKC + CG++
Sbjct  621   DGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKAS-GTCGNCDYRGEYDEKKCQTNCGDS  679

Query  931   SQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQA  752
             SQRWYHVPRSWL PTGNLLV FEEWGG+P G+S+VKR   S+CAD+ EWQP + +W  + 
Sbjct  680   SQRWYHVPRSWLNPTGNLLVIFEEWGGDPTGISMVKRTTGSICADVSEWQPSMKSWHTKD  739

Query  751   SGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIG  572
               KA      K HL C  G+KIT IKFASFGTP+GSCGS+SEGTCHA  SYDIF K CIG
Sbjct  740   YEKA------KVHLQCDHGRKITEIKFASFGTPQGSCGSYSEGTCHAHKSYDIFLKNCIG  793

Query  571   WNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
                C V V P+ FGGDPCP  MK+  VE +C
Sbjct  794   QERCGVSVVPDVFGGDPCPGTMKRAVVEAIC  824



>gb|ABY71826.1| beta-galactosidase [Prunus salicina]
Length=836

 Score =  1204 bits (3115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/824 (71%), Positives = 689/824 (84%), Gaps = 7/824 (1%)
 Frame = -2

Query  2941  SWV-SLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             SW+ S  TASVSYD  + IINGQ++IL+SGSIHYPRSTPEMWPDL++K+K+GGLDV+QTY
Sbjct  18    SWLASAATASVSYDHKAIIINGQKRILISGSIHYPRSTPEMWPDLIQKSKDGGLDVIQTY  77

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWNGHEP PGKYYFE RYDLVKFIKL  QAGLYV+LR+GPY CAEWNFGGFPVWLKYVP
Sbjct  78    VFWNGHEPSPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVP  137

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G+ FRTDN PFKAAMQKFT  IV+MMK+++L++SQGGPIILSQIENE+GP+E+E+GAPGK
Sbjct  138   GIVFRTDNEPFKAAMQKFTEKIVSMMKAEQLFQSQGGPIILSQIENEFGPVEWEIGAPGK  197

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y +WAA+MAVGL TGVPW+MCKQ+DAPDPV++ CNGFYC+ F+PNK YKPKMWTE WT 
Sbjct  198   AYTKWAAQMAVGLNTGVPWIMCKQEDAPDPVIDTCNGFYCENFTPNKNYKPKMWTEVWTG  257

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             W+TEFGG VP RPAEDLA+++A+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ATSYDYDA
Sbjct  258   WYTEFGGAVPTRPAEDLAFSIARFIQKGGSFVNYYMYHGGTNFGRTAGGPFMATSYDYDA  317

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DE+GL REPKWGHL+DLH+AIK  E ALVS +P+V SLGN QEA VFKSKSG CAAFL
Sbjct  318   PLDEYGLPREPKWGHLRDLHKAIKSSESALVSAEPSVTSLGNSQEAHVFKSKSG-CAAFL  376

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN +  S AKV+FGN  Y LPPWSISILPDC+  VYNTAR+G+QSS+MKMTPV     WQ
Sbjct  377   ANYDTKSSAKVSFGNGQYELPPWSISILPDCRTAVYNTARLGSQSSQMKMTPVKSALPWQ  436

Query  1684  SYNEETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             S+ EE++S D+ +T T  GL EQIN TRD +DY WYMTD+ I P E F+K G+ P LT+Y
Sbjct  437   SFIEESASSDESDTTTLDGLWEQINVTRDTTDYSWYMTDITISPDEGFIKRGESPLLTIY  496

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVFINGQL GT YG+LENPK+TFS+ V LR+G+NK++LLSI+VGLPNVG HFET
Sbjct  497   SAGHALHVFINGQLSGTVYGALENPKLTFSQNVKLRSGINKLALLSISVGLPNVGLHFET  556

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGPV+L GLN G  D++  KW+YK+GLKGE L LH++SGSSSVEW EG  +AQKQ
Sbjct  557   WNAGVLGPVTLKGLNSGTWDMSRWKWTYKVGLKGEALGLHTVSGSSSVEWAEGPSMAQKQ  616

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWY+ TF+AP GN PLALDM++MGKGQIWINGQS+GR+WP Y A G  CG C YAG +
Sbjct  617   PLTWYRATFNAPPGNGPLALDMSSMGKGQIWINGQSIGRHWPAYTARGN-CGNCYYAGTY  675

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             D+KKC + CGE SQRWYHVPRSWL  +GNLLV FEEWGG+P  +SLV+R  +SVCADI+E
Sbjct  676   DDKKCRTHCGEPSQRWYHVPRSWLTTSGNLLVVFEEWGGDPTKISLVERRTSSVCADIFE  735

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
              QP L N +  ASGK     RPKAHL C  GQ I+ IKFAS+G  +G+CGSF EG+CHA 
Sbjct  736   GQPTLTNSQKLASGKLN---RPKAHLWCPPGQVISDIKFASYGLSQGTCGSFQEGSCHAH  792

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              SYD  ++ CIG  SC+V V PE FGGDPCP   KKLSVE VCS
Sbjct  793   KSYDAPKRNCIGKQSCSVTVAPEVFGGDPCPGSTKKLSVEAVCS  836



>ref|NP_001043405.1| Os01g0580200 [Oryza sativa Japonica Group]
 sp|Q8W0A1.1|BGAL2_ORYSJ RecName: Full=Beta-galactosidase 2; Short=Lactase 2; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAB84455.1| putative beta-galactosidase [Oryza sativa Japonica Group]
 dbj|BAF05319.1| Os01g0580200 [Oryza sativa Japonica Group]
 dbj|BAG95853.1| unnamed protein product [Oryza sativa Japonica Group]
Length=827

 Score =  1203 bits (3113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/811 (72%), Positives = 674/811 (83%), Gaps = 11/811 (1%)
 Frame = -2

Query  2911  SYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPG  2732
             +YD+ + ++NGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDVVQTYVFWNGHEP PG
Sbjct  27    TYDRKAVVVNGQRRILISGSIHYPRSTPEMWPDLIEKAKDGGLDVVQTYVFWNGHEPSPG  86

Query  2731  KYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPF  2552
             +YYFEGRYDLV FIKL +QAGLYV+LR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN PF
Sbjct  87    QYYFEGRYDLVHFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPF  146

Query  2551  KAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAV  2372
             KA MQKFTT IV MMKS+ L+E QGGPIILSQIENE+GP+E++ G P K+YA WAA MAV
Sbjct  147   KAEMQKFTTKIVEMMKSEGLFEWQGGPIILSQIENEFGPLEWDQGEPAKAYASWAANMAV  206

Query  2371  GLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPY  2192
              L T VPW+MCK+DDAPDP++N CNGFYCDWFSPNK +KP MWTEAWTAW+T FG PVP+
Sbjct  207   ALNTSVPWIMCKEDDAPDPIINTCNGFYCDWFSPNKPHKPTMWTEAWTAWYTGFGIPVPH  266

Query  2191  RPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREP  2012
             RP EDLAY VAKFI KGGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GLLREP
Sbjct  267   RPVEDLAYGVAKFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLLREP  326

Query  2011  KWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKV  1832
             KWGHLK LH+AIKLCEPALV+GDP V SLGN Q++ VF+S +GACAAFL N ++ S+A+V
Sbjct  327   KWGHLKQLHKAIKLCEPALVAGDPIVTSLGNAQKSSVFRSSTGACAAFLENKDKVSYARV  386

Query  1831  AFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSYDD  1652
             AF  MHY+LPPWSISILPDCK TV+NTARVG+Q S+MKM   + GF+WQSYNEE +S+ +
Sbjct  387   AFNGMHYDLPPWSISILPDCKTTVFNTARVGSQISQMKME-WAGGFAWQSYNEEINSFGE  445

Query  1651  NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFING  1472
             +  T  GLLEQIN TRD +DYLWY T V +   E FL  G+   LTV SAGHALH+FING
Sbjct  446   DPLTTVGLLEQINVTRDNTDYLWYTTYVDVAQDEQFLSNGENLKLTVMSAGHALHIFING  505

Query  1471  QLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLS  1292
             QL GT YGS+++PK+T++  V L AG N IS LSIAVGLPNVG HFETWNAG+LGPV+L 
Sbjct  506   QLKGTVYGSVDDPKLTYTGNVKLWAGSNTISCLSIAVGLPNVGEHFETWNAGILGPVTLD  565

Query  1291  GLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDAP  1112
             GLNEG+RDLTWQKW+Y++GLKGE +SLHSLSGSS+VEW E     QKQPLTWYK  F+AP
Sbjct  566   GLNEGRRDLTWQKWTYQVGLKGESMSLHSLSGSSTVEWGEP---VQKQPLTWYKAFFNAP  622

Query  1111  AGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEA  932
              G+EPLALDM++MGKGQIWINGQ +GRYWPGYKASG  CG C+Y G +DE KC + CG++
Sbjct  623   DGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKASGN-CGTCDYRGEYDETKCQTNCGDS  681

Query  931   SQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQA  752
             SQRWYHVPRSWL PTGNLLV FEEWGG+P G+S+VKR + SVCAD+ EWQP + NW  + 
Sbjct  682   SQRWYHVPRSWLSPTGNLLVIFEEWGGDPTGISMVKRSIGSVCADVSEWQPSMKNWHTKD  741

Query  751   SGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIG  572
               KA      K HL C  GQKIT IKFASFGTP+GSCGS++EG CHA  SYDIF K C+G
Sbjct  742   YEKA------KVHLQCDNGQKITEIKFASFGTPQGSCGSYTEGGCHAHKSYDIFWKNCVG  795

Query  571   WNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
                C V V PE FGGDPCP  MK+  VE +C
Sbjct  796   QERCGVSVVPEIFGGDPCPGTMKRAVVEAIC  826



>ref|XP_003566806.1| PREDICTED: beta-galactosidase 2 [Brachypodium distachyon]
Length=831

 Score =  1201 bits (3108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/814 (72%), Positives = 674/814 (83%), Gaps = 12/814 (1%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + ++NGQR+ILLSGSIHYPRS PEMWPDL++KAK+GGLDVVQTYVFWNGHEP P
Sbjct  29    VTYDRKAVVVNGQRRILLSGSIHYPRSVPEMWPDLIQKAKDGGLDVVQTYVFWNGHEPSP  88

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             G+Y+FEGRYDLV FIKL +QAGLYVHLR+GPY CAEWNFGGFP+WLKYVPG+SFRTDN P
Sbjct  89    GQYHFEGRYDLVHFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVPGISFRTDNEP  148

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FKA MQKFTT IV MMKS+RL+E QGGPIILSQIENE+GP+E++ G P K YA WAA MA
Sbjct  149   FKAEMQKFTTKIVQMMKSERLFEWQGGPIILSQIENEFGPLEWDQGEPAKDYASWAANMA  208

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             + L TGVPW+MCK+DDAPDP++N CNGFYCDWFSPNK +KP MWTEAWTAW+T FG PVP
Sbjct  209   MALNTGVPWIMCKEDDAPDPIINTCNGFYCDWFSPNKPHKPTMWTEAWTAWYTGFGIPVP  268

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
             +RP EDLAY VAKFI KGGSF+NYYM+HGGTNF RTAGGPFIATSYDYDAP+DE+GLLRE
Sbjct  269   HRPVEDLAYGVAKFIQKGGSFVNYYMYHGGTNFERTAGGPFIATSYDYDAPLDEYGLLRE  328

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PKWGHLK+LHRAIKLCEPALV+ DP + SLGN Q+A VF+S +GACAAFL N ++ S+A+
Sbjct  329   PKWGHLKELHRAIKLCEPALVAADPILSSLGNAQKASVFRSSTGACAAFLENKHKLSYAR  388

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSYD  1655
             V+F  MHY+LPPWSISILPDCK TV+NTARVG+Q S+MKM   + G +WQSYNEE +S+ 
Sbjct  389   VSFNGMHYDLPPWSISILPDCKTTVFNTARVGSQISQMKME-WAGGLTWQSYNEEINSFS  447

Query  1654  D-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFI  1478
             +  +FT  GLLEQIN TRD +DYLWY T V +   E FL  GK P LTV SAGHALHVFI
Sbjct  448   ELESFTTVGLLEQINMTRDNTDYLWYTTYVDVAKDEQFLTSGKNPKLTVMSAGHALHVFI  507

Query  1477  NGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVS  1298
             NGQL GT YGS+ENPK+T++  V L +G N IS LSIAVGLPNVG HFETWNAG+LGPV+
Sbjct  508   NGQLSGTVYGSVENPKLTYTGKVKLWSGSNTISCLSIAVGLPNVGEHFETWNAGILGPVT  567

Query  1297  LSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFD  1118
             L GLNEGKRDLTWQKW+Y++GLKGE +SLHSLSGSSSVEW E     QKQPLTWYK  F+
Sbjct  568   LDGLNEGKRDLTWQKWTYQVGLKGEAMSLHSLSGSSSVEWGEP---VQKQPLTWYKAFFN  624

Query  1117  APAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCG  938
             AP G+EPLALDMN+MGKGQIWINGQ +GRYWPGYKAS G CG C+Y G ++E KC + CG
Sbjct  625   APDGDEPLALDMNSMGKGQIWINGQGIGRYWPGYKAS-GTCGHCDYRGEYNETKCQTNCG  683

Query  937   EASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEM  758
             + SQRWYHVPR WL PTGNLLV FEEWGG+P G+S+VKR   SVCAD+ EWQP + NW  
Sbjct  684   DPSQRWYHVPRPWLNPTGNLLVIFEEWGGDPTGISMVKRTTGSVCADVSEWQPSIKNWRT  743

Query  757   QASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYC  578
             +   KA      + HL C  G+KIT IKFASFGTP+GSCG++SEG CHA  SYDIF+K C
Sbjct  744   KDYEKA------EVHLQCDHGRKITEIKFASFGTPQGSCGNYSEGGCHAHRSYDIFKKNC  797

Query  577   IGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             I    C V V PEAFGGDPCP  MK+  VEV CS
Sbjct  798   INQEWCGVSVVPEAFGGDPCPGTMKRAVVEVTCS  831



>ref|XP_010090040.1| hypothetical protein L484_027271 [Morus notabilis]
 gb|EXB38837.1| hypothetical protein L484_027271 [Morus notabilis]
Length=838

 Score =  1200 bits (3105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/824 (71%), Positives = 688/824 (83%), Gaps = 6/824 (1%)
 Frame = -2

Query  2941  SWV-SLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             SW  S  TASV+YD  + +ING+R+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTY
Sbjct  19    SWAFSSATASVTYDHRAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTY  78

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWNGHEP  GKYYFE RYDLVKFIKL  QAGLYVHLR+GPY C EWNFGGFPVWLKYVP
Sbjct  79    VFWNGHEPSEGKYYFENRYDLVKFIKLVHQAGLYVHLRIGPYICGEWNFGGFPVWLKYVP  138

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G++FRTDNGPFK  MQ+FT  IVN+MK++ L+E+QGGPII+SQIENEYGP+E+E+GAPGK
Sbjct  139   GIAFRTDNGPFKWHMQRFTEKIVNIMKAEGLFETQGGPIIMSQIENEYGPVEWEIGAPGK  198

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y +WAA+MAVGL TGVPWVMCKQDDAPDPV++ACNGFYC+ + PN+ YKPK+WTEAWT 
Sbjct  199   AYTKWAAQMAVGLNTGVPWVMCKQDDAPDPVIDACNGFYCENYKPNQVYKPKLWTEAWTG  258

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             W+TEFGGPVP+RPAEDLA+AVA+FI  GG+F NYYM+HGGTNFGRTAGGPFIATSYDYDA
Sbjct  259   WYTEFGGPVPHRPAEDLAFAVARFIQNGGAFFNYYMYHGGTNFGRTAGGPFIATSYDYDA  318

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DEFGL R+PKWGHL+DLHRAIKL E ALVS DP V  LGN QEA VF+S +GACAAFL
Sbjct  319   PLDEFGLPRDPKWGHLRDLHRAIKLAESALVSSDPTVTKLGNNQEAHVFRSNTGACAAFL  378

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN + +   KV+FGN  YNLPPWSISILPDCK  VYNTAR+GAQS+ M MTPV +GFSW+
Sbjct  379   ANYDTNYDVKVSFGNGRYNLPPWSISILPDCKTAVYNTARLGAQSTVMWMTPVYKGFSWE  438

Query  1684  SYNEETSSYDDNTFTA-TGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             SYNEET+S +    TA  GL EQ+  TRD +DYLWY+TD+ I   E FLK G +P L ++
Sbjct  439   SYNEETASANSGDTTALDGLWEQVYVTRDNTDYLWYLTDITIGSDEGFLKTGNYPLLNIF  498

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALHVF+NGQL G++YGSL+ PK+TF++ + LRAGVNK++LLS+AVGLPNVG HFET
Sbjct  499   SAGHALHVFVNGQLTGSAYGSLDKPKLTFTQNIKLRAGVNKLALLSVAVGLPNVGLHFET  558

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGPV+L+GLN G  D++  KWSYKIGLKGE L LH++SGSSSVEW +GSF+A+ Q
Sbjct  559   WNAGVLGPVTLNGLNTGTWDMSKWKWSYKIGLKGEKLGLHTVSGSSSVEWGQGSFLAKHQ  618

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYKTTF+AP GN PLALDMN+MGKGQIWING+S+GR+WP YKASGG CG CNYAG F
Sbjct  619   PLTWYKTTFNAPGGNGPLALDMNSMGKGQIWINGRSIGRHWPAYKASGG-CGPCNYAGTF  677

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
              +KKC + CG+ SQRWYHVPRSWL PTGNLLV FEEWGG+P  ++L +R   +VCADI+E
Sbjct  678   TDKKCRTDCGQPSQRWYHVPRSWLNPTGNLLVVFEEWGGDPNWINLDQRTTGTVCADIHE  737

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
              QP + NW    SGK       KAHL C  G KI+ IKFAS+G P+G+CG++  G+CHA 
Sbjct  738   GQPTMENWGALGSGKVA---VAKAHLWCPPGHKISQIKFASYGVPQGTCGNYRAGSCHAH  794

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              SYD+ QK C+G  SCTV V P+ FGGDPCP V KKLS+E +CS
Sbjct  795   KSYDVPQKNCVGQQSCTVIVAPQFFGGDPCPGVAKKLSLEAICS  838



>gb|EYU45851.1| hypothetical protein MIMGU_mgv1a002308mg [Erythranthe guttata]
Length=689

 Score =  1199 bits (3102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/690 (84%), Positives = 642/690 (93%), Gaps = 2/690 (0%)
 Frame = -2

Query  2542  MQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLG  2363
             MQKFTT IVNMMK++RLY++QGGPIILSQIENEYGPMEYELGAPG++Y +WAAKMA+ LG
Sbjct  1     MQKFTTKIVNMMKAERLYQTQGGPIILSQIENEYGPMEYELGAPGRAYTEWAAKMALDLG  60

Query  2362  TGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPA  2183
             TGVPW+MCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT WFTEFGGPVPYRPA
Sbjct  61    TGVPWIMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWFTEFGGPVPYRPA  120

Query  2182  EDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWG  2003
             EDLA++VAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+G+LR+PKWG
Sbjct  121   EDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGMLRQPKWG  180

Query  2002  HLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVAFG  1823
             HLKDLHRAIKLCEPAL+SGDP V  LG  QEA VFKS+SGACAAFLAN +QHSFA+V+F 
Sbjct  181   HLKDLHRAIKLCEPALISGDPVVTPLGKSQEAHVFKSRSGACAAFLANYDQHSFARVSFA  240

Query  1822  NMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET-SSYDDNT  1646
             NMHY+LPPWSISILPDCKNTVYNTAR+GAQS++MKMTPVSRGFSWQSYNEET SSYDDN+
Sbjct  241   NMHYDLPPWSISILPDCKNTVYNTARIGAQSAKMKMTPVSRGFSWQSYNEETASSYDDNS  300

Query  1645  FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQL  1466
             FT  GL EQINTTRD++DYLWY TDVRID RE FL+GGKWP LTV SAGHALHVFINGQL
Sbjct  301   FTVVGLREQINTTRDSTDYLWYTTDVRIDSREGFLRGGKWPVLTVSSAGHALHVFINGQL  360

Query  1465  VGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGL  1286
              GT+YGSL+ PK+ F++ V LRAGVNKISLLSI+VGLPNVGPHFETWNAGVLGP+SL+GL
Sbjct  361   SGTAYGSLDKPKLFFNQGVNLRAGVNKISLLSISVGLPNVGPHFETWNAGVLGPISLTGL  420

Query  1285  NEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDAPAG  1106
             NEGKRDLTWQKWSYK+GLKGE LSLHSLSGSSSVEWVEGS+IA++QPLTWYKT F+AP+G
Sbjct  421   NEGKRDLTWQKWSYKVGLKGESLSLHSLSGSSSVEWVEGSYIAERQPLTWYKTIFNAPSG  480

Query  1105  NEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQ  926
             NEPLALDMNTM KGQ+WINGQ++GRYW  YKASG  CGACNYAGWF+EKKCL+ CGEASQ
Sbjct  481   NEPLALDMNTMSKGQVWINGQNIGRYWNQYKASGN-CGACNYAGWFNEKKCLTNCGEASQ  539

Query  925   RWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQASG  746
             RWYH+PRSWL PTGNLLV FEEWGGNPYG+SLVKREVASVCADIYEWQP L+NW++Q+SG
Sbjct  540   RWYHIPRSWLYPTGNLLVVFEEWGGNPYGISLVKREVASVCADIYEWQPTLVNWQLQSSG  599

Query  745   KATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWN  566
             K  +PLRPKAHLSC AGQKI+SIKFASFGTP+GSCG+F EG CHAFHSYD+F+KYC+G  
Sbjct  600   KVNKPLRPKAHLSCDAGQKISSIKFASFGTPQGSCGNFREGNCHAFHSYDVFEKYCVGQE  659

Query  565   SCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SCTVPVTPE FGGDPCPSVMKKLSVE +CS
Sbjct  660   SCTVPVTPEIFGGDPCPSVMKKLSVEAICS  689



>ref|XP_008672351.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA58688.1| TPA: hypothetical protein ZEAMMB73_223728 [Zea mays]
Length=830

 Score =  1197 bits (3097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/811 (72%), Positives = 670/811 (83%), Gaps = 11/811 (1%)
 Frame = -2

Query  2911  SYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPG  2732
             +YD+ + ++NGQR+IL+SGSIHYPRS PEMWPDL++KAK+GGLDVVQTYVFWNGHEP   
Sbjct  30    TYDRKAVVVNGQRRILMSGSIHYPRSVPEMWPDLIQKAKDGGLDVVQTYVFWNGHEPSRR  89

Query  2731  KYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPF  2552
             +YYFEGRYDLV FIKL +QAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN PF
Sbjct  90    QYYFEGRYDLVHFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPF  149

Query  2551  KAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAV  2372
             KA MQ FTT IV+MMKS+ L+E QGGPIILSQIENE+GP+E++ G P K+YA WAA MAV
Sbjct  150   KAEMQNFTTKIVDMMKSEGLFEWQGGPIILSQIENEFGPLEWDQGEPAKAYASWAANMAV  209

Query  2371  GLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPY  2192
              L T VPWVMCK+DDAPDP++N CNGFYCDWFSPNK +KP MWTEAWT+W+T FG PVP+
Sbjct  210   ALNTSVPWVMCKEDDAPDPIINTCNGFYCDWFSPNKPHKPTMWTEAWTSWYTGFGIPVPH  269

Query  2191  RPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREP  2012
             RP EDLAY VAKFI KGGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GLLREP
Sbjct  270   RPVEDLAYGVAKFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLLREP  329

Query  2011  KWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKV  1832
             KWGHLK+LH+AIKLCEPALV+GDP V SLGN Q+A VF+S + AC AFL N ++ S+A+V
Sbjct  330   KWGHLKELHKAIKLCEPALVAGDPIVTSLGNAQQASVFRSSTDACVAFLENKDKVSYARV  389

Query  1831  AFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSYDD  1652
             +F  MHY+LPPWSISILPDCK TVYNTA VG+Q S+MKM   + GF+WQSYNE+ +S  D
Sbjct  390   SFNGMHYDLPPWSISILPDCKTTVYNTASVGSQISQMKME-WAGGFTWQSYNEDINSLGD  448

Query  1651  NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFING  1472
              +F   GLLEQIN TRD +DYLWY T V I   E FL  GK P LTV SAGHALH+F+NG
Sbjct  449   ESFATVGLLEQINVTRDNTDYLWYTTYVDIAQDEQFLSNGKNPMLTVMSAGHALHIFVNG  508

Query  1471  QLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLS  1292
             QL GT YGS+E+PK+T+S  V L +G N IS LSIAVGLPNVG HFETWNAG+LGPV+L 
Sbjct  509   QLTGTVYGSVEDPKLTYSGNVKLWSGSNTISCLSIAVGLPNVGEHFETWNAGILGPVTLD  568

Query  1291  GLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDAP  1112
             GLNEG+RDLTWQKW+YK+GLKGE LSLHSLSGSSSVEW E     QKQPL+WYK  F+AP
Sbjct  569   GLNEGRRDLTWQKWTYKVGLKGEALSLHSLSGSSSVEWGEP---VQKQPLSWYKAFFNAP  625

Query  1111  AGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEA  932
              G+EPLALDM++MGKGQIWINGQ +GRYWPGYKAS G CG C+Y G +DEKKC + CG++
Sbjct  626   DGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKAS-GTCGICDYRGEYDEKKCQTNCGDS  684

Query  931   SQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQA  752
             SQRWYHVPRSWL PTGNLLV FEEWGG+P G+S+VKR   S+CAD+ EWQP + NW  + 
Sbjct  685   SQRWYHVPRSWLNPTGNLLVIFEEWGGDPTGISMVKRIAGSICADVSEWQPSMANWRTKG  744

Query  751   SGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIG  572
               KA      K HL C  G+K+T IKFASFGTP+GSCGS+SEG CHA  SYDIF K CIG
Sbjct  745   YEKA------KVHLQCDHGRKMTHIKFASFGTPQGSCGSYSEGGCHAHKSYDIFWKSCIG  798

Query  571   WNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
                C V V P+AFGGDPCP  MK+  VE +C
Sbjct  799   QERCGVSVVPDAFGGDPCPGTMKRAVVEAIC  829



>ref|XP_007154660.1| hypothetical protein PHAVU_003G137000g [Phaseolus vulgaris]
 gb|ESW26654.1| hypothetical protein PHAVU_003G137000g [Phaseolus vulgaris]
Length=833

 Score =  1194 bits (3089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/822 (71%), Positives = 680/822 (83%), Gaps = 6/822 (1%)
 Frame = -2

Query  2938  WVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVF  2759
             WV   TASV+YD  + ++NGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV++TYVF
Sbjct  17    WVCAVTASVTYDHKAILVNGQRRILVSGSIHYPRSTPEMWPDLIQKAKDGGLDVIETYVF  76

Query  2758  WNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGV  2579
             WNGHEP PGKYYFE RYDLVKFIK+ QQAGLY+HLR+GP+ CAEWNFGGFPVWLKYVPG+
Sbjct  77    WNGHEPSPGKYYFEDRYDLVKFIKVVQQAGLYLHLRIGPFVCAEWNFGGFPVWLKYVPGI  136

Query  2578  SFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSY  2399
             +FRTDN PFKAAMQ FT  IV+MMK ++L++++GGPII+SQIENE+GP+E+E+GAPGK+Y
Sbjct  137   AFRTDNEPFKAAMQNFTEKIVSMMKEEKLFQTEGGPIIMSQIENEFGPVEWEIGAPGKAY  196

Query  2398  AQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWF  2219
             AQWAAKMAVGL TGVPW+MCKQ+DAPDPV+N CNG+YC+ F+PNK YKPKMWTE W+ W+
Sbjct  197   AQWAAKMAVGLDTGVPWIMCKQEDAPDPVINTCNGYYCENFTPNKEYKPKMWTENWSGWY  256

Query  2218  TEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPI  2039
             TEFGG VP RPAED+A++VA+F+  GGSF+NYYMFHGGTNF RT+GGPFIATSYDYD  +
Sbjct  257   TEFGGAVPRRPAEDMAFSVARFVQNGGSFVNYYMFHGGTNFDRTSGGPFIATSYDYDGLL  316

Query  2038  DEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLAN  1859
             DE+GLL EPKWGHL+DLH+AIKLCE ALVS DP V   G   E  VFK+ SGACAAFLAN
Sbjct  317   DEYGLLNEPKWGHLRDLHKAIKLCEAALVSVDPTVTWPGKNLEVHVFKT-SGACAAFLAN  375

Query  1858  NNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSY  1679
              +  S A V F N  Y+LPPWSISILPDCK  V+NTARVGAQSS MKMT V+  F WQSY
Sbjct  376   YDTKSSATVTFENGQYDLPPWSISILPDCKTEVFNTARVGAQSSLMKMTAVNTAFDWQSY  435

Query  1678  NEE-TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             NEE  SS +D+  TA  L EQIN TRD++DYLWYMTDV ID  E F+K G+ P LTV SA
Sbjct  436   NEEPASSSEDDPLTAYALWEQINITRDSTDYLWYMTDVNIDANEGFIKSGQSPVLTVMSA  495

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHALHVFINGQL GT YG LE PK+TFS  V LR G NKISLLSIAVGLPNVG HFETWN
Sbjct  496   GHALHVFINGQLSGTVYGGLEFPKLTFSDGVKLRVGNNKISLLSIAVGLPNVGTHFETWN  555

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPV+L+GLNEG RDL+ QKWSYKIGLKGE L+L+++SGSSSVEWV+GS +A+KQPL
Sbjct  556   AGVLGPVTLNGLNEGTRDLSKQKWSYKIGLKGEALNLNTVSGSSSVEWVQGSLLAKKQPL  615

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYKTTF  P GN+PLALDM +MGKGQ+WING+S+GR+WPGY A  G CG C YAG +++
Sbjct  616   TWYKTTFSTPVGNDPLALDMISMGKGQVWINGRSIGRHWPGYIAR-GHCGECYYAGTYND  674

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
             KKC + CGE SQRWYH+PRSWL P+GN LV  EEWGG+P G+SLVKR  ASVCADIYE Q
Sbjct  675   KKCRTNCGEPSQRWYHIPRSWLNPSGNYLVVLEEWGGDPNGISLVKRTTASVCADIYEGQ  734

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             P L +  M  +GK     RPKAHL C  G KI+ IKFAS+G P+G+CG++ EG+CHA  S
Sbjct  735   PTLKSRHMLDTGKIN---RPKAHLWCPPGLKISQIKFASYGLPQGTCGNYREGSCHAHRS  791

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD  +K CIG  SC+V V PE FGGDPCP   KKLS+E +CS
Sbjct  792   YDAPEKNCIGKQSCSVTVAPEVFGGDPCPGTAKKLSLEALCS  833



>gb|EEE54862.1| hypothetical protein OsJ_02342 [Oryza sativa Japonica Group]
Length=839

 Score =  1194 bits (3088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/823 (71%), Positives = 674/823 (82%), Gaps = 23/823 (3%)
 Frame = -2

Query  2911  SYDKHSFIINGQRKILLSGSIHYPRSTPE------------MWPDLLKKAKEGGLDVVQT  2768
             +YD+ + ++NGQR+IL+SGSIHYPRSTPE            MWPDL++KAK+GGLDVVQT
Sbjct  27    TYDRKAVVVNGQRRILISGSIHYPRSTPEARRTRFPFLLLTMWPDLIEKAKDGGLDVVQT  86

Query  2767  YVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYV  2588
             YVFWNGHEP PG+YYFEGRYDLV FIKL +QAGLYV+LR+GPY CAEWNFGGFPVWLKYV
Sbjct  87    YVFWNGHEPSPGQYYFEGRYDLVHFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYV  146

Query  2587  PGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPG  2408
             PG+SFRTDN PFKA MQKFTT IV MMKS+ L+E QGGPIILSQIENE+GP+E++ G P 
Sbjct  147   PGISFRTDNEPFKAEMQKFTTKIVEMMKSEGLFEWQGGPIILSQIENEFGPLEWDQGEPA  206

Query  2407  KSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWT  2228
             K+YA WAA MAV L T VPW+MCK+DDAPDP++N CNGFYCDWFSPNK +KP MWTEAWT
Sbjct  207   KAYASWAANMAVALNTSVPWIMCKEDDAPDPIINTCNGFYCDWFSPNKPHKPTMWTEAWT  266

Query  2227  AWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYD  2048
             AW+T FG PVP+RP EDLAY VAKFI KGGSF+NYYM+HGGTNFGRTAGGPFIATSYDYD
Sbjct  267   AWYTGFGIPVPHRPVEDLAYGVAKFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYD  326

Query  2047  APIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAF  1868
             APIDE+GLLREPKWGHLK LH+AIKLCEPALV+GDP V SLGN Q++ VF+S +GACAAF
Sbjct  327   APIDEYGLLREPKWGHLKQLHKAIKLCEPALVAGDPIVTSLGNAQKSSVFRSSTGACAAF  386

Query  1867  LANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSW  1688
             L N ++ S+A+VAF  MHY+LPPWSISILPDCK TV+NTARVG+Q S+MKM   + GF+W
Sbjct  387   LENKDKVSYARVAFNGMHYDLPPWSISILPDCKTTVFNTARVGSQISQMKME-WAGGFAW  445

Query  1687  QSYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             QSYNEE +S+ ++  T  GLLEQIN TRD +DYLWY T V +   E FL  G+   LTV 
Sbjct  446   QSYNEEINSFGEDPLTTVGLLEQINVTRDNTDYLWYTTYVDVAQDEQFLSNGENLKLTVM  505

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGHALH+FINGQL GT YGS+++PK+T++  V L AG N IS LSIAVGLPNVG HFET
Sbjct  506   SAGHALHIFINGQLKGTVYGSVDDPKLTYTGNVKLWAGSNTISCLSIAVGLPNVGEHFET  565

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAG+LGPV+L GLNEG+RDLTWQKW+Y++GLKGE +SLHSLSGSS+VEW E     QKQ
Sbjct  566   WNAGILGPVTLDGLNEGRRDLTWQKWTYQVGLKGESMSLHSLSGSSTVEWGEP---VQKQ  622

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYK  F+AP G+EPLALDM++MGKGQIWINGQ +GRYWPGYKASG  CG C+Y G +
Sbjct  623   PLTWYKAFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKASGN-CGTCDYRGEY  681

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             DE KC + CG++SQRWYHVPRSWL PTGNLLV FEEWGG+P G+S+VKR + SVCAD+ E
Sbjct  682   DETKCQTNCGDSSQRWYHVPRSWLSPTGNLLVIFEEWGGDPTGISMVKRSIGSVCADVSE  741

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
             WQP + NW  +   KA      K HL C  GQKIT IKFASFGTP+GSCGS++EG CHA 
Sbjct  742   WQPSMKNWHTKDYEKA------KVHLQCDNGQKITEIKFASFGTPQGSCGSYTEGGCHAH  795

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
              SYDIF K C+G   C V V PE FGGDPCP  MK+  VE +C
Sbjct  796   KSYDIFWKNCVGQERCGVSVVPEIFGGDPCPGTMKRAVVEAIC  838



>ref|XP_003550633.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=839

 Score =  1193 bits (3086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/821 (70%), Positives = 678/821 (83%), Gaps = 6/821 (1%)
 Frame = -2

Query  2938  WVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVF  2759
             WV   TASV+YD  + ++NGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYVF
Sbjct  23    WVCAVTASVTYDHKAIVVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVF  82

Query  2758  WNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGV  2579
             WNGHEP PGKYYFE RYDLVKFIKL QQAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG+
Sbjct  83    WNGHEPSPGKYYFEDRYDLVKFIKLVQQAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGI  142

Query  2578  SFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSY  2399
             +FRTDN PFKAAMQKFT  IV++MK ++L+++QGGPII+SQIENEYGP+E+E+GAPGK+Y
Sbjct  143   AFRTDNEPFKAAMQKFTEKIVSIMKEEKLFQTQGGPIIMSQIENEYGPVEWEIGAPGKAY  202

Query  2398  AQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWF  2219
              +W ++MAVGL TGVPW+MCKQ D PDP+++ CNG+YC+ F+PNK YKPKMWTE WT W+
Sbjct  203   TKWFSQMAVGLDTGVPWIMCKQQDTPDPLIDTCNGYYCENFTPNKKYKPKMWTENWTGWY  262

Query  2218  TEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPI  2039
             TEFGG VP RPAED+A++VA+F+  GGSF+NYYM+HGGTNF RT+ G FIATSYDYD PI
Sbjct  263   TEFGGAVPRRPAEDMAFSVARFVQNGGSFVNYYMYHGGTNFDRTSSGLFIATSYDYDGPI  322

Query  2038  DEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLAN  1859
             DE+GLL EPKWGHL+DLH+AIKLCEPALVS DP V   GN  E  VFK+ SGACAAFLAN
Sbjct  323   DEYGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVTWPGNNLEVHVFKT-SGACAAFLAN  381

Query  1858  NNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSY  1679
              +  S A V FGN  Y+LPPWSISILPDCK  V+NTAR+GAQSS MKMT V+  F WQSY
Sbjct  382   YDTKSSASVKFGNGQYDLPPWSISILPDCKTAVFNTARLGAQSSLMKMTAVNSAFDWQSY  441

Query  1678  NEE-TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             NEE  SS +D++ TA  L EQIN TRD++DYLWYMTDV ID  E F+K G+ P LTV SA
Sbjct  442   NEEPASSNEDDSLTAYALWEQINVTRDSTDYLWYMTDVNIDANEGFIKNGQSPVLTVMSA  501

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GH LHV IN QL GT YG L++ K+TFS +V LR G NKISLLSIAVGLPNVGPHFETWN
Sbjct  502   GHVLHVLINDQLSGTVYGGLDSHKLTFSDSVKLRVGNNKISLLSIAVGLPNVGPHFETWN  561

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPV+L GLNEG RDL+ QKWSYKIGLKGE L+L+++SGSSSVEWV+GS +A++QPL
Sbjct  562   AGVLGPVTLKGLNEGTRDLSKQKWSYKIGLKGEALNLNTVSGSSSVEWVQGSLLAKQQPL  621

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
              WYKTTF  PAGN+PLALDM +MGKGQ WING+S+GR+WPGY A G  CG C YAG + +
Sbjct  622   AWYKTTFSTPAGNDPLALDMISMGKGQAWINGRSIGRHWPGYIARGN-CGDCYYAGTYTD  680

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
             KKC + CGE SQRWYH+PRSWL P+GN LV FEEWGG+P G++LVKR  ASVCADIY+ Q
Sbjct  681   KKCRTNCGEPSQRWYHIPRSWLNPSGNYLVVFEEWGGDPTGITLVKRTTASVCADIYQGQ  740

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             P L N +M  SGK    +RPKAHL C  G+ I+ IKFAS+G P+G+CG+F EG+CHA  S
Sbjct  741   PTLKNRQMLDSGKV---VRPKAHLWCPPGKNISQIKFASYGLPQGTCGNFREGSCHAHKS  797

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             YD  QK CIG  SC V V PE FGGDPCP + KKLS+E +C
Sbjct  798   YDAPQKNCIGKQSCLVTVAPEVFGGDPCPGIAKKLSLEALC  838



>ref|XP_008775429.1| PREDICTED: beta-galactosidase 2-like [Phoenix dactylifera]
Length=832

 Score =  1191 bits (3082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/818 (72%), Positives = 682/818 (83%), Gaps = 12/818 (1%)
 Frame = -2

Query  2932  SLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWN  2753
             S  +A+VSYD  + I+NGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYVFWN
Sbjct  26    SPASAAVSYDHKAVIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWN  85

Query  2752  GHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSF  2573
             GHEP PG+YYFEGRYDLV FIKL  QAGL+VHLR+GPY CAEWNFGGFPVWLKYVPG+ F
Sbjct  86    GHEPSPGEYYFEGRYDLVHFIKLVHQAGLFVHLRIGPYVCAEWNFGGFPVWLKYVPGIRF  145

Query  2572  RTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQ  2393
             RTDN PFKAAM  FT  IV+MMKS+ L+E QGGPIILSQIENE+GP+EY+ G P K+YA 
Sbjct  146   RTDNEPFKAAMANFTEKIVSMMKSEALFEWQGGPIILSQIENEFGPLEYDQGEPAKAYAA  205

Query  2392  WAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTE  2213
             WAAKMAVGL TGVPWVMCKQDDAPDPV+N CNGFYCD+FSPN+ YKP MWTEAWTAW+T 
Sbjct  206   WAAKMAVGLDTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNQQYKPTMWTEAWTAWYTA  265

Query  2212  FGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDE  2033
             FGGPVP+RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFIATSYDY APIDE
Sbjct  266   FGGPVPHRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYGAPIDE  325

Query  2032  FGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNN  1853
             +GLLR+P WGHL+DLHRAIKLCEPALVSGDP V SLG+ Q+A V++S+SG CAAFLAN +
Sbjct  326   YGLLRQPNWGHLRDLHRAIKLCEPALVSGDPVVTSLGSAQQAYVYRSQSGDCAAFLANFD  385

Query  1852  QHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNE  1673
               S+AKV+F  MH +LPPWSISILPDCK TV+NTA VG Q+S M M  V  GFS+QSYNE
Sbjct  386   SGSYAKVSFNGMHDDLPPWSISILPDCKTTVFNTAMVGFQTSLMNMEWVG-GFSFQSYNE  444

Query  1672  ETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHA  1493
             ETSSYDD +FT  GLLEQ+N TRD SDYLWY T V I   E FLK GK+P LTV SAGH+
Sbjct  445   ETSSYDDKSFTTVGLLEQVNVTRDNSDYLWYTTYVDIGQDEQFLKNGKYPVLTVMSAGHS  504

Query  1492  LHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGV  1313
             L VFINGQL GT+YGS+E+P++T++  V L  G N IS+LS++VGLPNVG HFETWNAGV
Sbjct  505   LLVFINGQLTGTAYGSVEDPRLTYTGNVKLWQGSNTISILSVSVGLPNVGEHFETWNAGV  564

Query  1312  LGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWY  1133
             LGPV+L+GLNEG RDLTWQKW+Y+IGLKGE LSL+SL+GSS VEW E    +Q  PLTWY
Sbjct  565   LGPVTLNGLNEGTRDLTWQKWTYQIGLKGETLSLYSLAGSSFVEWDEA---SQNHPLTWY  621

Query  1132  KTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKC  953
             K  F+AP GNEPLALDM++MGKGQ+WINGQS+GRYWPGYKA  G C  C+Y G +DEKKC
Sbjct  622   KAFFNAPEGNEPLALDMSSMGKGQVWINGQSIGRYWPGYKAY-GTCSNCDYRGEYDEKKC  680

Query  952   LSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQL  773
              + CGE+SQ+WYHVPRSWL PTGNLLV FEEWGG+P G+S+VKR + SVCADI EWQP +
Sbjct  681   QTNCGESSQKWYHVPRSWLNPTGNLLVLFEEWGGDPKGISMVKRTIGSVCADISEWQPAM  740

Query  772   MNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDI  593
              NW  +         R K HLSC  G+K+T IKFASFGTP+G CGSFSEG+CHA  SYD 
Sbjct  741   KNWRTKDYE------RSKVHLSCDPGRKVTKIKFASFGTPQGVCGSFSEGSCHAHESYDA  794

Query  592   FQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             F+K C+G   C+V + PE FGGDPCP  MK+++VE +C
Sbjct  795   FEK-CVGQEKCSVTIVPEVFGGDPCPGTMKRIAVEALC  831



>gb|KHN06610.1| Beta-galactosidase [Glycine soja]
Length=831

 Score =  1185 bits (3066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/822 (70%), Positives = 677/822 (82%), Gaps = 8/822 (1%)
 Frame = -2

Query  2938  WVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVF  2759
             WV   TASV+YD  + ++NGQR+IL+SGSIHYPRSTPE   +L++KAK+GGLDV+QTYVF
Sbjct  17    WVCAVTASVTYDHKAIVVNGQRRILISGSIHYPRSTPEA--NLIQKAKDGGLDVIQTYVF  74

Query  2758  WNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGV  2579
             WNGHEP PGKYYFE RYDLVKFIKL QQAGL VHLR+GPY CAEWNFGGFPVWLKYVP +
Sbjct  75    WNGHEPSPGKYYFEDRYDLVKFIKLVQQAGLSVHLRIGPYICAEWNFGGFPVWLKYVPDI  134

Query  2578  SFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSY  2399
             +FRTDN PFKAAMQKFT  IV+MMK+++L+++QGGPII+SQIENEYG +E+E+GAPGK+Y
Sbjct  135   AFRTDNEPFKAAMQKFTEKIVSMMKAEKLFQTQGGPIIMSQIENEYGTVEWEIGAPGKAY  194

Query  2398  AQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWF  2219
              +W ++MAVGL TGVPW+MCKQ D PDP+++ CNG+YC+ F+PNK YKPKMWTE WT W+
Sbjct  195   TKWFSQMAVGLDTGVPWIMCKQQDTPDPIIDTCNGYYCENFTPNKKYKPKMWTENWTGWY  254

Query  2218  TEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPI  2039
             TEFGG VP RPAED+A++VA+F+  GGSF+NYYM+HGGTNF RT+ G FIATSYDYD PI
Sbjct  255   TEFGGAVPRRPAEDMAFSVARFVQNGGSFVNYYMYHGGTNFDRTSSGLFIATSYDYDGPI  314

Query  2038  DEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLAN  1859
             DE+GLL EPKWGHL+DLH+AIKLCEPALVS DP V   GN  E  VFK+ SGACAAFLAN
Sbjct  315   DEYGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVTWPGNNLEVHVFKT-SGACAAFLAN  373

Query  1858  NNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSY  1679
              +  S A V FGN  Y+LPPWSISILPDCK  V+NTAR+GAQSS MKMT V+  F WQSY
Sbjct  374   YDTKSSAAVKFGNGQYDLPPWSISILPDCKTAVFNTARLGAQSSLMKMTAVNSAFDWQSY  433

Query  1678  NEE-TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             NEE  SS +D++ TA  L EQIN TRD++DYLWYMTDV ID  E F+K G+ P LTV SA
Sbjct  434   NEEAASSNEDDSLTAYALWEQINVTRDSTDYLWYMTDVNIDANEGFIKNGQSPVLTVMSA  493

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHALHVFINGQL GT YG L++ K+TFS +V LR G NKISLLSI VGLPNVGPHFETWN
Sbjct  494   GHALHVFINGQLSGTVYGGLDSHKLTFSDSVKLRVGNNKISLLSITVGLPNVGPHFETWN  553

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPL  1142
             AGVLGPV+L GLNEG RDL+ QKWSYKIGLKGE L+L+++SGSSSVEWV+GS + +KQPL
Sbjct  554   AGVLGPVTLKGLNEGTRDLSKQKWSYKIGLKGEALNLNTVSGSSSVEWVQGSLLTKKQPL  613

Query  1141  TWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDE  962
             TWYKTTF  PAGN+PLALDM +MGKGQ+WING+S+GR+WPGY A  G+CG C YAG + +
Sbjct  614   TWYKTTFSTPAGNDPLALDMISMGKGQVWINGRSIGRHWPGYIAR-GSCGDCYYAGTYTD  672

Query  961   KKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQ  782
             KKC + CGE SQRWYH+PRSWL P+GN LV FEEWGG+P G+SLVKR  ASVCADI+E Q
Sbjct  673   KKCRTNCGEPSQRWYHIPRSWLNPSGNYLVVFEEWGGDPTGISLVKRTTASVCADIFEGQ  732

Query  781   PQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHS  602
             P L N +M  SGK    +RPKAHL C  GQKI+ IKFAS+G P G+CG+F EG+CHA  S
Sbjct  733   PTLKNRQMLDSGKV---IRPKAHLWCPPGQKISKIKFASYGLPHGTCGNFREGSCHAHKS  789

Query  601   YDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             YD  QK CIG  SC V V PE FGGDPCP + KK S+E +CS
Sbjct  790   YDAPQKNCIGKQSCLVTVAPEVFGGDPCPGIAKKFSLEALCS  831



>ref|XP_009611028.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana tomentosiformis]
Length=837

 Score =  1184 bits (3063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/815 (70%), Positives = 671/815 (82%), Gaps = 3/815 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             A+VSYD  + IING+R+IL+SGSIHYPRSTPEMWPDL++KAK+GGLD+++TYVFWNGHE 
Sbjct  24    ATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDIIETYVFWNGHEL  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGK+ FEGRYDLVKFIKL QQAGLY++LR+GPY C EWNFGGFPVWLKYVPG+ FR DN
Sbjct  84    SPGKFKFEGRYDLVKFIKLVQQAGLYINLRIGPYICGEWNFGGFPVWLKYVPGMEFRADN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ F   IVNMMKS+ L+E QGGPIIL+QIENEYGP+E+E+G+PGK+Y +WAA+
Sbjct  144   HPFKLAMQGFVQRIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAAE  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAV L  GVPW+MCKQ+DAPDPV++ CNGFYC+ FSPNK YKPKMWTE WTAW+T+FGGP
Sbjct  204   MAVSLDIGVPWIMCKQEDAPDPVIDTCNGFYCEDFSPNKPYKPKMWTEVWTAWYTKFGGP  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP RPAEDLA++VA+FI   GSF NYYM+HGGTNFGRT    FIATSYDYDAP+DE+GLL
Sbjct  264   VPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGLL  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
              EPK+GHL+DLH+AIKL EPALVS  P V  LG  QEA VF+SKSG C+AFL+N +    
Sbjct  324   NEPKYGHLRDLHKAIKLSEPALVSSYPTVNWLGKNQEAHVFRSKSGDCSAFLSNYDTKYS  383

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET-S  1664
              KV F N+ Y+LPPWSISILPDCK  VYNTAR+ +QSS+M M PV    SWQSYNEET S
Sbjct  384   VKVTFQNIQYDLPPWSISILPDCKTAVYNTARISSQSSQMMMAPVVGSLSWQSYNEETPS  443

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             + + +T +A GLLEQIN TRD+SDYLWYMTDV +   E FLK GK P+LTV SAGHA+HV
Sbjct  444   AEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGSDEGFLKNGKDPFLTVMSAGHAMHV  503

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQ  GT YG L+NPK+T+S  V LRAG NKISLLS+AVGLPNVG HFETWN GVLGP
Sbjct  504   FINGQQSGTVYGGLDNPKLTYSGNVKLRAGTNKISLLSVAVGLPNVGLHFETWNTGVLGP  563

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+LSGLNEG RDLT Q+WSYK+GLKGE LS H+ SG SSVEWVEGS +AQ+QPLTWYK T
Sbjct  564   VTLSGLNEGTRDLTIQRWSYKVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKAT  623

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GN+P+ALDM +MGKGQIW+NG+ VGR+WPGY A  G CG CNYAG + EKKC + 
Sbjct  624   FDAPEGNDPVALDMVSMGKGQIWVNGEGVGRHWPGYIAK-GHCGECNYAGDYTEKKCQTN  682

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ SQRWYHVPRSWL+P+GNLLV FEEWGG P  +SLV+R  ASVCADI + QP L NW
Sbjct  683   CGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGVPTRISLVRRATASVCADIVDGQPTLKNW  742

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
              M +SGK+   +R KAHL C  G+KI+ I+FAS+G P+G+CG+F EGTCHA  SYD F+K
Sbjct  743   RMVSSGKSGN-VRRKAHLWCPDGKKISKIQFASYGVPQGTCGNFREGTCHAHKSYDAFEK  801

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
              CIG  SC+V V P+ FGGDPCP+  KKLSVE +C
Sbjct  802   NCIGRQSCSVNVVPKVFGGDPCPNTSKKLSVEAIC  836



>ref|XP_009757671.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana sylvestris]
Length=839

 Score =  1181 bits (3054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/815 (70%), Positives = 667/815 (82%), Gaps = 3/815 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             A+VSYD  + IING+R+IL+SGSIHYPRSTPEMWP L++KAK+GGLD+++TYVFWN HEP
Sbjct  26    ATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNAHEP  85

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGK+ FEGRYDLVKFIKL QQAGLYV+LR+GPY C EWNFGGFPVWLKYVPG+ FR DN
Sbjct  86    SPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRADN  145

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ F   IVNMMKS+ L+E QGGPIIL+QIENEYGP+E+E+G+PGK+Y +WAA 
Sbjct  146   HPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAAA  205

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL  GVPW+MCKQ+DAPDPV++ CNGFYC+ F PNK YKPKMWTE WTAW+T+FGGP
Sbjct  206   MAVGLEIGVPWIMCKQEDAPDPVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGGP  265

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP RPAEDLA++VA+FI   GSF NYYM+HGGTNFGRT    FIATSYDYDAP++E+GLL
Sbjct  266   VPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLNEYGLL  325

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
              EPK+GHL+DLH+AIKL EPAL+S  P V  LG  QEA VF+SKSG CAAFL+N +    
Sbjct  326   NEPKYGHLRDLHQAIKLSEPALLSSYPTVNWLGKNQEAHVFRSKSGDCAAFLSNYDTKYS  385

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET-S  1664
              KV F    Y+LPPWSISILPDCK  VYNTAR+ +QSS+M M PV    SWQSY+EET S
Sbjct  386   VKVTFQTTQYDLPPWSISILPDCKTAVYNTARISSQSSQMMMAPVVGSLSWQSYSEETPS  445

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             + + +T +A GLLEQIN TRD+SDYLWYMTDV + P E FLK GK P+LTV SAGHA+HV
Sbjct  446   AEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGPDEGFLKNGKDPFLTVMSAGHAMHV  505

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT YG L+NPK+T+S  V LRAG+NKISLLS+AVGLPNVG HFE+WN GVLGP
Sbjct  506   FINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGVLGP  565

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+LSGLN+G RDLT Q+WSYK+GLKGE LS H+ SG SSVEWVEGS +AQ+QPLTWYK T
Sbjct  566   VTLSGLNDGTRDLTIQRWSYKVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKAT  625

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GN+P+ALDM +MGKGQIW+NG+ VGR+WPGY A  G CG CNYAG + EKKC + 
Sbjct  626   FDAPEGNDPVALDMVSMGKGQIWVNGEGVGRHWPGYIAK-GHCGECNYAGEYTEKKCQTN  684

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ SQRWYHVPRSWL+P+GNLLV FEEWGG P  +SLV+R  A VCADI + QP L NW
Sbjct  685   CGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGVPTRISLVRRATARVCADIVDGQPTLKNW  744

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
                 SGK+   + PKAHL C  G+KI+ I+FAS+G P+G+CG+F EGTCHA  SYD F+K
Sbjct  745   RTVGSGKSNN-MHPKAHLCCPDGKKISKIQFASYGVPQGTCGNFREGTCHARKSYDAFEK  803

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
              CIG  SC+V V PE FGGDPCP+  KKLSVE +C
Sbjct  804   NCIGRQSCSVNVVPEVFGGDPCPNTSKKLSVEAIC  838



>ref|XP_009611026.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana tomentosiformis]
Length=839

 Score =  1179 bits (3051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/817 (70%), Positives = 671/817 (82%), Gaps = 5/817 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             A+VSYD  + IING+R+IL+SGSIHYPRSTPEMWPDL++KAK+GGLD+++TYVFWNGHE 
Sbjct  24    ATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDIIETYVFWNGHEL  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGK+ FEGRYDLVKFIKL QQAGLY++LR+GPY C EWNFGGFPVWLKYVPG+ FR DN
Sbjct  84    SPGKFKFEGRYDLVKFIKLVQQAGLYINLRIGPYICGEWNFGGFPVWLKYVPGMEFRADN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ F   IVNMMKS+ L+E QGGPIIL+QIENEYGP+E+E+G+PGK+Y +WAA+
Sbjct  144   HPFKLAMQGFVQRIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAAE  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAV L  GVPW+MCKQ+DAPDPV++ CNGFYC+ FSPNK YKPKMWTE WTAW+T+FGGP
Sbjct  204   MAVSLDIGVPWIMCKQEDAPDPVIDTCNGFYCEDFSPNKPYKPKMWTEVWTAWYTKFGGP  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP RPAEDLA++VA+FI   GSF NYYM+HGGTNFGRT    FIATSYDYDAP+DE+GLL
Sbjct  264   VPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGLL  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQE--ARVFKSKSGACAAFLANNNQH  1847
              EPK+GHL+DLH+AIKL EPALVS  P V  LG  QE  A VF+SKSG C+AFL+N +  
Sbjct  324   NEPKYGHLRDLHKAIKLSEPALVSSYPTVNWLGKNQEQQAHVFRSKSGDCSAFLSNYDTK  383

Query  1846  SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET  1667
                KV F N+ Y+LPPWSISILPDCK  VYNTAR+ +QSS+M M PV    SWQSYNEET
Sbjct  384   YSVKVTFQNIQYDLPPWSISILPDCKTAVYNTARISSQSSQMMMAPVVGSLSWQSYNEET  443

Query  1666  -SSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+ + +T +A GLLEQIN TRD+SDYLWYMTDV +   E FLK GK P+LTV SAGHA+
Sbjct  444   PSAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGSDEGFLKNGKDPFLTVMSAGHAM  503

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQ  GT YG L+NPK+T+S  V LRAG NKISLLS+AVGLPNVG HFETWN GVL
Sbjct  504   HVFINGQQSGTVYGGLDNPKLTYSGNVKLRAGTNKISLLSVAVGLPNVGLHFETWNTGVL  563

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPV+LSGLNEG RDLT Q+WSYK+GLKGE LS H+ SG SSVEWVEGS +AQ+QPLTWYK
Sbjct  564   GPVTLSGLNEGTRDLTIQRWSYKVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYK  623

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
              TFDAP GN+P+ALDM +MGKGQIW+NG+ VGR+WPGY A  G CG CNYAG + EKKC 
Sbjct  624   ATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGRHWPGYIAK-GHCGECNYAGDYTEKKCQ  682

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             + CG+ SQRWYHVPRSWL+P+GNLLV FEEWGG P  +SLV+R  ASVCADI + QP L 
Sbjct  683   TNCGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGVPTRISLVRRATASVCADIVDGQPTLK  742

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW M +SGK+   +R KAHL C  G+KI+ I+FAS+G P+G+CG+F EGTCHA  SYD F
Sbjct  743   NWRMVSSGKSGN-VRRKAHLWCPDGKKISKIQFASYGVPQGTCGNFREGTCHAHKSYDAF  801

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             +K CIG  SC+V V P+ FGGDPCP+  KKLSVE +C
Sbjct  802   EKNCIGRQSCSVNVVPKVFGGDPCPNTSKKLSVEAIC  838



>ref|XP_006838689.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
 gb|ERN01258.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
Length=843

 Score =  1179 bits (3049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/825 (67%), Positives = 669/825 (81%), Gaps = 5/825 (1%)
 Frame = -2

Query  2941  SWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYV  2762
             ++  L   +V+YD  S +ING R+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYV
Sbjct  15    AFAELAHCAVTYDHRSLVINGNRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV  74

Query  2761  FWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPG  2582
             FWN HEP PG Y F GRYDLV+F+K AQ+ GLYVHLR+GPYACAEWNFGGFPVWLKYVPG
Sbjct  75    FWNVHEPSPGNYDFSGRYDLVRFVKTAQKVGLYVHLRIGPYACAEWNFGGFPVWLKYVPG  134

Query  2581  VSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKS  2402
             +SFRTDN PFK AMQ FT  IV +MKS+ LYESQGGPIILSQIENEYGP     G PG +
Sbjct  135   ISFRTDNEPFKIAMQGFTQKIVELMKSENLYESQGGPIILSQIENEYGPESKAFGPPGHA  194

Query  2401  YAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAW  2222
             Y  WAA MAV  GTGVPWVMCK+DDAPDPV+N CNGFYCD F PNK YKP MWTEAW+ W
Sbjct  195   YMTWAANMAVQTGTGVPWVMCKEDDAPDPVINTCNGFYCDSFVPNKPYKPTMWTEAWSGW  254

Query  2221  FTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAP  2042
             FTEFGG VP RP +DLAY+VA+F+ KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP
Sbjct  255   FTEFGGSVPERPVQDLAYSVARFVQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAP  314

Query  2041  IDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLA  1862
             IDE+GLLR+PKWGHLK+LHRAIKLCEPAL+S DP V +LG+ Q++ VF S SG CAAFLA
Sbjct  315   IDEYGLLRQPKWGHLKELHRAIKLCEPALISADPIVTTLGSLQQSSVFSSDSGGCAAFLA  374

Query  1861  NNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQ  1685
             N +  S A+V F N+HYNLPPWSISILPDC+N V+NTA++G Q+S+M+M    S  FSW 
Sbjct  375   NFDSRSTARVMFNNVHYNLPPWSISILPDCRNVVFNTAKIGVQTSQMEMKVSDSETFSWD  434

Query  1684  SYNEETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
              Y+E+ +++ D+T TA GLLEQ+N TRD +DYLWYMT V I P E+FL+ G++P L+V S
Sbjct  435   MYDEDVAAFSDDTITAVGLLEQLNVTRDTTDYLWYMTSVEISPSESFLQNGQFPVLSVQS  494

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AGHALHVFINGQL G++YGS EN K T+S  + LRAG NKISLLS+AVGLPN GPHFETW
Sbjct  495   AGHALHVFINGQLSGSAYGSRENQKFTYSGGINLRAGTNKISLLSMAVGLPNNGPHFETW  554

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK--  1151
             N GVLGPV++ GL+EG+RD+TWQKWSY++GLKGE + LHS++G SSVEW++ S +AQK  
Sbjct  555   NTGVLGPVTIKGLDEGRRDITWQKWSYQVGLKGESMGLHSINGISSVEWIKASLVAQKQQ  614

Query  1150  QPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGW  971
             Q LTWYK  FDAPAG++PLALDM TM KGQ+W+NGQS+GRYWP Y A  G CGAC+Y G 
Sbjct  615   QTLTWYKAYFDAPAGDDPLALDMGTMHKGQVWVNGQSIGRYWPAYLAQ-GQCGACDYTGT  673

Query  970   FDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIY  791
             +   KC + CG  +QRWYHVPRSWL+PTGNLL+ FEE GG+  G+SL +R V SVCAD+ 
Sbjct  674   YRPNKCQTGCGHPTQRWYHVPRSWLQPTGNLLIVFEEIGGDVSGISLGRRSVESVCADVS  733

Query  790   EWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHA  611
             E+ P + NW +++ G+A   ++PK HL C  GQ I++IKFASFGTP G+CGSF +G CH+
Sbjct  734   EFHPVVKNWHIESYGRAQPVIKPKVHLHCSPGQSISAIKFASFGTPLGTCGSFQQGACHS  793

Query  610   FHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              +S+D+ QK CIG   C+V ++   F GDPCP++MK+++VE VCS
Sbjct  794   PNSHDVLQKKCIGRQRCSVTISTNIF-GDPCPNIMKRVAVEAVCS  837



>ref|XP_009757670.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana sylvestris]
Length=839

 Score =  1178 bits (3047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/815 (70%), Positives = 666/815 (82%), Gaps = 3/815 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             A+VSYD  + IING+R+IL+SGSIHYPRSTPEMWP L++KAK+GGLD+++TYVFWN HEP
Sbjct  26    ATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNAHEP  85

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGK+ FEGRYDLVKFIKL QQAGLYV+LR+GPY C EWNFGGFPVWLKYVPG+ FR DN
Sbjct  86    SPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRADN  145

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ F   IVNMMKS+ L+E QGGPIIL+QIENEYGP+E+E+G+PGK+Y +WAA 
Sbjct  146   HPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAAA  205

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL  GVPW+MCKQ+DAPDPV++ CNGFYC+ F PNK YKPKMWTE WTAW+T+FGGP
Sbjct  206   MAVGLEIGVPWIMCKQEDAPDPVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGGP  265

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP RPAEDLA++VA+FI   GSF NYYM+HGGTNFGRT    FIATSYDYDAP++E+GLL
Sbjct  266   VPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLNEYGLL  325

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
              EPK+GHL+DLH+AIKL EPAL+S  P V  LG  QEA VF+SKSG CAAFL+N +    
Sbjct  326   NEPKYGHLRDLHQAIKLSEPALLSSYPTVNWLGKNQEAHVFRSKSGDCAAFLSNYDTKYS  385

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET-S  1664
              KV F    Y+LPPWSISILPDCK  VYNTAR+ +QSS+M M PV    SWQSY+EET S
Sbjct  386   VKVTFQTTQYDLPPWSISILPDCKTAVYNTARISSQSSQMMMAPVVGSLSWQSYSEETPS  445

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             + + +T +A GLLEQIN TRD+SDYLWYMTDV +   E FLK GK P+LTV SAGHA+HV
Sbjct  446   AEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGSDEGFLKNGKDPFLTVMSAGHAMHV  505

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT YG L+NPK+T+S  V LRAG+NKISLLS+AVGLPNVG HFE+WN GVLGP
Sbjct  506   FINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGVLGP  565

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+LSGLN+G RDLT Q+WSYK+GLKGE LS H+ SG SSVEWVEGS +AQ+QPLTWYK T
Sbjct  566   VTLSGLNDGTRDLTIQRWSYKVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKAT  625

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GN+P+ALDM +MGKGQIW+NG+ VGR+WPGY A  G CG CNYAG + EKKC + 
Sbjct  626   FDAPEGNDPVALDMVSMGKGQIWVNGEGVGRHWPGYIAK-GHCGECNYAGEYTEKKCQTN  684

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ SQRWYHVPRSWL+P+GNLLV FEEWGG P  +SLV+R  A VCADI + QP L NW
Sbjct  685   CGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGVPTRISLVRRATARVCADIVDGQPTLKNW  744

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
                 SGK+   + PKAHL C  G+KI+ I+FAS+G P+G+CG+F EGTCHA  SYD F+K
Sbjct  745   RTVGSGKSNN-MHPKAHLCCPDGKKISKIQFASYGVPQGTCGNFREGTCHARKSYDAFEK  803

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
              CIG  SC+V V PE FGGDPCP+  KKLSVE +C
Sbjct  804   NCIGRQSCSVNVVPEVFGGDPCPNTSKKLSVEAIC  838



>ref|XP_002455836.1| hypothetical protein SORBIDRAFT_03g025990 [Sorghum bicolor]
 gb|EES00956.1| hypothetical protein SORBIDRAFT_03g025990 [Sorghum bicolor]
Length=785

 Score =  1176 bits (3043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/795 (72%), Positives = 655/795 (82%), Gaps = 11/795 (1%)
 Frame = -2

Query  2863  LSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKL  2684
             +SGS+HYPRS PEMWPDL++KAK+GGLDVVQTYVFWNGHEP  G+YYFEGRYDLV FIKL
Sbjct  1     MSGSVHYPRSVPEMWPDLIQKAKDGGLDVVQTYVFWNGHEPSRGQYYFEGRYDLVHFIKL  60

Query  2683  AQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMK  2504
              +QAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN PFKA MQKFTT IV+MMK
Sbjct  61    VKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKAEMQKFTTKIVDMMK  120

Query  2503  SQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDA  2324
             S+ L+E QGGPIILSQIENE+GP+E++ G P K+YA WAA MAV L T VPWVMCK+DDA
Sbjct  121   SEGLFEWQGGPIILSQIENEFGPLEWDQGEPAKAYASWAANMAVALNTSVPWVMCKEDDA  180

Query  2323  PDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMK  2144
             PDP++N CNGFYCDWFSPNK +KP MWTEAWT+W+T FG PVP+RP EDLAY VAKFI K
Sbjct  181   PDPIINTCNGFYCDWFSPNKPHKPTMWTEAWTSWYTGFGIPVPHRPVEDLAYGVAKFIQK  240

Query  2143  GGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCE  1964
             GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GLLREPKWGHLK+LH+AIKLCE
Sbjct  241   GGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLLREPKWGHLKELHKAIKLCE  300

Query  1963  PALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISI  1784
             PALV+GDP V SLGN Q+A VF+S + AC AFL N ++ S+A+V+F  MHYNLPPWSISI
Sbjct  301   PALVAGDPIVTSLGNAQQASVFRSSTDACVAFLENKDKVSYARVSFNGMHYNLPPWSISI  360

Query  1783  LPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSYDDNTFTATGLLEQINTTR  1604
             LPDCK TVYNTARVG+Q S+MKM   + GF+WQSYNE+ +S  D +F   GLLEQIN TR
Sbjct  361   LPDCKTTVYNTARVGSQISQMKME-WAGGFTWQSYNEDINSLGDESFVTVGLLEQINVTR  419

Query  1603  DASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVT  1424
             D +DYLWY T V +   E FL  GK P LTV SAGHALH+F+NGQL GT YGS+++PK+T
Sbjct  420   DNTDYLWYTTYVDVAQDEQFLSNGKNPVLTVMSAGHALHIFVNGQLTGTVYGSVDDPKLT  479

Query  1423  FSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSY  1244
             +   V L  G N IS LSIAVGLPNVG HFETWNAG+LGPV+L GLNEG+RDLTWQKW+Y
Sbjct  480   YRGNVKLWPGSNTISCLSIAVGLPNVGEHFETWNAGILGPVTLDGLNEGRRDLTWQKWTY  539

Query  1243  KIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKG  1064
             K+GLKGE LSLHSLSGSSSVEW E     QKQPLTWYK  F+AP G+EPLALDM++MGKG
Sbjct  540   KVGLKGEDLSLHSLSGSSSVEWGEP---MQKQPLTWYKAFFNAPDGDEPLALDMSSMGKG  596

Query  1063  QIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTG  884
             QIWINGQ +GRYWPGYKAS G CG C+Y G +DEKKC + CG++SQRWYHVPRSWL PTG
Sbjct  597   QIWINGQGIGRYWPGYKAS-GTCGICDYRGEYDEKKCQTNCGDSSQRWYHVPRSWLNPTG  655

Query  883   NLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSC  704
             NLLV FEEWGG+P G+S+VKR   S+CAD+ EWQP + NW  +   KA      K HL C
Sbjct  656   NLLVIFEEWGGDPTGISMVKRTTGSICADVSEWQPSMTNWRTKDYEKA------KIHLQC  709

Query  703   GAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGD  524
               G+K+T IKFASFGTP+GSCGS+SEG CHA  SYDIF K CIG   C V V P  FGGD
Sbjct  710   DHGRKMTDIKFASFGTPQGSCGSYSEGGCHAHKSYDIFWKNCIGQERCGVSVVPNVFGGD  769

Query  523   PCPSVMKKLSVEVVC  479
             PCP  MK+  VE +C
Sbjct  770   PCPGTMKRAVVEAIC  784



>ref|XP_009760185.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana sylvestris]
Length=839

 Score =  1176 bits (3041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/815 (70%), Positives = 666/815 (82%), Gaps = 3/815 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             A+VSYD  + IING+R+IL+SGSIHYPRSTPEMWP L++KAK+GGLD+++TYVFWNGHEP
Sbjct  26    ATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNGHEP  85

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGK+ FEGRYDLVKFIKL QQAGLYV+LR+GPY C EWNFGGFPVWLKYVPG+ FR DN
Sbjct  86    SPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRADN  145

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ F   IVNMMKS+ L+E QGGPIIL+QIENEYGP+E+E+G+PGK+Y +WAA+
Sbjct  146   HPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAAE  205

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL  GVPW+MCKQ+DAPD V++ CNGFYC+ F PNK YKPKMWTE WTAW+T+FGGP
Sbjct  206   MAVGLEIGVPWIMCKQEDAPDHVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGGP  265

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP RPAEDLA++VA+FI   GSF NYYM+HGGTNFGRT    FIATSYDYDAP+DE+GLL
Sbjct  266   VPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGLL  325

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
              EPK+GHL+DLH+AIKL EPAL+S  P V  LG  QEA VF+SKSG CAAFL+N +    
Sbjct  326   NEPKYGHLRDLHKAIKLSEPALISSYPTVNWLGKNQEAHVFRSKSGDCAAFLSNYDTKYS  385

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET-S  1664
              KV F  M Y+L PWSISILP CK  VYNTAR+ +Q S+M M PV    SWQSY+EET S
Sbjct  386   VKVTFQTMQYDLSPWSISILPYCKTAVYNTARISSQCSQMMMAPVVGSLSWQSYSEETPS  445

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             + + +T +A GLLEQIN TRD+SDYLWYMTDV + P E FLK GK P+LTV SAGHA+HV
Sbjct  446   AEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGPDEGFLKNGKDPFLTVMSAGHAMHV  505

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT YG L+NPK+T+S  V LRAG+NKISLLS+AVGLPNVG HFE+WN GVLGP
Sbjct  506   FINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGVLGP  565

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+LSGLN+G RDLT Q+WSYK+GLKGE LS H+ SG SSVEWVEGS +AQ+QPLTWYK T
Sbjct  566   VTLSGLNDGTRDLTIQRWSYKVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKAT  625

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GN+P+ALDM +MGKGQIW+NG+ VGR WPGY A  G CG CNYAG + EKKC + 
Sbjct  626   FDAPEGNDPVALDMVSMGKGQIWVNGEGVGRQWPGYIAK-GHCGECNYAGEYTEKKCQTN  684

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ SQRWYHVPRSWL+P+GNLLV FEEWGG P  +SLV+R  A VCADI + QP L NW
Sbjct  685   CGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGVPTRISLVRRATARVCADIVDGQPTLKNW  744

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
                +SGK+   + PKAHL C  G+KI+ I+FAS+G P+G+CG+F EGTCHA  SYD F+K
Sbjct  745   RTVSSGKSNN-MHPKAHLCCPDGKKISKIQFASYGVPQGTCGNFREGTCHAHKSYDAFEK  803

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
              CIG  SC++ V PE FGGDPCP+  KKLSVE +C
Sbjct  804   NCIGRQSCSLNVVPEVFGGDPCPNTSKKLSVEAIC  838



>gb|EEC70952.1| hypothetical protein OsI_02561 [Oryza sativa Indica Group]
Length=822

 Score =  1174 bits (3038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/812 (71%), Positives = 667/812 (82%), Gaps = 13/812 (2%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             ++YD+ + ++NGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDVVQTYVFWNGHEP P
Sbjct  23    LTYDRKAVVVNGQRRILISGSIHYPRSTPEMWPDLIEKAKDGGLDVVQTYVFWNGHEPSP  82

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             G+YYFEGRYDLV FIKL +QAGLYV+LR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  83    GQYYFEGRYDLVHFIKLVKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  142

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FKA MQKFTT IV MMKS+ L+E QGGPIILSQIENE+GP+E++ G P K+YA WAA MA
Sbjct  143   FKAEMQKFTTKIVEMMKSEGLFEWQGGPIILSQIENEFGPLEWDQGEPAKAYASWAANMA  202

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             V L TGVPW+MCK+DDAPDP++N CNGFYCDWFSPNK +KP MWTEAWTAW+T FG PVP
Sbjct  203   VALNTGVPWIMCKEDDAPDPIINTCNGFYCDWFSPNKPHKPTMWTEAWTAWYTGFGIPVP  262

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
             +RP EDLAY VAKFI KGGSF+NYYMFHGGTNFGRTAGGPFIATSYDYDAPIDE+GLLRE
Sbjct  263   HRPVEDLAYGVAKFIQKGGSFVNYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEYGLLRE  322

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PKWGHLK LH+AIKLCEPALV+GDP V SLGN Q++ VF+S +GACAAFL N ++ S+A+
Sbjct  323   PKWGHLKQLHKAIKLCEPALVAGDPIVTSLGNAQKSSVFRSSTGACAAFLDNKDKVSYAR  382

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSYD  1655
             VAF  MHY+LPPWSISILPDCK TV+NTARVG+Q S+MKM   + GF+WQSYNEE +S+ 
Sbjct  383   VAFNGMHYDLPPWSISILPDCKTTVFNTARVGSQISQMKME-WAGGFAWQSYNEEINSFG  441

Query  1654  DNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFIN  1475
             ++ FT  GLLEQIN TRD +DYLWY T V +   + FL  G+ P LTV      +   + 
Sbjct  442   EDPFTTVGLLEQINVTRDNTDYLWYTTYVDVAQDDQFLSNGENPKLTVMCF--LILNILF  499

Query  1474  GQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSL  1295
               L GT YGS+++PK+T++  V L AG N IS LSIAVGLPNVG HFETWNAG+LGPV+L
Sbjct  500   NLLAGTVYGSVDDPKLTYTGNVKLWAGSNTISCLSIAVGLPNVGEHFETWNAGILGPVTL  559

Query  1294  SGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDA  1115
              GLNEG+RDLTWQKW+Y++GLKGE +SLHSLSGSS+VEW E     QKQPLTWYK  F+A
Sbjct  560   DGLNEGRRDLTWQKWTYQVGLKGESMSLHSLSGSSTVEWGEP---VQKQPLTWYKAFFNA  616

Query  1114  PAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGE  935
             P G+EPLALDM++MGKGQIWINGQ +GRYWPGYKASG  CG C+Y G +DE KC + CG+
Sbjct  617   PDGDEPLALDMSSMGKGQIWINGQGIGRYWPGYKASGN-CGTCDYRGEYDETKCQTNCGD  675

Query  934   ASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQ  755
             +SQRWYHVPRSWL PTGNLLV FEEWGG+P G+S+VKR + SVCAD+ EWQP + NW  +
Sbjct  676   SSQRWYHVPRSWLSPTGNLLVIFEEWGGDPTGISMVKRSIGSVCADVSEWQPSMKNWHTK  735

Query  754   ASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCI  575
                KA      K HL C  GQKIT IKFASFGTP+GSCGS+SEG CHA  SYDIF K C+
Sbjct  736   DYEKA------KVHLQCDNGQKITEIKFASFGTPQGSCGSYSEGGCHAHKSYDIFWKNCV  789

Query  574   GWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             G   C V V PE FGGDPCP  MK+  VE +C
Sbjct  790   GQERCGVSVVPEIFGGDPCPGTMKRAVVEAIC  821



>ref|XP_010939579.1| PREDICTED: beta-galactosidase 2-like [Elaeis guineensis]
Length=833

 Score =  1172 bits (3032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/819 (71%), Positives = 675/819 (82%), Gaps = 11/819 (1%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
             +S   A+V YD  +  +NGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYVFW
Sbjct  25    LSPAYATVWYDHKAITVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  84

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             NGHEP PG+YYFEGRYDLV FIKL QQAGL+VHLR+GPY CAEWNFGGFPVWLKYVPG+ 
Sbjct  85    NGHEPSPGEYYFEGRYDLVHFIKLVQQAGLFVHLRIGPYVCAEWNFGGFPVWLKYVPGIR  144

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDN PFKAAM  FT  IV+MMKS+ LYE QGGPIILSQIENE+GP+EY+ G P K+YA
Sbjct  145   FRTDNEPFKAAMWNFTDKIVSMMKSESLYEWQGGPIILSQIENEFGPLEYDQGEPAKAYA  204

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAA MAVGL TGVPWVMCK+DDAPDPV+N CN FYCD+F PN+ YKP MWTEAWTAW+T
Sbjct  205   AWAANMAVGLNTGVPWVMCKEDDAPDPVINTCNDFYCDYFYPNQHYKPTMWTEAWTAWYT  264

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
              FG PVP+RP EDLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFIATSYDY APID
Sbjct  265   AFGSPVPHRPVEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYGAPID  324

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             E+GLLR+P WGHL+DLH+AIKLCEPALVSGDP V SLG  Q++ VF+S+SG CAAFLAN 
Sbjct  325   EYGLLRQPLWGHLRDLHKAIKLCEPALVSGDPVVTSLGITQQSYVFRSQSGDCAAFLANF  384

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYN  1676
             +   +A+VAF  M+Y+LPPWS+SILPDCK TV+NTA VG+Q+    M  V  GFS+QSY+
Sbjct  385   DSGYYARVAFNGMNYDLPPWSVSILPDCKTTVFNTAMVGSQTWVTNMEWVG-GFSFQSYD  443

Query  1675  EETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             EETSSY+DN+FT  GLLEQ+N TRD +DYLWY T V I   E FLK G++P LTV SAGH
Sbjct  444   EETSSYNDNSFTTVGLLEQVNMTRDNTDYLWYTTYVDIGQDEQFLKNGQYPVLTVMSAGH  503

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             +L VFINGQL GT+YGS+E+P++T++  V L  G N IS+LS +VGLPNVG HFETWNAG
Sbjct  504   SLVVFINGQLTGTAYGSVEDPRLTYTGNVKLWQGSNTISILSASVGLPNVGEHFETWNAG  563

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTW  1136
             VLGPV+L GLNEG RDLTWQKW+YKIGLKGE LSL+SL+GSSSVEW E     Q QPLTW
Sbjct  564   VLGPVTLDGLNEGTRDLTWQKWTYKIGLKGESLSLYSLTGSSSVEWGEPY---QNQPLTW  620

Query  1135  YKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKK  956
             YK  F+AP GNEPLA+DM++MGKGQ+WINGQS+GRYWPGYKA  G CG C+Y G +DEKK
Sbjct  621   YKAFFNAPEGNEPLAIDMSSMGKGQVWINGQSIGRYWPGYKAY-GTCGNCDYRGEYDEKK  679

Query  955   CLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQ  776
             C + CGE+SQ WYHVPRSWL PTGNLLV FEEWGG+P G+S+VKR V S CADI EWQP 
Sbjct  680   CQTNCGESSQIWYHVPRSWLNPTGNLLVVFEEWGGDPKGISMVKRTVGSACADISEWQPA  739

Query  775   LMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYD  596
             + NW  +  G      R K HLSC  G+KIT IKFASFGTP+G CGSFSEG+CHA  SYD
Sbjct  740   MKNWHTKNYG------RSKVHLSCDHGRKITKIKFASFGTPQGVCGSFSEGSCHAHESYD  793

Query  595   IFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
              F+K C+G   C+V + PE FGGDPCP  MK+++VE +C
Sbjct  794   AFEKNCVGQEKCSVTIVPEVFGGDPCPGTMKRIAVEALC  832



>ref|XP_009760184.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana sylvestris]
Length=841

 Score =  1170 bits (3027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/817 (69%), Positives = 666/817 (82%), Gaps = 5/817 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             A+VSYD  + IING+R+IL+SGSIHYPRSTPEMWP L++KAK+GGLD+++TYVFWNGHEP
Sbjct  26    ATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNGHEP  85

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGK+ FEGRYDLVKFIKL QQAGLYV+LR+GPY C EWNFGGFPVWLKYVPG+ FR DN
Sbjct  86    SPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRADN  145

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ F   IVNMMKS+ L+E QGGPIIL+QIENEYGP+E+E+G+PGK+Y +WAA+
Sbjct  146   HPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAAE  205

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL  GVPW+MCKQ+DAPD V++ CNGFYC+ F PNK YKPKMWTE WTAW+T+FGGP
Sbjct  206   MAVGLEIGVPWIMCKQEDAPDHVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGGP  265

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP RPAEDLA++VA+FI   GSF NYYM+HGGTNFGRT    FIATSYDYDAP+DE+GLL
Sbjct  266   VPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGLL  325

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQE--ARVFKSKSGACAAFLANNNQH  1847
              EPK+GHL+DLH+AIKL EPAL+S  P V  LG  QE  A VF+SKSG CAAFL+N +  
Sbjct  326   NEPKYGHLRDLHKAIKLSEPALISSYPTVNWLGKNQEQQAHVFRSKSGDCAAFLSNYDTK  385

Query  1846  SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET  1667
                KV F  M Y+L PWSISILP CK  VYNTAR+ +Q S+M M PV    SWQSY+EET
Sbjct  386   YSVKVTFQTMQYDLSPWSISILPYCKTAVYNTARISSQCSQMMMAPVVGSLSWQSYSEET  445

Query  1666  -SSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              S+ + +T +A GLLEQIN TRD+SDYLWYMTDV + P E FLK GK P+LTV SAGHA+
Sbjct  446   PSAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGPDEGFLKNGKDPFLTVMSAGHAM  505

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQL GT YG L+NPK+T+S  V LRAG+NKISLLS+AVGLPNVG HFE+WN GVL
Sbjct  506   HVFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGVL  565

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPV+LSGLN+G RDLT Q+WSYK+GLKGE LS H+ SG SSVEWVEGS +AQ+QPLTWYK
Sbjct  566   GPVTLSGLNDGTRDLTIQRWSYKVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYK  625

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
              TFDAP GN+P+ALDM +MGKGQIW+NG+ VGR WPGY A  G CG CNYAG + EKKC 
Sbjct  626   ATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGRQWPGYIAK-GHCGECNYAGEYTEKKCQ  684

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             + CG+ SQRWYHVPRSWL+P+GNLLV FEEWGG P  +SLV+R  A VCADI + QP L 
Sbjct  685   TNCGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGVPTRISLVRRATARVCADIVDGQPTLK  744

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW   +SGK+   + PKAHL C  G+KI+ I+FAS+G P+G+CG+F EGTCHA  SYD F
Sbjct  745   NWRTVSSGKSNN-MHPKAHLCCPDGKKISKIQFASYGVPQGTCGNFREGTCHAHKSYDAF  803

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             +K CIG  SC++ V PE FGGDPCP+  KKLSVE +C
Sbjct  804   EKNCIGRQSCSLNVVPEVFGGDPCPNTSKKLSVEAIC  840



>ref|XP_007217046.1| hypothetical protein PRUPE_ppa001415mg [Prunus persica]
 gb|EMJ18245.1| hypothetical protein PRUPE_ppa001415mg [Prunus persica]
Length=835

 Score =  1169 bits (3024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/821 (69%), Positives = 673/821 (82%), Gaps = 6/821 (1%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
              S  TASVSYD  S IING+++IL+SGSIHYPRSTPEMWPDL++KAKEGG+DV+QTYVFW
Sbjct  20    ASACTASVSYDHRSIIINGRKRILISGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFW  79

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             NGHEP PGKYYFE RYDLVKFIKL  QAGLYV+LR+GPY CAEWNFGGFPVWLKYVPG++
Sbjct  80    NGHEPSPGKYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGIA  139

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDN PFKAAMQ F   IV MMK++ L++SQGGPIILSQIENEYGP+E+E+GAPGK+Y 
Sbjct  140   FRTDNEPFKAAMQTFMEKIVGMMKAESLFQSQGGPIILSQIENEYGPVEWEIGAPGKAYT  199

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAA+MAV L  GVPW+MCKQ+DAPDP+++ CNGFYC  F+P K YKPKMWTE WT W+T
Sbjct  200   NWAAQMAVNLNIGVPWIMCKQEDAPDPIIDTCNGFYCQNFTPTKKYKPKMWTEVWTGWYT  259

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
             EFGG VP RPAEDLA++VA+FI  GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYD+P+D
Sbjct  260   EFGGAVPTRPAEDLAFSVARFIQNGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDSPLD  319

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             EFGL REPKWGHL+DLHRAIKL E ALVS DP+VISLG +QEA VFKS S  CAAFLAN 
Sbjct  320   EFGLPREPKWGHLRDLHRAIKLSESALVSADPSVISLGRHQEAHVFKS-SYQCAAFLANY  378

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYN  1676
             + +   +V FG+  Y+LPPWSISILPDCK  VYNTAR+GAQSS+MKMTPV+   SWQS+ 
Sbjct  379   DTNYSVEVRFGDGQYDLPPWSISILPDCKTAVYNTARLGAQSSQMKMTPVNNALSWQSFA  438

Query  1675  EETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAG  1499
             EET+S DD +TFT  GL +QIN T D++DYLWYMTD+ I P E FL+ G+ P LT+ SAG
Sbjct  439   EETASSDDPDTFTLDGLRDQINMTWDSTDYLWYMTDITISPDEGFLESGQSPLLTIGSAG  498

Query  1498  HALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNA  1319
             HALHVFING+L GT+YGSLE  ++ FS  V LR+G+NK++LLS+++GLPN+G HFETWN 
Sbjct  499   HALHVFINGKLSGTAYGSLEKRRLRFSDNVKLRSGINKLALLSVSLGLPNIGLHFETWNV  558

Query  1318  GVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLT  1139
             GVLG V+L GLN G  DL+ +KW+YK+GLKGE LSLH+++GSSSVEWV+  ++A+K PLT
Sbjct  559   GVLGSVTLKGLNSGTWDLSQRKWTYKVGLKGEALSLHTVNGSSSVEWVQKPYLAKKPPLT  618

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             WYK TFDAP+GN+PLALDM +MGKGQIWING+S+GR+WP Y A  GAC  C YAG ++E 
Sbjct  619   WYKATFDAPSGNDPLALDMVSMGKGQIWINGRSIGRHWPAYTAH-GACRDCYYAGTYNEN  677

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC +KCGE SQRWYHVPR WL P+GNLLV FEEWGG P  ++L +R  +SVCADI+E QP
Sbjct  678   KCRTKCGEPSQRWYHVPRGWLNPSGNLLVVFEEWGGEPTKIALAQRATSSVCADIFEGQP  737

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              L + +  AS K    ++ KAHL C  GQ I+ IKFAS+G P+G+CGSF EG+CHA  SY
Sbjct  738   TLQSSQKLASAKL---IKAKAHLRCQPGQIISDIKFASYGWPQGTCGSFKEGSCHAHKSY  794

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             D  ++ CIG   CT+PV P  FGGDPCP   KK SVE VCS
Sbjct  795   DFPRRVCIGKQFCTIPVAPAYFGGDPCPGSAKKFSVEAVCS  835



>ref|XP_010917686.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=849

 Score =  1160 bits (3000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/816 (67%), Positives = 664/816 (81%), Gaps = 4/816 (0%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD  + IINGQR+IL+SGSIHYPRSTP+MW  L++KAK+GGLDV+QTYVFWNGHEP P
Sbjct  28    VTYDSKAVIINGQRRILISGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPSP  87

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             G Y FEGRYDLV+FIK  Q+ GLYVHLR+GPY C EWNFGGFPVWLKYV G+SFRTDN P
Sbjct  88    GSYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYICGEWNFGGFPVWLKYVSGISFRTDNEP  147

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP    LGA G +Y  WAAKMA
Sbjct  148   FKNAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESNALGAAGHAYVNWAAKMA  207

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             VG+GTGVPWVMCK+DDAPDP++NACNGFYCD F+PNK YKP MWTEAW+ WFTEFGG V 
Sbjct  208   VGMGTGVPWVMCKEDDAPDPMINACNGFYCDAFTPNKPYKPTMWTEAWSGWFTEFGGTVH  267

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
              RP EDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+RE
Sbjct  268   QRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRE  327

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LH+AIKLCEPALVS DP V S G+Y +A VF S+SG+CAAFLAN N +SF++
Sbjct  328   PKYGHLKELHKAIKLCEPALVSADPTVTSFGSYAQAHVFSSESGSCAAFLANYNPNSFSR  387

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSSY  1658
             V F NMHY+LPPWSISILPDC+N V+NTA+VG Q+S+M+M P  S    W++Y+EE +S+
Sbjct  388   VMFNNMHYSLPPWSISILPDCRNVVFNTAKVGVQTSQMQMFPADSTSLMWETYDEEVASF  447

Query  1657  DDNTF-TATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             DDN+  + TGLLEQIN TRDASDYLWY+T V +   E FL+GG+ P LTV SAGHALHVF
Sbjct  448   DDNSLISTTGLLEQINVTRDASDYLWYITSVDVSSAEGFLQGGQLPVLTVQSAGHALHVF  507

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G++YG+ E+ ++T++  + LRAG N+I+LLS+AVGLPNVG H+E WN GVLGPV
Sbjct  508   VNGQLSGSAYGTREDRRITYTGNINLRAGSNRIALLSVAVGLPNVGMHYELWNTGVLGPV  567

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
              L G++EGKRDLTWQKWSY++GLKGE ++L+SL G+SSVEW++ S  +QK QPLTWY+  
Sbjct  568   VLHGVDEGKRDLTWQKWSYQVGLKGEAMNLNSLDGTSSVEWMKQSLTSQKQQPLTWYRAY  627

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAPAG++PLALDM +MGKGQ WINGQS+GRYW  + A  G C  CNYAG +   KC S 
Sbjct  628   FDAPAGDDPLALDMGSMGKGQAWINGQSIGRYWSLW-APNGDCNGCNYAGTYRSPKCQSG  686

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +QRWYHVPRSWL+PT NLLV FEE GG+   +S VK+ V+ VCAD+ EW P + NW
Sbjct  687   CGQPTQRWYHVPRSWLQPTQNLLVVFEELGGDATKISFVKKSVSGVCADVSEWHPMIKNW  746

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
              +++ G+     +PK HL C  GQ I++IKFASFGTP G+CG+F +G CH+ +S+   +K
Sbjct  747   HIESYGQPEEHHKPKVHLRCAPGQSISAIKFASFGTPLGTCGNFEQGACHSPNSHSTLEK  806

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CIG   C V ++ + FGGDPCP+VMK+++VE +CS
Sbjct  807   KCIGQQRCAVTISTDNFGGDPCPNVMKRVAVEAICS  842



>ref|XP_010254673.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =  1160 bits (3000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/817 (67%), Positives = 652/817 (80%), Gaps = 5/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SV+YD+ + IINGQR+IL SGSIHYPRSTPEMW DL++KAKEGGLDV+QTYVFWN HEP 
Sbjct  26    SVTYDRKAIIINGQRRILFSGSIHYPRSTPEMWGDLIQKAKEGGLDVIQTYVFWNVHEPS  85

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+FIK  Q+AGLYVHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  86    PGNYNFEGRYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  145

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV MMKS+RL+ESQGGPIILSQIENEYGP     G+ G SY  WAA M
Sbjct  146   PFKMAMQGFTQKIVQMMKSERLFESQGGPIILSQIENEYGPESKAFGSAGYSYMTWAANM  205

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AV LGTGVPWVMCKQDDAPDPV+NACNGFYCD FSPNK YKP MWTEAW+ WFTEFGG V
Sbjct  206   AVKLGTGVPWVMCKQDDAPDPVINACNGFYCDAFSPNKPYKPAMWTEAWSGWFTEFGGTV  265

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLA AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+R
Sbjct  266   HQRPVQDLALAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIR  325

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LHR IKLCE A+VS DP VISLG+YQ+A VF S+SG CAAFLAN N +S A
Sbjct  326   QPKYGHLKELHRTIKLCERAIVSADPTVISLGSYQQAHVFSSRSGGCAAFLANYNPNSAA  385

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSISILPDC+N V+NTA++G Q+S+M+M P  S+  +W++Y+E+ SS
Sbjct  386   RVMFNNMHYNLPPWSISILPDCRNVVFNTAKIGVQTSQMQMLPSNSKLLAWETYDEDISS  445

Query  1660  YDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              DDN+  T  GLLEQIN TRD SDYLWY+T V I   E+FL+GG+ P L V SAGHALHV
Sbjct  446   LDDNSMITTVGLLEQINVTRDNSDYLWYITSVEISSSESFLRGGQNPTLIVQSAGHALHV  505

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             ++NGQL G++ G+ E  + TF   V LRAG+N+I+LLSIAVGLPN+G H+E W+ GVLGP
Sbjct  506   YVNGQLSGSASGTREKRRFTFIGKVNLRAGINRIALLSIAVGLPNIGTHYEMWSTGVLGP  565

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKT  1127
             V L GL+EGKRDLTWQKWSY++GLKGE + L S +  S+V+W+ GS   QK QPLTWYK 
Sbjct  566   VVLHGLDEGKRDLTWQKWSYQVGLKGEAMDLVSPNRISNVDWIRGSLAVQKQQPLTWYKA  625

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              F+AP G+EPLALDM +MGKGQ+WINGQS+GRYW  +  + G C  C+Y G F   KC +
Sbjct  626   YFNAPEGDEPLALDMGSMGKGQVWINGQSIGRYWTIH--ASGDCNGCSYTGTFRPPKCQT  683

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QRWYHVPRSWL+PT NLLV FEE GG+   +SLVKR V ++CAD+ EW P + +
Sbjct  684   GCGQPTQRWYHVPRSWLKPTQNLLVVFEEIGGDASRISLVKRSVTTICADVSEWHPNIKS  743

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W++++  +     RPK HL C  GQ I++IKFASFGTP G+CGSF  GTCHA  SY I  
Sbjct  744   WQIESYDRTEEFHRPKVHLHCAPGQSISAIKFASFGTPLGTCGSFQRGTCHAPTSYSILD  803

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K CIG   C V ++   FG DPCP+V+K+LSVE VCS
Sbjct  804   KMCIGQERCAVTISNSNFGADPCPNVLKRLSVEAVCS  840



>ref|XP_008809207.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=852

 Score =  1158 bits (2996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/816 (67%), Positives = 664/816 (81%), Gaps = 4/816 (0%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + +ING R+IL+SGSIHYPRSTP+MW  L++KAK+GGLDVVQTYVFWNGHEP P
Sbjct  31    VTYDRKAVVINGHRRILISGSIHYPRSTPDMWEGLIQKAKDGGLDVVQTYVFWNGHEPSP  90

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             G Y F+G YDLV+FIK  Q+AGLYVHLR+GPY C EWNFGGFPVWLKYV G+SFRTDN P
Sbjct  91    GSYNFKGSYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPVWLKYVSGISFRTDNEP  150

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP     GA G +Y  WAAKMA
Sbjct  151   FKTAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESNAFGAAGHAYVNWAAKMA  210

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             VG+GTGVPWVMCK++DAPDP++NACNGFYCD F+PNK YKP MWTEAW+ WFTEFGG V 
Sbjct  211   VGMGTGVPWVMCKEEDAPDPMINACNGFYCDAFTPNKPYKPTMWTEAWSGWFTEFGGTVR  270

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
              RP EDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+RE
Sbjct  271   QRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRE  330

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LH+AIKLCEPALVS DP V SLG+Y++A VF S+SG CAAFLAN N +S A+
Sbjct  331   PKYGHLKELHKAIKLCEPALVSADPTVTSLGSYEQAHVFSSESGRCAAFLANYNLNSVAR  390

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSSY  1658
             V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  S+   W++Y+EE +S 
Sbjct  391   VMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMFPADSQSLMWETYDEEVASL  450

Query  1657  DDNTF-TATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             +DN+  + TGLLEQIN TRDASDYLWY+T V + P E FL+GG+ P LTV SAGHALHVF
Sbjct  451   EDNSLISTTGLLEQINVTRDASDYLWYITSVDVSPAEGFLRGGQLPVLTVQSAGHALHVF  510

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +N QL G++YG+ EN ++T++  + LRAG N+I+LLS+AVGLPNVG H+E WN GVLGPV
Sbjct  511   VNDQLSGSAYGTRENRRITYTGNINLRAGSNRIALLSVAVGLPNVGVHYELWNTGVLGPV  570

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
              L G++EGKRDLTWQKWSY++GLKGE ++++SL G+SSVEW++ S  +QK QPLTWY+  
Sbjct  571   VLHGVDEGKRDLTWQKWSYQVGLKGEAMNINSLDGTSSVEWMKESLASQKQQPLTWYRAY  630

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAPAG++PLALDM +MGKGQ+WINGQSVGRYW  + A  G C  CNYAG +    C S 
Sbjct  631   FDAPAGDDPLALDMGSMGKGQVWINGQSVGRYWSLW-APDGDCKGCNYAGTYRSPNCQSG  689

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +QRWYHVPRSWL+P  NLLV FEE GG+   +SLVK+ V+SVCAD+ EW P + NW
Sbjct  690   CGQPTQRWYHVPRSWLQPAQNLLVVFEELGGDATKISLVKKSVSSVCADVSEWHPTIKNW  749

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
              +++ G+     +PK HL C  GQ I++IKFASFGTP G+CG+F +G CH+ +S+   +K
Sbjct  750   HIESYGQPVEHHKPKVHLRCAPGQSISAIKFASFGTPLGTCGNFQQGACHSTNSHSTLEK  809

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CIG   C V ++ + FGGDPCP+VMK+++VE +CS
Sbjct  810   KCIGQQRCAVTISTDNFGGDPCPNVMKRVAVEAICS  845



>ref|XP_008799994.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=845

 Score =  1158 bits (2995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/816 (67%), Positives = 661/816 (81%), Gaps = 4/816 (0%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             VSYD+ + IINGQR+IL+SGSIHYPRSTP+MW  LL+KAK+GGLDV+QTY FWNGHEP P
Sbjct  24    VSYDRKAIIINGQRRILISGSIHYPRSTPDMWEGLLQKAKDGGLDVIQTYAFWNGHEPSP  83

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             G Y FEGRYDLV+FIK   + GLYVHLR+GPY C EWNFGGFPVWLKY PG+SFRTDN P
Sbjct  84    GNYNFEGRYDLVRFIKTVHKVGLYVHLRIGPYICGEWNFGGFPVWLKYAPGISFRTDNEP  143

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP     GA G +Y  WAAKMA
Sbjct  144   FKMAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESKAFGAAGNAYVNWAAKMA  203

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             VGLGTGVPWVMCK+DDAPDPV+NACNGFYCD F+PNK YKP MWTEAW+ WFTEFGG V 
Sbjct  204   VGLGTGVPWVMCKEDDAPDPVINACNGFYCDAFTPNKPYKPTMWTEAWSGWFTEFGGTVR  263

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
              RP EDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+RE
Sbjct  264   QRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRE  323

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LH+AIKLCEPALVS DP V SLG+Y+EA VF S+SG CAAFLAN N +SFA+
Sbjct  324   PKYGHLKELHKAIKLCEPALVSADPTVTSLGSYEEAHVFSSESGGCAAFLANYNPNSFAR  383

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSSY  1658
             V F NMHYNLPPWSISILPDC+N ++NTA+VG Q+S+M+M P  S+   W++Y+E+ +S 
Sbjct  384   VMFNNMHYNLPPWSISILPDCRNILFNTAKVGVQTSQMQMLPANSQSLMWETYDEDVASL  443

Query  1657  DDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             +DNT  TA GLLEQIN TRDASDYLWY+T V   P E FL+GG+ P LTV SAGHALHVF
Sbjct  444   EDNTPTTAAGLLEQINVTRDASDYLWYITSVDASPAEGFLRGGQLPVLTVQSAGHALHVF  503

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NG+L G++YGS EN + T++ ++ LRAG N+I+LLS++VGLPNVG H+E WN GVLGPV
Sbjct  504   VNGRLSGSAYGSRENRRFTYTGSINLRAGSNRIALLSVSVGLPNVGVHYELWNTGVLGPV  563

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
              L G++EGKRDLTWQKWSY++GLKGE ++L++L G+SSVEW++ S ++QK QPLTWY+  
Sbjct  564   VLHGVDEGKRDLTWQKWSYQVGLKGEAMNLNTLEGTSSVEWIKESLVSQKQQPLTWYRAY  623

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAPAG++PLALDM +MGKGQ W+NGQS+GRYW  + A  G C  CNYAG +   KC + 
Sbjct  624   FDAPAGDDPLALDMGSMGKGQAWLNGQSIGRYWTLW-APNGDCNGCNYAGTYRTPKCQTG  682

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             C + +QRWYHVPRSWL+PT NLLV FEE GG+   +SL K+ ++SVCAD+ EW P + N 
Sbjct  683   CSQPTQRWYHVPRSWLQPTENLLVVFEELGGDATKISLAKKSMSSVCADVSEWHPTIKNR  742

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
              +Q+ G+     +PK HL C  GQ I++IKFASFGTP G+CG+F +GTCH+ +S+   +K
Sbjct  743   HIQSYGQPEEYHKPKIHLRCAPGQSISAIKFASFGTPLGTCGNFQQGTCHSPNSHSTLEK  802

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CIG   C V ++   FGGDPCP VMK ++VE +CS
Sbjct  803   KCIGLQRCAVTISTNNFGGDPCPEVMKSVAVEAICS  838



>dbj|BAF31234.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =  1155 bits (2987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/821 (67%), Positives = 664/821 (81%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   SV+YD+ + IINGQRKIL+SGSIHYPRSTP+MW  L++KAK+GGLDV+QTYVFWN 
Sbjct  25    LIQCSVTYDRKAIIINGQRKILISGSIHYPRSTPDMWEGLMQKAKDGGLDVIQTYVFWNV  84

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+F+K  Q+AGLY+HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  85    HEPSPGNYNFEGRYDLVRFVKTVQKAGLYMHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  144

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AMQ FT  IV MMKS+ L+ESQGGPIILSQIENEYG     LGAPG +Y  W
Sbjct  145   TDNEPFKMAMQGFTEKIVQMMKSESLFESQGGPIILSQIENEYGSESKALGAPGHAYMTW  204

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AAKMAVGL TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP MWTEAW+ WFTEF
Sbjct  205   AAKMAVGLRTGVPWVMCKEDDAPDPVINTCNGFYCDAFTPNKPYKPTMWTEAWSGWFTEF  264

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GG V  RP EDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+
Sbjct  265   GGTVHERPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEY  324

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHRAIKLCEPAL+S DP V SLG YQ++ VF S +G CAAFL+N N 
Sbjct  325   GLIRQPKYGHLKELHRAIKLCEPALISADPIVTSLGPYQQSHVFSSGTGGCAAFLSNYNP  384

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTP-VSRGFSWQSYNE  1673
             +S A+V F NMHY+LPPWSISILPDC+N V+NTA+VG Q+S+M M+   ++  SW+ Y+E
Sbjct  385   NSVARVMFNNMHYSLPPWSISILPDCRNVVFNTAKVGVQTSQMHMSAGETKLLSWEMYDE  444

Query  1672  ETSSYDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + +S  DN+  TA GLLEQ+N TRD SDYLWYMT V I P E+ L+GG+ P LTV SAGH
Sbjct  445   DIASLGDNSMITAVGLLEQLNVTRDTSDYLWYMTSVDISPSESSLRGGRPPVLTVQSAGH  504

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             ALHV+INGQL G+++GS EN + TF+  V +RAG+N+I+LLSIAV LPNVG H+E+ N G
Sbjct  505   ALHVYINGQLSGSAHGSRENRRFTFTGDVNMRAGINRIALLSIAVELPNVGLHYESTNTG  564

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             VLGPV L GL++GKRDLTWQKWSY++GLKGE ++L + SG S VEW++ SF  QK QPLT
Sbjct  565   VLGPVVLHGLDQGKRDLTWQKWSYQVGLKGEAMNLVAPSGISYVEWMQASFATQKLQPLT  624

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             WYK  F+AP G+EPLALD+ +MGKGQ+WING+S+GRYW    A+ G C  C+YAG +   
Sbjct  625   WYKAYFNAPGGDEPLALDLGSMGKGQVWINGESIGRYWTA--AANGDCNHCSYAGTYRAP  682

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC + CG+ +QRWYHVPRSWL+PT NLLV FEE GG+  G+SLVKR V+SVCAD+ EW P
Sbjct  683   KCQTGCGQPTQRWYHVPRSWLQPTKNLLVIFEEIGGDASGISLVKRSVSSVCADVSEWHP  742

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW +++ G++    RPK HL C  GQ I++IKFASFGTP G+CGSF +G CH+ +S+
Sbjct  743   TIKNWHIESYGRSEELHRPKVHLRCAMGQSISAIKFASFGTPLGTCGSFQQGPCHSPNSH  802

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              I +K CIG   C V ++   FGGDPCP+VMK+++VE +C+
Sbjct  803   AILEKKCIGQQRCAVTISMNNFGGDPCPNVMKRVAVEAICT  843



>ref|XP_010275526.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =  1154 bits (2986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/817 (67%), Positives = 659/817 (81%), Gaps = 5/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YD+ + IINGQR+IL+SGSIHYPRSTPEMW DL++KAKEGGLDV+QTYVFWN HEP 
Sbjct  26    TVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKEGGLDVIQTYVFWNVHEPS  85

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+FIK  Q+AGLYVHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  86    PGNYNFEGRYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  145

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV MMKS+ L+ESQGGPIILSQIENEYG      GA G +Y  WAA M
Sbjct  146   PFKMAMQGFTQKIVEMMKSEMLFESQGGPIILSQIENEYGTESKAFGAAGHAYMTWAANM  205

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             A+GLGTGVPWVMCK+ DAPDPV+NACNGFYCD F PNK YKP MWTEAW+ WFTEFGG V
Sbjct  206   AIGLGTGVPWVMCKEGDAPDPVINACNGFYCDAFHPNKPYKPAMWTEAWSGWFTEFGGTV  265

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLA+AVA+FI  GGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+R
Sbjct  266   HQRPVQDLAFAVARFIQNGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIR  325

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LHRAIKLCE +LVS DP + SLG+YQ+A VF S+SG CAAF+AN + +S A
Sbjct  326   QPKYGHLKELHRAIKLCERSLVSSDPTITSLGSYQQAHVFSSESGDCAAFIANYDPNSAA  385

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  S  FSW++Y+E+ SS
Sbjct  386   RVMFNNMHYNLPPWSISILPDCRNMVFNTAKVGVQTSQMQMLPSNSELFSWETYDEDVSS  445

Query  1660  YDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              +DN+  T+ GLLEQIN TRD SDYLWY+T V I   E+FL+GG+ P L V S GHALHV
Sbjct  446   LEDNSMITSVGLLEQINVTRDTSDYLWYITSVDISSSESFLRGGQSPTLIVESTGHALHV  505

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G++ G+ EN +  F+  V LRAG+NKI+LLSIAVGLPNVG HFE W  G+LGP
Sbjct  506   FINGQLSGSASGTRENRRFMFTGKVNLRAGINKIALLSIAVGLPNVGTHFEAWKTGILGP  565

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKT  1127
             V L GL++GK DLTWQKWSY++GLKGE ++L S +G SSV+W++GS + QK QPLTWYK 
Sbjct  566   VVLHGLDQGKMDLTWQKWSYQVGLKGEAMNLVSPNGISSVDWMQGSLVVQKQQPLTWYKA  625

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              F+AP G+EPLALDM++MGKGQ+WINGQS+GRYW  Y  + G C  C+Y+G F   KC  
Sbjct  626   YFNAPEGDEPLALDMSSMGKGQVWINGQSIGRYWTIY--ANGNCNGCSYSGTFRPPKCQI  683

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QRWYHVPRSWL+PT NLLV FEE GG+  G+SLVKR V+SVCAD+ EW P + N
Sbjct  684   GCGQPTQRWYHVPRSWLKPTQNLLVVFEEIGGDASGISLVKRSVSSVCADVSEWHPNIKN  743

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W++++ G+     RPK HL C  GQ I++IKFASFGTP G+CGSF +G CHA  SY + +
Sbjct  744   WQIESYGRTQEFHRPKVHLRCAPGQSISAIKFASFGTPLGTCGSFQQGICHAPTSYSVLE  803

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             + C+G   C+V ++   FG DPCP+V+K+L+VE +C+
Sbjct  804   ERCVGQERCSVTISNRNFGADPCPNVLKRLTVEAICA  840



>ref|XP_009396354.1| PREDICTED: beta-galactosidase 5-like [Musa acuminata subsp. malaccensis]
Length=848

 Score =  1154 bits (2986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/815 (67%), Positives = 659/815 (81%), Gaps = 3/815 (0%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + IINGQRKIL+SGSIHYPRSTP+MW  L++KAK+GGLDV+QTYVFWNGHEP P
Sbjct  28    VTYDRKAIIINGQRKILISGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPSP  87

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             G Y FEGRYDLV+FIK  Q+ GLYVHLRVGPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  88    GTYNFEGRYDLVRFIKTVQKVGLYVHLRVGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  147

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP    LG+ G+SY  WAA MA
Sbjct  148   FKMAMQGFTQKIVEMMKSESLFASQGGPIILSQIENEYGPESKALGSAGRSYVNWAADMA  207

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             VGLGTGVPWVMCK++DAPDPV+N CNGFYCD F+PNK YKP MWTEAW+ WFTEFGG + 
Sbjct  208   VGLGTGVPWVMCKEEDAPDPVINTCNGFYCDSFTPNKPYKPMMWTEAWSGWFTEFGGTIR  267

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
             +RPAEDLA+AVA+FI  GGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+RE
Sbjct  268   HRPAEDLAFAVARFIQNGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRE  327

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LH+AIKLCE ALVS DP V SLG+ Q+A VF S+SG CAAFL+N+  +S+AK
Sbjct  328   PKYGHLKELHKAIKLCEQALVSADPTVTSLGSLQQAHVFSSESGGCAAFLSNHEPNSYAK  387

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSSY  1658
             + F NMHYNLPPWSISILPDC+N V+NTA++G Q+S+M+M P  ++   W+ Y+EE +S 
Sbjct  388   IMFNNMHYNLPPWSISILPDCRNVVFNTAKIGVQTSQMQMYPTNTQSLMWERYDEEVASL  447

Query  1657  DDNTF-TATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             ++N+  TATGLLEQIN TRD SDYLWY+T V I   E FLKGGK P LTV SAGHALH+F
Sbjct  448   EENSLITATGLLEQINVTRDTSDYLWYITSVDISSAEEFLKGGKLPVLTVRSAGHALHIF  507

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G++YG+ EN ++ FS  + LRAG N+I+LLS+AVGLPN G H+E W+ GVLGPV
Sbjct  508   VNGQLSGSAYGTRENKRIKFSGNINLRAGTNRIALLSVAVGLPNSGVHYELWSTGVLGPV  567

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTF  1121
              L  L+EG RDLTWQ WSY++GLKGE ++L+SL G+SSVEW++GS +  +QPLTWY+  F
Sbjct  568   VLHELDEGSRDLTWQTWSYQVGLKGEDMNLNSLEGASSVEWMQGSLVQNQQPLTWYRAYF  627

Query  1120  DAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKC  941
             DAP G+EPLALDM +MGKG +WINGQS+GRYW  Y A    C +C+Y G +   KC S C
Sbjct  628   DAPDGDEPLALDMASMGKGHVWINGQSIGRYWTAY-APKENCKSCSYTGTYRSPKCQSGC  686

Query  940   GEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWE  761
             G+ +QRWYHVPRSWL+PT NLLV FEE GG+   ++L+ R V+SVCAD+ EW P + NW 
Sbjct  687   GQPTQRWYHVPRSWLQPTRNLLVVFEELGGDATKIALMMRSVSSVCADVSEWHPTIKNWH  746

Query  760   MQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKY  581
             +++ G+     +PK HL C  GQ I++IKFAS+GTP G+CG+F +G CH+ +S+ I +K 
Sbjct  747   IESYGEPEEYRKPKVHLRCAPGQSISAIKFASYGTPLGTCGNFQQGACHSPNSHTILEKK  806

Query  580   CIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             CIG   C V ++   FGGDPCP+VMKK++VE VCS
Sbjct  807   CIGKEKCVVAISQANFGGDPCPNVMKKVAVEAVCS  841



>gb|KHG01120.1| Beta-galactosidase [Gossypium arboreum]
Length=837

 Score =  1153 bits (2983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/835 (69%), Positives = 663/835 (79%), Gaps = 33/835 (4%)
 Frame = -2

Query  2944  TSWV-SLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQT  2768
             +SWV  L +A+VSYD  + IING+R+ILLSGSIHYPRSTP+MWPDL+ KAKEGGLDV+QT
Sbjct  22    SSWVFPLVSATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKEGGLDVIQT  81

Query  2767  YVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFG---------  2615
             YVFWNGHEP PG YYFE RYDLV+FIKL QQAGLYVHLR+GPY CAEWNFG         
Sbjct  82    YVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGCLPICSVFW  141

Query  2614  --GFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEY  2441
               GFPVWLKYVPG++FRTDN PFKAAMQKFT  IV+MMK+++L+E+QGGPII+SQIENE+
Sbjct  142   FRGFPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQIENEF  201

Query  2440  GPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKA  2261
             GP+E+E+G PGK+Y +WAA+MAVGL TGVPW+MCKQDDAPDPV+N CNGFYC+ F+PN  
Sbjct  202   GPVEWEIGDPGKAYTKWAAQMAVGLDTGVPWIMCKQDDAPDPVINTCNGFYCENFTPNAK  261

Query  2260  YKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAG  2081
             YKPKMWTE WT W+TEFGG VP RPAED+A++VA+FI  GGSF     +HGGTNFGRTA 
Sbjct  262   YKPKMWTENWTGWYTEFGGAVPTRPAEDIAFSVARFIQNGGSF-----YHGGTNFGRTAS  316

Query  2080  GPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARV  1901
             G FIATSYDYDAPIDE+GL REPKWGHL+DLHRAIKL EPALVS DP V SLG+ QE  V
Sbjct  317   GLFIATSYDYDAPIDEYGLPREPKWGHLRDLHRAIKLSEPALVSADPTVTSLGSNQEGHV  376

Query  1900  FKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRM  1721
             FKSKSGACAAFLAN +     KV FG+ HY LP WSI+ILPDCK  V+NTAR+GAQSS  
Sbjct  377   FKSKSGACAAFLANYDTKYSVKVTFGSAHYELPSWSITILPDCKTAVFNTARLGAQSSEK  436

Query  1720  KMTPVSRGFSWQSYNEETSSYDDNTFTA-TGLLEQINTTRDASDYLWYMTDVRIDPREAF  1544
             KM   +  FSWQSYNEE+ S DD   T   GL EQI  TRDA+DYLWYMTDV+ID  E F
Sbjct  437   KMVLANTAFSWQSYNEESPSADDQDVTVHDGLWEQIYITRDATDYLWYMTDVQIDSDEGF  496

Query  1543  LKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIA  1364
             L+ G+ P LT++SAGHALHVFINGQL GT YG LENPK+TFS  V LRAG+NK       
Sbjct  497   LRSGQDPLLTIWSAGHALHVFINGQLSGTVYGGLENPKLTFSNNVKLRAGINK-------  549

Query  1363  VGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssv  1184
                 NVG HFETWN GVLGPV+L GLNEG RD + QKWSYKIGLKGE L LH+ +GSSSV
Sbjct  550   ----NVGTHFETWNVGVLGPVTLKGLNEGTRDFSKQKWSYKIGLKGEALKLHTDAGSSSV  605

Query  1183  ewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASG  1004
             EWVEGS + +KQP+TWYKTTFDAP GNEPL LDM++MGKGQ+WINGQS+GR+WPGY A G
Sbjct  606   EWVEGSQLVKKQPMTWYKTTFDAPGGNEPLGLDMSSMGKGQVWINGQSIGRHWPGYIAHG  665

Query  1003  GACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVK  824
               C AC+Y+G + ++KC + CG+ SQRWYHVPRSWL+P+GN LV FEEWGG+P G++L K
Sbjct  666   N-CDACDYSGTYSDQKCRTNCGQPSQRWYHVPRSWLKPSGNFLVVFEEWGGDPNGIALAK  724

Query  823   REVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGS  644
             R   SVCADI+E QP +    M  +G+ +    PKAHL C  GQKI+ I FAS+G P GS
Sbjct  725   RTTRSVCADIFEGQPTMKKRGMLIAGRIS---SPKAHLWCPPGQKISKINFASYGMPEGS  781

Query  643   CGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             CG+F EG+CHA  SYD FQK CIG  SC+V V PE FGGDPCP   KK+SVE  C
Sbjct  782   CGNFREGSCHANKSYDAFQKNCIGKQSCSVTVAPEVFGGDPCPGSRKKVSVEAAC  836



>ref|XP_009395554.1| PREDICTED: beta-galactosidase 5 [Musa acuminata subsp. malaccensis]
Length=842

 Score =  1153 bits (2982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/818 (66%), Positives = 662/818 (81%), Gaps = 4/818 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             + V+YD+ + II+GQR+IL+SGSIHYPRSTPEMW  L++KAK+GGLDV+QTYVFWNGHEP
Sbjct  19    SGVTYDRKAIIIDGQRRILISGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEP  78

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEGRYDLV+FIK  Q+ GLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  79    SPGTYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  138

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP     G+ G SY  WAA+
Sbjct  139   EPFKMAMQGFTQKIVQMMKSESLFGSQGGPIILSQIENEYGPESKAFGSAGHSYVNWAAE  198

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPWVMCK+DDAPDPV+NACNGFYCD F+PNK YKP MWTEAW+ WFTEFGG 
Sbjct  199   MAVGLKTGVPWVMCKEDDAPDPVINACNGFYCDSFTPNKPYKPTMWTEAWSGWFTEFGGT  258

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             + +RP EDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+
Sbjct  259   IHHRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLV  318

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             REPK+GHLK+LHRAIKLCE ALVS DP VISLG+ Q+A VF S+SG CAAFL+N+N +SF
Sbjct  319   REPKYGHLKELHRAIKLCERALVSADPTVISLGSLQQAHVFSSQSGGCAAFLSNHNPNSF  378

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVS-RGFSWQSYNEETS  1664
             A+V F NMHYN+PPWSISILPDC+N V+NTA+VG Q+S+M+M P++ +   W+ Y+EE +
Sbjct  379   ARVMFNNMHYNIPPWSISILPDCRNVVFNTAKVGVQTSQMQMYPINVQSLMWERYDEEVA  438

Query  1663  SYDDNTF-TATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S ++N+  T TGLLEQIN TRD SDYLWY+T V + P E FL+G K P L V SAGHALH
Sbjct  439   SLEENSLITTTGLLEQINVTRDTSDYLWYITSVDVSPAEGFLRGRKRPVLMVESAGHALH  498

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             +F+NGQL G++YGS E+ ++ FS  V LRAG N+I+LLS+AVGLPN G H+E W+ GVLG
Sbjct  499   IFVNGQLSGSAYGSREDRRIKFSGNVNLRAGTNRIALLSVAVGLPNAGVHYELWSTGVLG  558

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYK  1130
             PV L GL+EG RDLTWQKWSY++GLKGE ++L+SL G+SSVEW++GS +AQ +QPLTWY+
Sbjct  559   PVVLHGLDEGSRDLTWQKWSYQLGLKGEAMNLNSLEGASSVEWMQGSLVAQNQQPLTWYR  618

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               FDAP GN+PLALDM +MGKG +WINGQS+GRYW  Y A    C +C+Y G +   KC 
Sbjct  619   AYFDAPDGNDPLALDMGSMGKGHVWINGQSIGRYWTAY-APSEYCNSCSYRGTYRSPKCQ  677

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             S CG+ +QRWYHVPRSWL+PT NLL+ FEE GG+   +SL KR V+SVCAD+ EW P + 
Sbjct  678   SGCGQPTQRWYHVPRSWLQPTRNLLIVFEELGGDATKISLAKRSVSSVCADVSEWHPTIK  737

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW ++  G+     +PK HL C  GQ I++IKFAS+GTP G+CG+F +G CH+ +S+ I 
Sbjct  738   NWHIENYGRPEEHHKPKVHLRCAQGQFISAIKFASYGTPIGTCGNFQQGACHSPNSHTIL  797

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K CIG   C V ++   FGGDPC +VMK+++VE +CS
Sbjct  798   EKMCIGKEKCMVAISQNIFGGDPCRNVMKRVAVEAICS  835



>ref|XP_010932916.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=845

 Score =  1150 bits (2976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/816 (66%), Positives = 662/816 (81%), Gaps = 4/816 (0%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + IING+R+IL+SGSIHYPRSTP+MW  L++KA++GGLDV+QTYVFWNGHEP P
Sbjct  24    VTYDRKAIIINGRRRILISGSIHYPRSTPDMWEGLVQKARDGGLDVIQTYVFWNGHEPSP  83

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             G Y FEGRYDLV+FIK A + G+YVHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  84    GNYNFEGRYDLVRFIKTAHKVGMYVHLRIGPYVCGEWNFGGFPVWLKYVPGISFRTDNEP  143

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP      A G +Y  WAAKMA
Sbjct  144   FKIAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESKAFDAAGHAYVNWAAKMA  203

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             VGLGTGVPWVMCK+DDAPDPV+NACNGFYCD F+PNK YKP MWTEAW+ WFTEFGG V 
Sbjct  204   VGLGTGVPWVMCKEDDAPDPVINACNGFYCDAFTPNKPYKPTMWTEAWSGWFTEFGGTVR  263

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
              RP EDLA+AVA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI+TSYDYDAPIDEFGL+RE
Sbjct  264   QRPVEDLAFAVARFLQKGGSFINYYMYHGGTNFGRTAGGPFISTSYDYDAPIDEFGLIRE  323

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHL++LH+AIKLCE ALVS DP V SLG+Y+EA VF S+SG CAAFLAN N +SFA+
Sbjct  324   PKYGHLRELHKAIKLCESALVSADPTVTSLGSYEEAHVFSSESGGCAAFLANYNPNSFAR  383

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSSY  1658
             V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  S+   W++Y+E+ +S 
Sbjct  384   VIFNNMHYNLPPWSISILPDCRNIVFNTAKVGVQTSQMQMLPANSQSLMWETYDEDVASL  443

Query  1657  DDNTF-TATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
              DN+  T  GLLEQIN TRDASDYLWY+T V + P E FL+GG++P LTV SAGHALHVF
Sbjct  444   GDNSLITIAGLLEQINVTRDASDYLWYITSVDVSPAEGFLRGGQFPVLTVQSAGHALHVF  503

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G++YG+ +N ++T++  V L AG N+I+LLS+AVGLPN G H+E WN GVLGPV
Sbjct  504   VNGQLSGSAYGNRKNRRITYTGNVNLHAGSNRIALLSVAVGLPNAGVHYELWNTGVLGPV  563

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
              L G++EGKRDLTWQKWSY++GLKGE ++L+SL G+SSVEW++ S ++Q+ QPLTWY+  
Sbjct  564   VLHGVDEGKRDLTWQKWSYQVGLKGEAMNLNSLEGTSSVEWIKESLVSQRQQPLTWYRAY  623

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAPAG++PL LDM +MGKGQ WINGQS+GRYW    A  G C  CNYAG +   KC + 
Sbjct  624   FDAPAGHDPLGLDMGSMGKGQAWINGQSIGRYWT-LLAPNGDCKGCNYAGTYRIPKCQTG  682

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +Q WYHVPRSWL+PT NLLV FEE GG+   +SLVK+ V+SVCAD+ EW P + +W
Sbjct  683   CGQPTQLWYHVPRSWLQPTKNLLVVFEELGGDATKISLVKKSVSSVCADVSEWHPTIKSW  742

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
              +Q+ G+     +PK HL C +GQ I++IKFASFGTP G+CG+F +G CH+ +S+   +K
Sbjct  743   HIQSYGQPEEYHKPKVHLRCASGQLISAIKFASFGTPLGTCGNFQQGACHSPNSHTTLEK  802

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              C+G   C V ++   FGGDPCP VMK+++VE VCS
Sbjct  803   KCVGQQRCAVTISTNNFGGDPCPDVMKRVAVEAVCS  838



>gb|AAQ21369.1| beta-galactosidase [Sandersonia aurantiaca]
Length=826

 Score =  1150 bits (2974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/813 (70%), Positives = 670/813 (82%), Gaps = 12/813 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V YD  +  INGQR+IL+SGSIHYPRSTPEMWPDL++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  25    NVWYDSRAITINGQRRILMSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  84

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PGKYYFEG YDLV+FIKL QQ GLY+HLR+GPY CAEWNFGGFPVWLKYVPG+ FRTDN 
Sbjct  85    PGKYYFEGNYDLVRFIKLVQQGGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGIHFRTDNE  144

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKA M+KFT+ IVNMMK+++L+  QGGPIILSQIENE+GP+EY+ GAP K+YA WAAKM
Sbjct  145   PFKAEMEKFTSHIVNMMKAEKLFHWQGGPIILSQIENEFGPLEYDQGAPAKAYAAWAAKM  204

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AV L TGVPWVMCK+DDAPDPV+N  NGFY D F PNK YKP MWTE WT WFT +G PV
Sbjct  205   AVDLETGVPWVMCKEDDAPDPVINTWNGFYADGFYPNKRYKPMMWTENWTGWFTGYGVPV  264

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
             P+RP EDLA++VAKF+ KGGS++NYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+G+LR
Sbjct  265   PHRPVEDLAFSVAKFVQKGGSYVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGMLR  324

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHL DLH+AIKLCEPALVSG P V SLGN QE+ VF+S SGACAAFLAN +   +A
Sbjct  325   QPKYGHLTDLHKAIKLCEPALVSGYPVVTSLGNNQESNVFRSNSGACAAFLANYDTKYYA  384

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSY  1658
              V F  M YNLPPWSISILPDCK TV+NTARVGAQ+++M+MT V  GFSW SYNE+ +S 
Sbjct  385   TVTFNGMRYNLPPWSISILPDCKTTVFNTARVGAQTTQMQMTTVG-GFSWVSYNEDPNSI  443

Query  1657  DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFI  1478
             DD +FT  GL+EQI+ TRD++DYLWY T V ID  E FLK G++P LT  SAGH+LHVFI
Sbjct  444   DDGSFTKLGLVEQISMTRDSTDYLWYTTYVNIDQNEQFLKNGQYPVLTAQSAGHSLHVFI  503

Query  1477  NGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVS  1298
             NGQL+GT+YGS+E+P++T++  V L AG NKIS LSIAVGLPNVG HFETWN G+LGPV+
Sbjct  504   NGQLIGTAYGSVEDPRLTYTGNVKLFAGSNKISFLSIAVGLPNVGEHFETWNTGLLGPVT  563

Query  1297  LSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFD  1118
             L+GLNEGKRDLTWQKW+YKIGLKGE LSLH+LSGSS+VEW +    ++KQPL WYK  F+
Sbjct  564   LNGLNEGKRDLTWQKWTYKIGLKGEALSLHTLSGSSNVEWGDA---SRKQPLAWYKGFFN  620

Query  1117  APAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCG  938
             AP G+EPLALDM+TMGKGQ+WINGQS+GRYWP YKA  G+C  C+Y G ++E KC S CG
Sbjct  621   APGGSEPLALDMSTMGKGQVWINGQSIGRYWPAYKAR-GSCPKCDYEGTYEETKCQSNCG  679

Query  937   EASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEM  758
             ++SQRWYHVPRSWL PTGNL+V FEEWGG P G+SLVKR + S CA + + QP + NW  
Sbjct  680   DSSQRWYHVPRSWLNPTGNLIVVFEEWGGEPTGISLVKRSMRSACAYVSQGQPSMNNWH-  738

Query  757   QASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYC  578
                   T+    K HLSC  G K+T IKFAS+GTP+G+C S+SEG CHA  SYDIFQK C
Sbjct  739   ------TKYAESKVHLSCDPGLKMTQIKFASYGTPQGACESYSEGRCHAHKSYDIFQKNC  792

Query  577   IGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             IG   C+V V PE FGGDPCP +MK ++V+  C
Sbjct  793   IGQQVCSVTVVPEVFGGDPCPGIMKSVAVQASC  825



>ref|XP_009418405.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =  1148 bits (2970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/816 (66%), Positives = 657/816 (81%), Gaps = 4/816 (0%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + IINGQR+IL+SGSIHYPRSTPEMW  L++KAK+  LDV+QTYVFWNGHEP P
Sbjct  26    VTYDRKAIIINGQRRILISGSIHYPRSTPEMWEGLIQKAKDAHLDVIQTYVFWNGHEPSP  85

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             G Y FEGRYDLVKFIK  Q  GLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  86    GTYDFEGRYDLVKFIKTVQNLGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  145

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AMQ FT  IV M+KS+ L+ SQGGPIILSQIENEYGP+    G PG+SY  WAA+MA
Sbjct  146   FKMAMQGFTQKIVQMLKSESLFASQGGPIILSQIENEYGPVSRASGPPGRSYLNWAAEMA  205

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             VGL TGVPWVMCK+DDAPDPV+N CNGFYCD F+PN  YKP MWTEAW+ WFTEFG P+ 
Sbjct  206   VGLETGVPWVMCKEDDAPDPVINTCNGFYCDTFTPNMPYKPIMWTEAWSGWFTEFGSPIH  265

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
             +RP EDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+RE
Sbjct  266   HRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIRE  325

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LHRAIKLCE ALVS DP V SLG+ Q+A VF S++G CAAFLAN N  SFA+
Sbjct  326   PKYGHLKELHRAIKLCEQALVSADPTVTSLGSLQQAHVFSSQTGGCAAFLANYNPDSFAR  385

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSSY  1658
             V F N+HYN+PPWSISILPDC N V+NTA+VG Q+S+M+M P  ++   W+ Y+E  +S 
Sbjct  386   VMFNNVHYNIPPWSISILPDCSNVVFNTAKVGVQTSQMQMYPANTQSLMWERYDEVVASL  445

Query  1657  DDNTF-TATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             +DN+  T TGLLEQIN TRD SDYLWY++ V + P E FL GG+ P LTV SAGHALH+F
Sbjct  446   EDNSLITTTGLLEQINVTRDTSDYLWYISSVDVSPAEGFLHGGQLPVLTVQSAGHALHIF  505

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G++YGS E+ ++ FS  V +RAG NKI++LS+AVGLPN G H+E W+ GVLGPV
Sbjct  506   LNGQLSGSAYGSREDRRIKFSGNVNIRAGTNKIAILSVAVGLPNAGVHYEFWSTGVLGPV  565

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYKTT  1124
              L GL+EG RDLTWQKWSY++GLKGE ++L+SL G+SSVEW++GS   Q +QPLTWY+  
Sbjct  566   VLHGLDEGSRDLTWQKWSYQVGLKGEAMNLNSLEGASSVEWMQGSLAVQDQQPLTWYRAY  625

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GN+PLALDM +MGKGQ+WINGQS+GRYW  Y A  G C +C+Y G +   KC S 
Sbjct  626   FDAPDGNDPLALDMGSMGKGQVWINGQSIGRYWTAY-APNGDCNSCSYIGTYRSPKCQSN  684

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +QRWYHVPRSWL+PT NLLV FEE GG+   +S++KR V+SVCAD+ EW P + NW
Sbjct  685   CGQPTQRWYHVPRSWLQPTRNLLVIFEEVGGDATKISMMKRSVSSVCADVSEWHPTIKNW  744

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++++ G+     +PK HL C  GQ I++IKFAS+GTP G+CG+F +G CH+ +SY I +K
Sbjct  745   DIESDGQPEEYHKPKVHLRCAPGQSISAIKFASYGTPLGTCGNFQQGACHSPNSYTILEK  804

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CIG   C V ++   FGGDPCP+VMK+++VE +CS
Sbjct  805   NCIGQERCAVVISTTNFGGDPCPNVMKRVAVEAICS  840



>ref|XP_010029731.1| PREDICTED: beta-galactosidase 3 [Eucalyptus grandis]
 gb|KCW56689.1| hypothetical protein EUGRSUZ_I02384 [Eucalyptus grandis]
Length=849

 Score =  1144 bits (2958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/821 (66%), Positives = 659/821 (80%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   SVSYD+ + +I+GQR+IL SGSIHYPRSTP+MW DL++KAK+GGLDVV+TYVFWN 
Sbjct  25    LIQCSVSYDRKALVIDGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGLDVVETYVFWNV  84

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+FIK  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  85    HEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  144

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AM+ FT  IVN+MKS+ L+ESQGGPIIL+QIENEYG     LGA G +Y  W
Sbjct  145   TDNEPFKRAMEGFTKKIVNLMKSENLFESQGGPIILNQIENEYGAESKLLGAAGHNYVTW  204

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MAV LGTGVPWVMCK++DAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WFTEF
Sbjct  205   AADMAVKLGTGVPWVMCKEEDAPDPVINTCNGFYCDAFTPNKDYKPTIWTEAWSGWFTEF  264

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GG    RP +DLA+A+A+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+
Sbjct  265   GGTHHERPVQDLAFAIARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEY  324

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHRA+K+CE ALVS DP V SLG YQ+A V+ ++SG C+AFLAN + 
Sbjct  325   GLIRQPKYGHLKELHRAVKMCERALVSADPMVTSLGAYQQAHVYTTESGDCSAFLANYDT  384

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S  +V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M PV S   SW+SY+E
Sbjct  385   KSSTRVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMEMLPVNSEMLSWESYDE  444

Query  1672  ETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + SS DD +TFT  GLLEQIN TRD SDYLWY+T V I   E+FL+GG+ P L V S GH
Sbjct  445   DISSLDDSSTFTTYGLLEQINVTRDTSDYLWYITSVGIGSSESFLQGGELPTLIVQSTGH  504

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+HVFINGQL G+++G+ +N + T+S  V LRAG N+I+LLS+AVGLPNVG H+ETWN G
Sbjct  505   AVHVFINGQLSGSAFGTRQNRRFTYSGKVNLRAGTNRIALLSVAVGLPNVGGHYETWNTG  564

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             +LGPV+L GL++GK DL+WQKW+Y++GLKGE ++L+S +  SSV+W++ S IAQ+ QPLT
Sbjct  565   ILGPVALHGLDQGKWDLSWQKWTYQVGLKGEAMNLNSPNSISSVDWMDASLIAQRQQPLT  624

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+K  F+AP G+EPLA+DM+ MGKGQIWINGQS+GRYW  Y    G C  CNYAG F   
Sbjct  625   WHKAYFNAPKGDEPLAIDMSGMGKGQIWINGQSIGRYWTAYAT--GDCNGCNYAGTFRPP  682

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG+ +QRWYHVPRSWL+PT NLLV FEE GGNP  +SLVKR + SVCAD+ E+ P
Sbjct  683   KCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKRSMTSVCADVTEFHP  742

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              L NW +++ GK+     PK HL C  GQ I+SIKFASFGTP G+CGS+ +G CHA  SY
Sbjct  743   TLKNWHIESYGKSEEFHNPKVHLRCSPGQSISSIKFASFGTPLGTCGSYQQGACHAQSSY  802

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             DI +K CIG   C+V ++   FG DPCP+V+K+LSVE VC+
Sbjct  803   DILEKKCIGKERCSVTISNSNFGRDPCPNVLKRLSVEAVCT  843



>ref|XP_002306893.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE93889.1| beta-galactosidase family protein [Populus trichocarpa]
Length=853

 Score =  1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/817 (66%), Positives = 652/817 (80%), Gaps = 5/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YDK + II+GQR+IL+SGSIHYPRSTP+MW DL++KAK+GGLDV+ TYVFWN HEP 
Sbjct  27    TVTYDKKAIIIDGQRRILISGSIHYPRSTPDMWEDLVQKAKDGGLDVIDTYVFWNVHEPS  86

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGR+DLV+FIK  Q+ GLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDNG
Sbjct  87    PGNYNFEGRFDLVRFIKTVQKGGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNG  146

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKAAMQ FT  IV MMK +RL++SQGGPII SQIENEYGP     GA G SY  WAA+M
Sbjct  147   PFKAAMQGFTQKIVQMMKDERLFQSQGGPIIFSQIENEYGPESRAFGAAGHSYINWAAQM  206

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCK+DDAPDPV+N CNGFYCD FSPNK YKP MWTEAW+ WFTEFGG  
Sbjct  207   AVGLKTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYKPTMWTEAWSGWFTEFGGAF  266

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
              +RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+GL+R
Sbjct  267   HHRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEYGLIR  326

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             EPK+GHLK+LHRAIKLCE  LVS DP +  LG YQ+A VF S   +C+AFLAN +  S A
Sbjct  327   EPKYGHLKELHRAIKLCEHELVSSDPTITLLGTYQQAHVFSSGKRSCSAFLANYHTQSAA  386

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSS  1661
             +V F NMHY LPPWSISILPDC+N V+NTA+VG Q+S ++M P  SR FSW+SY+E+ SS
Sbjct  387   RVMFNNMHYVLPPWSISILPDCRNVVFNTAKVGVQTSHVQMLPTGSRFFSWESYDEDISS  446

Query  1660  YDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
                ++  TA GL+EQIN TRD +DYLWY+T V I+P E+FL+GG+WP LTV SAGHALHV
Sbjct  447   LGASSRMTALGLMEQINVTRDTTDYLWYITSVNINPSESFLRGGQWPTLTVESAGHALHV  506

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQ  G+++G+ EN + TF+  V LRAG N+I+LLSIAVGLPNVG H+ETW  G+LGP
Sbjct  507   FINGQFSGSAFGTRENREFTFTGPVNLRAGTNRIALLSIAVGLPNVGVHYETWKTGILGP  566

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V L GLN+G +DLTWQ+WSY++GLKGE ++L S + +SSV+W++GS   ++QPL WYK  
Sbjct  567   VMLHGLNQGNKDLTWQQWSYQVGLKGEAMNLVSPNRASSVDWIQGSLATRQQPLKWYKAY  626

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GNEPLALDM +MGKGQ+WINGQS+GRYW  Y  + G C +C Y+G F   KC   
Sbjct  627   FDAPGGNEPLALDMRSMGKGQVWINGQSIGRYWLSY--AKGDCSSCGYSGTFRPPKCQLG  684

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +QRWYHVPRSWL+P  NLLV FEE GG+   +SLVKR   SVCAD +E  P + N+
Sbjct  685   CGQPTQRWYHVPRSWLKPKQNLLVIFEELGGDASKISLVKRSTTSVCADAFEHHPTIENY  744

Query  763   EMQASGKATRPL-RPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
               +++G++ R L + K HL C  GQ I++I FASFGTP G+CGSF EGTCHA +S+ + +
Sbjct  745   NTESNGESERNLHQAKVHLRCAPGQSISAINFASFGTPTGTCGSFQEGTCHAPNSHSVVE  804

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K CIG  SC V ++   FG DPCPS +KKLSVE VCS
Sbjct  805   KKCIGRESCMVAISNSNFGADPCPSKLKKLSVEAVCS  841



>ref|XP_004509327.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=851

 Score =  1141 bits (2951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/820 (66%), Positives = 658/820 (80%), Gaps = 7/820 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ++V+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL++KAKEGGLDV++TYVFWN HEP
Sbjct  26    STVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIQKAKEGGLDVIETYVFWNVHEP  85

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG + FEGRYDLVKFIK  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  86    SPGNFNFEGRYDLVKFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  145

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ FT  IV MMKS+ L+ESQGGPIILSQIENEYG      GA G++Y  WAAK
Sbjct  146   EPFKRAMQGFTEKIVGMMKSEHLFESQGGPIILSQIENEYGAQSKLQGAAGQNYMNWAAK  205

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAV +GTGVPWVMCK+DDAPDPV+N CNGFYCD F+PN+ YKP MWTEAW+ WFTEFGGP
Sbjct  206   MAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNRPYKPTMWTEAWSGWFTEFGGP  265

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             +  RP +DLA+AVA+F+ +GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL+
Sbjct  266   IHKRPVQDLAFAVARFVTRGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLI  325

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LHRAIK+CE ALVS DP V SLG+ Q+A V+ ++SG CAAFL+N +  S 
Sbjct  326   RQPKYGHLKELHRAIKMCERALVSTDPIVTSLGSSQQAHVYSTESGDCAAFLSNYDSKSA  385

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTAR--VGAQSSRMKMTPV-SRGFSWQSYNEE  1670
             A+V F NMHYNLPPWS+SILPDC+N V+NTA+  VG Q+S+M+M P  ++ FSW+S++E+
Sbjct  386   ARVLFNNMHYNLPPWSVSILPDCRNAVFNTAKVCVGVQTSQMQMLPTNTQMFSWESFDED  445

Query  1669  TSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHA  1493
             TSS DD +T TA GLLEQIN TRDASDYLWY+T V I   E+FL GG+ P L V S GHA
Sbjct  446   TSSLDDSSTLTAPGLLEQINVTRDASDYLWYITSVDISSSESFLHGGELPTLIVQSTGHA  505

Query  1492  LHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGV  1313
             +HVFINGQL G++YGS E  +      V LRAG N+I+LLS+A+GLPNVG HFETWN G+
Sbjct  506   VHVFINGQLSGSTYGSREYRRFMHIGKVNLRAGTNRIALLSVAIGLPNVGEHFETWNTGI  565

Query  1312  LGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTW  1136
             LGPV+L GL++GKRDL+ QKW+Y++GLKGE ++L S +  SSVEW++ + + Q+ QPLTW
Sbjct  566   LGPVALHGLDQGKRDLSQQKWTYQVGLKGEAMNLASPNSISSVEWMQSAIVVQRNQPLTW  625

Query  1135  YKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKK  956
             +KT FDAP G+EPLALDM  MGKGQIWINGQS+GRYW  +  + G C  CNYAG F  +K
Sbjct  626   HKTNFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAF--ANGNCNDCNYAGSFRPQK  683

Query  955   CLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQ  776
             C   CG+ +QRWYHVPRSWL+PT NLLV FEE GGNP  +SLVKR V+SVCAD+ E+ P 
Sbjct  684   CQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKRSVSSVCADVSEYHPN  743

Query  775   LMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYD  596
             + NW + + GK+     PK HL C  GQ I+SIKFASFGTP G+CG++ +G CH+  SY 
Sbjct  744   IKNWHIDSYGKSEEFHAPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEQGACHSPTSYA  803

Query  595   IFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             I +K C+G   C V V+   FG DPCP VMK+LSVE VC+
Sbjct  804   ILEKKCLGKPRCVVTVSNSNFGQDPCPRVMKRLSVEAVCA  843



>ref|XP_009418404.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=860

 Score =  1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/829 (65%), Positives = 657/829 (79%), Gaps = 17/829 (2%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + IINGQR+IL+SGSIHYPRSTPEMW  L++KAK+  LDV+QTYVFWNGHEP P
Sbjct  26    VTYDRKAIIINGQRRILISGSIHYPRSTPEMWEGLIQKAKDAHLDVIQTYVFWNGHEPSP  85

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             G Y FEGRYDLVKFIK  Q  GLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  86    GTYDFEGRYDLVKFIKTVQNLGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  145

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AMQ FT  IV M+KS+ L+ SQGGPIILSQIENEYGP+    G PG+SY  WAA+MA
Sbjct  146   FKMAMQGFTQKIVQMLKSESLFASQGGPIILSQIENEYGPVSRASGPPGRSYLNWAAEMA  205

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             VGL TGVPWVMCK+DDAPDPV+N CNGFYCD F+PN  YKP MWTEAW+ WFTEFG P+ 
Sbjct  206   VGLETGVPWVMCKEDDAPDPVINTCNGFYCDTFTPNMPYKPIMWTEAWSGWFTEFGSPIH  265

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF-----  2030
             +RP EDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+     
Sbjct  266   HRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGICIV  325

Query  2029  --------GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACA  1874
                     GL+REPK+GHLK+LHRAIKLCE ALVS DP V SLG+ Q+A VF S++G CA
Sbjct  326   QLFCHQMAGLIREPKYGHLKELHRAIKLCEQALVSADPTVTSLGSLQQAHVFSSQTGGCA  385

Query  1873  AFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRG  1697
             AFLAN N  SFA+V F N+HYN+PPWSISILPDC N V+NTA+VG Q+S+M+M P  ++ 
Sbjct  386   AFLANYNPDSFARVMFNNVHYNIPPWSISILPDCSNVVFNTAKVGVQTSQMQMYPANTQS  445

Query  1696  FSWQSYNEETSSYDDNTF-TATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPW  1520
               W+ Y+E  +S +DN+  T TGLLEQIN TRD SDYLWY++ V + P E FL GG+ P 
Sbjct  446   LMWERYDEVVASLEDNSLITTTGLLEQINVTRDTSDYLWYISSVDVSPAEGFLHGGQLPV  505

Query  1519  LTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGP  1340
             LTV SAGHALH+F+NGQL G++YGS E+ ++ FS  V +RAG NKI++LS+AVGLPN G 
Sbjct  506   LTVQSAGHALHIFLNGQLSGSAYGSREDRRIKFSGNVNIRAGTNKIAILSVAVGLPNAGV  565

Query  1339  HFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFI  1160
             H+E W+ GVLGPV L GL+EG RDLTWQKWSY++GLKGE ++L+SL G+SSVEW++GS  
Sbjct  566   HYEFWSTGVLGPVVLHGLDEGSRDLTWQKWSYQVGLKGEAMNLNSLEGASSVEWMQGSLA  625

Query  1159  AQ-KQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACN  983
              Q +QPLTWY+  FDAP GN+PLALDM +MGKGQ+WINGQS+GRYW  Y A  G C +C+
Sbjct  626   VQDQQPLTWYRAYFDAPDGNDPLALDMGSMGKGQVWINGQSIGRYWTAY-APNGDCNSCS  684

Query  982   YAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVC  803
             Y G +   KC S CG+ +QRWYHVPRSWL+PT NLLV FEE GG+   +S++KR V+SVC
Sbjct  685   YIGTYRSPKCQSNCGQPTQRWYHVPRSWLQPTRNLLVIFEEVGGDATKISMMKRSVSSVC  744

Query  802   ADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEG  623
             AD+ EW P + NW++++ G+     +PK HL C  GQ I++IKFAS+GTP G+CG+F +G
Sbjct  745   ADVSEWHPTIKNWDIESDGQPEEYHKPKVHLRCAPGQSISAIKFASYGTPLGTCGNFQQG  804

Query  622   TCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CH+ +SY I +K CIG   C V ++   FGGDPCP+VMK+++VE +CS
Sbjct  805   ACHSPNSYTILEKNCIGQERCAVVISTTNFGGDPCPNVMKRVAVEAICS  853



>emb|CDP01954.1| unnamed protein product [Coffea canephora]
Length=851

 Score =  1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/818 (66%), Positives = 657/818 (80%), Gaps = 5/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             +SVSYD+ + +IN QR+IL+SGSIHYPRSTPEMW DL+ KAK+GGLDV++TYVFWN HEP
Sbjct  26    SSVSYDRKAVVINEQRRILISGSIHYPRSTPEMWEDLINKAKDGGLDVIETYVFWNVHEP  85

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEGRYDLV+FIK  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  86    SPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  145

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK  MQ+FT  IV +MKS+ L+ESQGGPIILSQIENEYGP    LGAP   Y  WAA 
Sbjct  146   EPFKMYMQRFTEKIVRLMKSENLFESQGGPIILSQIENEYGPQVKVLGAPAHQYMTWAAN  205

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPWVMCK++DAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WFTEFGGP
Sbjct  206   MAVGLNTGVPWVMCKEEDAPDPVINTCNGFYCDSFTPNKPYKPTIWTEAWSGWFTEFGGP  265

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             V  RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGR+AGGPFIATSYDYDAP+DE+GL+
Sbjct  266   VHQRPVQDLAFAVARFIQKGGSFLNYYMYHGGTNFGRSAGGPFIATSYDYDAPLDEYGLI  325

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LHRAIKL E ALVS DP V SLGN Q+A VF S++G CAAFLAN + +S 
Sbjct  326   RQPKYGHLKELHRAIKLSERALVSADPTVTSLGNLQQAHVFSSEAGDCAAFLANYDTNSA  385

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F NMHY+LPPWSISILPDC+N V+NTA+VG Q+S M+M P  S  FSW+++NE+ +
Sbjct  386   ARVMFNNMHYSLPPWSISILPDCRNVVFNTAKVGVQTSHMEMQPSNSEMFSWETFNEDLT  445

Query  1663  SYDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S DD+ TFTA GLLEQIN TRD +DYLWY+T V I   E+FL+GG+ P L V S GH LH
Sbjct  446   SSDDSLTFTAPGLLEQINVTRDTTDYLWYITSVNIGSSESFLRGGELPTLIVESTGHTLH  505

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQ  G+++G+ EN + TF + V L AG NKI+LLS+AVGLPNVG HFETWN G+LG
Sbjct  506   VFINGQPSGSAFGTRENRRFTFKEKVNLHAGTNKIALLSVAVGLPNVGGHFETWNTGILG  565

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYK  1130
             PV+L GL++GK DL+W KW+Y++GLKGE ++L S +G SSVEW++GS IAQK QPLTW+K
Sbjct  566   PVALHGLDQGKWDLSWAKWTYQVGLKGESMNLVSPTGISSVEWMQGSLIAQKQQPLTWHK  625

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               F+AP G+EPLALDM++MGKGQ+WINGQS+GRYW  Y    G C  C+Y G F   KC 
Sbjct  626   AYFNAPDGDEPLALDMSSMGKGQVWINGQSLGRYWTAYAT--GNCNECSYTGTFRPPKCQ  683

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CG+ +QRWYHVPRSWL+PT NL+V FEE GG+P  +SLVKR V+SVCADI E+ P + 
Sbjct  684   LGCGQPTQRWYHVPRSWLKPTQNLVVLFEELGGDPTRISLVKRTVSSVCADITEYHPTIK  743

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW +++ G++    +PK HL C  GQ I+SIKFASFGT  G+CGSF +GTCHA  SY   
Sbjct  744   NWHIESYGRSEEFHKPKVHLHCAPGQSISSIKFASFGTAMGTCGSFQQGTCHAPTSYTTM  803

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             ++ C+G   C+V ++   FG DPCP V+K+LSVE +CS
Sbjct  804   ERRCLGRQRCSVTISNSNFGQDPCPKVLKRLSVEAICS  841



>ref|XP_004287850.1| PREDICTED: beta-galactosidase 3-like [Fragaria vesca subsp. vesca]
Length=853

 Score =  1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/821 (65%), Positives = 662/821 (81%), Gaps = 6/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   +V+YD+ + +INGQR+IL+SGSIHYPRSTPEMW DL++KAK+GGLDVV+TYVFWNG
Sbjct  23    LVQCTVTYDRKAIVINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVVETYVFWNG  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HEPSPGNYNFEGRYDLVRFLKTVQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AMQ FT  IV +MKS++L+ESQGGPIILSQIENEYG      GA G +Y  W
Sbjct  143   TDNEPFKRAMQGFTEKIVGLMKSEKLFESQGGPIILSQIENEYGVQSKLFGAAGHNYMTW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA+MAVGLGTGVPWVMCK++DAPDPV+N CNGFYCD FSPNK YKP +WTEAW+ WFTEF
Sbjct  203   AAEMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDSFSPNKPYKPTIWTEAWSGWFTEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP +DLAYAVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+
Sbjct  263   GGPIHQRPVQDLAYAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LH+AIK+CE ALVS DP + SLG++Q+A V+ S+SG CAAFL+N+N 
Sbjct  323   GLIRQPKYGHLKELHKAIKMCERALVSADPIITSLGDFQQAHVYTSESGDCAAFLSNHNS  382

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVS-RGFSWQSYNE  1673
              S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P +     W++Y+E
Sbjct  383   KSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPTNVETLLWETYDE  442

Query  1672  ETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + +S DD +T TA+GLLEQIN TRD +DYLWY+T V I   E+FL GG+ P L V S GH
Sbjct  443   DLTSLDDSSTMTASGLLEQINVTRDTTDYLWYITSVDIGSSESFLHGGELPTLIVQSTGH  502

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             ALH+FINGQL G+++G+ E+ + T++  V LRAG NKI+LLS+AVGLPNVG HFE +N G
Sbjct  503   ALHIFINGQLSGSAFGTRESRRFTYTGKVNLRAGTNKIALLSVAVGLPNVGGHFEAYNTG  562

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             +LGPV+L GLN+GK DL+WQKW+Y++GLKGE ++L S    SSV+W++ S +AQK QPLT
Sbjct  563   ILGPVALHGLNQGKWDLSWQKWTYQVGLKGEAMNLVSPDSISSVDWLQASLVAQKQQPLT  622

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+K+ FDAP G+EPLALDM  MGKGQIWINGQSVGRYW  +  + G C  C+YAG F   
Sbjct  623   WHKSIFDAPEGDEPLALDMEGMGKGQIWINGQSVGRYWTAF--ANGDCNGCSYAGGFKPT  680

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC + CG+ +QR+YHVPRSWL+PT NLLV FEE GG+P  VS+VKR V++VCA++ E+ P
Sbjct  681   KCQTGCGQPTQRYYHVPRSWLKPTQNLLVIFEELGGDPSRVSIVKRSVSTVCAEVAEYHP  740

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW +++ GK      PK HL C  GQ I+SIKFASFGTP G+CG++ +G+CHA  SY
Sbjct  741   TIKNWHIESYGKVQDFHSPKVHLRCNPGQSISSIKFASFGTPFGTCGTYQQGSCHASTSY  800

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + +K CIG   C V ++   F GDPCP V+K+LSVE VC+
Sbjct  801   SVIEKKCIGKQRCAVTISNTNF-GDPCPKVLKRLSVEAVCA  840



>ref|XP_011083609.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=845

 Score =  1138 bits (2943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/821 (66%), Positives = 647/821 (79%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L + SV+YD  + IINGQR+ILLSGSIHYPRSTP+MW DL+ KAK  GLDV+ TYVFWN 
Sbjct  23    LISGSVTYDNKAVIINGQRRILLSGSIHYPRSTPDMWEDLILKAKNAGLDVIDTYVFWNV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+F+K  Q+ GLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HEPSPGNYNFEGRYDLVRFVKTVQKLGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFKAAMQ+FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LG  G++Y  W
Sbjct  143   TDNEPFKAAMQQFTQKIVGVMKSENLFESQGGPIILSQIENEYGAQRRALGPAGEAYMNW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AAKMAV L TGVPWVMCK D+APDPV+NACNGFYCD FSPNK YKP MWTEAW+ WFTEF
Sbjct  203   AAKMAVALDTGVPWVMCKDDEAPDPVINACNGFYCDSFSPNKPYKPTMWTEAWSGWFTEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP +DLA+AVA+FI KGGSFINYYMFHGGTNFGRTAGGPF+ TSYDYDAP+DE+
Sbjct  263   GGPILQRPVQDLAFAVARFIQKGGSFINYYMFHGGTNFGRTAGGPFVTTSYDYDAPVDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+REPK+GHLK+LH+AIKLCE ALVS DP V SLG+ QEA VF S  G+CAAFLAN N 
Sbjct  323   GLIREPKYGHLKELHKAIKLCEHALVSSDPTVTSLGSSQEAHVFSSGDGSCAAFLANFNS  382

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F N HYNLPPWSISILPDCKN V+NTA+VG Q+S+ +M P  S+  SW++Y E
Sbjct  383   TSAARVLFNNKHYNLPPWSISILPDCKNVVFNTAKVGTQTSQFQMLPSDSQLHSWETYGE  442

Query  1672  ETSSYDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + +S DD+ TF A GLLEQIN TRD+SDYLWY+T + I   E+FL+GG+ P LTV S GH
Sbjct  443   DMTSLDDSTTFAAIGLLEQINVTRDSSDYLWYITSIDIGSSESFLRGGQKPTLTVNSRGH  502

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             ALHVFINGQL G++YG+ EN + TF+  V L+ G NKISLLSIA+GLPN G HFE WN G
Sbjct  503   ALHVFINGQLAGSAYGTRENTRFTFTGPVSLQVGTNKISLLSIAMGLPNNGVHFENWNVG  562

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLT  1139
             VLG V L+GL++GKRDL+ Q WSYK+GLKGE ++L S    SSVEW + S I Q +QPL 
Sbjct  563   VLGRVELAGLDQGKRDLSRQTWSYKVGLKGEQMNLVSPDKVSSVEWAQVSAITQNQQPLR  622

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             WYK  FDAP+G+EPLALDM +MGKGQ+WINGQ++GRYW  Y  S G CG C+YAG F   
Sbjct  623   WYKAYFDAPSGDEPLALDMRSMGKGQVWINGQNIGRYWMAY--SNGNCGVCHYAGTFRAT  680

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG+ +QRWYHVPRSWL+PT NL+V FEE GG+   +SLVKR  A VCA+ +E +P
Sbjct  681   KCQRSCGQPTQRWYHVPRSWLQPTQNLIVLFEELGGDASKISLVKRTTAGVCANAFEHRP  740

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + N+++Q++  +    + K HLSC  GQ I++I FASFGTP G+CGSF  G CHA +S+
Sbjct  741   SVANYQIQSTSASKMLHQAKIHLSCSPGQSISAITFASFGTPTGTCGSFRLGNCHAQNSH  800

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + +K C+G  SC + V+   FG DPCP V+KKLSVE +CS
Sbjct  801   SVVEKMCVGMESCKLAVSNSYFGADPCPRVLKKLSVEAICS  841



>ref|XP_004512085.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=847

 Score =  1137 bits (2942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/820 (66%), Positives = 652/820 (80%), Gaps = 7/820 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             + V+YD+ + IINGQR+IL SGSIHYPRSTP+MW DL++KAKEGGLDV++TYVFWN HEP
Sbjct  24    SDVTYDRKAIIINGQRRILFSGSIHYPRSTPDMWEDLIQKAKEGGLDVIETYVFWNVHEP  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEGR DLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  84    SPGNYNFEGRNDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ FT  IV MMKS+ LYESQGGPIILSQIENEYG      GA G +Y  WAAK
Sbjct  144   EPFKKAMQGFTEKIVGMMKSEHLYESQGGPIILSQIENEYGAQSKLFGAVGYNYMNWAAK  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAV +GTGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP MWTEAW+ WF+EFGGP
Sbjct  204   MAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNKPYKPTMWTEAWSGWFSEFGGP  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             +  RP +DLA+AV +FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+
Sbjct  264   IHQRPVQDLAFAVGRFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLI  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LH+AIK+CE ALVS DP V SLGN+Q+A V+ ++SG CAAFLAN +  S 
Sbjct  324   RQPKYGHLKELHKAIKMCERALVSSDPVVTSLGNFQQASVYSTESGDCAAFLANYDSKSS  383

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  ++ FSW+S+NE+TS
Sbjct  384   ARVMFNNMHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMQMLPTNTQMFSWESFNEDTS  443

Query  1663  SYD---DNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHA  1493
             S D     T TA+GLLEQIN TRD SDYLWY+T V +   E+FL+GGK P + V S GHA
Sbjct  444   SLDYSSSTTITASGLLEQINVTRDTSDYLWYITSVDVGSSESFLRGGKLPSIIVQSTGHA  503

Query  1492  LHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGV  1313
             +HVFINGQL G+ YG+ E+ +  ++  V LRAG N I+LLS+AVGLPNVG HFETWN G+
Sbjct  504   VHVFINGQLSGSGYGTREDRRFRYTGIVNLRAGTNTIALLSVAVGLPNVGGHFETWNTGI  563

Query  1312  LGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTW  1136
             LGPV L GL++GK D++WQKW+Y++GLKGE ++L S  G SSVEW++ + + QK QPLTW
Sbjct  564   LGPVVLHGLDQGKLDMSWQKWTYQVGLKGEAMNLASPYGISSVEWMQSALVVQKNQPLTW  623

Query  1135  YKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKK  956
             +KT FDAP G EPLALDM+ MGKGQIWING S+GRYW    ++ G+C  C+YAG F   K
Sbjct  624   HKTFFDAPEGEEPLALDMDGMGKGQIWINGVSIGRYWTA--SATGSCNGCSYAGSFRPPK  681

Query  955   CLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQ  776
             C   CGE +QRWYHVPRSWL+P  NLLV FEE GG+P  +SLVKR V+SVCAD+ E+ P 
Sbjct  682   CQLGCGEPTQRWYHVPRSWLKPNHNLLVVFEELGGDPSKISLVKRSVSSVCADVSEYHPN  741

Query  775   LMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYD  596
             + NW + + GK+     PK HL C  GQ I+SIKFASFGTP G+CG++ +G CH+  SY 
Sbjct  742   IKNWHIDSYGKSEEFHPPKVHLHCNPGQAISSIKFASFGTPLGTCGNYEQGACHSSASYA  801

Query  595   IFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             I +K CIG   C V V+   FG DPCP+V+K+LSVE VC+
Sbjct  802   ILEKKCIGKQRCIVTVSNSNFGQDPCPNVLKRLSVEAVCA  841



>ref|XP_008440778.1| PREDICTED: beta-galactosidase 3 [Cucumis melo]
Length=854

 Score =  1137 bits (2940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/823 (67%), Positives = 653/823 (79%), Gaps = 5/823 (1%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
             V     SV+YD+ + +INGQR++L SGSIHYPRSTPEMW  L++KAKEGGLDVV+TYVFW
Sbjct  22    VQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEGGLDVVETYVFW  81

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             N HEP PG Y FEGRYDLV+FIK  Q+AGLY +LR+GPY CAEWNFGGFPVWLKYVPG+S
Sbjct  82    NVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGFPVWLKYVPGIS  141

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDN PFK AMQ FT  IV +MKS+ L+ESQGGPIILSQIENEYG      GA G++Y 
Sbjct  142   FRTDNEPFKRAMQGFTEKIVGLMKSENLFESQGGPIILSQIENEYGVQSKLFGAAGQNYM  201

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAAKMAVGLGTGVPWVMCK++DAPDPV+N CNGFYCD FSPN+ YKP MWTEAW+ WF 
Sbjct  202   TWAAKMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDAFSPNRPYKPAMWTEAWSGWFN  261

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
             EFGGP+  RP +DLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPID
Sbjct  262   EFGGPIHQRPVQDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPID  321

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             E+GL+R+PK+GHLK+LHRA+K+CE ALVS DP V SLG+ Q+A V+ S+SG CAAFL+N 
Sbjct  322   EYGLIRQPKYGHLKELHRAVKMCEKALVSADPIVTSLGSSQQAYVYTSESGNCAAFLSNY  381

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSY  1679
             +  S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+ +M P  S    W+SY
Sbjct  382   DTDSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQFEMLPTNSPMLLWESY  441

Query  1678  NEETSSYDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             NE+ S+ DD+ T TA+GLLEQIN T+D SDYLWY+T V I   E+FL GG+ P L V S 
Sbjct  442   NEDISAEDDSTTMTASGLLEQINVTKDTSDYLWYITSVDIGSTESFLHGGELPTLIVQST  501

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHA+H+FING+L G+++GS EN + T++  V  RAG N I+LLS+AVGLPNVG HFETWN
Sbjct  502   GHAVHIFINGRLSGSAFGSRENRRFTYTGKVNFRAGRNTIALLSVAVGLPNVGGHFETWN  561

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QP  1145
              G+LGPV+L GL+ GK DL+W KW+YK+GLKGE ++L S +G SSVEW+EGS  AQ  QP
Sbjct  562   TGILGPVALHGLDHGKLDLSWAKWTYKVGLKGEAMNLVSPNGISSVEWMEGSLAAQAPQP  621

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTW+K+ FDAP G+EPLA+DM  MGKGQIWING S+GRYW  Y    G C  CNYAG F 
Sbjct  622   LTWHKSNFDAPEGDEPLAIDMRGMGKGQIWINGVSIGRYWTAYAT--GNCDKCNYAGTFR  679

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
               KC   CG+ +QRWYHVPR+WL+P  NLLV FEE GGNP  +SLVKR V SVCAD+ E+
Sbjct  680   PPKCQQGCGQPTQRWYHVPRAWLKPKDNLLVVFEELGGNPTSISLVKRSVTSVCADVSEY  739

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
              P L NW +++ GK+    RPK HL C AG  ITSIKFASFGTP G+CGS+ +GTCHA  
Sbjct  740   HPTLKNWHIESYGKSEDLHRPKVHLKCSAGYSITSIKFASFGTPLGTCGSYQQGTCHAPM  799

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SYDI +K CIG   C V ++   FG DPCP+V+K+LSVEVVC+
Sbjct  800   SYDILEKRCIGKQRCAVTISNTNFGQDPCPNVLKRLSVEVVCA  842



>dbj|BAD91082.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=854

 Score =  1137 bits (2940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/818 (66%), Positives = 658/818 (80%), Gaps = 7/818 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YD+ + +INGQR+IL+SGSIHYPRSTPEMW DL++KAK+GGLDVV+TYVFWN HEP 
Sbjct  27    AVTYDRKAIVINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVVETYVFWNVHEPT  86

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  87    PGNYNFEGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  146

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV +MKS+ L+ESQGGPIILSQIENEYG      GA G +Y  WAA+M
Sbjct  147   PFKRAMQGFTQKIVGLMKSESLFESQGGPIILSQIENEYGAQSKLFGAAGHNYITWAAEM  206

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCK++DAPDPV+N CNGFYCD FSPN+ YKP +WTE W+ WFTEFGGP+
Sbjct  207   AVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDSFSPNRPYKPTIWTETWSGWFTEFGGPI  266

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLAYAVA FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+R
Sbjct  267   HQRPVQDLAYAVATFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLIR  326

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LH+AIK+CE ALVS DP + SLGN+Q+A V+ S+SG C+AFL+N++  S A
Sbjct  327   QPKYGHLKELHKAIKMCERALVSADPIITSLGNFQQAYVYTSESGDCSAFLSNHDSKSAA  386

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVS-RGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P +    SW+SY+E+ +S
Sbjct  387   RVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPTNIPMLSWESYDEDLTS  446

Query  1660  YDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              DD +T TA GLLEQIN TRD++DYLWY+T V ID  E+FL GG+ P L V S GHA+H+
Sbjct  447   MDDSSTMTAPGLLEQINVTRDSTDYLWYITSVDIDSSESFLHGGELPTLIVQSTGHAVHI  506

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G+++G+ E+ + T++  V LRAG NKI+LLS+AVGLPNVG HFE WN G+LGP
Sbjct  507   FINGQLTGSAFGTRESRRFTYTGKVNLRAGTNKIALLSVAVGLPNVGGHFEAWNTGILGP  566

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK--QPLTWYK  1130
             V+L GLN+GK DL+WQKW+Y++GLKGE ++L S +  SSVEW+ GS IAQK  QPLTW+K
Sbjct  567   VALHGLNQGKWDLSWQKWTYQVGLKGEAMNLVSQNAFSSVEWISGSLIAQKKQQPLTWHK  626

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             T F+ P G+EPLALDM  MGKGQIWINGQS+GRYW  +  + G C  C+YAG F   KC 
Sbjct  627   TIFNEPEGSEPLALDMEGMGKGQIWINGQSIGRYWTAF--ANGNCNGCSYAGGFRPTKCQ  684

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             S CG+ +QR+YHVPRSWL+PT NLLV FEE GG+P  +SLVKR V+SVC+++ E+ P + 
Sbjct  685   SGCGKPTQRYYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRAVSSVCSEVAEYHPTIK  744

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW +++ GK      PK HL C  GQ I+SIKFASFGTP G+CGS+ EGTCHA  SY + 
Sbjct  745   NWHIESYGKVEDFHSPKVHLRCNPGQAISSIKFASFGTPLGTCGSYQEGTCHATTSYSVV  804

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             QK CIG   C V ++   F GDPCP V+K+LSVE VC+
Sbjct  805   QKKCIGKQRCAVTISNSNF-GDPCPKVLKRLSVEAVCA  841



>ref|XP_002310279.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE90729.2| beta-galactosidase family protein [Populus trichocarpa]
Length=847

 Score =  1136 bits (2939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/820 (65%), Positives = 653/820 (80%), Gaps = 4/820 (0%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   SV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL++KAK+GG+DV++TYVFWN 
Sbjct  24    LIQCSVTYDRKAIMINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGIDVIETYVFWNV  83

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y+FEGRYD+V+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  84    HEPTPGNYHFEGRYDIVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  143

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AMQ FT  IV +MK++ L+ESQGGPIILSQIENEYG      GA G +Y  W
Sbjct  144   TDNEPFKRAMQGFTEKIVGLMKAEHLFESQGGPIILSQIENEYGVQSKLFGAAGYNYMTW  203

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MA+  GTGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WF+EF
Sbjct  204   AANMAIQTGTGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPTIWTEAWSGWFSEF  263

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GG +  RP +DLA+AVAKFI KGGSFINYYMFHGGTNFGR+AGGPFI TSYDYDAPIDE+
Sbjct  264   GGTIHQRPVQDLAFAVAKFIQKGGSFINYYMFHGGTNFGRSAGGPFITTSYDYDAPIDEY  323

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHR+IK+CE ALVS DP +  LG YQ+  V+ ++SG CAAFLAN + 
Sbjct  324   GLIRQPKYGHLKELHRSIKMCERALVSVDPIITQLGTYQQVHVYSTESGDCAAFLANYDT  383

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEE  1670
              S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P +  FSW+SY+E+
Sbjct  384   KSAARVLFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMEMLPTNGIFSWESYDED  443

Query  1669  TSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHA  1493
              SS DD +TFT  GLLEQIN TRDASDYLWYMT V I   E+FL GG+ P L + S GHA
Sbjct  444   ISSLDDSSTFTTAGLLEQINVTRDASDYLWYMTSVDIGSSESFLHGGELPTLIIQSTGHA  503

Query  1492  LHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGV  1313
             +H+FINGQL G+++G+ EN + T++  V LR G N+I+LLS+AVGLPNVG H+E+WN G+
Sbjct  504   VHIFINGQLSGSAFGTRENRRFTYTGKVNLRPGTNRIALLSVAVGLPNVGGHYESWNTGI  563

Query  1312  LGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTW  1136
             LGPV+L GL++GK DL+WQKW+Y++GLKGE ++L S    +SVEW++ S  AQ+ QPLTW
Sbjct  564   LGPVALHGLDQGKWDLSWQKWTYQVGLKGEAMNLLSPDSVTSVEWMQSSLAAQRPQPLTW  623

Query  1135  YKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKK  956
             +K  F+AP G+EPLALDM  MGKGQIWINGQS+GRYW  Y +  G C  C+YAG F   K
Sbjct  624   HKAYFNAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAYAS--GNCNGCSYAGTFRPTK  681

Query  955   CLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQ  776
             C   CG+ +QRWYHVPRSWL+PT NLLV FEE GG+P  +SLVKR +ASVCA++ E+ P 
Sbjct  682   CQLGCGQPTQRWYHVPRSWLKPTNNLLVVFEELGGDPSRISLVKRSLASVCAEVSEFHPT  741

Query  775   LMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYD  596
             + NW++++ G+A     PK HL C  GQ ITSIKFASFGTP G+CGS+ +G CHA  SY 
Sbjct  742   IKNWQIESYGRAEEFHSPKVHLRCSGGQSITSIKFASFGTPLGTCGSYQQGACHASTSYA  801

Query  595   IFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             I +K CIG   C V ++   FG DPCP+VMKKLSVE VC+
Sbjct  802   ILEKKCIGKQRCAVTISNSNFGQDPCPNVMKKLSVEAVCA  841



>ref|XP_004149980.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=854

 Score =  1136 bits (2938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/823 (66%), Positives = 653/823 (79%), Gaps = 5/823 (1%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
             V     SV+YD+ + +INGQR++L SGSIHYPRSTPEMW  L++KAKEGGLDVV+TYVFW
Sbjct  22    VQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEGGLDVVETYVFW  81

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             N HEP PG Y FEGRYDLV+FIK  Q+AGLY +LR+GPY CAEWNFGGFPVWLKYVPG+S
Sbjct  82    NVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGFPVWLKYVPGIS  141

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDN PFK AMQ FT  IV +MKS+ L+ESQGGPIILSQIENEYG      GA G++Y 
Sbjct  142   FRTDNEPFKRAMQGFTEKIVGLMKSENLFESQGGPIILSQIENEYGVQSKLFGAAGQNYM  201

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAAKMAVGLGTGVPWVMCK++DAPDPV+N CNGFYCD FSPN+ YKP MWTEAW+ WF 
Sbjct  202   TWAAKMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDAFSPNRPYKPTMWTEAWSGWFN  261

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
             EFGGP+  RP +DLA+AVA FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPID
Sbjct  262   EFGGPIHQRPVQDLAFAVALFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPID  321

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             E+GL+R+PK+GHLK+LHRA+K+CE ALVS DP V SLG+ Q+A V+ S+SG CAAFL+N 
Sbjct  322   EYGLIRQPKYGHLKELHRAVKMCEKALVSADPIVTSLGSSQQAYVYTSESGNCAAFLSNY  381

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSY  1679
             +  S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+++M P  S    W+SY
Sbjct  382   DTDSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQLEMLPTNSPMLLWESY  441

Query  1678  NEETSSYDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             NE+ S+ DD+ T TA+GLLEQIN T+D SDYLWY+T V I   E+FL GG+ P L V S 
Sbjct  442   NEDVSAEDDSTTMTASGLLEQINVTKDTSDYLWYITSVDIGSTESFLHGGELPTLIVQST  501

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHA+H+FING+L G+++GS EN + T++  V  RAG N I+LLS+AVGLPNVG HFETWN
Sbjct  502   GHAVHIFINGRLSGSAFGSRENRRFTYTGKVNFRAGRNTIALLSVAVGLPNVGGHFETWN  561

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QP  1145
              G+LGPV+L GL++GK DL+W KW+YK+GLKGE ++L S +G SSVEW+EGS  AQ  QP
Sbjct  562   TGILGPVALHGLDQGKLDLSWAKWTYKVGLKGEAMNLVSPNGISSVEWMEGSLAAQAPQP  621

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTW+K+ FDAP G+EPLA+DM  MGKGQIWING S+GRYW  Y    G C  CNYAG F 
Sbjct  622   LTWHKSNFDAPEGDEPLAIDMRGMGKGQIWINGVSIGRYWTAYAT--GNCDKCNYAGTFR  679

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
               KC   CG+ +QRWYHVPR+WL+P  NLLV FEE GGNP  +SLVKR V  VCAD+ E+
Sbjct  680   PPKCQQGCGQPTQRWYHVPRAWLKPKDNLLVVFEELGGNPTSISLVKRSVTGVCADVSEY  739

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
              P L NW +++ GK+    RPK HL C AG  ITSIKFASFGTP G+CGS+ +GTCHA  
Sbjct  740   HPTLKNWHIESYGKSEDLHRPKVHLKCSAGYSITSIKFASFGTPLGTCGSYQQGTCHAPM  799

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SYDI +K CIG   C V ++   FG DPCP+V+K+LSVEVVC+
Sbjct  800   SYDILEKRCIGKQRCAVTISNTNFGQDPCPNVLKRLSVEVVCA  842



>ref|XP_011048837.1| PREDICTED: beta-galactosidase 5 [Populus euphratica]
Length=853

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/817 (66%), Positives = 649/817 (79%), Gaps = 5/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YDK + II+G R+IL+SGSIHYPRSTP+MW DL++KAK GGLDV+ TYVFWN HEP 
Sbjct  27    TVTYDKKAIIIDGHRRILISGSIHYPRSTPDMWEDLVRKAKHGGLDVIDTYVFWNVHEPS  86

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGR+DLV+FIK  Q+ GLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDNG
Sbjct  87    PGNYNFEGRFDLVRFIKTVQKEGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNG  146

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKAAMQ FT  IV MMK +RL++SQGGPII SQIENEYGP     GA G SY  WAA+M
Sbjct  147   PFKAAMQGFTQKIVQMMKDERLFQSQGGPIIFSQIENEYGPESRAFGAAGHSYINWAAQM  206

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCK+DDAPDPV+N CNGFYCD FSPNK YKP MWTEAW+ WFTEFGG  
Sbjct  207   AVGLNTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYKPTMWTEAWSGWFTEFGGAF  266

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
              +RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+GL+R
Sbjct  267   HHRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEYGLIR  326

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             EPK+GHLK+LHRAIKLCE  LVS DP +  LG YQ+A VF S   +CAAFLAN +  S A
Sbjct  327   EPKYGHLKELHRAIKLCEHELVSSDPTITLLGTYQQAHVFSSGKRSCAAFLANYHTKSAA  386

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSS  1661
             +V F NMHY LPPWSISILPDC+N V+NTA+VG Q+S ++M P  SR FSW++Y+E+ SS
Sbjct  387   RVMFNNMHYVLPPWSISILPDCRNVVFNTAKVGVQTSHVQMLPTGSRFFSWETYDEDISS  446

Query  1660  YDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
                ++  TA G +EQIN TRD +DYLWY+T V I+P E+FL+GG+WP LTV SAGHALHV
Sbjct  447   LGASSRMTALGFMEQINVTRDTTDYLWYITSVNINPSESFLQGGQWPTLTVESAGHALHV  506

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQ  G+++G+ EN + T++  V LRAG N+I+LLSIAVGLPNVG H+ETW  G+LGP
Sbjct  507   FINGQFSGSAFGTRENREFTYTGPVNLRAGANRIALLSIAVGLPNVGVHYETWKTGILGP  566

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V L GLN+G +DLTWQ+WSY++GLKGE + + S +G+SSV+W++GS   ++QPL WYK  
Sbjct  567   VMLRGLNQGNKDLTWQQWSYQVGLKGEAMHIVSPNGASSVDWIQGSLATRQQPLKWYKAY  626

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GNEPLALDM +MGKGQ+WINGQS+GRYW  Y  + G C +C+Y+G F   KC   
Sbjct  627   FDAPGGNEPLALDMRSMGKGQVWINGQSIGRYWLSY--AKGDCSSCSYSGTFRPPKCQLG  684

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG  +QRWYHVPRSWL+P  NLLV FEE GG+   +SLVKR   SVCAD +E  P + N+
Sbjct  685   CGRPTQRWYHVPRSWLKPKQNLLVIFEELGGDASKISLVKRSTTSVCADAFEHHPAIENY  744

Query  763   EMQASGKATRPL-RPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
               +++G++ R L + K HL C  GQ I++IKFASFGTP G+CGSF EG CH+ +S+ + +
Sbjct  745   NNESNGESERNLHQAKVHLQCAPGQSISAIKFASFGTPTGTCGSFQEGACHSPNSHSVVE  804

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K CIG  SC V ++   FG DPCPS +KKLSVE VCS
Sbjct  805   KKCIGRESCMVTISNSNFGADPCPSKLKKLSVEAVCS  841



>gb|EMS53990.1| Beta-galactosidase 2 [Triticum urartu]
Length=807

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/796 (70%), Positives = 648/796 (81%), Gaps = 25/796 (3%)
 Frame = -2

Query  2824  MWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVG  2645
             MWPDL++KAK GGLDVVQTYVFWNGHEP PG+YYFEGRYDLV+FIKL +QAGLYVHLR+G
Sbjct  22    MWPDLIQKAKGGGLDVVQTYVFWNGHEPSPGQYYFEGRYDLVRFIKLVKQAGLYVHLRIG  81

Query  2644  PYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAA---MQKFTTMIVNMMKSQRLYESQGG  2474
             PY CAEWNFGGFPVWLKYVPG+SFRTDN PFKA+   MQKFTT IV+MMKS+ L+E QGG
Sbjct  82    PYVCAEWNFGGFPVWLKYVPGISFRTDNQPFKASVLEMQKFTTKIVDMMKSEGLFEWQGG  141

Query  2473  PIILSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNG  2294
             PIILSQIENE+GP+E++ G P K+YA WAA MA+ L TGVPW+MCK+DDAPDP++N CNG
Sbjct  142   PIILSQIENEFGPLEWDQGEPSKAYASWAANMAIALNTGVPWIMCKEDDAPDPIINTCNG  201

Query  2293  FYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMF  2114
             FYCDWFSPNK +KP MWTEAWTAW+T FG PVP+RP EDLAY VAKFI KGGSF+NYYM+
Sbjct  202   FYCDWFSPNKPHKPTMWTEAWTAWYTGFGVPVPHRPVEDLAYGVAKFIQKGGSFVNYYMY  261

Query  2113  HGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNV  1934
             HGGTNFGRTAGGPF+ATSYDYDAPIDE+GLLREPKWGHLK+LHRAIKLCEPALV+GDP +
Sbjct  262   HGGTNFGRTAGGPFVATSYDYDAPIDEYGLLREPKWGHLKELHRAIKLCEPALVAGDPII  321

Query  1933  ISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYN  1754
              SLG  Q++ VF+S +GACAAFL N ++ S+A+V+F  MHY+LPPWSISILPDCK TV+N
Sbjct  322   SSLGKAQKSSVFRSSTGACAAFLENKDKLSYARVSFSGMHYDLPPWSISILPDCKTTVFN  381

Query  1753  TARVGAQSSRMKMTPVSRGFSWQSYNEETSSY-DDNTFTATGLLEQINTTRDASDYLWYM  1577
             TARVG+Q S+MKM   + G +WQSYNEE +SY ++  FTA GLLEQIN TRD +DYLWY 
Sbjct  382   TARVGSQISQMKME-WAGGLTWQSYNEEINSYSEEEAFTAVGLLEQINMTRDNTDYLWYT  440

Query  1576  TDVRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRA  1397
             T V +   E FL  GK P LTV SAGHALHVF+NGQL GT YGS+E+PK+T++ +V L A
Sbjct  441   TYVDVAKNEQFLTSGKSPKLTVMSAGHALHVFVNGQLTGTVYGSVEDPKLTYTGSVKLWA  500

Query  1396  GVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevl  1217
             G N IS LSIAVGLPNVG HFETWNAG+LGPV L GLNEG+RDLTWQKW+Y++GLKGE +
Sbjct  501   GRNTISCLSIAVGLPNVGEHFETWNAGILGPVILYGLNEGRRDLTWQKWTYQVGLKGEAM  560

Query  1216  slhslsgsssvewvegSFIAQKQPLTWYKTT----------FDAPAGNEPLALDMNTMGK  1067
             SLHSLSGSSSVEW E     QKQPLTWYK            F+AP G+EPLALDMN+MGK
Sbjct  561   SLHSLSGSSSVEWGEP---VQKQPLTWYKKIYPTVPSFQAFFNAPDGDEPLALDMNSMGK  617

Query  1066  GQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPT  887
             GQIWINGQ +GRYWPGYKA  G CG C+Y G +DE KC + CG++SQRWYHVPR+WL PT
Sbjct  618   GQIWINGQGIGRYWPGYKAP-GTCGYCDYRGEYDETKCQTNCGDSSQRWYHVPRAWLNPT  676

Query  886   GNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLS  707
             GNLLV FEE GG+P  +S+VKR   SVCAD+ EWQP + NW  +   KA      K HL 
Sbjct  677   GNLLVIFEEMGGDPSEISMVKRTRGSVCADVSEWQPSMTNWRTKDYEKA------KVHLQ  730

Query  706   CGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGG  527
             C  G+KIT +KFASFGTP+GSCGS+SEG CHA  SYDIF K CI    C V V P+ FGG
Sbjct  731   CDHGRKITEVKFASFGTPQGSCGSYSEGGCHAHKSYDIFWKNCINQEHCAVSVVPQVFGG  790

Query  526   DPCPSVMKKLSVEVVC  479
             DPCP  MK+  VEV+C
Sbjct  791   DPCPGTMKRAVVEVMC  806



>ref|XP_004158882.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=854

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/823 (66%), Positives = 653/823 (79%), Gaps = 5/823 (1%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
             V     SV+YD+ + +INGQR++L SGSIHYPRSTPEMW  L++KAKEGGLDVV+TYVFW
Sbjct  22    VQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEGGLDVVETYVFW  81

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             N HEP PG Y FEGRYDL +FIK  Q+AGLY +LR+GPY CAEWNFGGFPVWLKYVPG+S
Sbjct  82    NVHEPSPGNYNFEGRYDLARFIKTIQKAGLYANLRIGPYVCAEWNFGGFPVWLKYVPGIS  141

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDN PFK AMQ FT  IV +MKS+ L+ESQGGPIILSQIENEYG      GA G++Y 
Sbjct  142   FRTDNEPFKRAMQGFTEKIVGLMKSENLFESQGGPIILSQIENEYGVQSKLFGAAGQNYM  201

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAAKMAVGLGTGVPWVMCK++DAPDPV+N CNGFYCD FSPN+ YKP MWTEAW+ WF 
Sbjct  202   TWAAKMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDAFSPNRPYKPTMWTEAWSGWFN  261

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
             EFGGP+  RP +DLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPID
Sbjct  262   EFGGPIHQRPVQDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPID  321

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             E+GL+R+PK+GHLK+LHRA+K+CE ALVS DP V SLG+ Q+A V+ S+SG CAAFL+N 
Sbjct  322   EYGLIRQPKYGHLKELHRAVKMCEKALVSADPIVTSLGSSQQAYVYTSESGNCAAFLSNY  381

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSY  1679
             +  S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+++M P  S    W+SY
Sbjct  382   DTDSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQLEMLPTNSPMLLWESY  441

Query  1678  NEETSSYDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             NE+ S+ DD+ T TA+GLLEQIN T+D SDYLWY+T V I   E+FL GG+ P L V S 
Sbjct  442   NEDVSAEDDSTTMTASGLLEQINVTKDTSDYLWYITSVDIGSTESFLHGGELPTLIVQST  501

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHA+H+FING+L G+++GS EN + T++  V  RAG N I+LLS+AVGLPNVG HFETWN
Sbjct  502   GHAVHIFINGRLSGSAFGSRENRRFTYTGKVNFRAGRNTIALLSVAVGLPNVGGHFETWN  561

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QP  1145
              G+LGPV+L GL++GK DL+W KW+YK+GLKGE ++L S +G SSVEW+EGS  AQ  QP
Sbjct  562   TGILGPVALHGLDQGKLDLSWAKWTYKVGLKGEAMNLVSPNGISSVEWMEGSLAAQAPQP  621

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTW+K+ FDAP G+EPLA+DM  MGKGQIWING S+GRYW  Y    G C  CNYAG F 
Sbjct  622   LTWHKSNFDAPEGDEPLAIDMRGMGKGQIWINGVSIGRYWTAYAT--GNCDKCNYAGTFR  679

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
               KC   CG+ +QRWYHVPR+WL+P  NLLV FEE GGNP  +SLVKR V  VCAD+ E+
Sbjct  680   PPKCQQGCGQPTQRWYHVPRAWLKPKDNLLVVFEELGGNPTSISLVKRSVTGVCADVSEY  739

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
              P L NW +++ GK+    RPK HL C AG  ITSIKFASFGTP G+CGS+ +GTCHA  
Sbjct  740   HPTLKNWHIESYGKSEDLHRPKVHLKCSAGYSITSIKFASFGTPLGTCGSYQQGTCHAPM  799

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SYDI +K CIG   C V ++   FG DPCP+V+K+LSVEVVC+
Sbjct  800   SYDILEKRCIGKQRCAVTISNTNFGQDPCPNVLKRLSVEVVCA  842



>gb|EYU24087.1| hypothetical protein MIMGU_mgv1a001258mg [Erythranthe guttata]
Length=851

 Score =  1135 bits (2935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/817 (66%), Positives = 654/817 (80%), Gaps = 5/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SV+YD+ + +INGQR+IL SGSIHYPRSTPEMW DL+ KAKEGG+DV++TYVFWN HEP 
Sbjct  34    SVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLINKAKEGGVDVIETYVFWNVHEPS  93

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  94    PGNYDFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  153

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AM+ FT  IVN+MKS++LYESQGGPIILSQIENEYGPM   LGA G  Y+ WAA M
Sbjct  154   PFKMAMKGFTEKIVNLMKSEKLYESQGGPIILSQIENEYGPMAKSLGASGHQYSTWAANM  213

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AV L TGVPWVMCK++DAPDPV+N CNGFYCD FSPNK YKP +WTEAW+ WFTEFGGP 
Sbjct  214   AVALDTGVPWVMCKEEDAPDPVINTCNGFYCDAFSPNKPYKPTIWTEAWSGWFTEFGGPN  273

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLA+AVA+FI KGGSFINYYM+HGGTNFGR+AGGPFI TSYDYDAP+DE+GL+R
Sbjct  274   HERPVQDLAFAVARFIQKGGSFINYYMYHGGTNFGRSAGGPFITTSYDYDAPLDEYGLIR  333

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LHRA+KLCE +L+S DP + SLGN Q+A V+ S+SG CAAFL+N +  S  
Sbjct  334   QPKYGHLKELHRAVKLCEKSLISTDPTITSLGNLQQAYVYTSESGDCAAFLSNYDTKSAV  393

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRG-FSWQSYNEETSS  1661
             +V F NMHYN+PPWSISILPDC+N V+NTA+VG Q+S+M+M P +    SWQ+YNE+ SS
Sbjct  394   RVMFNNMHYNIPPWSISILPDCRNVVFNTAKVGVQTSQMEMVPANNEILSWQTYNEDLSS  453

Query  1660  YDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              DD +TF+  GLLEQIN TRDA+DYLWY T V I   E+FL GG+ P L V S GHALHV
Sbjct  454   LDDSSTFSTVGLLEQINVTRDATDYLWYTTSVDIGSSESFLHGGELPTLIVQSTGHALHV  513

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G++ G+ +N + TF   V LRAG NKI LLS+AVGLPNVG H+ETWN GVLGP
Sbjct  514   FINGQLSGSASGTRQNRRFTFKGKVNLRAGSNKIGLLSVAVGLPNVGGHYETWNTGVLGP  573

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKT  1127
             V+L GL++GK DL+W KW+Y++GLKGE ++L S +  SSVEW++GS IAQK QPLTW+K 
Sbjct  574   VALLGLDQGKWDLSWAKWTYQVGLKGEAMNLVSPNTISSVEWMQGSLIAQKQQPLTWHKA  633

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              F+AP G+EPLALDM++MGKGQ+W+NGQS+GRYW  Y    G C  C+Y G F   KC  
Sbjct  634   YFNAPDGDEPLALDMSSMGKGQLWVNGQSLGRYWTAYAT--GDCNGCSYVGSFRPPKCQL  691

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +Q+WYH+PRSWL+PT NLLV FEE GG+P  + +VKR + SVCAD+ E+ P   N
Sbjct  692   GCGQPTQKWYHLPRSWLKPTENLLVLFEELGGDPTRIGVVKRSMTSVCADMAEYHPNFKN  751

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W++++ GK     +PK HL CG GQ I+SIKFASFGTP G+CGSF +GTCHA  SY I +
Sbjct  752   WQIESYGKPEEFRKPKVHLHCGPGQSISSIKFASFGTPLGTCGSFQKGTCHAPTSYAILE  811

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K CIG   C+V ++   FG DPCP+V+K+LSVE +C+
Sbjct  812   KKCIGKERCSVAISNSNFGHDPCPNVLKRLSVEAICA  848



>ref|XP_011025878.1| PREDICTED: beta-galactosidase 3 [Populus euphratica]
Length=847

 Score =  1134 bits (2933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/820 (65%), Positives = 653/820 (80%), Gaps = 4/820 (0%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   SV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL++KAK+GG+DV++TYVFWN 
Sbjct  24    LIQCSVTYDRKAIMINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGIDVIETYVFWNV  83

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y+FEGRYD+V+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  84    HEPTPGNYHFEGRYDIVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  143

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AM+ FT  IV +MK++ L+ESQGGPIILSQIENEYG      GA G +Y  W
Sbjct  144   TDNEPFKRAMKGFTEKIVGLMKAENLFESQGGPIILSQIENEYGVQSKLFGAAGYNYMTW  203

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MA+  GTGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WF+EF
Sbjct  204   AANMAIQTGTGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPTIWTEAWSGWFSEF  263

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GG +  RP +DLA+AVAKFI KGGSFINYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+
Sbjct  264   GGTIHQRPVQDLAFAVAKFIQKGGSFINYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEY  323

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHR+IK+CE ALVS DP V  LG YQ+  V+ ++SG CAAFLAN + 
Sbjct  324   GLIRQPKYGHLKELHRSIKMCERALVSVDPIVTQLGTYQQVHVYSTESGDCAAFLANYDT  383

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEE  1670
              S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P +  FSW+SY+E+
Sbjct  384   KSAARVLFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMEMLPTNGIFSWESYDED  443

Query  1669  TSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHA  1493
              SS DD +TFT  GLLEQIN TRDASDYLWYMT V I   E+FL GG+ P L V S GHA
Sbjct  444   ISSLDDSSTFTTAGLLEQINVTRDASDYLWYMTSVDIGSSESFLHGGELPTLIVQSTGHA  503

Query  1492  LHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGV  1313
             +H+FINGQL G+++G+ EN + T++  V LR G N+I+LLS+AVGLPNVG H+E+WN G+
Sbjct  504   VHIFINGQLSGSAFGTRENRRFTYTGKVNLRPGTNRIALLSVAVGLPNVGGHYESWNTGI  563

Query  1312  LGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTW  1136
             LGPV+L GL++GK DL+WQKW+Y++GLKGE ++L S    +SVEW++ S  AQ+ QPLTW
Sbjct  564   LGPVALHGLDQGKWDLSWQKWTYQVGLKGEAMNLLSPDSVTSVEWMQSSLAAQRPQPLTW  623

Query  1135  YKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKK  956
             +K  F+AP G+EPLALDM  MGKGQIWINGQS+GRYW  Y +  G C  C+YAG F   K
Sbjct  624   HKAYFNAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAYAS--GNCNGCSYAGTFRPTK  681

Query  955   CLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQ  776
             C   CG+ +QRWYHVPRSWL+PT NLLV FEE GG+P  +SLVKR +ASVCA++ E+ P 
Sbjct  682   CQLGCGQPTQRWYHVPRSWLKPTNNLLVVFEELGGDPSRISLVKRSLASVCAEVSEFHPT  741

Query  775   LMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYD  596
             + NW++++ G+A     PK HL C  GQ ITSIKFASFGTP G+CGS+ +G CHA  SY 
Sbjct  742   IKNWQIESYGRAEEFHNPKVHLRCSVGQSITSIKFASFGTPLGTCGSYQQGACHASTSYA  801

Query  595   IFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             I +K CIG   C V ++   FG DPCP+VMKKLSVE VC+
Sbjct  802   ILEKKCIGKQRCAVTISNSNFGQDPCPNVMKKLSVEAVCA  841



>ref|XP_008337843.1| PREDICTED: beta-galactosidase 3 [Malus domestica]
 ref|XP_008363095.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =  1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/817 (65%), Positives = 660/817 (81%), Gaps = 6/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YD+ + +INGQR+IL+SGSIHYPRSTPEMW DL++KAKEGGLDVV+TYVFWN HEP 
Sbjct  27    TVTYDRKAIVINGQRRILISGSIHYPRSTPEMWEDLIQKAKEGGLDVVETYVFWNVHEPT  86

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+F+K  Q AGLY HLR+GPY CAEWN GGFPVWLKYVPG+SFRTDN 
Sbjct  87    PGNYNFEGRYDLVRFLKTIQNAGLYAHLRIGPYVCAEWNNGGFPVWLKYVPGISFRTDNE  146

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LGA G +Y  WAA+M
Sbjct  147   PFKRAMQGFTEKIVRLMKSENLFESQGGPIILSQIENEYGAQSKLLGAAGHNYITWAAEM  206

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCK++DAPDPV+N CNGFYCD FSPN+ YKP +WTE W+ WFTEFGGP+
Sbjct  207   AVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDSFSPNQPYKPTIWTETWSGWFTEFGGPI  266

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLAYAVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+R
Sbjct  267   HQRPVQDLAYAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLIR  326

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LH+AIK+CE ALVS DP + SLG++Q+A V+ S+SG C+AFL+N++ +S A
Sbjct  327   QPKYGHLKELHKAIKMCERALVSADPIITSLGSFQQAHVYTSESGDCSAFLSNHDSNSAA  386

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVS-RGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P +    SW+SY+E+ +S
Sbjct  387   RVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPTNIPMLSWESYDEDLTS  446

Query  1660  YDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              DD +T TA GLLEQIN TRD++DYLWY+T V I   E+FL+GG+ P L V S GHA+H+
Sbjct  447   LDDSSTLTAPGLLEQINVTRDSTDYLWYITSVDIASSESFLRGGELPTLIVQSTGHAVHI  506

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G+++G+ ++ + T++  V LRAG N+I+LLSIAVGLPNVG HFE WN G+LGP
Sbjct  507   FINGQLTGSAFGTRQSRRFTYTGKVNLRAGTNRIALLSIAVGLPNVGGHFEAWNTGILGP  566

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKT  1127
             V+L GL++GK DL+WQKW+Y++GLKGE ++L S +  SSVEW+ GS IAQK QPLTW+KT
Sbjct  567   VALHGLDQGKWDLSWQKWTYQVGLKGEAMNLASPNDFSSVEWMSGSLIAQKQQPLTWHKT  626

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              F+ P GNEPLALD+  MGKGQIWINGQS+GRYW  +  + G C  C+YAG F   KC S
Sbjct  627   IFNEPEGNEPLALDLEGMGKGQIWINGQSIGRYWTAF--ANGNCNGCSYAGGFRPTKCQS  684

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QR+YHVPRSWL+PT NLLV FEE GG+P  +SLVKR V+SVC+++ E+ P + N
Sbjct  685   GCGQPTQRYYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRAVSSVCSEVAEYHPTIKN  744

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W +++ GK      PK HL C  GQ I+SIKFASFGTP G+CGS+ +GTCHA  SY + Q
Sbjct  745   WHIESYGKVEDFXSPKVHLRCNPGQAISSIKFASFGTPLGTCGSYQQGTCHATTSYSVLQ  804

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K CIG   C V ++   F GDPCP+V+K+LSVE VC+
Sbjct  805   KKCIGKQRCAVTISNSNF-GDPCPNVLKRLSVEAVCA  840



>ref|XP_007046794.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX90951.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=854

 Score =  1133 bits (2931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/817 (66%), Positives = 657/817 (80%), Gaps = 5/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL++KAK+GGLDV++TYVFWN HEP 
Sbjct  27    SVTYDRKAVVINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGLDVIETYVFWNVHEPS  86

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  87    PGNYNFEGRYDLVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  146

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV +MKS  L+ESQGGPIILSQIENEYG     LGA G +Y  WAAKM
Sbjct  147   PFKRAMQGFTEKIVGLMKSHNLFESQGGPIILSQIENEYGAQSKLLGASGYNYVTWAAKM  206

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             A+  GTGVPWVMCK++DAPDPV+N CNGFYCD F PNK YKP MWTEAW+ WFTEFGGP+
Sbjct  207   AIETGTGVPWVMCKEEDAPDPVINTCNGFYCDTFQPNKPYKPTMWTEAWSGWFTEFGGPL  266

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
              +RPAEDLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+R
Sbjct  267   HHRPAEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIR  326

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LHRAIK+ E ALVS DP V SLG++Q+A ++ S+SG CAAFL+N +  S A
Sbjct  327   QPKYGHLKELHRAIKMSERALVSADPIVTSLGSFQQAYMYTSESGDCAAFLSNYDTKSAA  386

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  +  FSW+SY+E+TSS
Sbjct  387   RVLFNNMHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMQMLPTNAEMFSWESYDEDTSS  446

Query  1660  YDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              DD +T TA GLLEQIN TRDASDYLWY+T V I   E+FL GG+ P L V S GHA+H+
Sbjct  447   LDDSSTITADGLLEQINVTRDASDYLWYITSVNIGSSESFLHGGELPTLIVQSTGHAVHI  506

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G+++G+ +N + T++  V LRAG N+I+LLS+AVGLPNVG HFETWN G+LGP
Sbjct  507   FINGQLSGSAFGTRQNRRFTYTGKVNLRAGTNRIALLSVAVGLPNVGGHFETWNTGILGP  566

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKT  1127
             V+L GL++GK DL+WQKW+Y++GLKGE ++L S +  SSVEW+EGS  AQK QPL W+K 
Sbjct  567   VALHGLDQGKWDLSWQKWTYQVGLKGEAMNLVSPNSISSVEWMEGSLAAQKQQPLRWHKA  626

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              F+AP G+EPLALDM +MGKGQIWINGQS+GRYW  Y  + G C  C+YAG F   KC  
Sbjct  627   YFNAPEGDEPLALDMESMGKGQIWINGQSIGRYWTAY--AHGDCNGCSYAGTFRPPKCQL  684

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QRWYHVPRSWL+PT NLLV FEE G +P  +S++KR V+SVCA++ E+ P + N
Sbjct  685   GCGQPTQRWYHVPRSWLKPTQNLLVIFEELGADPSRISVMKRSVSSVCAEVSEYHPNIKN  744

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W++++ GKA    RPK HL C  GQ I+ IKFASFGTP G+CGS+ +G CHA  SY I +
Sbjct  745   WQIESYGKAEEFHRPKVHLHCNPGQAISFIKFASFGTPLGTCGSYQQGPCHAPASYAILE  804

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K CIG   C V +    FG DPCP+V+K+LSVE  C+
Sbjct  805   KKCIGKQRCAVTIANSNFGQDPCPNVLKRLSVEAACA  841



>ref|XP_008241765.1| PREDICTED: beta-galactosidase 3 [Prunus mume]
Length=853

 Score =  1133 bits (2930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/821 (65%), Positives = 659/821 (80%), Gaps = 6/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   +V+YD+ + +INGQR+IL+SGSIHYPRSTPEMW DL++KAK+GGLDVV+TYVFWN 
Sbjct  23    LVQCTVTYDRRAIVINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVVETYVFWNV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+F+K  Q+A LY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HEPSPGNYNFEGRYDLVRFLKTIQKARLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AMQ FT  IV +MKS++L+ESQGGPIILSQIENEYG      GA G +Y  W
Sbjct  143   TDNEPFKRAMQGFTEKIVGLMKSEKLFESQGGPIILSQIENEYGAQSKLFGAAGHNYMTW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MAVGLGTGVPWVMCK++DAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WF+EF
Sbjct  203   AANMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDSFAPNKPYKPMIWTEAWSGWFSEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP +DLAYAVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+
Sbjct  263   GGPIHQRPVQDLAYAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHRAIK+CE ALVS DP + SLGN+Q+A V+ S+SG C+AFL+N++ 
Sbjct  323   GLIRQPKYGHLKELHRAIKMCERALVSADPIITSLGNFQQAYVYTSESGDCSAFLSNHDS  382

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVS-RGFSWQSYNE  1673
              S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P + +  SW+SY+E
Sbjct  383   KSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMEMLPTNIQMLSWESYDE  442

Query  1672  ETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + SS DD +T TA GLLEQIN TRD++DYLWY+T V I   E+FL+GG+ P L V S GH
Sbjct  443   DISSLDDSSTITAPGLLEQINVTRDSTDYLWYITSVDIGSSESFLRGGELPTLIVQSTGH  502

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+H+FINGQL G+S+G+ E+ + T++  V L AG N+I+LLS+AVGLPNVG HFE WN G
Sbjct  503   AVHIFINGQLSGSSFGTRESRRFTYTGKVNLHAGTNRIALLSVAVGLPNVGGHFEAWNTG  562

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             +LGPV+L GL++GK DL+WQKW+Y++GLKGE ++L S +  SSV+W+ GS  AQK QPLT
Sbjct  563   ILGPVALHGLDQGKWDLSWQKWTYQVGLKGEAMNLVSPNSISSVDWMRGSLAAQKQQPLT  622

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+KT F+AP G+EPLALDM  MGKGQIWINGQS+GRYW  +  + G C  C+YAG F   
Sbjct  623   WHKTLFNAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAF--ANGNCNGCSYAGGFRPP  680

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG+ +QR YHVPRSWL+P  NLLV FEE GG+P  +SLVKR V+SVCA++ E+ P
Sbjct  681   KCQVGCGQPTQRVYHVPRSWLKPMQNLLVIFEELGGDPSRISLVKRSVSSVCAEVAEYHP  740

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW +++ GKA     PK HL C  GQ I+SIKFASFGTP G+CGS+ EGTCHA  SY
Sbjct  741   TIKNWHIESYGKAEDFQSPKVHLRCNPGQAISSIKFASFGTPLGTCGSYQEGTCHATTSY  800

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + QK CIG   C V ++   F GDPCP V+K+LSVE VC+
Sbjct  801   SVLQKKCIGKQRCAVTISNSNF-GDPCPKVLKRLSVEAVCA  840



>ref|XP_010649088.1| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI17431.3| unnamed protein product [Vitis vinifera]
Length=845

 Score =  1132 bits (2929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/821 (65%), Positives = 657/821 (80%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   SV+YD+ + +INGQR+IL+SGSIHYPRSTP+MW D+++KAK+GGLDVV+TYVFWN 
Sbjct  23    LIQCSVTYDRKAIVINGQRRILISGSIHYPRSTPDMWEDIIQKAKDGGLDVVETYVFWNV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+FI+  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HEPSPGSYNFEGRYDLVRFIRTVQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AMQ FT  IV +MKS+RL+ESQGGPIILSQIENEYG     LG  G  Y  W
Sbjct  143   TDNEPFKRAMQGFTEKIVGLMKSERLFESQGGPIILSQIENEYGVQSKLLGDAGHDYMTW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MAVGLGTGVPWVMCK++DAPDPV+N CNGFYCD FSPNK YKP +WTEAW+ WF EF
Sbjct  203   AANMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDAFSPNKPYKPTIWTEAWSGWFNEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+
Sbjct  263   GGPLHQRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHR+IKLCE ALVS DP V SLG++Q+A V+ S +G CAAFL+N + 
Sbjct  323   GLVRQPKYGHLKELHRSIKLCERALVSADPIVSSLGSFQQAHVYSSDAGDCAAFLSNYDT  382

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q++ M+M P  +   SW+SY+E
Sbjct  383   KSSARVMFNNMHYNLPPWSISILPDCRNAVFNTAKVGVQTAHMEMLPTNAEMLSWESYDE  442

Query  1672  ETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + SS DD +TFT  GLLEQIN TRDASDYLWY+T + I   E+FL+GG+ P L + + GH
Sbjct  443   DISSLDDSSTFTTLGLLEQINVTRDASDYLWYITRIDIGSSESFLRGGELPTLILQTTGH  502

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+HVFINGQL G+++G+ E  + TF++ V L AG N I+LLS+AVGLPNVG HFETWN G
Sbjct  503   AVHVFINGQLTGSAFGTREYRRFTFTEKVNLHAGTNTIALLSVAVGLPNVGGHFETWNTG  562

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             +LGPV+L GLN+GK DL+WQ+W+YK+GLKGE ++L S +G SSV+W++GS  AQ+ QPLT
Sbjct  563   ILGPVALHGLNQGKWDLSWQRWTYKVGLKGEAMNLVSPNGISSVDWMQGSLAAQRQQPLT  622

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+K  F+AP G+EPLALDM  MGKGQ+WINGQS+GRYW  Y  + G C  C+Y+G +   
Sbjct  623   WHKAFFNAPEGDEPLALDMEGMGKGQVWINGQSIGRYWTAY--ANGNCQGCSYSGTYRPP  680

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG+ +QRWYHVPRSWL+PT NLLV FEE GG+P  +SLV+R + SVCAD++E+ P
Sbjct  681   KCQLGCGQPTQRWYHVPRSWLKPTQNLLVVFEELGGDPSRISLVRRSMTSVCADVFEYHP  740

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW +++ GK     +PK HL CG GQ I+SIKFAS+GTP G+CGSF +G CHA  SY
Sbjct  741   NIKNWHIESYGKTEELHKPKVHLRCGPGQSISSIKFASYGTPLGTCGSFEQGPCHAPDSY  800

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              I +K CIG   C V ++   F  DPCP+V+K+LSVE VC+
Sbjct  801   AIVEKRCIGRQRCAVTISNTNFAQDPCPNVLKRLSVEAVCA  841



>gb|AAW47739.1| beta-galactosidase [Prunus persica]
Length=853

 Score =  1131 bits (2926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/821 (65%), Positives = 659/821 (80%), Gaps = 6/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   +V+YD+ + +INGQR+IL+SGSIHYPRSTPEMW DL++KAK+GGLDVV+TYVFWN 
Sbjct  23    LVQCTVTYDRRAIVINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVVETYVFWNV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y F+GRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HEPSPGNYNFKGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AMQ FT  IV +MKS++L+ESQGGPIILSQIENEYG      GA G +Y  W
Sbjct  143   TDNEPFKRAMQGFTEKIVGLMKSEKLFESQGGPIILSQIENEYGAQSKLFGAAGHNYMTW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MAVGLGTGVPWVMCK++DAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WF+EF
Sbjct  203   AANMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDSFAPNKPYKPTIWTEAWSGWFSEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP +DLAYAVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+
Sbjct  263   GGPIHQRPVQDLAYAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHRAIK+CE ALVS DP + SLGN+Q+A V+ S+SG C+AFL+N++ 
Sbjct  323   GLIRQPKYGHLKELHRAIKMCERALVSADPIITSLGNFQQAYVYTSESGDCSAFLSNHDS  382

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVS-RGFSWQSYNE  1673
              S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M M P + +  SW+SY+E
Sbjct  383   KSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMGMLPTNIQMLSWESYDE  442

Query  1672  ETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + +S DD +T TA GLLEQIN TRD++DYLWY T V I   E+FL+GG+ P L V S GH
Sbjct  443   DITSLDDSSTITAPGLLEQINVTRDSTDYLWYKTSVDIGSSESFLRGGELPTLIVQSTGH  502

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+H+FINGQL G+S+G+ E+ + T++  V L AG N+I+LLS+AVGLPNVG HFE WN G
Sbjct  503   AVHIFINGQLSGSSFGTRESRRFTYTGKVNLHAGTNRIALLSVAVGLPNVGGHFEAWNTG  562

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             +LGPV+L GL++GK DL+WQKW+Y++GLKGE ++L S +  SSV+W+ GS  AQK QPLT
Sbjct  563   ILGPVALHGLDQGKWDLSWQKWTYQVGLKGEAMNLVSPNSISSVDWMRGSLAAQKQQPLT  622

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+KT F+AP G+EPLALDM  MGKGQIWINGQS+GRYW  +  + G C  C+YAG F   
Sbjct  623   WHKTLFNAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAF--ANGNCNGCSYAGGFRPP  680

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG+ +QR YHVPRSWL+P  NLLV FEE+GG+P  +SLVKR V+SVCA++ E+ P
Sbjct  681   KCQVGCGQPTQRVYHVPRSWLKPMQNLLVIFEEFGGDPSRISLVKRSVSSVCAEVAEYHP  740

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW +++ GKA     PK HL C  GQ I+SIKFASFGTP G+CGS+ EGTCHA  SY
Sbjct  741   TIKNWHIESYGKAEDFHSPKVHLRCNPGQAISSIKFASFGTPLGTCGSYQEGTCHAATSY  800

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + QK CIG   C V ++   F GDPCP V+K+LSVE VC+
Sbjct  801   SVLQKKCIGKQRCAVTISNSNF-GDPCPKVLKRLSVEAVCA  840



>gb|KHN27041.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =  1131 bits (2925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/818 (65%), Positives = 657/818 (80%), Gaps = 5/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL+ KAKEGGLDVV+TYVFWN HEP
Sbjct  25    ASVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGLDVVETYVFWNVHEP  84

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  85    SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  144

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ FT  IV MMKS+RL+ESQGGPIILSQIENEYG      G  G++Y  WAAK
Sbjct  145   EPFKTAMQGFTEKIVGMMKSERLFESQGGPIILSQIENEYGAQSKLQGDAGQNYVNWAAK  204

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAV +GTGVPWVMCK+DDAPDPV+N CNGFYCD F+PN+ YKP +WTEAW+ WFTEFGGP
Sbjct  205   MAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNRPYKPMIWTEAWSGWFTEFGGP  264

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             +  RP +DLA+AVA+FI++GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL+
Sbjct  265   IHKRPVQDLAFAVARFIIRGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLI  324

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LHRAIK+CE ALVS DP + SLG  Q+A V+ ++SG CAAFL+N +  S 
Sbjct  325   RQPKYGHLKELHRAIKMCERALVSTDPIITSLGESQQAHVYTTESGDCAAFLSNYDSKSS  384

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F NMHYNLPPWS+S+LPDC+N V+NTA+VG Q+S+M+M P  ++ FSW+S++E+  
Sbjct  385   ARVMFNNMHYNLPPWSVSVLPDCRNVVFNTAKVGVQTSQMQMLPTNTQLFSWESFDEDVY  444

Query  1663  SYDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S DD++  TA GLLEQIN T+DASDYLWY+T V I   E+FL+GG+ P L V S GHA+H
Sbjct  445   SVDDSSAITAPGLLEQINVTKDASDYLWYITSVDIGSSESFLRGGELPTLIVQSRGHAVH  504

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQL G++YG+ E  +  ++  V LRAG+N+I+LLS+A+GLPNVG HFE+W+ G+LG
Sbjct  505   VFINGQLSGSAYGTREYRRFMYTGKVNLRAGINRIALLSVAIGLPNVGEHFESWSTGILG  564

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYK  1130
             PV+L GL++GK DL+ QKW+Y++GLKGE + L S +G SSV W++ + + Q+ QPLTW+K
Sbjct  565   PVALHGLDQGKWDLSGQKWTYQVGLKGEAMDLASPNGISSVAWMQSAIVVQRNQPLTWHK  624

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             T FDAP G+EPLALDM  MGKGQIWINGQS+GRYW  +    G C  CNYAG F   KC 
Sbjct  625   THFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTTFAT--GNCNDCNYAGSFRPPKCQ  682

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CG+ +QRWYHVPRSWL+PT NLLV FEE GGNP  +SLVKR V+SVCAD+ E+ P + 
Sbjct  683   LGCGQPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKRSVSSVCADVSEYHPNIK  742

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW +++ GK+     PK HL C  GQ I+SIKFASFGTP G+CG++ +G CH+  SY I 
Sbjct  743   NWHIESYGKSEEFHPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEQGACHSPASYAIL  802

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K CIG   CTV V+   FG DPCP V+K+LSVE VC+
Sbjct  803   EKRCIGKPRCTVTVSNSNFGQDPCPKVLKRLSVEAVCA  840



>ref|XP_011083163.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=845

 Score =  1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/817 (66%), Positives = 660/817 (81%), Gaps = 5/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SV+YD+ + IINGQR+IL+SGSIHYPRSTPEMW DL+ KAKEGGLDV+ TYVFWN HEP 
Sbjct  28    SVTYDRKALIINGQRRILISGSIHYPRSTPEMWEDLINKAKEGGLDVIDTYVFWNVHEPS  87

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLVKF+K  Q+AGLY HLR+GPY CAEWNFGG PVWLK+VPG+SFRTDN 
Sbjct  88    PGNYNFEGRYDLVKFVKTIQKAGLYAHLRIGPYVCAEWNFGGLPVWLKFVPGISFRTDNE  147

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AM++FT  IVNMMK++ LYESQGGPIILSQIENEYGP    LGAPG+ Y  WAA M
Sbjct  148   PFKMAMKRFTKKIVNMMKTENLYESQGGPIILSQIENEYGPQANLLGAPGRQYVTWAANM  207

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCK+DDAPDPV+N CNGFYCD FSPNK YKP +WTEAWT WFTEFGGPV
Sbjct  208   AVGLDTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYKPMIWTEAWTGWFTEFGGPV  267

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP EDLA++VA+F+ KGGSF+NYYM+HGGTNFGR+AGGPFI TSYDYDAP+DE+GL+R
Sbjct  268   HQRPVEDLAFSVARFLQKGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPVDEYGLIR  327

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GH+K+LH+A+KLCE ALVS DP V SLG+ QEA V+ S+SG CAAFL+N + ++ A
Sbjct  328   QPKYGHMKELHKAVKLCERALVSADPTVTSLGSLQEAYVYSSESGDCAAFLSNYDTNTTA  387

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEE-TS  1664
              V F NMHY+LPPWSISILPDCKN V+NTA+VG Q+S+M+M P  +  FSW++YNE+ +S
Sbjct  388   GVMFNNMHYSLPPWSISILPDCKNVVFNTAKVGGQTSQMEMRPTDTEIFSWETYNEDLSS  447

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             S D +TF+  GLLEQIN TRD+SDYLWY T V I P E+FL+GG+ P L V S+GHALHV
Sbjct  448   SDDSSTFSTLGLLEQINVTRDSSDYLWYTTSVDISPSESFLRGGELPTLIVQSSGHALHV  507

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             F+NG+L G+++G++E  + TF+  V LR+G NKISLLS+AVGLP +G HFETWN G+LGP
Sbjct  508   FVNGELSGSAFGTMEKRRFTFTGKVNLRSGSNKISLLSVAVGLPYIGGHFETWNTGILGP  567

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKT  1127
             V+L GL++GK DL+W KW+Y++GLKGE ++L S S  SSV+W +GS +AQK QPL W+K 
Sbjct  568   VALRGLDQGKWDLSWAKWTYQVGLKGEAMNLVSPSSVSSVDWTKGSLVAQKQQPLAWHKA  627

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              F AP G+EPLALDM++MGKGQ+W+NGQS+GRYW  Y A  G C  C+Y G F  +KC  
Sbjct  628   YFSAPDGDEPLALDMSSMGKGQLWVNGQSLGRYWTAYAA--GDCSGCSYTGIFKPQKCQV  685

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QRWYH+PRSWL+PT NLLV FEE GG+P  + LVKR V SVCAD+ E+ P + N
Sbjct  686   GCGQPTQRWYHLPRSWLKPTQNLLVLFEEIGGDPTRIILVKRSVTSVCADVAEYHPNIKN  745

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W++++ GK     +P+ HL CG GQ I+SIKFASFGTP G+CGSF +GTCHA  SY +  
Sbjct  746   WQVESYGKMEEFRKPRVHLHCGPGQSISSIKFASFGTPLGTCGSFQQGTCHAPTSYTVLA  805

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K CIG   C+V ++   FG DPCP++ K+LSVE +C+
Sbjct  806   KKCIGQQRCSVTISNRNFGRDPCPNISKRLSVEAICA  842



>ref|XP_003548865.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =  1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/818 (65%), Positives = 656/818 (80%), Gaps = 5/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL+ KAKEGGLDVV+TYVFWN HEP
Sbjct  25    ASVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGLDVVETYVFWNVHEP  84

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  85    SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  144

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ FT  IV MMKS+RL+ESQGGPIILSQIENEYG      G  G++Y  WAAK
Sbjct  145   EPFKTAMQGFTEKIVGMMKSERLFESQGGPIILSQIENEYGAQSKLQGDAGQNYVNWAAK  204

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAV +GTGVPWVMCK+DDAPDPV+N CNGFYCD F+PN+ YKP +WTEAW+ WFTEFGGP
Sbjct  205   MAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNRPYKPMIWTEAWSGWFTEFGGP  264

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             +  RP +DLA+AVA+FI++GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL+
Sbjct  265   IHKRPVQDLAFAVARFIIRGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLI  324

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LHRAIK+CE ALVS DP + SLG  Q+A V+ ++SG CAAFL+N +  S 
Sbjct  325   RQPKYGHLKELHRAIKMCERALVSTDPIITSLGESQQAHVYTTESGDCAAFLSNYDSKSS  384

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F NMHYNLPPWS+SILPDC+N V+NTA+VG Q+S+M+M P  ++ FSW+S++E+  
Sbjct  385   ARVMFNNMHYNLPPWSVSILPDCRNVVFNTAKVGVQTSQMQMLPTNTQLFSWESFDEDVY  444

Query  1663  SYDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S DD++   A GLLEQIN T+DASDYLWY+T V I   E+FL+GG+ P L V S GHA+H
Sbjct  445   SVDDSSAIMAPGLLEQINVTKDASDYLWYITSVDIGSSESFLRGGELPTLIVQSRGHAVH  504

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQL G++YG+ E  +  ++  V LRAG+N+I+LLS+A+GLPNVG HFE+W+ G+LG
Sbjct  505   VFINGQLSGSAYGTREYRRFMYTGKVNLRAGINRIALLSVAIGLPNVGEHFESWSTGILG  564

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYK  1130
             PV+L GL++GK DL+ QKW+Y++GLKGE + L S +G SSV W++ + + Q+ QPLTW+K
Sbjct  565   PVALHGLDQGKWDLSGQKWTYQVGLKGEAMDLASPNGISSVAWMQSAIVVQRNQPLTWHK  624

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             T FDAP G+EPLALDM  MGKGQIWINGQS+GRYW  +    G C  CNYAG F   KC 
Sbjct  625   THFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTTFAT--GNCNDCNYAGSFRPPKCQ  682

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CG+ +QRWYHVPRSWL+PT NLLV FEE GGNP  +SLVKR V+SVCAD+ E+ P + 
Sbjct  683   LGCGQPTQRWYHVPRSWLKPTQNLLVIFEELGGNPSKISLVKRSVSSVCADVSEYHPNIK  742

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW +++ GK+     PK HL C  GQ I+SIKFASFGTP G+CG++ +G CH+  SY I 
Sbjct  743   NWHIESYGKSEEFHPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEQGACHSPASYAIL  802

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K CIG   CTV V+   FG DPCP V+K+LSVE VC+
Sbjct  803   EKRCIGKPRCTVTVSNSNFGQDPCPKVLKRLSVEAVCA  840



>ref|XP_002510455.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF52642.1| beta-galactosidase, putative [Ricinus communis]
Length=846

 Score =  1129 bits (2920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/821 (66%), Positives = 650/821 (79%), Gaps = 6/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   +V+YDK + IINGQR+IL+SGSIHYPRSTPEMW DL++KAK+GGLDV+ TYVFW+ 
Sbjct  23    LVQCTVTYDKKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVIDTYVFWDV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HE  PG Y F+GRYDLV+FIK  Q+ GLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HETSPGNYNFDGRYDLVRFIKTVQKVGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFKAAMQ FT  IV MMK++ L+ SQGGPIILSQIENEYGP    LGA G+SY  W
Sbjct  143   TDNEPFKAAMQGFTQKIVQMMKNENLFASQGGPIILSQIENEYGPESRALGAAGRSYINW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AAKMAVGL TGVPWVMCK+DDAPDP++N CNGFYCD F+PNK YKP +WTEAW+ WFTEF
Sbjct  203   AAKMAVGLDTGVPWVMCKEDDAPDPMINTCNGFYCDAFAPNKPYKPTLWTEAWSGWFTEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP EDLA+AVA+FI KGGS+ NYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+
Sbjct  263   GGPIHQRPVEDLAFAVARFIQKGGSYFNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+REPK+GHLK LH+AIKLCE ALVS DP++ SLG YQ+A VF S   +CAAFLAN N 
Sbjct  323   GLIREPKYGHLKALHKAIKLCEHALVSSDPSITSLGTYQQAHVFSSGR-SCAAFLANYNA  381

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F NMHY+LPPWSISILPDC+N V+NTARVGAQ+ RM+M P  S  FSW++Y+E
Sbjct  382   KSAARVMFNNMHYDLPPWSISILPDCRNVVFNTARVGAQTLRMQMLPTGSELFSWETYDE  441

Query  1672  ETSSYDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             E SS  D++  TA GLLEQIN TRD SDYLWY+T V I P EAFL+ G+ P LTV SAGH
Sbjct  442   EISSLTDSSRITALGLLEQINVTRDTSDYLWYLTSVDISPSEAFLRNGQKPSLTVQSAGH  501

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
              LHVFINGQ  G+++G+ EN ++TF+  V LRAG N+I+LLSIAVGLPNVG H+ETW  G
Sbjct  502   GLHVFINGQFSGSAFGTRENRQLTFTGPVNLRAGTNRIALLSIAVGLPNVGLHYETWKTG  561

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFI-AQKQPLT  1139
             V GPV L+GLN+GK+DLTWQKWSY++GLKGE ++L S +G SSV+W+EGS   +Q Q L 
Sbjct  562   VQGPVLLNGLNQGKKDLTWQKWSYQVGLKGEAMNLVSPNGVSSVDWIEGSLASSQGQALK  621

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+K  FDAP GNEPLALDM +MGKGQ+WINGQS+GRYW  Y  + G C +C+Y   F   
Sbjct  622   WHKAYFDAPRGNEPLALDMRSMGKGQVWINGQSIGRYWMAY--AKGDCNSCSYIWTFRPS  679

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CGE +QRWYHVPRSWL+PT NLLV FEE GG+   +SLVKR +  VCAD YE  P
Sbjct  680   KCQLGCGEPTQRWYHVPRSWLKPTKNLLVVFEELGGDASKISLVKRSIEGVCADAYEHHP  739

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
                N+    + ++++  + K HL C  GQ I +IKFASFGTP G+CGSF +GTCHA +++
Sbjct  740   ATKNYNTGGNDESSKLHQAKIHLRCAPGQFIAAIKFASFGTPSGTCGSFQQGTCHAPNTH  799

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + +K CIG  SC V ++   FG DPCP+V+KKLSVE VCS
Sbjct  800   SVIEKKCIGQESCMVTISNSNFGADPCPNVLKKLSVEAVCS  840



>ref|XP_009145073.1| PREDICTED: beta-galactosidase 3 [Brassica rapa]
Length=856

 Score =  1129 bits (2919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/827 (64%), Positives = 652/827 (79%), Gaps = 8/827 (1%)
 Frame = -2

Query  2947  GTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQT  2768
             G  +V  G   V+YD+ + +INGQR+IL SGSIHYPRSTP+MW  L++KAK+GG+DV++T
Sbjct  25    GVGFVQCG---VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIET  81

Query  2767  YVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYV  2588
             YVFWN HEP PGKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYV
Sbjct  82    YVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYV  141

Query  2587  PGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPG  2408
             PG+SFRTDN PFK AMQ FT  IV +MKS+ LYESQGGPIILSQIENEYG     LGA G
Sbjct  142   PGISFRTDNEPFKRAMQGFTERIVQLMKSENLYESQGGPIILSQIENEYGRQGQLLGAEG  201

Query  2407  KSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWT  2228
              +Y  WAAKMA+   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+
Sbjct  202   HNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPLIWTEAWS  261

Query  2227  AWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYD  2048
              WFTEFGGP+ +RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYD
Sbjct  262   GWFTEFGGPMHHRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYD  321

Query  2047  APIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAF  1868
             APIDE+GL+REPK+GHLK+LHRAIK+CE ALVS DP V SLGN Q+A V+ S+SG C+AF
Sbjct  322   APIDEYGLIREPKYGHLKELHRAIKMCEKALVSTDPVVTSLGNKQQAHVYSSESGECSAF  381

Query  1867  LANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSR-GFS  1691
             LAN +  S A+V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P S   F 
Sbjct  382   LANYDTESAARVLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTSTPNFQ  441

Query  1690  WQSYNEETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLT  1514
             WQSY E+ SS DD +TFT  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L 
Sbjct  442   WQSYLEDLSSLDDSSTFTTQGLLEQINVTRDTSDYLWYMTSVDIGSTESFLHGGELPTLI  501

Query  1513  VYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHF  1334
             + S GHA+H+F+NGQL G+++G+ +N + T+   + L +G N+I+LLS+AVGLPNVG HF
Sbjct  502   IQSTGHAVHIFVNGQLSGSAFGTRQNRRFTYRGKINLHSGTNRIALLSVAVGLPNVGGHF  561

Query  1333  ETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ  1154
             E+WN G+LGPV+L GL++GKRDL+WQKW+Y++GLKGE ++L   + + S  W++ S +AQ
Sbjct  562   ESWNTGILGPVALHGLSQGKRDLSWQKWTYQVGLKGEAMNLAYPTNTPSNGWMDASLVAQ  621

Query  1153  K-QPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYA  977
             K QPLTW+K  FDAP GNEPLALDM  MGKGQ+W+NG+S+GRYW  +    G CG C+Y 
Sbjct  622   KSQPLTWHKAYFDAPEGNEPLALDMEGMGKGQVWVNGESIGRYWTAFAT--GDCGHCSYT  679

Query  976   GWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCAD  797
             G +   KCLS CG+ +QR+YHVPRSWL+P+ NLLV FEE GGNP  VSLVKR V+ VCA+
Sbjct  680   GTYKPNKCLSGCGQPTQRYYHVPRSWLKPSQNLLVIFEELGGNPSAVSLVKRSVSGVCAE  739

Query  796   IYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTC  617
             + E+ P + NW++++ GK     RPK HL C  GQ I++IKFASFGTP G CGS+ +G C
Sbjct  740   VSEYHPNIKNWQIESYGKGQTFRRPKVHLKCSPGQAISAIKFASFGTPLGKCGSYQQGEC  799

Query  616   HAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             HA  SY I ++ C+G   C V ++   FG DPCP+V+K+L+VE VCS
Sbjct  800   HATTSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCS  846



>ref|XP_003517202.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=849

 Score =  1129 bits (2919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/819 (65%), Positives = 652/819 (80%), Gaps = 7/819 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL+ KAKEGGLDV++TYVFWN HEP 
Sbjct  31    SVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGGLDVIETYVFWNVHEPS  90

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
              G Y FEGRYDLV+F+K  Q+AGLY +LR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  91    RGNYNFEGRYDLVRFVKTIQKAGLYANLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  150

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV MMKS+RLYESQGGPIILSQIENEYG     LG+ G++Y  WAAKM
Sbjct  151   PFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQIENEYGAQSKLLGSAGQNYVNWAAKM  210

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AV  GTGVPWVMCK+DDAPDPV+N CNGFYCD+F+PNK YKP +WTEAW+ WF+EFGGP 
Sbjct  211   AVETGTGVPWVMCKEDDAPDPVINTCNGFYCDYFTPNKPYKPSIWTEAWSGWFSEFGGPN  270

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLA+ VA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+R
Sbjct  271   HERPVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLIR  330

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LH+AIK+CE ALVS DP V SLGN+Q+A V+ +KSG CAAFL+N +  S  
Sbjct  331   QPKYGHLKELHKAIKMCERALVSTDPAVTSLGNFQQAHVYSAKSGDCAAFLSNFDTKSSV  390

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  +R FSW+S++E+ SS
Sbjct  391   RVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPTNTRMFSWESFDEDISS  450

Query  1660  YDDN---TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              DD    T T +GLLEQIN TRD SDYLWY+T V I   E+FL+GGK P L V S GHA+
Sbjct  451   LDDGSSITTTTSGLLEQINVTRDTSDYLWYITSVDIGSSESFLRGGKLPTLIVQSTGHAV  510

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQL G++YG+ E+ + T++  V LRAG N+I+LLS+AVGLPNVG HFETWN G+L
Sbjct  511   HVFINGQLSGSAYGTREDRRFTYTGTVNLRAGTNRIALLSVAVGLPNVGGHFETWNTGIL  570

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWY  1133
             GPV L G ++GK DL+WQKW+Y++GLKGE ++L S +G SSVEW++ + ++ K QPLTW+
Sbjct  571   GPVVLRGFDQGKLDLSWQKWTYQVGLKGEAMNLASPNGISSVEWMQSALVSDKNQPLTWH  630

Query  1132  KTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKC  953
             KT FDAP G+EPLALDM  MGKGQIWING S+GRYW    A  G C  C+YAG F   KC
Sbjct  631   KTYFDAPDGDEPLALDMEGMGKGQIWINGLSIGRYWTALAA--GNCNGCSYAGTFRPPKC  688

Query  952   LSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQL  773
                CG+ +QRWYHVPRSWL+P  NLLV FEE GG+P  +SLVKR V+SVCAD+ E+ P +
Sbjct  689   QVGCGQPTQRWYHVPRSWLKPDHNLLVVFEELGGDPSKISLVKRSVSSVCADVSEYHPNI  748

Query  772   MNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDI  593
              NW + + GK+     PK HL C  GQ I+SIKFASFGTP G+CG++ +G CH+  S+  
Sbjct  749   RNWHIDSYGKSEEFHPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEKGVCHSSTSHAT  808

Query  592   FQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              +K CIG   CTV V+   FG DPCP+V+K+LSVE VC+
Sbjct  809   LEKKCIGKPRCTVTVSNSNFGQDPCPNVLKRLSVEAVCA  847



>ref|XP_003538867.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=853

 Score =  1128 bits (2918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/819 (65%), Positives = 650/819 (79%), Gaps = 7/819 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL+ KAKEGGLDV++TY+FWN HEP 
Sbjct  31    SVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGGLDVIETYIFWNVHEPS  90

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
              G Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  91    RGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  150

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV MMKS+RLYESQGGPIILSQIENEYG     LG  G++Y  WAAKM
Sbjct  151   PFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQIENEYGAQSKLLGPAGQNYVNWAAKM  210

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AV  GTGVPWVMCK+DDAPDPV+N CNGFYCD+F+PNK YKP +WTEAW+ WF+EFGGP 
Sbjct  211   AVETGTGVPWVMCKEDDAPDPVINTCNGFYCDYFTPNKPYKPSIWTEAWSGWFSEFGGPN  270

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLA+ VA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+R
Sbjct  271   HERPVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLIR  330

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LH+AIK+CE ALVS DP V S+GN+Q+A V+ +KSG CAAFL+N +  S  
Sbjct  331   QPKYGHLKELHKAIKMCERALVSADPAVTSMGNFQQAHVYTTKSGDCAAFLSNFDTKSSV  390

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  +  FSW+S++E+ SS
Sbjct  391   RVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPTNTHMFSWESFDEDISS  450

Query  1660  YDDN---TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              DD    T T +GLLEQIN TRD SDYLWY+T V I   E+FL+GGK P L V S GHA+
Sbjct  451   LDDGSAITITTSGLLEQINVTRDTSDYLWYITSVDIGSSESFLRGGKLPTLIVQSTGHAV  510

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQL G++YG+ E+ +  ++  V LRAG N+I+LLS+AVGLPNVG HFETWN G+L
Sbjct  511   HVFINGQLSGSAYGTREDRRFRYTGTVNLRAGTNRIALLSVAVGLPNVGGHFETWNTGIL  570

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWY  1133
             GPV L GLN+GK DL+WQKW+Y++GLKGE ++L S +G SSVEW++ + +++K QPLTW+
Sbjct  571   GPVVLRGLNQGKLDLSWQKWTYQVGLKGEAMNLASPNGISSVEWMQSALVSEKNQPLTWH  630

Query  1132  KTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKC  953
             KT FDAP G+EPLALDM  MGKGQIWING S+GRYW    A  G C  C+YAG F   KC
Sbjct  631   KTYFDAPDGDEPLALDMEGMGKGQIWINGLSIGRYWTAPAA--GICNGCSYAGTFRPPKC  688

Query  952   LSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQL  773
                CG+ +QRWYHVPRSWL+P  NLLV FEE GG+P  +SLVKR V+S+CAD+ E+ P +
Sbjct  689   QVGCGQPTQRWYHVPRSWLKPNHNLLVVFEELGGDPSKISLVKRSVSSICADVSEYHPNI  748

Query  772   MNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDI  593
              NW + + GK+     PK HL C   Q I+SIKFASFGTP G+CG++ +G CH+  SY  
Sbjct  749   RNWHIDSYGKSEEFHPPKVHLHCSPSQAISSIKFASFGTPLGTCGNYEKGVCHSPTSYAT  808

Query  592   FQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              +K CIG   CTV V+   FG DPCP+V+K+LSVE VCS
Sbjct  809   LEKKCIGKPRCTVTVSNSNFGQDPCPNVLKRLSVEAVCS  847



>gb|KDP33831.1| hypothetical protein JCGZ_07402 [Jatropha curcas]
Length=825

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/824 (67%), Positives = 662/824 (80%), Gaps = 10/824 (1%)
 Frame = -2

Query  2944  TSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             +SW+S  TA+V+YD  + IINGQR+IL+SGSIHYPRSTPEMWP L++KAKEGGLDV+QTY
Sbjct  11    SSWISSATATVTYDHKAVIINGQRRILISGSIHYPRSTPEMWPGLIQKAKEGGLDVIQTY  70

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFW+GHEP  G+YYFE RYD+VKFIKL QQAGLYVHLR+GPY CAEWNFGGFP+WLKY+P
Sbjct  71    VFWDGHEPNQGQYYFEDRYDIVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPLWLKYIP  130

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G+ FRTDNGPFKAAMQKFTT IV+MMK+++L+E QGGPIILSQIENEYGP+E+E+GAPGK
Sbjct  131   GIEFRTDNGPFKAAMQKFTTKIVDMMKAEKLFEPQGGPIILSQIENEYGPIEWEIGAPGK  190

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y +WAA MAVGL TGVPW+MCKQDDAPDP ++ CNGFYC+ + PNK YKPKMWTE WT 
Sbjct  191   AYTKWAAAMAVGLNTGVPWIMCKQDDAPDPTIDTCNGFYCEAYVPNKNYKPKMWTENWTG  250

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             W+TE+G PVPYRP ED A++VA+FI   GSF+NYYM+HGGTNFGRTA G F+ATSYDYDA
Sbjct  251   WYTEWGAPVPYRPPEDTAFSVARFIANKGSFVNYYMYHGGTNFGRTA-GLFMATSYDYDA  309

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DE+GL  +PKWGHL+DLH+AIKLCEPAL+S DP V SLG  QEA V+++K+ ACAAFL
Sbjct  310   PLDEYGLPHDPKWGHLRDLHKAIKLCEPALISVDPEVKSLGKNQEAHVYQTKT-ACAAFL  368

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN +     KV F N+ Y LPPWSIS+LPDCK  V+NTAR+GAQS++M M PV +GFSW+
Sbjct  369   ANYDTQYSVKVNFWNVEYWLPPWSISVLPDCKTAVFNTARMGAQSTQMWMMPVIKGFSWE  428

Query  1684  SYNE-ETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             SY +  T+ Y   TFT  GL EQ   T D +DYLWYMT+V IDP E FLK G+ P LTV 
Sbjct  429   SYKDVVTTGYGAGTFTHDGLWEQKFLTADKTDYLWYMTNVNIDPNEGFLKNGQNPLLTVQ  488

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             SAGH LHVFINGQ  GT +GSLE P++TFS+ V L AG NKISLLS  VGL NVG H++T
Sbjct  489   SAGHVLHVFINGQYAGTQHGSLEEPRITFSQKVKLNAGTNKISLLSATVGLANVGLHYDT  548

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WNAGVLGPV+L GLN+G  D++  KWSYKIGL GE L L + +GSSSV+W +GS + +KQ
Sbjct  549   WNAGVLGPVTLQGLNKGTLDMSKWKWSYKIGLGGEDLKLPTFAGSSSVKWAQGSQLVKKQ  608

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYK TFDAP+GN+PLALDM++MGKGQ++INGQS+GR+WP   A  G+C  C Y G +
Sbjct  609   PLTWYKATFDAPSGNDPLALDMSSMGKGQVYINGQSIGRHWPANTAR-GSCNDCGYEGTY  667

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
              +KKC SKCG  SQ++YHVPRSWL+P GNLLV  EE GG+P G+S+VKR V +VCADIY+
Sbjct  668   TDKKCKSKCGGPSQQYYHVPRSWLKPKGNLLVVLEEIGGDPTGISMVKRIVGAVCADIYD  727

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
              QP + NW+         P +PKAHL C  GQ ++ I  AS+G+P+G CG FS+G+CHA 
Sbjct  728   DQPAVKNWQQ------IVPTKPKAHLWCPPGQTMSKINLASYGSPKGRCGYFSQGSCHAQ  781

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              S+D FQK CIG  SC V V P+ FGGDPCP   KKLSVE+ CS
Sbjct  782   KSWDPFQKACIGKQSCEVVVDPQNFGGDPCPGSPKKLSVEIQCS  825



>ref|XP_006425593.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
 ref|XP_006466876.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
 gb|ESR38833.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
Length=854

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/817 (65%), Positives = 652/817 (80%), Gaps = 5/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL++KAK+GGLDV++TYVFWN HEP 
Sbjct  27    SVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGLDVIETYVFWNVHEPS  86

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+FIK  ++AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  87    PGNYNFEGRYDLVRFIKTIKKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  146

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IVN+MKS+ L+ESQGGPIILSQIENEYG    +LGA G +Y  WAAKM
Sbjct  147   PFKRAMQGFTEKIVNLMKSENLFESQGGPIILSQIENEYGAQSKQLGAAGHNYMTWAAKM  206

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AV +GTGVPWVMCK++DAPDPV+N+CNGFYCD F+PN+ YKP +WTEAW+ WFTEFGGP+
Sbjct  207   AVEMGTGVPWVMCKEEDAPDPVINSCNGFYCDAFTPNQPYKPTIWTEAWSGWFTEFGGPI  266

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLA+A A+FI KGGSFINYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+GL+R
Sbjct  267   HQRPVQDLAFAAARFIQKGGSFINYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEYGLIR  326

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LHRAIK+CE ALVS DP V SLG +Q+A V+ S+SG CAAFL+N +  S A
Sbjct  327   QPKYGHLKELHRAIKMCERALVSADPIVTSLGGFQQAHVYSSESGDCAAFLSNYDTKSAA  386

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSIS+LPDC+N V+NTA+VG Q+S+M+M P  +  FSW+SY E+ SS
Sbjct  387   RVLFNNMHYNLPPWSISVLPDCRNVVFNTAKVGVQTSQMEMLPANAEMFSWESYFEDISS  446

Query  1660  YDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              DD +TFT  GLLEQIN TRDASDYLWY+T V I   E+FL GG+ P L V S GHALH+
Sbjct  447   LDDSSTFTTQGLLEQINVTRDASDYLWYITSVDIGSSESFLHGGELPTLIVQSTGHALHI  506

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G+++G+ E  K  ++  V LRAG NKI+LLS+AVGLPNVG H+ETWN G+LGP
Sbjct  507   FINGQLSGSAFGTREARKFMYTGKVNLRAGRNKIALLSVAVGLPNVGGHYETWNTGILGP  566

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKT  1127
             V+L GL++GK DL+WQKW+Y++GL+GE ++L S +G SSVEW++ S   Q+ QPL W+K 
Sbjct  567   VALHGLDQGKWDLSWQKWTYQVGLRGEAMNLVSPNGISSVEWMQASLAVQRQQPLMWHKA  626

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              F+AP G+EPLALDM  MGKGQIWINGQSVGRYW  Y  + G C  CNY G +   KC  
Sbjct  627   YFNAPEGDEPLALDMEGMGKGQIWINGQSVGRYWTAY--AKGDCNGCNYVGGYRPTKCQL  684

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QRWYHVPRSWL+PT N LV FEE GGNP  +SLVKR V SVCA++ E+ P + N
Sbjct  685   GCGQPTQRWYHVPRSWLKPTQNFLVVFEELGGNPSRISLVKRSVTSVCAEVAEYHPTIKN  744

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W +++ GK      PK HL C  G  I+SIKFASFGTP G+CGS+ +G CH+  SYDI +
Sbjct  745   WHIESYGKPEEFHSPKVHLRCSPGHTISSIKFASFGTPLGTCGSYQQGPCHSPTSYDILE  804

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K C+G   C V ++   FG DPCP+V+K+LSVE +CS
Sbjct  805   KKCVGKQRCAVTISNSNFGVDPCPNVLKRLSVEAICS  841



>ref|XP_008338023.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
 ref|XP_008367947.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =  1127 bits (2916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/817 (65%), Positives = 654/817 (80%), Gaps = 6/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YD+ + +INGQR+IL+SGSIHYPRSTPE W DL++KAK+GGLDVV+TYVFWN HEP 
Sbjct  27    AVTYDRKAIVINGQRRILISGSIHYPRSTPEXWEDLIQKAKDGGLDVVETYVFWNVHEPT  86

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  87    PGNYNFEGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  146

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV +MKS+ L+ESQGGPIILSQIENEYG      GA G +Y  WAA+M
Sbjct  147   PFKRAMQGFTQKIVGLMKSESLFESQGGPIILSQIENEYGAQSKLFGAAGHNYITWAAEM  206

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCK++DAPDPV+N CNGFYCD FSPNK YKP +WTE W+ WFTEFGGP+
Sbjct  207   AVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDSFSPNKPYKPTIWTETWSGWFTEFGGPI  266

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLAYAVA FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+R
Sbjct  267   HQRPVQDLAYAVATFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLIR  326

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LH+AIK+CE ALVS DP + SLGN+Q+A V+ S+SG C+AFL+N++  S A
Sbjct  327   QPKYGHLKELHKAIKMCERALVSADPIITSLGNFQQAYVYTSESGDCSAFLSNHDSKSAA  386

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVS-RGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P +    SW+SY+E+ +S
Sbjct  387   RVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPTNIPMLSWESYDEDLTS  446

Query  1660  YDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              DD +T TA GLLEQIN TRD++DYLWY+T V ID  E+FL GG+ P L V S GHA+H+
Sbjct  447   LDDSSTMTAPGLLEQINVTRDSTDYLWYITSVDIDSSESFLHGGELPTLIVQSTGHAVHI  506

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G+++G+  + + T++  V LRAG N+I+LLS+AVGLPNVG HFE WN G+LGP
Sbjct  507   FINGQLTGSAFGTRVSRRFTYTGKVNLRAGTNRIALLSVAVGLPNVGGHFEAWNTGILGP  566

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKT  1127
             V L GLN+GK DL+WQKW+Y++GLKGE ++L S +  SSVEW+ GS IAQK QPLTW+KT
Sbjct  567   VVLHGLNQGKWDLSWQKWTYQVGLKGEAMNLASPNAFSSVEWIGGSLIAQKQQPLTWHKT  626

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              F+ P G+EPLALDM  MGKGQIWINGQS+GRYW  +  + G C  C+YAG F   KC  
Sbjct  627   IFNEPEGSEPLALDMEGMGKGQIWINGQSIGRYWTAF--ANGNCNGCSYAGGFRPTKCQL  684

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QR+YHVPRSWL+PT NLLV FEE GG+P  +SLVKR V+SVC+++ E+ P + N
Sbjct  685   GCGKPTQRYYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRAVSSVCSEVAEYHPTIKN  744

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W +++ GK      PK HL C  GQ I+SIKFASFGTP G+CGS+ EGTCHA  SY + Q
Sbjct  745   WHIESYGKVEDFHSPKVHLRCNPGQAISSIKFASFGTPLGTCGSYQEGTCHATTSYSVLQ  804

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K CIG   C V ++   F GDPCP V+K+LSVE VC+
Sbjct  805   KKCIGKQRCAVTISNSNF-GDPCPKVLKRLSVEAVCA  840



>ref|XP_008230925.1| PREDICTED: beta-galactosidase-like [Prunus mume]
Length=808

 Score =  1127 bits (2916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/824 (67%), Positives = 657/824 (80%), Gaps = 34/824 (4%)
 Frame = -2

Query  2941  SWV-SLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTY  2765
             SW+ S  TASVSYD  S IING+++IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTY
Sbjct  17    SWLASACTASVSYDHRSIIINGRKRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTY  76

Query  2764  VFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVP  2585
             VFWNGHEP PG+YYFE RYDLVKFIKL  QAGLYV+LR+GPY CAEWNFGGFPVWLK+VP
Sbjct  77    VFWNGHEPSPGQYYFEDRYDLVKFIKLVHQAGLYVNLRIGPYVCAEWNFGGFPVWLKFVP  136

Query  2584  GVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGK  2405
             G++FRTDN PFKAAMQ FT  IV MMK++ L++SQGGPIILSQIENEYGP+E+E+GAPGK
Sbjct  137   GIAFRTDNEPFKAAMQTFTEKIVGMMKAESLFQSQGGPIILSQIENEYGPVEWEIGAPGK  196

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y  WAA+MAV L  GVPW+MCKQ+DAPDP++N CNGFYC  F+P K YKPKMWTE WT 
Sbjct  197   AYTNWAAQMAVNLNIGVPWIMCKQEDAPDPIINTCNGFYCQNFTPTKKYKPKMWTEVWTG  256

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             W+TEFGG VP RPAEDLA++VA FI  GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYD+
Sbjct  257   WYTEFGGAVPTRPAEDLAFSVAMFIQNGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDS  316

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DEFGL REPKWGHL+DLHRAIKL E ALVS DP+VISLG +QEA VFKS S  CAAFL
Sbjct  317   PLDEFGLPREPKWGHLRDLHRAIKLSESALVSADPSVISLGRHQEAHVFKS-SYQCAAFL  375

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQ  1685
             AN + +   +V FG+  Y+LPPWSISILPDCK  VYNTAR+GAQSS+MKMTPV+   SWQ
Sbjct  376   ANYDTNYSVEVRFGDGQYDLPPWSISILPDCKTAVYNTARLGAQSSQMKMTPVNNALSWQ  435

Query  1684  SYNEETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             S+ EET+S DD +TFT  GL +QIN T D++DYLWYMTD+ I P E FL+          
Sbjct  436   SFTEETASSDDPDTFTLDGLRDQINMTWDSTDYLWYMTDITISPDEGFLE----------  485

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
                              +YGSLE  ++ FS  V LR+G+NK++LLS+++GLPN+G HFET
Sbjct  486   -----------------TYGSLEKRRLRFSDNVRLRSGINKLALLSVSLGLPNIGLHFET  528

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ  1148
             WN GVLGPV+L GLN G RDL+ +KW+YK+GLKGE LSLH+++GSSSVEWV+  ++A+K 
Sbjct  529   WNVGVLGPVTLQGLNSGTRDLSQRKWTYKVGLKGEALSLHTVNGSSSVEWVQKPYLAKKP  588

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYK TFDAP+GN+PLALDM +MGKGQIWING+S+GR+WP Y A  GAC  C YAG +
Sbjct  589   PLTWYKATFDAPSGNDPLALDMVSMGKGQIWINGRSIGRHWPAYTAH-GACHYCYYAGTY  647

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
             +E KCL+KCGE SQRWYHVPR WL P+GNLLVAFEEWGG P  ++L +R  + VCADI+E
Sbjct  648   NENKCLTKCGEPSQRWYHVPRGWLNPSGNLLVAFEEWGGEPTKIALAQRATSCVCADIFE  707

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
              QP L + +  AS K    ++ KAHL C  GQ I+ IKFAS+G P+G+CGSF EG+CHA 
Sbjct  708   GQPTLQSSQKLASAKL---IKAKAHLRCQPGQIISDIKFASYGWPQGTCGSFKEGSCHAH  764

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              SYD  ++ CIG   CT+PV P  FGGDPCP   KK SVE VCS
Sbjct  765   KSYDFPRRICIGKQFCTIPVAPAYFGGDPCPGSAKKFSVEAVCS  808



>gb|KDO71052.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=854

 Score =  1127 bits (2915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/817 (65%), Positives = 651/817 (80%), Gaps = 5/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL++KAK+GGLDV++TYVFWN HEP 
Sbjct  27    SVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGLDVIETYVFWNVHEPS  86

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+FIK  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  87    PGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  146

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IVN+MKS+ L+ESQGGPIILSQIENEYG     LGA G +Y  WAAKM
Sbjct  147   PFKRAMQGFTEKIVNLMKSENLFESQGGPIILSQIENEYGAQSKLLGAAGHNYMTWAAKM  206

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AV +GTGVPWVMCK++DAPDPV+N+CNGFYCD F+PN+ YKP +WTEAW+ WFTEFGGP+
Sbjct  207   AVEMGTGVPWVMCKEEDAPDPVINSCNGFYCDAFTPNQPYKPTIWTEAWSGWFTEFGGPI  266

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLA+A A+FI KGGSFINYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+GL+R
Sbjct  267   HQRPVQDLAFAAARFIQKGGSFINYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEYGLIR  326

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LHRAIK+CE ALVS DP V SLG +Q+A V+ S+SG CAAFL+N +  S A
Sbjct  327   QPKYGHLKELHRAIKMCERALVSADPIVTSLGGFQQAHVYSSESGDCAAFLSNYDTKSAA  386

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSIS+LPDC+N V+NTA+VG Q+S+M+M P  +  FSW+SY E+ SS
Sbjct  387   RVLFNNMHYNLPPWSISVLPDCRNVVFNTAKVGVQTSQMEMLPANAEMFSWESYFEDISS  446

Query  1660  YDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              DD +TFT  GLLEQIN TRDASDYLWY+T V I   E+FL GG+ P L V S GHALH+
Sbjct  447   LDDSSTFTTQGLLEQINVTRDASDYLWYITSVDIGSSESFLHGGELPTLIVQSTGHALHI  506

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G+++G+ E  +  ++  V LRAG NKI+LLS+AVGLPNVG H+ETWN G+LGP
Sbjct  507   FINGQLSGSAFGTREARRFMYTGKVNLRAGRNKIALLSVAVGLPNVGGHYETWNTGILGP  566

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKT  1127
             V+L GL++GK DL+WQKW+Y++GL+GE ++L S +G SSVEW++ S   Q+ QPL W+K 
Sbjct  567   VALHGLDQGKWDLSWQKWTYQVGLRGEAMNLVSPNGISSVEWMQASLAVQRQQPLMWHKA  626

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              F+AP G+EPLALDM  MGKGQIWINGQSVGRYW  Y  + G C  CNY G +   KC  
Sbjct  627   YFNAPEGDEPLALDMEGMGKGQIWINGQSVGRYWTAY--AKGDCNGCNYVGGYRPTKCQL  684

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QRWYHVPRSWL+PT N LV FEE GGNP  +SLVKR V SVCA++ E+ P + N
Sbjct  685   GCGQPTQRWYHVPRSWLKPTQNFLVVFEELGGNPSRISLVKRSVTSVCAEVAEYHPTIKN  744

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W +++ GK      PK HL C  G  I+SIKFASFGTP G+CGS+ +G CH+  SYDI +
Sbjct  745   WHIESYGKPEEFHSPKVHLRCSPGHTISSIKFASFGTPLGTCGSYQQGPCHSPTSYDILE  804

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K C+G   C V ++   FG DPCP+V+K+LSVE +CS
Sbjct  805   KKCVGKQRCAVTISNSNFGVDPCPNVLKRLSVEAICS  841



>gb|KHN36067.1| Beta-galactosidase 3 [Glycine soja]
Length=849

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/819 (65%), Positives = 651/819 (79%), Gaps = 7/819 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL+ KAKEGGLDV++TYVFWN HEP 
Sbjct  31    SVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGGLDVIETYVFWNVHEPS  90

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
              G Y FEGRYDLV+F+K  Q+AGLY +LR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  91    RGNYNFEGRYDLVRFVKTIQKAGLYANLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  150

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV MMKS+RLYESQGGPIILSQIENEYG     LG+ G++Y  WAAKM
Sbjct  151   PFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQIENEYGAQSKLLGSAGQNYVNWAAKM  210

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AV  GTGVPWVMCK+DDAPDPV+N CNGFYCD+F+PNK YKP +WTEAW+ WF+EFGGP 
Sbjct  211   AVETGTGVPWVMCKEDDAPDPVINTCNGFYCDYFTPNKPYKPSIWTEAWSGWFSEFGGPN  270

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLA+ VA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+R
Sbjct  271   HERPVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLIR  330

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LH+AIK+CE ALVS DP V SLGN+Q+A V+ +KSG CAAFL+N +  S  
Sbjct  331   QPKYGHLKELHKAIKMCERALVSTDPAVTSLGNFQQAHVYSAKSGDCAAFLSNFDTKSSV  390

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  +R FSW+S++E+ SS
Sbjct  391   RVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPTNTRMFSWESFDEDISS  450

Query  1660  YDDN---TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              DD    T T +GLLEQIN TRD SDYLWY+T V I   E+FL+GGK P L V S GHA+
Sbjct  451   LDDGSSITTTTSGLLEQINVTRDTSDYLWYITSVDIGSSESFLRGGKLPTLIVQSTGHAV  510

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVFINGQL G++YG+ E+ + T++  V LRAG N+I+LLS+AVGLPNVG HFETWN G+L
Sbjct  511   HVFINGQLSGSAYGTREDRRFTYTGTVNLRAGTNRIALLSVAVGLPNVGGHFETWNTGIL  570

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWY  1133
             GPV L G ++GK DL+WQKW+Y++GLKGE ++L S +G SSVEW++ + ++ K QPLTW+
Sbjct  571   GPVVLRGFDQGKLDLSWQKWTYQVGLKGEAMNLASPNGISSVEWMQSALVSDKNQPLTWH  630

Query  1132  KTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKC  953
             KT FDAP G+E LALDM  MGKGQIWING S+GRYW    A  G C  C+YAG F   KC
Sbjct  631   KTYFDAPDGDERLALDMEGMGKGQIWINGLSIGRYWTALAA--GNCNGCSYAGTFRPPKC  688

Query  952   LSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQL  773
                CG+ +QRWYHVPRSWL+P  NLLV FEE GG+P  +SLVKR V+SVCAD+ E+ P +
Sbjct  689   QVGCGQPTQRWYHVPRSWLKPDHNLLVVFEELGGDPSKISLVKRSVSSVCADVSEYHPNI  748

Query  772   MNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDI  593
              NW + + GK+     PK HL C  GQ I+SIKFASFGTP G+CG++ +G CH+  S+  
Sbjct  749   RNWHIDSYGKSEEFHPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEKGVCHSSTSHAT  808

Query  592   FQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              +K CIG   CTV V+   FG DPCP+V+K+LSVE VC+
Sbjct  809   LEKKCIGKPRCTVTVSNSNFGQDPCPNVLKRLSVEAVCA  847



>ref|XP_006435076.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
 gb|ESR48316.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
Length=850

 Score =  1125 bits (2909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/818 (66%), Positives = 642/818 (78%), Gaps = 5/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ++V+YD+ + +INGQR+IL+SGSIHYPRSTPEMW DL++KAK+GGLDV+ TYVFWNGHEP
Sbjct  27    STVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLIRKAKDGGLDVIDTYVFWNGHEP  86

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEG YDLV+FIK  Q+ GLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  87    SPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  146

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFK AMQ FT  IV MMK+++L+ SQGGPIILSQIENEYGP    LGA G +Y  WAAK
Sbjct  147   GPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPESKSLGAAGHAYVNWAAK  206

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPWVMCK+DDAPDPV+N+CNGFYCD FSPNK YKP +WTEAW+ WFTEFGG 
Sbjct  207   MAVGLDTGVPWVMCKEDDAPDPVINSCNGFYCDAFSPNKPYKPTLWTEAWSGWFTEFGGA  266

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             V  RP +DLA+AVA+FI KGGSF NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+
Sbjct  267   VHRRPVQDLAFAVARFIQKGGSFFNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLM  326

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK LH AIKLCE ALVS DP V SLG YQ+A VF +    CAAFL+N N  S 
Sbjct  327   RQPKYGHLKQLHEAIKLCEYALVSSDPTVTSLGTYQQAHVFSAGQQKCAAFLSNYNTKSA  386

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F   HYNLPPWSISILPDCKN V+NTA+V  Q ++M+M P  S+  SW++Y+E+ S
Sbjct  387   ARVTFNGRHYNLPPWSISILPDCKNDVFNTAKVAVQHTKMQMLPTGSKLLSWETYDEDIS  446

Query  1663  SY-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S  + +T TA GLLEQIN TRD SDYLWYMT V I   E+FL+GG+ P LTV SAGHA+H
Sbjct  447   SLGESSTLTAIGLLEQINITRDTSDYLWYMTSVEISSSESFLRGGQKPTLTVESAGHAVH  506

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQ +G+++G+ EN + TFS    LRAG+NKI+LLSIAVGLPNVG H+ETW  GV G
Sbjct  507   VFINGQFLGSAFGTRENRRFTFSGPANLRAGINKIALLSIAVGLPNVGLHYETWETGVRG  566

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYK  1130
              V L GL+ G +DLTWQKWSY++GLKGE ++L S S ++SV+W  GS  AQ +Q L WYK
Sbjct  567   AVVLHGLDHGNKDLTWQKWSYQVGLKGEAMNLVSPSEATSVDWTRGSLAAQGQQSLKWYK  626

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               FDAPAGNEPLALD+ +MGKGQ+WINGQS+GRYW  Y  + G C  C+YAG F    C 
Sbjct  627   AYFDAPAGNEPLALDLRSMGKGQVWINGQSIGRYWMAY--AKGDCKTCSYAGTFRPINCQ  684

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
              +CG  +QRWYHVPRSWL+PT NLLV FEE GG+   +SLVKR VA VCAD +E  P   
Sbjct  685   RRCGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTD  744

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N +++  G +      K  L C  GQ ITSI+FASFGTP G+CGSF +GTCHA +S+ + 
Sbjct  745   NNDIENKGNSNSTGNAKVLLQCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHAML  804

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K CIG +SC++ ++   FG DPCP+V+K+LSV+ VCS
Sbjct  805   EKECIGQDSCSIFISSGVFGTDPCPNVLKRLSVQAVCS  842



>ref|XP_003520277.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/821 (65%), Positives = 658/821 (80%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             +  ASV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL+ KAKEGG+DVV+TYVFWN 
Sbjct  22    VARASVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGIDVVETYVFWNV  81

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  82    HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  141

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AMQ FT  IV MMKS+RL+ESQGGPIILSQIENEYG      GA G++Y  W
Sbjct  142   TDNEPFKRAMQGFTEKIVGMMKSERLFESQGGPIILSQIENEYGAQSKLQGAAGQNYVNW  201

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AAKMAV +GTGVPWVMCK+DDAPDPV+N CNGFYCD F+PN+ YKP +WTEAW+ WFTEF
Sbjct  202   AAKMAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNRPYKPMIWTEAWSGWFTEF  261

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP +DLA+A A+FI++GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+
Sbjct  262   GGPIHKRPVQDLAFAAARFIIRGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEY  321

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHRAIK+CE ALVS DP V SLG +Q+A V+ ++SG CAAFL+N + 
Sbjct  322   GLIRQPKYGHLKELHRAIKMCERALVSTDPIVTSLGEFQQAHVYTTESGDCAAFLSNYDS  381

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F NMHY+LPPWS+SILPDC+N V+NTA+VG Q+S+M+M P  ++ FSW+S++E
Sbjct  382   KSSARVMFNNMHYSLPPWSVSILPDCRNVVFNTAKVGVQTSQMQMLPTNTQLFSWESFDE  441

Query  1672  ETSSYDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             +  S D+++  TA GLLEQIN T+DASDYLWY+T V I   E+FL+GG+ P L V S GH
Sbjct  442   DIYSVDESSAITAPGLLEQINVTKDASDYLWYITSVDIGSSESFLRGGELPTLIVQSTGH  501

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+HVFINGQL G+++G+ E  + T++  V L AG+N+I+LLS+A+GLPNVG HFE+W+ G
Sbjct  502   AVHVFINGQLSGSAFGTREYRRFTYTGKVNLLAGINRIALLSVAIGLPNVGEHFESWSTG  561

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             +LGPV+L GL++GK DL+ QKW+Y++GLKGE + L S +G SSV W++ + + Q+ QPLT
Sbjct  562   ILGPVALHGLDKGKWDLSGQKWTYQVGLKGEAMDLASPNGISSVAWMQSAIVVQRNQPLT  621

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+KT FDAP G+EPLALDM  MGKGQIWINGQS+GRYW  +    G C  CNYAG F   
Sbjct  622   WHKTYFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFAT--GNCNDCNYAGSFRPP  679

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG+ +QRWYHVPRSWL+ T NLLV FEE GGNP  +SLVKR V+SVCAD+ E+ P
Sbjct  680   KCQLGCGQPTQRWYHVPRSWLKTTQNLLVIFEELGGNPSKISLVKRSVSSVCADVSEYHP  739

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW +++ GK+     PK HL C  GQ I+SIKFASFGTP G+CG++ +G CH+  SY
Sbjct  740   NIKNWHIESYGKSEEFRPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEQGACHSPASY  799

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              I +K CIG   CTV V+   FG DPCP V+K+LSVE VC+
Sbjct  800   VILEKRCIGKPRCTVTVSNSNFGQDPCPKVLKRLSVEAVCA  840



>ref|XP_006412011.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
 gb|ESQ53464.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
Length=856

 Score =  1123 bits (2904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/816 (64%), Positives = 648/816 (79%), Gaps = 5/816 (1%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + +INGQR+IL SGSIHYPRSTP+MW  L++KAK+GG+DV++TYVFWN HEP P
Sbjct  33    VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGIDVIETYVFWNLHEPSP  92

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             GKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  93    GKYDFEGRNDLVRFVKAIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  152

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AM+ FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LGA G +Y  WAAKMA
Sbjct  153   FKRAMKGFTERIVELMKSENLFESQGGPIILSQIENEYGRQGQILGAEGHNYMTWAAKMA  212

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             +   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WFTEFGGP+ 
Sbjct  213   IATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPTIWTEAWSGWFTEFGGPMH  272

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
             +RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYDAPIDE+GL+R+
Sbjct  273   HRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYDAPIDEYGLIRQ  332

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LHRAIK+CE ALVS DP V SLGN Q+A V+ S+SG C+AFLAN +  S A+
Sbjct  333   PKYGHLKELHRAIKMCEKALVSTDPVVTSLGNKQQAHVYSSESGDCSAFLANYDTESAAR  392

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRG-FSWQSYNEETSSY  1658
             V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P S G F WQSY E+ SS 
Sbjct  393   VLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTSTGSFQWQSYLEDLSSL  452

Query  1657  DD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             DD +TFT  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L + S GHA+H+F
Sbjct  453   DDSSTFTTQGLLEQINVTRDTSDYLWYMTSVDIGETESFLHGGELPTLIIQSTGHAVHIF  512

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G+++G+ +N + T+   + L +G N+I+LLS+AVGLPNVG HFE+WN G+LGPV
Sbjct  513   VNGQLSGSAFGTRQNRRFTYKGKINLHSGTNRIALLSVAVGLPNVGGHFESWNTGILGPV  572

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
             +L GL++GKRDL+WQKW+Y++GLKGE ++L   + + S  W++ S   QK QPLTW+KT 
Sbjct  573   ALHGLSQGKRDLSWQKWTYQVGLKGEAMNLAYPTNTPSFGWMDASLTVQKPQPLTWHKTY  632

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GNEPLALDM  MGKGQIW+NG+S+GRYW  +    G CG C+Y G +   KC S 
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCGHCSYTGTYKPNKCNSG  690

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +Q+WYHVPRSWL+P+ NLLV FEE GGNP  VSLVKR V+ VCA++ E+ P + NW
Sbjct  691   CGQPTQKWYHVPRSWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHPNIKNW  750

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++++ GK     RPK HL C  GQ I++IKFASFGTP G+CGS+ +G CHA  SY I ++
Sbjct  751   QIESYGKGQTFRRPKVHLKCSPGQAISAIKFASFGTPLGTCGSYQQGDCHAATSYAILER  810

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              C+G   C V ++   FG DPCP+V+K+L+VE VC+
Sbjct  811   KCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCA  846



>ref|XP_010531064.1| PREDICTED: beta-galactosidase 3 [Tarenaya hassleriana]
Length=855

 Score =  1122 bits (2901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/816 (65%), Positives = 648/816 (79%), Gaps = 5/816 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SV+YD+ + +INGQR+IL SGSIHYPRSTP+MW  L++KAK+GG+DV++TYVFWN HEP 
Sbjct  31    SVTYDRKALVINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGIDVIETYVFWNLHEPT  90

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PGKY FEGR DLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  91    PGKYDFEGRNDLVRFVKTVQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  150

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AM+ FT  IV +MKS+ L+ESQGGPIILSQIENEYG      GA G +Y  WAAKM
Sbjct  151   PFKRAMKGFTEKIVELMKSESLFESQGGPIILSQIENEYGKQAQIFGAEGHNYMTWAAKM  210

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AV   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WFTEFGGP+
Sbjct  211   AVETDTGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPAIWTEAWSGWFTEFGGPI  270

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPF++TSYDYDAPIDE+GL+R
Sbjct  271   HQRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVSTSYDYDAPIDEYGLIR  330

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LHRAIKLCE ALVS DP V SLGN Q+A V+ S+SG C+AFLAN +  S A
Sbjct  331   QPKYGHLKELHRAIKLCEKALVSADPTVTSLGNKQQAHVYSSESGGCSAFLANYDTESAA  390

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSS  1661
             +V F NMHYNLPPWSI++LPDC+N V+NTA+VG Q+S+M+M P  +  F WQSY E+ SS
Sbjct  391   RVLFNNMHYNLPPWSITVLPDCRNAVFNTAKVGVQTSQMQMLPTNTEMFRWQSYFEDLSS  450

Query  1660  YDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
              DD +TFT  GLLEQIN TRD SDYLWY+T V I   E+FL GG+ P L+V S GHA+HV
Sbjct  451   VDDSSTFTTPGLLEQINVTRDTSDYLWYITSVDIGQTESFLHGGELPTLSVQSTGHAVHV  510

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             F+NGQL G+++G+ EN +  ++  V L AG NKI+LLS+AVGLPNVG HFE+WN G+LGP
Sbjct  511   FVNGQLSGSAFGTRENRRFRYTGKVNLHAGTNKIALLSVAVGLPNVGGHFESWNTGILGP  570

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKT  1127
             V+L GL++GK DL+WQKW+Y++GLKGEV++L   +  SSVEW+E S   QK QPLTW+K 
Sbjct  571   VALHGLDQGKWDLSWQKWTYQVGLKGEVMNLAYPTSGSSVEWMEASLAVQKAQPLTWHKA  630

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              FDAP G+EPLALDM  MGKGQIW+NG+S+GRYW  +    G C  C+YAG +   KC +
Sbjct  631   FFDAPEGDEPLALDMQGMGKGQIWVNGESIGRYWTAFAT--GNCNHCSYAGTYKPTKCQT  688

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QRWYHVPRSWL+P  NLLV FEE GGNP  +SLVKR V+SVCA+I E+ P + N
Sbjct  689   GCGQPTQRWYHVPRSWLKPGQNLLVIFEELGGNPSTISLVKRSVSSVCAEISEYHPNIKN  748

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W+++  GKA     PK HL C  GQ I+SIKFASFGTP G+CGS+ +G CHA  SY I +
Sbjct  749   WQIENYGKAEDFRTPKVHLRCRPGQTISSIKFASFGTPLGTCGSYQQGQCHAPASYAILE  808

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             + C+G   C V V+   FG DPCP+V+K+LSVE VC
Sbjct  809   RKCVGKQRCAVTVSNSNFGQDPCPNVLKRLSVEAVC  844



>ref|XP_006473573.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=850

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/818 (65%), Positives = 639/818 (78%), Gaps = 5/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ++V+YD+ + +INGQR+IL+SGSIHYPRSTPEMW DL++KAK+GGLDV+ TYVFWNGHEP
Sbjct  27    STVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLIRKAKDGGLDVIDTYVFWNGHEP  86

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEG YDLV+FIK  Q+ GLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  87    SPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  146

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFK AMQ FT  IV MMK+++L+ SQGGPIILSQIENEYGP    LGA G +Y  WAAK
Sbjct  147   GPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPESKALGAAGHAYVNWAAK  206

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPWVMCK+DDAPDPV+N CNGFYCD FSPNK YKP +WTEAW+ WFTEFGG 
Sbjct  207   MAVGLDTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYKPTLWTEAWSGWFTEFGGT  266

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             V  RP +DLA+AVA+FI KGGSF NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+
Sbjct  267   VHRRPVQDLAFAVARFIQKGGSFFNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLM  326

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK LH AIKLCE ALVS DP V SLG YQ+A VF +    CAAFL+N N  S 
Sbjct  327   RQPKYGHLKQLHEAIKLCEYALVSSDPTVTSLGTYQQAHVFSTGQQKCAAFLSNYNTKSA  386

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F    YNLPPWSISILPDCKN V+NTA+V  Q ++M+M P  S+  SW++Y+E+ S
Sbjct  387   ARVTFNGRQYNLPPWSISILPDCKNVVFNTAKVAVQHTKMQMLPTGSKLLSWETYDEDIS  446

Query  1663  SY-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S  + +T TA GLLEQIN TRD SDYLWYMT V I   E+FL+GG+ P LTV SAGHA+H
Sbjct  447   SLGESSTLTAIGLLEQINITRDTSDYLWYMTSVEISSSESFLRGGQKPTLTVESAGHAVH  506

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQ +G+++G+ EN + TFS    LRAG+NKI+LLSIAVGLPNVG H+ETW  GV G
Sbjct  507   VFINGQFLGSAFGTRENRRFTFSGPANLRAGINKIALLSIAVGLPNVGLHYETWETGVRG  566

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYK  1130
              V L GL+ G +DLTWQKWSY++GLKGE ++L S S ++SV+W  GS  AQ +Q L WYK
Sbjct  567   AVVLHGLDHGNKDLTWQKWSYQVGLKGEAMNLVSPSEATSVDWTRGSLAAQGQQSLKWYK  626

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               FDAP GNEPLALD+ +MGKGQ+WINGQS+GRYW  Y  + G C  C+YAG F    C 
Sbjct  627   AYFDAPTGNEPLALDLRSMGKGQVWINGQSIGRYWMAY--AKGDCKTCSYAGTFRPINCQ  684

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
              +CG  +QRWYHVPRSWL+PT NLLV FEE GG+   +SLVKR VA VCAD +E  P   
Sbjct  685   RRCGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTD  744

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N++++  G +      K  L C  GQ ITSI+FASFGTP G+CGSF +GTCHA +S+ + 
Sbjct  745   NYDIENKGNSNSTGNAKVLLQCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHAML  804

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K CIG  SC++ ++   FG DPCP+V+K+LSV+ VCS
Sbjct  805   EKECIGQESCSIFISSGVFGKDPCPNVLKRLSVQAVCS  842



>dbj|BAJ34544.1| unnamed protein product [Thellungiella halophila]
Length=856

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/816 (64%), Positives = 648/816 (79%), Gaps = 5/816 (1%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + +INGQR+IL SGSIHYPRSTP+MW  L++KAK+GG+DV++TYVFWN HEP P
Sbjct  33    VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGIDVIETYVFWNLHEPSP  92

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             GKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  93    GKYDFEGRNDLVRFVKAIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  152

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AM+ FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LGA G +Y  WAAKMA
Sbjct  153   FKRAMKGFTERIVELMKSENLFESQGGPIILSQIENEYGRQGQILGAEGHNYMTWAAKMA  212

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             +   TGVPWVMCK+DDAPDPV++ CNGFYCD F+PNK YKP +WTEAW+ WFTEFGGP+ 
Sbjct  213   IATETGVPWVMCKEDDAPDPVISTCNGFYCDSFAPNKPYKPTIWTEAWSGWFTEFGGPMH  272

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
             +RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYDAPIDE+GL+R+
Sbjct  273   HRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYDAPIDEYGLIRQ  332

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LHRAIK+CE ALVS DP V SLGN Q+A V+ S+SG C+AFLAN +  S A+
Sbjct  333   PKYGHLKELHRAIKMCEKALVSTDPVVTSLGNKQQAHVYSSESGDCSAFLANYDTESAAR  392

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRG-FSWQSYNEETSSY  1658
             V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P S G F WQSY E+ SS 
Sbjct  393   VLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTSTGSFQWQSYLEDLSSL  452

Query  1657  DD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             DD +TFT  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L + S GHA+H+F
Sbjct  453   DDSSTFTTQGLLEQINVTRDTSDYLWYMTSVDIGETESFLHGGELPTLIIQSTGHAVHIF  512

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G+++G+ +N + T+   + L +G N+I+LLS+AVGLPNVG HFE+WN G+LGPV
Sbjct  513   VNGQLSGSAFGTRQNRRFTYKGKINLHSGTNRIALLSVAVGLPNVGGHFESWNTGILGPV  572

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
             +L GL++GKRDL+WQKW+Y++GLKGE ++L   + + S  W++ S   QK QPLTW+KT 
Sbjct  573   ALHGLSQGKRDLSWQKWTYQVGLKGEAMNLAYPTNTPSFGWMDASLTVQKPQPLTWHKTY  632

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GNEPLALDM  MGKGQIW+NG+S+GRYW  +    G CG C+Y G +   KC S 
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCGHCSYTGTYKPNKCNSG  690

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +Q+WYHVPRSWL+P+ NLLV FEE GGNP  VSLVKR V+ VCA++ E+ P + NW
Sbjct  691   CGQPTQKWYHVPRSWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEYHPNIKNW  750

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++++ GK     RPK HL C  GQ I++IKFASFGTP G+CGS+ +G CHA  SY I ++
Sbjct  751   QIESYGKGQTFRRPKVHLKCSPGQAISAIKFASFGTPLGTCGSYQQGDCHAATSYAILER  810

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              C+G   C V ++   FG DPCP+V+K+L+VE VC+
Sbjct  811   KCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCA  846



>gb|KHN41933.1| Beta-galactosidase 3 [Glycine soja]
Length=862

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/828 (65%), Positives = 650/828 (79%), Gaps = 16/828 (2%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SV+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL+ KAKEGGLDV++TY+FWN HEP 
Sbjct  31    SVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGGLDVIETYIFWNVHEPS  90

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
              G Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  91    RGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNE  150

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQ---------IENEYGPMEYELGAPGK  2405
             PFK AMQ FT  IV MMKS+RLYESQGGPIILSQ         IENEYG     LG  G+
Sbjct  151   PFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQGDMHIMLFQIENEYGAQSKLLGPAGQ  210

Query  2404  SYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTA  2225
             +Y  WAAKMAV  GTGVPWVMCK+DDAPDPV+N CNGFYCD+F+PNK YKP +WTEAW+ 
Sbjct  211   NYVNWAAKMAVETGTGVPWVMCKEDDAPDPVINTCNGFYCDYFTPNKPYKPSIWTEAWSG  270

Query  2224  WFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDA  2045
             WF+EFGGP   RP +DLA+ VA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDA
Sbjct  271   WFSEFGGPNHERPVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDA  330

Query  2044  PIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFL  1865
             P+DE+GL+R+PK+GHLK+LH+AIK+CE ALVS DP V S+GN+Q+A V+ +KSG CAAFL
Sbjct  331   PLDEYGLIRQPKYGHLKELHKAIKMCERALVSADPAVTSMGNFQQAHVYTTKSGDCAAFL  390

Query  1864  ANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSW  1688
             +N +  S  +V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  +  FSW
Sbjct  391   SNFDTKSSVRVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSQMQMLPTNTHMFSW  450

Query  1687  QSYNEETSSYDDN---TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWL  1517
             +S++E+ SS DD    T T +GLLEQIN TRD SDYLWY+T V I   E+FL+GGK P L
Sbjct  451   ESFDEDISSLDDGSAITITTSGLLEQINVTRDTSDYLWYITSVDIGSSESFLRGGKLPTL  510

Query  1516  TVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPH  1337
              V S GHA+HVFINGQL G++YG+ E+ +  ++  V LRAG N+I+LLS+AVGLPNVG H
Sbjct  511   IVQSTGHAVHVFINGQLSGSAYGTREDRRFRYTGTVNLRAGTNRIALLSVAVGLPNVGGH  570

Query  1336  FETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIA  1157
             FETWN G+LGPV L GLN+GK DL+WQKW+Y++GLKGE ++L S +G SSVEW++ + ++
Sbjct  571   FETWNTGILGPVVLRGLNQGKLDLSWQKWTYQVGLKGEAMNLASPNGISSVEWMQSALVS  630

Query  1156  QK-QPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNY  980
             +K QPLTW+KT FDAP G+EPLALDM  MGKGQIWING S+GRYW    A  G C  C+Y
Sbjct  631   EKNQPLTWHKTYFDAPDGDEPLALDMEGMGKGQIWINGLSIGRYWTAPAA--GICNGCSY  688

Query  979   AGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCA  800
             AG F   KC   CG+ +QRWYHVPRSWL+P  NLLV FEE GG+P  +SLVKR V+S+CA
Sbjct  689   AGTFRPPKCQVGCGQPTQRWYHVPRSWLKPNHNLLVVFEELGGDPSKISLVKRSVSSICA  748

Query  799   DIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGT  620
             D+ E+ P + NW + + GK+     PK HL C   Q I+SIKFASFGTP G+CG++ +G 
Sbjct  749   DVSEYHPNIRNWHIDSYGKSEEFHPPKVHLHCSPSQAISSIKFASFGTPLGTCGNYEKGV  808

Query  619   CHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             CH+  SY   +K CIG   CTV V+   FG DPCP+V+K+LSVE VCS
Sbjct  809   CHSPTSYATLEKKCIGKPRCTVTVSNSNFGQDPCPNVLKRLSVEAVCS  856



>ref|XP_010446807.1| PREDICTED: beta-galactosidase 3 [Camelina sativa]
Length=856

 Score =  1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/816 (64%), Positives = 645/816 (79%), Gaps = 5/816 (1%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + +INGQR+IL SGSIHYPRSTP+MW  L++KAK+GG+DV++TYVFWN HEP P
Sbjct  33    VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFWNLHEPSP  92

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             GKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  93    GKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  152

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AMQ FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LGA G +Y  WAAKMA
Sbjct  153   FKRAMQGFTERIVELMKSENLFESQGGPIILSQIENEYGRQGQLLGAEGHNYMTWAAKMA  212

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             +   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WFTEFGGP+ 
Sbjct  213   IATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPLIWTEAWSGWFTEFGGPMH  272

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
              RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYDAPIDE+GL+R+
Sbjct  273   RRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYDAPIDEYGLIRQ  332

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LHRAIK+CE ALVS DP   SLGN Q+A V+ S+SG C+AFLAN +  S A+
Sbjct  333   PKYGHLKELHRAIKMCEKALVSADPVETSLGNKQQAHVYSSESGDCSAFLANYDTESAAR  392

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSSY  1658
             V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  ++ F WQSY E+ SS 
Sbjct  393   VLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTNTKNFQWQSYLEDLSSL  452

Query  1657  DD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             DD +TFT  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L + S GHA+H+F
Sbjct  453   DDSSTFTTHGLLEQINVTRDTSDYLWYMTSVDIKETESFLHGGELPTLIIQSTGHAVHIF  512

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G+++G+ +N + T+   + L +G NKI+LLS+AVGLPNVG HFE+WN G+LGPV
Sbjct  513   VNGQLSGSAFGTRQNRRFTYQGKINLHSGTNKIALLSVAVGLPNVGGHFESWNTGILGPV  572

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
             +L GL++GKRDL+WQKW+Y++GLKGE ++L   + + S  W++ S   QK QPLTW+KT 
Sbjct  573   ALHGLSQGKRDLSWQKWTYQVGLKGEAMNLAFPTNTPSFGWMDASLTVQKPQPLTWHKTY  632

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GNEPLALDM  MGKGQIW+NG+S+GRYW  +    G CG C+Y G +   KC + 
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCGHCSYTGTYKPNKCQTG  690

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +QRWYHVPRSWL+P+ NLLV FEE GGNP  +SLVKR V+ VCA++ E+ P + NW
Sbjct  691   CGQPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSTISLVKRSVSGVCAEVSEYHPNIKNW  750

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++++ GK     RPK HL C  GQ I SIKFASFGTP G+CGS+ +G CHA  SY I ++
Sbjct  751   QIESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHATTSYAILER  810

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              C+G   C V ++   FG DPCP+V+K+L+VE VC+
Sbjct  811   KCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCA  846



>gb|KDO84688.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=850

 Score =  1120 bits (2896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/818 (65%), Positives = 639/818 (78%), Gaps = 5/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ++V+YD+ + +INGQR+IL+SGSIHYPRSTPEMW DL++KAK+GGLDV+ TYVFWNGHEP
Sbjct  27    STVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLIRKAKDGGLDVIDTYVFWNGHEP  86

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEG YDLV+FIK  Q+ GLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  87    SPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  146

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFK AMQ FT  IV MMK+++L+ SQGGPIILSQIENEYGP    LGA G +Y  WAAK
Sbjct  147   GPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPESKSLGAAGHAYVNWAAK  206

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPWVMCK+DDAPDPV+N+CNGFYCD FSPNK YKP +WTEAW+ WFTEFGG 
Sbjct  207   MAVGLDTGVPWVMCKEDDAPDPVINSCNGFYCDAFSPNKPYKPTLWTEAWSGWFTEFGGA  266

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             V  RP +DLA+AVA+FI KGGSF NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+
Sbjct  267   VHRRPVQDLAFAVARFIQKGGSFFNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLM  326

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK LH AIKLCE ALVS DP V SLG YQ+A VF +    CAAFL+N N  S 
Sbjct  327   RQPKYGHLKQLHEAIKLCEYALVSSDPTVTSLGTYQQAHVFSAGQQKCAAFLSNYNTKSA  386

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F    YNLPPWSISILPDCKN V+NTA+V  Q ++M+M P  S+  SW++Y+E+ S
Sbjct  387   ARVTFNGRQYNLPPWSISILPDCKNVVFNTAKVAVQHTKMQMLPTGSKLLSWETYDEDIS  446

Query  1663  SY-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S  + +T TA GLLEQIN TRD SDYLWYMT V I   E+FL+GG+ P LTV SAGHA+H
Sbjct  447   SLGESSTLTAIGLLEQINITRDTSDYLWYMTSVEISSSESFLRGGQKPTLTVESAGHAVH  506

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQ +G+++G+ EN + TFS    LRAG+NKI+LLSIAVGLPNVG H+ETW  GV G
Sbjct  507   VFINGQFLGSAFGTRENRRFTFSGPANLRAGINKIALLSIAVGLPNVGLHYETWETGVRG  566

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYK  1130
              V L GL+ G +DLTWQKWSY++GLKGE ++L S S ++SV+W  GS  AQ +Q L WYK
Sbjct  567   AVVLHGLDHGNKDLTWQKWSYQVGLKGEAMNLVSPSEATSVDWTRGSLAAQGQQSLKWYK  626

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               FDAP GNEPLALD+ +MGKGQ+WINGQS+GRYW  Y  + G C  C+YAG F    C 
Sbjct  627   AYFDAPTGNEPLALDLRSMGKGQVWINGQSIGRYWMAY--AKGDCKTCSYAGTFRPINCQ  684

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
              +CG  +QRWYHVPRSWL+PT NLLV FEE GG+   +SLVKR VA VCAD +E  P   
Sbjct  685   RRCGHPTQRWYHVPRSWLKPTKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTD  744

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N +++  G +      K  L C  GQ ITSI+FASFGTP G+CGSF +GTCHA +S+ + 
Sbjct  745   NNDIENKGNSNSTGNAKVLLQCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHAML  804

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K CIG  SC++ ++   FG DPCP+V+K+LSV+ VCS
Sbjct  805   EKECIGQESCSIFISSGVFGTDPCPNVLKRLSVQAVCS  842



>ref|XP_006283101.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15999.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=856

 Score =  1119 bits (2895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/816 (64%), Positives = 645/816 (79%), Gaps = 5/816 (1%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + +INGQR+IL SGSIHYPRSTP+MW  L++KAK+GG+DV++TYVFWN HEP P
Sbjct  33    VTYDRKALLINGQRRILFSGSIHYPRSTPDMWESLIQKAKDGGVDVIETYVFWNLHEPSP  92

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             GKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  93    GKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  152

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AM+ FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LGA G +Y  WAAKMA
Sbjct  153   FKRAMKGFTERIVELMKSENLFESQGGPIILSQIENEYGRQGQLLGAEGHNYMTWAAKMA  212

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             +   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WFTEFGGP+ 
Sbjct  213   IATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPLIWTEAWSGWFTEFGGPMH  272

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
             +RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ +SYDYDAPIDE+GL+R+
Sbjct  273   HRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTSSYDYDAPIDEYGLIRQ  332

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LHRAIK+CE ALVS DP V SLGN Q+A V+ S+SG C+AFLAN +  S  +
Sbjct  333   PKYGHLKELHRAIKMCEKALVSADPVVTSLGNKQQAHVYSSESGDCSAFLANYDTESATR  392

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVS-RGFSWQSYNEETSSY  1658
             V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P S + F WQSY E+ SS 
Sbjct  393   VLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTSTKDFQWQSYLEDLSSL  452

Query  1657  DD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             DD +TFT  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L V S GHA+H+F
Sbjct  453   DDSSTFTTNGLLEQINVTRDTSDYLWYMTSVDIGGTESFLHGGELPTLIVQSTGHAVHIF  512

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G+++G+ +N + T+   + L +G N+I+LLS+AVGLPNVG HFE+WN G+LGPV
Sbjct  513   VNGQLSGSAFGTRQNRRFTYQGKINLHSGTNRIALLSVAVGLPNVGGHFESWNTGILGPV  572

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
             +L GL++GKRDL+WQKW+Y++GLKGE ++L   + + S EW++ S   QK QPLTW+KT 
Sbjct  573   ALRGLSQGKRDLSWQKWTYQVGLKGEAMNLAFPTNTPSFEWMDASLTVQKPQPLTWHKTY  632

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GNEPLALDM  MGKGQIW+NG+S+GRYW  +    G C  C+Y G +   KC + 
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCSHCSYTGTYKPNKCQTG  690

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +QRWYHVPRSWL+P+ NLLV FEE GGNP  VSLVKR V+ VCA++ E+ P + NW
Sbjct  691   CGQPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSSVSLVKRSVSGVCAEVSEYHPNIKNW  750

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++++ GK     RPK HL C  GQ I SIKFASFGTP G+CGS+ +G CHA  SY I  +
Sbjct  751   QIESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHATTSYAILAR  810

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              C+G   C V ++   FG DPCP+V+K+L+VE VC+
Sbjct  811   KCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCA  846



>gb|KDO65278.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=697

 Score =  1118 bits (2893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/668 (80%), Positives = 612/668 (92%), Gaps = 4/668 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             SVSYD  +  ING+R+IL+SGSIHYPRS+PEMWPDL++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  32    SVSYDSKAIAINGKRRILISGSIHYPRSSPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  91

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PGKYYFEG YDLVKFIKLA+QAGLYV+LR+GPY CAEWNFGGFPVWLKY+PG++FRT+NG
Sbjct  92    PGKYYFEGNYDLVKFIKLAKQAGLYVNLRIGPYVCAEWNFGGFPVWLKYIPGINFRTENG  151

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKA M KFT  IV+MMK++RL+ESQGGPIILSQIENEYGPMEYE+GAPG+SY +WAAKM
Sbjct  152   PFKAEMHKFTKKIVDMMKAERLFESQGGPIILSQIENEYGPMEYEIGAPGRSYTRWAAKM  211

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGLGTGVPW+MCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W+TEFGGPV
Sbjct  212   AVGLGTGVPWIMCKQDDAPDPLINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGGPV  271

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
             P+RP EDLA++VAKFI KGGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GLLR
Sbjct  272   PHRPVEDLAFSVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLLR  331

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PKWGHLKDLHRAIKLCEPALVSG+P V+ LGNYQEA VFKSKS ACAAFLAN NQ +FA
Sbjct  332   QPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS-ACAAFLANYNQRTFA  390

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSWQSYNEETS  1664
             KVAFGN HYNLPPWSISILPDCKNTVYNTARVG QS++MKMTPV    GFSWQ++NE  S
Sbjct  391   KVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTPVPIHGGFSWQAFNEVPS  450

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y D++FT +GLLEQINTTRDA+DYLWYMTDV+IDP E FL+ G +P LTV SAGHALHV
Sbjct  451   AYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVLTVMSAGHALHV  510

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             F+NGQL GT+YGSLE PK+TF++ V +RAG+NKI+LLSIAVGLPNVGPHFETWNAGVLGP
Sbjct  511   FVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPHFETWNAGVLGP  570

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L+GLNEG+RDL+WQKW+YKIGL+GE L+LHSLSG SSVEW EGS +AQ+QPLTWY+TT
Sbjct  571   VTLNGLNEGRRDLSWQKWTYKIGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTT  630

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F APAGN PLALDM +MGKGQ+W+NGQS+GR+WP YKAS G+CG C+Y G + EKKCLS 
Sbjct  631   FSAPAGNAPLALDMGSMGKGQVWVNGQSIGRHWPAYKAS-GSCGYCSYTGTYTEKKCLSN  689

Query  943   CGEASQRW  920
             CGEASQRW
Sbjct  690   CGEASQRW  697



>ref|XP_007156097.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
 gb|ESW28091.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
Length=847

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/818 (64%), Positives = 654/818 (80%), Gaps = 5/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             A+V+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL+ KAKEGGLDVV+TYVFWN HEP
Sbjct  24    AAVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIFKAKEGGLDVVETYVFWNVHEP  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  84    SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ FT  IV MMKS++L+ESQGGPIILSQIENEYG      GA G++Y  WAAK
Sbjct  144   EPFKRAMQGFTEKIVGMMKSEQLFESQGGPIILSQIENEYGAQSKLQGAAGQNYVNWAAK  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAV +GTGVPWVMCK+DDAPDPV+N CNGFYCD F+PN+ YKP +WTEAW+ WFTEFGGP
Sbjct  204   MAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNRPYKPLIWTEAWSGWFTEFGGP  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             +  RP +DLA+A A+FI++GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL+
Sbjct  264   IHQRPVQDLAFAAARFIIRGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGLI  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LHRAIK+CE ALVS D  V SLG  Q+A V+ ++SG CAAFL+N +  S 
Sbjct  324   RQPKYGHLKELHRAIKMCERALVSTDAIVTSLGESQQAHVYTTESGECAAFLSNYDSKSS  383

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
              +V F NMHYNLPPWS+SILPDC+N V+NTA+VG Q+S+M+M P  ++ FSW+S++E+  
Sbjct  384   VRVMFNNMHYNLPPWSVSILPDCRNVVFNTAKVGVQTSQMQMLPTNTQMFSWESFDEDIY  443

Query  1663  SYDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S +D++  TA GLLEQIN T+D SDYLWY+T V I   E+FL GG+ P L V S GHA+H
Sbjct  444   SVEDSSAITAPGLLEQINVTKDESDYLWYITSVDIGSSESFLHGGELPTLLVQSTGHAVH  503

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQL G+++G+ E  +  ++  V LRAG N+I+LLS+A+GLPNVG HFE+WN G+LG
Sbjct  504   VFINGQLSGSAFGTREYRRFKYTDKVNLRAGTNRIALLSVAIGLPNVGEHFESWNTGILG  563

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYK  1130
             PV+L GL++GK DL+ QKW+Y++GLKGE + L S +G S+V W++ + + QK QPLTW++
Sbjct  564   PVALHGLDQGKWDLSGQKWTYQVGLKGEAMDLASPNGISNVAWMQSAIVVQKNQPLTWHR  623

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             T+FDAP G+EPLALDM  MGKGQIWINGQS+GRYW  +    G C  CNYAG F   KC 
Sbjct  624   TSFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFAT--GNCNDCNYAGSFRPPKCQ  681

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CG+ +QRWYHVPRSWL+PT NLLV FEE GG+P  +SLVKR V+SVCAD+ E+ P + 
Sbjct  682   LGCGQPTQRWYHVPRSWLKPTQNLLVIFEELGGDPSKISLVKRSVSSVCADVSEFHPNIK  741

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW +++ GK+     PK HL C  GQ I+SIKFASFGTP G+CG++ +G CH+  SY   
Sbjct  742   NWHIESYGKSEEFRPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYVQGACHSPASYATL  801

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K C+G + CT+ V+   FG DPCP+V+K+LSVE VC+
Sbjct  802   EKRCVGKSRCTITVSNSNFGQDPCPNVLKRLSVEAVCA  839



>ref|XP_002867020.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43279.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
Length=853

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/827 (63%), Positives = 650/827 (79%), Gaps = 8/827 (1%)
 Frame = -2

Query  2947  GTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQT  2768
             G  +V  G   V+YD+ + +INGQR+IL SGSIHYPRSTP+MW  L++KAK+GG+DV++T
Sbjct  22    GVGFVQCG---VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGIDVIET  78

Query  2767  YVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYV  2588
             YVFWN HEP PGKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYV
Sbjct  79    YVFWNLHEPTPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYV  138

Query  2587  PGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPG  2408
             PG+SFRTDN PFK AM+ FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LGA G
Sbjct  139   PGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQIENEYGRQGQLLGAEG  198

Query  2407  KSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWT  2228
              +Y  WAAKMA+   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+
Sbjct  199   HNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPLIWTEAWS  258

Query  2227  AWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYD  2048
              WFTEFGGP+ +RP +DLA+ VA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYD
Sbjct  259   GWFTEFGGPMHHRPVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYD  318

Query  2047  APIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAF  1868
             APIDE+GL+REPK+GHLK+LHRAIK+CE ALVS DP V S+GN Q+A V+ ++SG C+AF
Sbjct  319   APIDEYGLIREPKYGHLKELHRAIKMCEKALVSADPVVTSIGNKQQAHVYSAESGDCSAF  378

Query  1867  LANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFS  1691
             LAN +  S A+V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  ++ F 
Sbjct  379   LANYDTESAARVLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTDTKNFQ  438

Query  1690  WQSYNEETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLT  1514
             WQSY E+ SS DD +TFT  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L 
Sbjct  439   WQSYLEDLSSLDDSSTFTTQGLLEQINVTRDTSDYLWYMTSVDIGDTESFLHGGELPTLI  498

Query  1513  VYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHF  1334
             + S GHA+H+F+NGQL G+++G+ +N + T+   + L +G N+I+LLS+AVGLPNVG HF
Sbjct  499   IQSTGHAVHIFVNGQLSGSAFGTRQNRRFTYQGKINLHSGTNRIALLSVAVGLPNVGGHF  558

Query  1333  ETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ  1154
             E+WN G+LGPV+L GL++GKRDL+WQKW+Y++GLKGE ++L   + + S+ W++ S   Q
Sbjct  559   ESWNTGILGPVALHGLSQGKRDLSWQKWTYQVGLKGEAMNLAFPTNTRSIGWMDASLTVQ  618

Query  1153  K-QPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYA  977
             K QPLTW+KT FDAP GNEPLALDM  MGKGQIW+NG+S+GRYW  +    G C  C+Y 
Sbjct  619   KPQPLTWHKTYFDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCSQCSYT  676

Query  976   GWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCAD  797
             G +   KC + CG+ +QR+YHVPRSWL+P+ NLLV FEE GGNP  VSLVKR V+ VCA+
Sbjct  677   GTYKPNKCQTGCGQPTQRYYHVPRSWLKPSQNLLVIFEELGGNPSSVSLVKRSVSGVCAE  736

Query  796   IYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTC  617
             + E+ P + NW++++ GK     RPK HL C  GQ I SIKFASFGTP G+CGS+ +G C
Sbjct  737   VSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGEC  796

Query  616   HAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             HA  SY I ++ C+G   C V ++   FG DPCP+V+K+L+VE VC+
Sbjct  797   HAATSYAILERKCVGKARCAVTISNTNFGKDPCPNVLKRLTVEAVCA  843



>ref|NP_001268162.1| beta-galactosidase BG1-like precursor [Vitis vinifera]
 gb|AAK81874.1| putative beta-galactosidase BG1 [Vitis vinifera]
Length=854

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/821 (65%), Positives = 646/821 (79%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   SV+YDK + +INGQR+IL+SGSIHYPRSTP+MW DL++KAK+GGLDV+ TY+FWN 
Sbjct  24    LIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVIDTYIFWNV  83

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+FIK  Q+ GLYVHLR+GPY CAEWNFGGFPVWLK+VPG+SFR
Sbjct  84    HEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKFVPGISFR  143

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             T+N PFK AMQ FT  IV+MMKS+ L+ SQGGPIILSQIENEYGP   ELGA G +Y  W
Sbjct  144   TNNEPFKMAMQGFTQKIVHMMKSENLFASQGGPIILSQIENEYGPESRELGAAGHAYINW  203

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AAKMAVGL TGVPWVMCK+DDAPDPV+NACNGFYCD FSPNK YKP++WTEAW+ WFTEF
Sbjct  204   AAKMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDAFSPNKPYKPRIWTEAWSGWFTEF  263

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GG +  RP +DLA+ VA+FI  GGSF+NYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+
Sbjct  264   GGTIHRRPVQDLAFGVARFIQNGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEY  323

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LH+AIKLCE A+VS DP VISLG+YQ+A VF S  G CAAFL+N N 
Sbjct  324   GLIRQPKYGHLKELHKAIKLCEHAVVSADPTVISLGSYQQAHVFSSGRGNCAAFLSNYNP  383

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F N+HY+LP WSISILPDC+  V+NTARVG Q+S M+M P  S+  SW++Y E
Sbjct  384   KSSARVIFNNVHYDLPAWSISILPDCRTVVFNTARVGVQTSHMRMFPTNSKLHSWETYGE  443

Query  1672  ETSSY-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + SS     T TA GLLEQIN TRD++DYLWYMT V ID  E+FL+ G+ P LTV S GH
Sbjct  444   DISSLGSSGTMTAGGLLEQINITRDSTDYLWYMTSVNIDSSESFLRRGQTPTLTVQSKGH  503

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+HVFINGQ  G++YG+ EN K T++ A  L AG N+I+LLSIAVGLPNVG HFETW  G
Sbjct  504   AVHVFINGQYSGSAYGTRENRKFTYTGAANLHAGTNRIALLSIAVGLPNVGLHFETWKTG  563

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLT  1139
             +LGPV L G+++GKRDL+WQKWSY++GLKGE ++L S +G S+VEWV GS  AQ +QPL 
Sbjct  564   ILGPVLLHGIDQGKRDLSWQKWSYQVGLKGEAMNLVSPNGVSAVEWVRGSLAAQGQQPLK  623

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             WYK  F+AP G+EPLALDM +MGKGQ+WINGQS+GRYW  Y  + G C  C+Y+G +   
Sbjct  624   WYKAYFNAPEGDEPLALDMRSMGKGQVWINGQSIGRYWMAY--AKGDCNVCSYSGTYRPP  681

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG  +QRWYHVPRSWL+PT NLL+ FEE GG+   ++L+KR + SVCAD  E  P
Sbjct  682   KCQHGCGHPTQRWYHVPRSWLKPTQNLLIIFEELGGDASKIALMKRAMKSVCADANEHHP  741

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              L NW  ++  ++    +   HL C  GQ I++I FASFGTP G+CGSF +GTCHA +S 
Sbjct  742   TLENWHTESPSESEELHQASVHLQCAPGQSISTIMFASFGTPSGTCGSFQKGTCHAPNSQ  801

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              I +K CIG   C+VP++   FG DPCP+V+K+LSVE  CS
Sbjct  802   AILEKNCIGQEKCSVPISNSYFGADPCPNVLKRLSVEAACS  842



>emb|CBI19767.3| unnamed protein product [Vitis vinifera]
Length=854

 Score =  1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/821 (65%), Positives = 645/821 (79%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   SV+YDK + +INGQR+IL+SGSIHYPRSTP+MW DL++KAK+GGLDV+ TY+FWN 
Sbjct  24    LIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVIDTYIFWNV  83

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+FIK  Q+ GLYVHLR+GPY CAEWNFGGFPVWLK+VPG+SFR
Sbjct  84    HEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKFVPGISFR  143

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             T+N PFK AMQ FT  IV+MMKS+ L+ SQGGPIILSQIENEYGP   ELGA G +Y  W
Sbjct  144   TNNEPFKMAMQGFTQKIVHMMKSENLFASQGGPIILSQIENEYGPESRELGAAGHAYINW  203

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AAKMAVGL TGVPWVMCK+DDAPDPV+NACNGFYCD FSPNK YKP++WTEAW+ WFTEF
Sbjct  204   AAKMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDAFSPNKPYKPRIWTEAWSGWFTEF  263

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GG +  RP +DLA+ VA+FI  GGSF+NYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+
Sbjct  264   GGTIHRRPVQDLAFGVARFIQNGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEY  323

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LH+AIKLCE A+VS DP VISLG+YQ+A VF S  G CAAFL+N N 
Sbjct  324   GLIRQPKYGHLKELHKAIKLCEHAVVSADPTVISLGSYQQAHVFSSGRGNCAAFLSNYNP  383

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F N+HY+LP WSISILPDC+  V+NTARVG Q+S M+M P  S+  SW++Y E
Sbjct  384   KSSARVIFNNVHYDLPAWSISILPDCRTVVFNTARVGVQTSHMRMFPTNSKLHSWETYGE  443

Query  1672  ETSSY-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + SS     T TA GLLEQIN TRD++DYLWYMT V ID  E+FL+ G+ P LTV S GH
Sbjct  444   DISSLGSSGTMTAGGLLEQINITRDSTDYLWYMTSVNIDSSESFLRRGQTPTLTVQSKGH  503

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+HVFINGQ  G++YG+ EN K T++ A  L AG N+I+LLSIAVGLPNVG HFETW  G
Sbjct  504   AVHVFINGQYSGSAYGTRENRKFTYTGAANLHAGTNRIALLSIAVGLPNVGLHFETWKTG  563

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLT  1139
             +LGPV L G+++GKRDL+WQKWSY++GLKGE ++L S +G S+VEWV GS  AQ +QPL 
Sbjct  564   ILGPVLLHGIDQGKRDLSWQKWSYQVGLKGEAMNLVSPNGVSAVEWVRGSLAAQGQQPLK  623

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             WYK  F+AP G+EPLALDM +MGKGQ+WINGQS+GRYW  Y  + G C  C+Y+G +   
Sbjct  624   WYKAYFNAPEGDEPLALDMRSMGKGQVWINGQSIGRYWMAY--AKGDCNVCSYSGTYRPP  681

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG  +QRWYHVPRSWL+PT NLL+ FEE GG+   ++L+KR + SVCAD  E  P
Sbjct  682   KCQHGCGHPTQRWYHVPRSWLKPTQNLLIIFEELGGDASKIALMKRAMKSVCADANEHHP  741

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              L NW  ++  ++        HL C  GQ I++I FASFGTP G+CGSF +GTCHA +S 
Sbjct  742   TLENWHTESPSESEELHEASVHLQCAPGQSISTIMFASFGTPSGTCGSFQKGTCHAPNSQ  801

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              I +K CIG   C+VP++   FG DPCP+V+K+LSVE  CS
Sbjct  802   AILEKNCIGQEKCSVPISNSYFGADPCPNVLKRLSVEAACS  842



>ref|XP_010437358.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =  1117 bits (2890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/816 (64%), Positives = 644/816 (79%), Gaps = 5/816 (1%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + +INGQR+IL SGSIHYPRSTP+MW  L++KAK+GG+DV++TYVFWN HEP P
Sbjct  33    VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFWNLHEPSP  92

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             GKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  93    GKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  152

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AM+ FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LGA G +Y  WAAKMA
Sbjct  153   FKRAMKGFTERIVELMKSENLFESQGGPIILSQIENEYGRQGQLLGAEGHNYMTWAAKMA  212

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             +   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WFTEFGGP+ 
Sbjct  213   IATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPLIWTEAWSGWFTEFGGPMH  272

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
              RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYDAPIDE+GL+R+
Sbjct  273   RRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYDAPIDEYGLIRQ  332

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LHRAIK+CE ALVS DP   SLGN Q+A V+ S+SG C+AFLAN +  S A+
Sbjct  333   PKYGHLKELHRAIKMCEKALVSADPVETSLGNKQQAHVYSSESGDCSAFLANYDTESAAR  392

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSSY  1658
             V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  ++ F WQSY E+ SS 
Sbjct  393   VLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTNTKNFQWQSYLEDLSSL  452

Query  1657  DD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             DD +T T  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L V S GHA+H+F
Sbjct  453   DDSSTITTHGLLEQINVTRDTSDYLWYMTSVDIKETESFLHGGELPTLIVQSTGHAVHIF  512

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G+++G+ +N + T+   + L +G NKI+LLS+AVGLPNVG HFE+WN G+LGPV
Sbjct  513   VNGQLSGSAFGTRQNRRFTYQGKINLHSGTNKIALLSVAVGLPNVGGHFESWNTGILGPV  572

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
             +L GL++GKRDL+WQKW+Y++GLKGE ++L   + + S  W++ S   QK QPLTW+KT 
Sbjct  573   ALHGLSQGKRDLSWQKWTYQVGLKGEAMNLAFPTNTPSFGWMDASLTVQKPQPLTWHKTY  632

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GNEPLALDM  MGKGQIW+NG+S+GRYW  +    G CG C+Y G +   KC + 
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCGHCSYTGTYKPNKCQTG  690

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +QRWYHVPRSWL+P+ NLLV FEE GGNP  +SLVKR V+ VCA++ E+ P + NW
Sbjct  691   CGQPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSTISLVKRSVSGVCAEVSEYHPNIKNW  750

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++++ GK     RPK HL C  GQ I SIKFASFGTP G+CGS+ +G CHA  SY I ++
Sbjct  751   QIESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGECHATTSYAILER  810

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              C+G   C V ++   FG DPCP+V+K+L+VE VC+
Sbjct  811   KCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCA  846



>emb|CAN78072.1| hypothetical protein VITISV_013292 [Vitis vinifera]
Length=854

 Score =  1117 bits (2890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/821 (65%), Positives = 645/821 (79%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   SV+YDK + +INGQR+IL+SGSIHYPRSTP+MW DL++KAK+GGLDV+ TY+FWN 
Sbjct  24    LIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVIDTYIFWNV  83

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+FIK  Q+ GLYVHLR+GPY CAEWNFGGFPVWLK+VPG+SFR
Sbjct  84    HEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKFVPGISFR  143

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             T+N PFK AMQ FT  IV+MMKS+ L+ SQGGPIILSQIENEYGP   ELGA G +Y  W
Sbjct  144   TNNEPFKMAMQGFTQKIVHMMKSENLFASQGGPIILSQIENEYGPESRELGAAGHAYINW  203

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AAKMAVGL TGVPWVMCK+DDAPDPV+NACNGFYCD FSPNK YKP++WTEAW+ WFTEF
Sbjct  204   AAKMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDAFSPNKPYKPRIWTEAWSGWFTEF  263

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GG +  RP +DLA+ VA+FI  GGSF+NYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+
Sbjct  264   GGTIHRRPVQDLAFGVARFIQNGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEY  323

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LH+AIKLCE A+VS DP VISLG+YQ+A VF S  G CAAFL+N N 
Sbjct  324   GLIRQPKYGHLKELHKAIKLCEHAVVSADPTVISLGSYQQAHVFSSGRGNCAAFLSNYNP  383

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F N+HY+LP WSISILPDC+  V+NTARVG Q+S M+M P  S+  SW++Y E
Sbjct  384   KSSARVIFNNVHYDLPAWSISILPDCRTVVFNTARVGVQTSHMRMFPTNSKLHSWETYGE  443

Query  1672  ETSSY-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + SS     T TA GLLEQIN TRD++DYLWYMT V ID  E+FL+ G+ P LTV S GH
Sbjct  444   DISSLGSSGTMTAGGLLEQINITRDSTDYLWYMTSVNIDSSESFLRRGQTPTLTVQSKGH  503

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+HVFINGQ  G++YG+ EN K T++ A  L AG N+I+LLSIAVGLPNVG HFETW  G
Sbjct  504   AVHVFINGQYSGSAYGTRENRKFTYTGAANLHAGTNRIALLSIAVGLPNVGLHFETWKTG  563

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLT  1139
             +LGPV L G+++GKRDL+WQKWSY++GLKGE ++L S +G S+VEWV GS  AQ +QPL 
Sbjct  564   ILGPVLLHGIDQGKRDLSWQKWSYQVGLKGEAMNLVSPNGVSAVEWVRGSLAAQGQQPLK  623

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             WYK  F+AP G+EPLALDM +MGKGQ+WINGQS+GRYW  Y  + G C  C+Y+G +   
Sbjct  624   WYKAYFNAPEGDEPLALDMRSMGKGQVWINGQSIGRYWMAY--AKGDCNVCSYSGTYRPP  681

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG  +QRWYHVPRSWL+PT NLL+ FEE GG+   ++L+KR + SVCAD  E  P
Sbjct  682   KCQHGCGHPTQRWYHVPRSWLKPTQNLLIIFEELGGDASKIALMKRAMKSVCADANEHHP  741

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              L NW  ++  ++        HL C  GQ I++I FASFGTP G+CGSF +GTCHA +S 
Sbjct  742   TLENWHTESPSESEELHZASVHLQCAPGQSISTIMFASFGTPSGTCGSFQKGTCHAPNSQ  801

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              I +K CIG   C+VP++   FG DPCP+V+K+LSVE  CS
Sbjct  802   AILEKNCIGQEKCSVPISNSYFGADPCPNVLKRLSVEAACS  842



>gb|KHN00504.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/821 (64%), Positives = 655/821 (80%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             +  A V+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL+ KAKEGG+DVV+TYVFWN 
Sbjct  22    VARAFVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGIDVVETYVFWNV  81

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  82    HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  141

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AMQ FT  IV MMKS+RL+ESQGGPIILSQIENEYG      GA G++Y  W
Sbjct  142   TDNEPFKRAMQGFTEKIVGMMKSERLFESQGGPIILSQIENEYGAQSKLQGAAGQNYVNW  201

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AAKMAV +GTGVPWVMCK+DDAPDPV+N CNGFYC  F+PN+ YKP +W EAW+ WFTEF
Sbjct  202   AAKMAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCHKFTPNRPYKPMIWIEAWSGWFTEF  261

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP +DLA+AVA+FI++GGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+
Sbjct  262   GGPIHKRPVQDLAFAVARFIIRGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEY  321

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GH K+LHRAIK+CE ALVS DP V SLG +Q+A V+ ++SG CAAFL+N + 
Sbjct  322   GLIRQPKYGHFKELHRAIKMCERALVSTDPIVTSLGEFQQAHVYTTESGDCAAFLSNYDS  381

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F NMHY+LPPWS+SILPDC+N V+NTA+VG Q+S+M+M P  ++ FSW+S++E
Sbjct  382   KSSARVMFNNMHYSLPPWSVSILPDCRNVVFNTAKVGVQTSQMQMLPTNTQLFSWESFDE  441

Query  1672  ETSSYDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             +  S D+++  TA GLLEQIN T+DASDYLWY+T V I   E+FL+GG+ P L V S GH
Sbjct  442   DIYSVDESSAITAPGLLEQINVTKDASDYLWYITSVDIGSSESFLRGGELPTLIVQSTGH  501

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+HVFINGQL G+++G+ E  + T++  V L AG+N+I+LLS+A+GLPNVG HFE+W+ G
Sbjct  502   AVHVFINGQLSGSAFGTREYRRFTYTGKVNLLAGINRIALLSVAIGLPNVGEHFESWSTG  561

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             +LGPV+L GL++GK DL+ QKW+Y++GLKGE + L S +G SSV W++ + + Q+ QPLT
Sbjct  562   ILGPVALHGLDKGKWDLSGQKWTYQVGLKGEAMDLASPNGISSVAWMQSAIVVQRNQPLT  621

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+KT FDAP G+EPLALDM  MGKGQIWINGQS+GRYW  +    G C  CNYAG F   
Sbjct  622   WHKTYFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAFAT--GNCNDCNYAGSFRPP  679

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG+ +QRWYHVPRSWL+ T NLLV FEE GGNP  +SLVKR V+SVCAD+ E+ P
Sbjct  680   KCQLGCGQPTQRWYHVPRSWLKTTQNLLVIFEELGGNPSKISLVKRSVSSVCADVSEYHP  739

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW +++ GK+     PK HL C  GQ I+SIKFASFGTP G+CG++ +G CH+  SY
Sbjct  740   NIKNWHIESYGKSEEFRPPKVHLHCSPGQTISSIKFASFGTPLGTCGNYEQGACHSPASY  799

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              I +K CIG   CTV V+   FG DPCP V+K+LSVE VC+
Sbjct  800   VILEKRCIGKPRCTVTVSNSNFGQDPCPKVLKRLSVEAVCA  840



>ref|XP_010113483.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC35510.1| Beta-galactosidase 3 [Morus notabilis]
Length=847

 Score =  1117 bits (2888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/820 (65%), Positives = 650/820 (79%), Gaps = 6/820 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   +V+YD+ + +INGQR+IL SGSIHYPRSTPEMW DL++KAK+GGLDVV+TYVFWN 
Sbjct  22    LIQCNVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAKDGGLDVVETYVFWNV  81

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+FIKL Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  82    HEPSPGNYNFEGRYDLVRFIKLIQRAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  141

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AMQ FT  IV MMK + L+ESQGGPIILSQIENEYG      GAP  +Y  W
Sbjct  142   TDNEPFKRAMQGFTEKIVGMMKKENLFESQGGPIILSQIENEYGVQSKLFGAPAHNYMTW  201

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AAKMAVGL TGVPWVMCK++DAPDPV+N CNGFYCD FSPNK YKP +WTEAW+ WF EF
Sbjct  202   AAKMAVGLKTGVPWVMCKEEDAPDPVINTCNGFYCDTFSPNKPYKPTIWTEAWSGWFNEF  261

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+ +RP +DLA+AV +FI +GGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+
Sbjct  262   GGPLHHRPVQDLAFAVTRFIQRGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEY  321

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHRAIK+CE ALVS DP + SLG+YQ+A ++ S+SG CAAFL+N + 
Sbjct  322   GLIRQPKYGHLKELHRAIKMCERALVSADPVITSLGSYQQAHLYTSESGDCAAFLSNYDT  381

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S  +V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  ++ FSW+S+NE
Sbjct  382   KSATRVLFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTNTQMFSWESFNE  441

Query  1672  -ETSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
               +S  D ++FTA GLLEQIN TRD SDYLWY+T V I   E+FL  G+ P L V S GH
Sbjct  442   DLSSIDDSSSFTAPGLLEQINVTRDTSDYLWYITSVGISASESFLHKGELPTLIVQSTGH  501

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+HVFINGQL G+++GS E+ +  ++  V L AG N+I+LLS+AVGLPNVG H+ETW+ G
Sbjct  502   AVHVFINGQLSGSAFGSRESRRFRYTGKVNLHAGTNRIALLSVAVGLPNVGGHYETWSTG  561

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             +LGPV L GL++GK DL+WQKW+Y++GLKGE   L S +  SSVEW+ GS  AQ+ QPLT
Sbjct  562   ILGPVVLHGLDQGKWDLSWQKWTYQVGLKGESKDLVSPNQYSSVEWMSGSLAAQRPQPLT  621

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+KT FDAP G+EPLALDM  MGKGQIWINGQS+GRYW  +  + G C  CNYAG F   
Sbjct  622   WHKTYFDAPEGDEPLALDMEGMGKGQIWINGQSIGRYWTAF--ANGNCNECNYAGGFKPT  679

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG+ +QRWYHVPRSWLRPT NLLV FEE GG+P  +SLV+R V++VCA++ E+ P
Sbjct  680   KCQFGCGQPTQRWYHVPRSWLRPTQNLLVLFEELGGDPSRISLVRRSVSTVCAEVTEYHP  739

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              L NW +++ GK+     PK HL C  GQ I+SIKFASFGTP G+CGS+ +GTCH+  SY
Sbjct  740   TLKNWHIESYGKSEEFHSPKVHLRCSNGQAISSIKFASFGTPLGTCGSYQQGTCHSAASY  799

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
              + +K CIG   C V +    F GDPCP+V+K+LSVE VC
Sbjct  800   SVIEKKCIGKQRCAVTIANSNF-GDPCPNVLKRLSVEAVC  838



>ref|XP_010432182.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =  1116 bits (2887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/816 (64%), Positives = 644/816 (79%), Gaps = 5/816 (1%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + +INGQR+IL SGSIHYPRSTP+MW  L++KAK+GG+DV++TYVFWN HEP P
Sbjct  33    VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFWNLHEPSP  92

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             GKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  93    GKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  152

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AMQ FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LGA G +Y  WAAKMA
Sbjct  153   FKRAMQGFTERIVELMKSENLFESQGGPIILSQIENEYGRQGQLLGAEGHNYMTWAAKMA  212

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             +   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WFTEFGGP+ 
Sbjct  213   IATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPLIWTEAWSGWFTEFGGPMH  272

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
              RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYDAPIDE+GL+R+
Sbjct  273   RRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYDAPIDEYGLIRQ  332

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LHRAIK+CE ALVS DP   SLGN Q+A V+ S+SG C+AFLAN +  S A+
Sbjct  333   PKYGHLKELHRAIKMCEKALVSADPVETSLGNKQQAHVYSSESGDCSAFLANYDTESAAR  392

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETSSY  1658
             V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  ++ F WQSY E+ SS 
Sbjct  393   VLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTNTKNFQWQSYLEDLSSL  452

Query  1657  DD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             DD +TFT  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L + S GHA+H+F
Sbjct  453   DDSSTFTTHGLLEQINVTRDTSDYLWYMTSVDIKETESFLHGGELPTLIIQSTGHAVHIF  512

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G+++G+ +N + T+   + L +G NKI+LLS+AVGLPNVG HFE+WN G+LGPV
Sbjct  513   VNGQLSGSAFGTRQNRRFTYQGKINLHSGTNKIALLSVAVGLPNVGGHFESWNTGILGPV  572

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
             +L GL++GKRDL+WQKW+Y++GLKGE ++L   + + S  W++ S   QK QPLTW+KT 
Sbjct  573   ALHGLSQGKRDLSWQKWTYQVGLKGEAMNLAFPTNTPSFGWMDASLTVQKPQPLTWHKTY  632

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDAP GNEPLALDM  MGKGQIW+NG+S+GRYW  +    G CG C+Y G +   KC + 
Sbjct  633   FDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCGHCSYTGTYKPNKCQTG  690

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +QRWYHVPRSWL+P+ NLLV FEE GGNP  +SLVKR V+ VCA++ E+ P + NW
Sbjct  691   CGQPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSTISLVKRSVSGVCAEVSEYHPNIKNW  750

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++++ GK     RPK HL C  GQ I SIKFASFGTP G+CG++ +G CHA  S  I ++
Sbjct  751   QIESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGNYQQGECHATTSCAILER  810

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              C+G   C V ++   FG DPCP+V+K+L+VE VC+
Sbjct  811   KCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCA  846



>ref|XP_009760187.1| PREDICTED: beta-galactosidase-like isoform X4 [Nicotiana sylvestris]
Length=807

 Score =  1116 bits (2887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/816 (67%), Positives = 645/816 (79%), Gaps = 37/816 (5%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             A+VSYD  + IING+R+IL+SGSIHYPRSTPEMWP L++KAK+GGLD+++TYVFWNGHEP
Sbjct  26    ATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNGHEP  85

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGK+ FEGRYDLVKFIKL QQAGLYV+LR+GPY C EWNFGGFPVWLKYVPG+ FR DN
Sbjct  86    SPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRADN  145

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ F   IVNMMKS+ L+E QGGPIIL+QIENEYGP+E+E+G+PGK+Y +WAA+
Sbjct  146   HPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAAE  205

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL  GVPW+MCKQ+DAPD V++ CNGFYC+ F PNK YKPKMWTE WTAW+T+FGGP
Sbjct  206   MAVGLEIGVPWIMCKQEDAPDHVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGGP  265

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP RPAEDLA++VA+FI   GSF NYYM+HGGTNFGRT    FIATSYDYDAP+DE+GLL
Sbjct  266   VPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGLL  325

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
              EPK+GHL+DLH+AIKL EPAL+S  P V  LG  QEA VF+SKSG CAAFL+N      
Sbjct  326   NEPKYGHLRDLHKAIKLSEPALISSYPTVNWLGKNQEAHVFRSKSGDCAAFLSN------  379

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTA-RVGAQSSRMKMTPVSRGFSWQSYNEET-  1667
                                        Y+T   + +Q S+M M PV    SWQSY+EET 
Sbjct  380   ---------------------------YDTKYSISSQCSQMMMAPVVGSLSWQSYSEETP  412

Query  1666  SSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S+ + +T +A GLLEQIN TRD+SDYLWYMTDV + P E FLK GK P+LTV SAGHA+H
Sbjct  413   SAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGPDEGFLKNGKDPFLTVMSAGHAMH  472

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQL GT YG L+NPK+T+S  V LRAG+NKISLLS+AVGLPNVG HFE+WN GVLG
Sbjct  473   VFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGVLG  532

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKT  1127
             PV+LSGLN+G RDLT Q+WSYK+GLKGE LS H+ SG SSVEWVEGS +AQ+QPLTWYK 
Sbjct  533   PVTLSGLNDGTRDLTIQRWSYKVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWYKA  592

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
             TFDAP GN+P+ALDM +MGKGQIW+NG+ VGR WPGY A  G CG CNYAG + EKKC +
Sbjct  593   TFDAPEGNDPVALDMVSMGKGQIWVNGEGVGRQWPGYIAK-GHCGECNYAGEYTEKKCQT  651

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ SQRWYHVPRSWL+P+GNLLV FEEWGG P  +SLV+R  A VCADI + QP L N
Sbjct  652   NCGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGVPTRISLVRRATARVCADIVDGQPTLKN  711

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W   +SGK+   + PKAHL C  G+KI+ I+FAS+G P+G+CG+F EGTCHA  SYD F+
Sbjct  712   WRTVSSGKSNN-MHPKAHLCCPDGKKISKIQFASYGVPQGTCGNFREGTCHAHKSYDAFE  770

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             K CIG  SC++ V PE FGGDPCP+  KKLSVE +C
Sbjct  771   KNCIGRQSCSLNVVPEVFGGDPCPNTSKKLSVEAIC  806



>ref|NP_568001.1| beta-galactosidase 3 [Arabidopsis thaliana]
 sp|Q9SCV9.1|BGAL3_ARATH RecName: Full=Beta-galactosidase 3; Short=Lactase 3; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64739.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAL07134.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAM14371.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE86646.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=856

 Score =  1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/827 (63%), Positives = 650/827 (79%), Gaps = 8/827 (1%)
 Frame = -2

Query  2947  GTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQT  2768
             G  +V  G   V+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL++KAK+GG+DV++T
Sbjct  25    GVGFVQCG---VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGIDVIET  81

Query  2767  YVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYV  2588
             YVFWN HEP PGKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYV
Sbjct  82    YVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYV  141

Query  2587  PGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPG  2408
             PG+SFRTDN PFK AM+ FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LGA G
Sbjct  142   PGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQIENEYGRQGQLLGAEG  201

Query  2407  KSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWT  2228
              +Y  WAAKMA+   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+
Sbjct  202   HNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPLIWTEAWS  261

Query  2227  AWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYD  2048
              WFTEFGGP+ +RP +DLA+ VA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYD
Sbjct  262   GWFTEFGGPMHHRPVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYD  321

Query  2047  APIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAF  1868
             APIDE+GL+R+PK+GHLK+LHRAIK+CE ALVS DP V S+GN Q+A V+ ++SG C+AF
Sbjct  322   APIDEYGLIRQPKYGHLKELHRAIKMCEKALVSADPVVTSIGNKQQAHVYSAESGDCSAF  381

Query  1867  LANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFS  1691
             LAN +  S A+V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  ++ F 
Sbjct  382   LANYDTESAARVLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTDTKNFQ  441

Query  1690  WQSYNEETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLT  1514
             W+SY E+ SS DD +TFT  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L 
Sbjct  442   WESYLEDLSSLDDSSTFTTHGLLEQINVTRDTSDYLWYMTSVDIGDSESFLHGGELPTLI  501

Query  1513  VYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHF  1334
             + S GHA+H+F+NGQL G+++G+ +N + T+   + L +G N+I+LLS+AVGLPNVG HF
Sbjct  502   IQSTGHAVHIFVNGQLSGSAFGTRQNRRFTYQGKINLHSGTNRIALLSVAVGLPNVGGHF  561

Query  1333  ETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ  1154
             E+WN G+LGPV+L GL++GK DL+WQKW+Y++GLKGE ++L   + + S+ W++ S   Q
Sbjct  562   ESWNTGILGPVALHGLSQGKMDLSWQKWTYQVGLKGEAMNLAFPTNTPSIGWMDASLTVQ  621

Query  1153  K-QPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYA  977
             K QPLTW+KT FDAP GNEPLALDM  MGKGQIW+NG+S+GRYW  +    G C  C+Y 
Sbjct  622   KPQPLTWHKTYFDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCSHCSYT  679

Query  976   GWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCAD  797
             G +   KC + CG+ +QRWYHVPR+WL+P+ NLLV FEE GGNP  VSLVKR V+ VCA+
Sbjct  680   GTYKPNKCQTGCGQPTQRWYHVPRAWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAE  739

Query  796   IYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTC  617
             + E+ P + NW++++ GK     RPK HL C  GQ I SIKFASFGTP G+CGS+ +G C
Sbjct  740   VSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGEC  799

Query  616   HAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             HA  SY I ++ C+G   C V ++   FG DPCP+V+K+L+VE VC+
Sbjct  800   HAATSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCA  846



>dbj|BAJ96054.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =  1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/818 (66%), Positives = 648/818 (79%), Gaps = 8/818 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YD+ + +INGQR+IL SGSIHYPRSTPEMW  L++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  31    AVTYDRKAVLINGQRRILFSGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  90

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLVKFIK AQ+AGL+VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  91    PGSYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  150

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKAAMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP E E GA GKSY+ WAAKM
Sbjct  151   PFKAAMQGFTEKIVGMMKSEELFASQGGPIILSQIENEYGPEEKEFGAAGKSYSDWAAKM  210

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCKQ+DAPDPV+NACNGFYCD F+PN   KP MWTEAWT WFTEFGG +
Sbjct  211   AVGLDTGVPWVMCKQEDAPDPVINACNGFYCDAFTPNTPSKPTMWTEAWTGWFTEFGGTI  270

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP EDL++AVA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL R
Sbjct  271   RKRPVEDLSFAVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLAR  330

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             EPK+GHLK+LH+AIKLCE ALVS DP V SLG+ QEA V++S SG CAAFLAN N +S A
Sbjct  331   EPKYGHLKELHKAIKLCEQALVSVDPTVTSLGSMQEAHVYRSPSG-CAAFLANYNSNSHA  389

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQSYNEETSS  1661
             K+ F N HY+LPPWSISILPDCK  VYNTA VG Q+S+M+M +  +    W+ Y+EE  S
Sbjct  390   KIVFDNEHYSLPPWSISILPDCKTVVYNTATVGVQTSQMQMWSDGASSMMWERYDEEVGS  449

Query  1660  YDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
                    T TGLLEQ+N TRD SDYLWYMT V + P E  L+GGK   LTV SAGHALH+
Sbjct  450   LAAAPLLTTTGLLEQLNATRDTSDYLWYMTSVDVSPSEKSLQGGKPLSLTVQSAGHALHI  509

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             F+NGQL G++ G+ E+ ++++   V LRAG NKISLLS+A GLPN+G H+ETWN GV GP
Sbjct  510   FVNGQLQGSASGTREDKRISYKGDVKLRAGTNKISLLSVACGLPNIGVHYETWNTGVNGP  569

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ-PLTWYKT  1127
             V L GL+EG RDLTWQ W+Y++GLKGE ++L+SL G+SSVEW++GS IAQ Q PL WY+ 
Sbjct  570   VVLHGLDEGSRDLTWQTWTYQVGLKGEQMNLNSLEGASSVEWMQGSLIAQNQMPLAWYRA  629

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              FD P+G+EPLALDM +MGKGQIWINGQS+GRY   Y    G C  C+Y G F   KC +
Sbjct  630   YFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYSLAYAT--GDCKDCSYTGSFRAIKCQA  687

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QRWYHVP+SWL+PT NLLV FEE GG+   +SLVKR V++VCAD+ E+ P + N
Sbjct  688   GCGQPTQRWYHVPKSWLQPTRNLLVVFEELGGDTSKISLVKRSVSNVCADVSEFHPSIKN  747

Query  766   WEMQASGKATRPL-RPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             W+ + SG+A   L R K HL C  GQ I++IKFASFGTP G+CGSF +G CH+  S  + 
Sbjct  748   WQTENSGEAKPELRRSKVHLRCAPGQSISAIKFASFGTPLGTCGSFEQGQCHSTKSQTVL  807

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +  CIG   C V ++P+ FGGDPCP+VMK+++VE VCS
Sbjct  808   EN-CIGKQRCAVTISPDNFGGDPCPNVMKRVAVEAVCS  844



>gb|KCW53601.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=696

 Score =  1115 bits (2883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/670 (81%), Positives = 608/670 (91%), Gaps = 3/670 (0%)
 Frame = -2

Query  2923  TASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHE  2744
             TASVSYD  +  INGQR+IL+SGSIHYPRSTPEMWPDL++KAKEGGLDV+QTYVFWNGHE
Sbjct  28    TASVSYDAKAITINGQRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHE  87

Query  2743  PQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTD  2564
             P PGKY FEG YD+VKF+KLAQQAGLYVHLRVGPY CAEWNFGGFPVWLKYV G+SFRTD
Sbjct  88    PSPGKYNFEGNYDIVKFVKLAQQAGLYVHLRVGPYVCAEWNFGGFPVWLKYVRGISFRTD  147

Query  2563  NGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAA  2384
             NGPFK  MQKFTT IVNMMK++ L+ESQGGPIILSQIENEYGPMEYE+GA G++Y +WAA
Sbjct  148   NGPFKYYMQKFTTKIVNMMKAEWLFESQGGPIILSQIENEYGPMEYEIGASGRAYTKWAA  207

Query  2383  KMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGG  2204
             +MAVGLGTGVPWVMCKQDDAPDP++N CNGFYCD+FSPNKAYKPKMWTEAWT W+TEFGG
Sbjct  208   EMAVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWTEAWTGWYTEFGG  267

Query  2203  PVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGL  2024
             PVP RP EDLA++VA+FI KGG+FINYYM+HGGTNFGRTAGGPFIATSYDYDAP+DE+GL
Sbjct  268   PVPNRPVEDLAFSVARFIKKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDAPLDEYGL  327

Query  2023  LREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHS  1844
             LR+PKWGHLKDLHRAIKLCEPALVSG+P V  LGNY+EA VF+SKSGACAAFL+N + ++
Sbjct  328   LRQPKWGHLKDLHRAIKLCEPALVSGNPTVTKLGNYEEAHVFRSKSGACAAFLSNYHSNA  387

Query  1843  FAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV--SRGFSWQSYNEE  1670
             FAKV++GNMHYNLPPWSISILPDCKNTVYNTARVGAQS+RMKMTPV    GFSWQ+YNEE
Sbjct  388   FAKVSWGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTPVPIHGGFSWQAYNEE  447

Query  1669  TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
              + Y+DN+FT  GLLEQINTTRD SDYLWY+TDV I+ +E FL+ GK+P LTV SAGHAL
Sbjct  448   PAGYEDNSFTMAGLLEQINTTRDVSDYLWYITDVYINSKEGFLRSGKYPTLTVQSAGHAL  507

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVF+NGQ  GT+YGSLE PK+TF++ V LRAG N+I+LLSIAVGLPNVGPHFE WNAGVL
Sbjct  508   HVFVNGQASGTAYGSLEFPKLTFNQGVKLRAGSNRIALLSIAVGLPNVGPHFERWNAGVL  567

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYK  1130
             GPV+L GL+EGKRDL+ QKWSYK+GLKGE L+LHSL+GSSSVEW EGS +A+KQPLTW+K
Sbjct  568   GPVTLYGLDEGKRDLSRQKWSYKVGLKGEALNLHSLTGSSSVEWAEGSLVARKQPLTWFK  627

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
             TTF APAGN PLALDMN+MGKGQIWINGQS+GRYWP YKAS G CG CNYAG + EKKCL
Sbjct  628   TTFSAPAGNTPLALDMNSMGKGQIWINGQSIGRYWPAYKAS-GTCGGCNYAGTYGEKKCL  686

Query  949   SKCGEASQRW  920
             S CGEASQRW
Sbjct  687   SNCGEASQRW  696



>ref|XP_004985588.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Setaria italica]
Length=841

 Score =  1115 bits (2883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/815 (66%), Positives = 649/815 (80%), Gaps = 7/815 (1%)
 Frame = -2

Query  2911  SYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPG  2732
             +YDK + +I+GQR+IL SGSIHYPRSTP+MW +L++KAK+GGLDV+QTYVFWNGHEP PG
Sbjct  28    TYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEELIQKAKDGGLDVIQTYVFWNGHEPTPG  87

Query  2731  KYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPF  2552
              YYFE RYDLV+F+K  Q+AGL+VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN PF
Sbjct  88    NYYFEERYDLVRFVKTVQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  147

Query  2551  KAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAV  2372
             K AMQ FT  IV MMKS++L+ SQGGPIILSQIENEYGP   E GA G+SY  WAAKMAV
Sbjct  148   KTAMQGFTEKIVGMMKSEKLFASQGGPIILSQIENEYGPEGKEFGAAGQSYINWAAKMAV  207

Query  2371  GLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPY  2192
             GLGTGVPWVMCK+DDAPDPV+NACNGFYCD FSPNK YKP MWTEAW+ WFTEFGG +  
Sbjct  208   GLGTGVPWVMCKEDDAPDPVINACNGFYCDAFSPNKPYKPMMWTEAWSGWFTEFGGTIRQ  267

Query  2191  RPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREP  2012
             RP EDLA+AVA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+REP
Sbjct  268   RPVEDLAFAVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLVREP  327

Query  2011  KWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKV  1832
             K  HLK+LHRA+KLCE ALVS DP + +LG  QEA VF+S SG CAAFLAN N +S+AKV
Sbjct  328   KHSHLKELHRAVKLCEQALVSVDPAITTLGTMQEAHVFRSPSG-CAAFLANYNSNSYAKV  386

Query  1831  AFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQSYNEETSSYD  1655
              F N HY+LPPWSISILPDCKN V+N+A VG Q+S+M+M    +    W+ Y+EE  S  
Sbjct  387   VFNNEHYSLPPWSISILPDCKNVVFNSATVGVQTSQMQMWADGASSMMWERYDEEVDSLA  446

Query  1654  DN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFI  1478
                  T TGLLEQ+N TRD+SDYLWY+T V I P E FL+G K   L+V SAGH LH+FI
Sbjct  447   AAPLLTTTGLLEQLNVTRDSSDYLWYITSVEISPSENFLQGAKPLSLSVQSAGHTLHIFI  506

Query  1477  NGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVS  1298
             NGQL G++YG+ E+ ++ ++    LRAG NKI+LLS+A GLPNVG H+ETWN GV+GPV 
Sbjct  507   NGQLQGSAYGTREDRRIKYNGNANLRAGTNKIALLSVACGLPNVGVHYETWNTGVVGPVV  566

Query  1297  LSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYKTTF  1121
             L GL+EG RDLTWQ WSY++GLKGE ++L+S+ GSSSVEW++GS +AQ +QPL WY+  F
Sbjct  567   LHGLDEGSRDLTWQTWSYQVGLKGEQMNLNSVQGSSSVEWMQGSLLAQNQQPLAWYRAYF  626

Query  1120  DAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKC  941
             + P+G+EPLALDM +MGKGQIWINGQS+GRYW  Y  + G C  C+Y G F   KC + C
Sbjct  627   ETPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAY--ANGDCKGCSYTGTFRAPKCQAGC  684

Query  940   GEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWE  761
             G+ +QRWYHVPRSWL+PT NLLV FEE GG+   ++LVKR V+SVCAD+ E  P +  W+
Sbjct  685   GQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALVKRSVSSVCADVSEDHPNIKKWQ  744

Query  760   MQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKY  581
             +++ G+     R K HL C  GQ I++IKFASFGTP G+CGSF +G CH+ +S+ + +K 
Sbjct  745   IESYGEREYH-RAKVHLKCAPGQSISAIKFASFGTPMGTCGSFQQGDCHSANSHTVLEKK  803

Query  580   CIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             CIG   C V ++PE FGGDPCP+V K+++VE VCS
Sbjct  804   CIGLQRCVVAISPENFGGDPCPNVTKRVAVEAVCS  838



>emb|CAB16852.1| beta-galactosidase like protein [Arabidopsis thaliana]
 emb|CAB80302.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score =  1115 bits (2883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/827 (63%), Positives = 650/827 (79%), Gaps = 8/827 (1%)
 Frame = -2

Query  2947  GTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQT  2768
             G  +V  G   V+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL++KAK+GG+DV++T
Sbjct  22    GVGFVQCG---VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGIDVIET  78

Query  2767  YVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYV  2588
             YVFWN HEP PGKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYV
Sbjct  79    YVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYV  138

Query  2587  PGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPG  2408
             PG+SFRTDN PFK AM+ FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LGA G
Sbjct  139   PGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQIENEYGRQGQLLGAEG  198

Query  2407  KSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWT  2228
              +Y  WAAKMA+   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+
Sbjct  199   HNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPLIWTEAWS  258

Query  2227  AWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYD  2048
              WFTEFGGP+ +RP +DLA+ VA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYD
Sbjct  259   GWFTEFGGPMHHRPVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYD  318

Query  2047  APIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAF  1868
             APIDE+GL+R+PK+GHLK+LHRAIK+CE ALVS DP V S+GN Q+A V+ ++SG C+AF
Sbjct  319   APIDEYGLIRQPKYGHLKELHRAIKMCEKALVSADPVVTSIGNKQQAHVYSAESGDCSAF  378

Query  1867  LANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFS  1691
             LAN +  S A+V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  ++ F 
Sbjct  379   LANYDTESAARVLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTDTKNFQ  438

Query  1690  WQSYNEETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLT  1514
             W+SY E+ SS DD +TFT  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L 
Sbjct  439   WESYLEDLSSLDDSSTFTTHGLLEQINVTRDTSDYLWYMTSVDIGDSESFLHGGELPTLI  498

Query  1513  VYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHF  1334
             + S GHA+H+F+NGQL G+++G+ +N + T+   + L +G N+I+LLS+AVGLPNVG HF
Sbjct  499   IQSTGHAVHIFVNGQLSGSAFGTRQNRRFTYQGKINLHSGTNRIALLSVAVGLPNVGGHF  558

Query  1333  ETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ  1154
             E+WN G+LGPV+L GL++GK DL+WQKW+Y++GLKGE ++L   + + S+ W++ S   Q
Sbjct  559   ESWNTGILGPVALHGLSQGKMDLSWQKWTYQVGLKGEAMNLAFPTNTPSIGWMDASLTVQ  618

Query  1153  K-QPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYA  977
             K QPLTW+KT FDAP GNEPLALDM  MGKGQIW+NG+S+GRYW  +    G C  C+Y 
Sbjct  619   KPQPLTWHKTYFDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCSHCSYT  676

Query  976   GWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCAD  797
             G +   KC + CG+ +QRWYHVPR+WL+P+ NLLV FEE GGNP  VSLVKR V+ VCA+
Sbjct  677   GTYKPNKCQTGCGQPTQRWYHVPRAWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAE  736

Query  796   IYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTC  617
             + E+ P + NW++++ GK     RPK HL C  GQ I SIKFASFGTP G+CGS+ +G C
Sbjct  737   VSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGEC  796

Query  616   HAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             HA  SY I ++ C+G   C V ++   FG DPCP+V+K+L+VE VC+
Sbjct  797   HAATSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCA  843



>emb|CDY59693.1| BnaC07g51120D [Brassica napus]
Length=856

 Score =  1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/816 (64%), Positives = 643/816 (79%), Gaps = 5/816 (1%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD+ + +INGQR+IL SGSIHYPRSTP+MW  L++KAK+GG+DV++TYVFWN HEP P
Sbjct  33    VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFWNLHEPSP  92

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             GKY F+GR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  93    GKYDFDGRNDLVRFVKTVHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  152

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AMQ FT  IV +MKS+ LYESQGGPIILSQIENEYG     LGA G +Y  WAAKMA
Sbjct  153   FKKAMQGFTERIVELMKSENLYESQGGPIILSQIENEYGRQGQLLGAEGHNYMTWAAKMA  212

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             +   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WFTEFGGP+ 
Sbjct  213   IATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPTIWTEAWSGWFTEFGGPMH  272

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
             +RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYDAPIDE+GL+R+
Sbjct  273   HRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYDAPIDEYGLIRQ  332

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PK+GHLK+LH+AIK+CE  LVS DP V SLGN Q+A V+ S+SG C+AFLAN +  S ++
Sbjct  333   PKYGHLKELHKAIKMCEKTLVSTDPVVTSLGNKQQAHVYSSESGDCSAFLANYDTESASR  392

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRG-FSWQSYNEETSSY  1658
             V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P +   F WQSY E+ SS 
Sbjct  393   VLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTNTANFQWQSYLEDLSSL  452

Query  1657  DD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
             DD +TFT  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L + S GHA+H+F
Sbjct  453   DDSSTFTTQGLLEQINVTRDTSDYLWYMTSVDIGETESFLHGGELPTLIIQSTGHAVHIF  512

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G+++G+ EN + T+   + L +G NKI+LLS+AVGLPNVG HFE+WN G+LGPV
Sbjct  513   VNGQLSGSAFGTRENRRFTYRGKINLHSGTNKIALLSVAVGLPNVGGHFESWNTGILGPV  572

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
             +L GL++GKRDL+WQKW+Y +GL+GE ++L   + + S+ W++ S   QK QPLTW+KT 
Sbjct  573   ALHGLSQGKRDLSWQKWTYLVGLRGEAMNLAYPTNTPSIGWMDASLTVQKPQPLTWHKTY  632

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FDA  G+EPLALDM  MGKGQIW+NG+S+GRYW  +    G C  C+Y G +   KCLS 
Sbjct  633   FDASEGDEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCDHCSYTGTYKPNKCLSG  690

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +QR+YHVPRSWL+P+ NLLV FEE  GNP  VSLVKR V+ VCA++ E+ P + NW
Sbjct  691   CGQPTQRYYHVPRSWLKPSQNLLVIFEEIEGNPSAVSLVKRSVSGVCAEVSEYHPNIKNW  750

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++++ GK     RPK HL C  GQ I++IKFASFGTP G CGS+ EG CHA  SY I +K
Sbjct  751   QLESYGKGQTFHRPKVHLKCSPGQAISAIKFASFGTPLGKCGSYQEGECHAATSYAILEK  810

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              C+G   C V ++   FG DPCP+V+K+L+VE VCS
Sbjct  811   KCVGKARCAVTISNTNFGKDPCPNVLKRLTVEAVCS  846



>gb|KDP38567.1| hypothetical protein JCGZ_04492 [Jatropha curcas]
Length=853

 Score =  1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/821 (65%), Positives = 639/821 (78%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   SV+YDK + IINGQR+IL+SGSIHYPRSTPEMW DL++KAK+GGLD + TYVFW+ 
Sbjct  23    LIQGSVTYDKKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDAIDTYVFWDV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+FIK  Q+ GLY HLR+GPY CAEWNFGG+PVWLKYVPG+SFR
Sbjct  83    HEPSPGNYNFEGRYDLVRFIKTIQKVGLYAHLRIGPYVCAEWNFGGYPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFKAAMQ FT  IV MMK+++L+ SQGGPIILSQIENEYGP+   L   G SY  W
Sbjct  143   TDNEPFKAAMQGFTEKIVQMMKNEKLFASQGGPIILSQIENEYGPVGKALREAGHSYINW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AAKMAVGL TGVPWVMCK+DDAPDPV+N CNGFYCD FSPNK YKP MWTEAW+ WFTEF
Sbjct  203   AAKMAVGLNTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYKPAMWTEAWSGWFTEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP +DLA+AVA+FI  GGS++NYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+
Sbjct  263   GGPIHQRPVQDLAFAVARFIQNGGSYVNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+REPK+ HLK+LH+AIKLCE ALVS DP V SLG Y++A +F S   +C+AFL+N N 
Sbjct  323   GLIREPKYSHLKELHKAIKLCEHALVSSDPRVTSLGTYEQAHIFSSGKRSCSAFLSNYNP  382

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGF-SWQSYNE  1673
              S A V F NMHYNLPPWSISILPDC+N V+NTARVG Q+S M+M P      SW++Y+E
Sbjct  383   KSAATVMFNNMHYNLPPWSISILPDCRNVVFNTARVGVQTSHMQMLPTGSPLRSWKTYDE  442

Query  1672  ETSSYDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + SS  D +  TA GLLEQIN TRD SDYLWYMT V I P E  L+ G+ P LTV SAGH
Sbjct  443   DISSLADGSRMTALGLLEQINVTRDTSDYLWYMTSVDISPSETSLRSGQKPSLTVQSAGH  502

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
              LHVFINGQ  G+++G+ EN ++TF+  + LRAG N+I+LLSIAVGLPN G H+ETW  G
Sbjct  503   GLHVFINGQFSGSAFGTRENRQLTFTGPINLRAGTNRIALLSIAVGLPNGGLHYETWKTG  562

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIA-QKQPLT  1139
             VLGPV L+GLNEGK+DLTWQKWSY++GLKGE ++L S +G+SS +W++GS  + Q QPL 
Sbjct  563   VLGPVILNGLNEGKKDLTWQKWSYQVGLKGEAMNLVSPNGASSGDWIQGSLASNQGQPLK  622

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+K  FDAP GNEPLALD+ +MGKGQ+WINGQS+GRYW  Y  + G C  C+Y+G F   
Sbjct  623   WHKAYFDAPGGNEPLALDLRSMGKGQVWINGQSIGRYWMTY--AKGDCIGCSYSGTFRPS  680

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG+ +Q+WYHVPRSWL+PT NLLV FEE GG+P  ++LVKR V  VCAD YE  P
Sbjct  681   KCQLGCGQPTQQWYHVPRSWLKPTKNLLVVFEELGGDPSKIALVKRSVTRVCADAYEHHP  740

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
                 +  +   +++   + K HL C  GQ I+ I FASFGTP G+CGSF +GTCHA  + 
Sbjct  741   AFEYYSREGHNESSMLHQAKIHLQCSLGQSISFINFASFGTPSGTCGSFQKGTCHASDTR  800

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + +K CIG  SC V ++   FG DPCP+V+KKLS+E VCS
Sbjct  801   SVIEKKCIGQESCMVTISNSNFGADPCPNVLKKLSIEAVCS  841



>ref|XP_006649450.1| PREDICTED: beta-galactosidase 5-like [Oryza brachyantha]
Length=841

 Score =  1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/815 (65%), Positives = 650/815 (80%), Gaps = 7/815 (1%)
 Frame = -2

Query  2911  SYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPG  2732
             +YDK S +I+GQR+IL SGSIHYPRSTPEMW  L++KAK+GGLDV+QTYVFWNGHEP PG
Sbjct  28    TYDKKSVVIDGQRRILFSGSIHYPRSTPEMWEGLIEKAKDGGLDVIQTYVFWNGHEPTPG  87

Query  2731  KYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPF  2552
              Y FEGRYDLV+FIK  Q+AG++VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN PF
Sbjct  88    NYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  147

Query  2551  KAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAV  2372
             K AMQ FT  IV++MKS+ L+ SQGGPIILSQIENEYGP   E GA GK+Y  WAAKMAV
Sbjct  148   KMAMQGFTEKIVDLMKSEELFASQGGPIILSQIENEYGPEGKEFGAAGKAYINWAAKMAV  207

Query  2371  GLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPY  2192
             GL TGVPWVMCK+DDAPDP++N CNGFYCD FSPNK YKP MWTEAW+ WFTEFGG +  
Sbjct  208   GLDTGVPWVMCKEDDAPDPLINTCNGFYCDAFSPNKPYKPMMWTEAWSGWFTEFGGTIRQ  267

Query  2191  RPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREP  2012
             RP EDLA+ VA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+REP
Sbjct  268   RPVEDLAFGVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLVREP  327

Query  2011  KWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKV  1832
             K+GHLK+LHRA+KLCE  LVS DP V +LG+ QEA VF+S SG CAAFLAN N +S+AKV
Sbjct  328   KFGHLKELHRAVKLCEQPLVSADPTVTTLGSMQEAHVFRSSSG-CAAFLANYNSNSYAKV  386

Query  1831  AFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQSYNEETSSYD  1655
              F N +Y+LPPWSISILPDCKN V+NTA VG Q+++M+M    +    W+ Y+EE  S  
Sbjct  387   VFNNENYSLPPWSISILPDCKNVVFNTATVGVQTNQMQMWADGASSMMWEKYDEEVDSLA  446

Query  1654  DN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFI  1478
                  T+TGLLEQ+N TRD SDYLWY+T V ++P E FL+GGK   LTV SAGHALHVFI
Sbjct  447   AAPLLTSTGLLEQLNVTRDTSDYLWYITSVEVNPSEKFLQGGKPLSLTVQSAGHALHVFI  506

Query  1477  NGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVS  1298
             NGQL G++YG+ E+ ++++S    LRAG NK++LLS+A GLPNVG H+ETWN GV+GPV 
Sbjct  507   NGQLQGSAYGTREDRRISYSGNANLRAGTNKVALLSVACGLPNVGVHYETWNTGVVGPVV  566

Query  1297  LSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYKTTF  1121
             + GL+EG RDLTWQ WSY++GLKGE ++L+SL GS SVEW++GS +AQ +QPL WY+  F
Sbjct  567   IHGLDEGSRDLTWQTWSYQVGLKGEQMNLNSLEGSGSVEWMQGSLVAQNQQPLAWYRAYF  626

Query  1120  DAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKC  941
             + P+G+EPLALDM +MGKGQIWINGQS+GRYW  Y  + G C  C+Y G F   KC + C
Sbjct  627   ETPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAY--AEGDCKECSYTGTFRAPKCQAGC  684

Query  940   GEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWE  761
             G+ +QRWYHVPRSWL+PT NLLV FEE GG+   ++LVKR V+ VCAD+ E+ P + NW+
Sbjct  685   GQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALVKRSVSGVCADVSEYHPNIKNWQ  744

Query  760   MQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKY  581
             +++ G+       K HL C  GQ I++IKFASFGTP G+CG+F +G CH+ +S+ + +K 
Sbjct  745   IESYGEPEFH-TAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSSNSHSVLEKK  803

Query  580   CIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             CIG   C V ++P +FGGDPCP VMK+++VE VCS
Sbjct  804   CIGLQRCVVAISPNSFGGDPCPEVMKRVAVEAVCS  838



>ref|XP_006826783.1| hypothetical protein AMTR_s00136p00108810 [Amborella trichopoda]
 gb|ERM94020.1| hypothetical protein AMTR_s00136p00108810 [Amborella trichopoda]
Length=755

 Score =  1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/753 (72%), Positives = 629/753 (84%), Gaps = 2/753 (0%)
 Frame = -2

Query  2731  KYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPF  2552
             +YYFEGRYDLV F+KL QQAGLY++LR+GPY CAEWNFGGFPVWLKYVPG+SFRTDNGPF
Sbjct  4     QYYFEGRYDLVWFVKLVQQAGLYLNLRIGPYVCAEWNFGGFPVWLKYVPGMSFRTDNGPF  63

Query  2551  KAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAV  2372
             K AMQ FTT IVNMMK+++L+ESQGGPIILSQIENEYGP E+E+GAPGK+YA WAA MAV
Sbjct  64    KMAMQTFTTKIVNMMKAEKLFESQGGPIILSQIENEYGPEEWEIGAPGKAYAAWAANMAV  123

Query  2371  GLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPY  2192
              LGTGVPW+MCKQDDAPDP++N CNGFYCD+F PNK YKPK+WTEAWT W+TEFGGPVP+
Sbjct  124   SLGTGVPWIMCKQDDAPDPIINTCNGFYCDYFVPNKPYKPKIWTEAWTGWYTEFGGPVPH  183

Query  2191  RPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREP  2012
             RPA+D+A+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI+TSYDYDAPIDE+GL+R+P
Sbjct  184   RPAQDMAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFISTSYDYDAPIDEYGLIRQP  243

Query  2011  KWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKV  1832
             KWGHLK+LHRAIKLCEP LVS D  V SLGNYQEA VF  KSG CAAFLAN +  S A V
Sbjct  244   KWGHLKELHRAIKLCEPMLVSADAVVTSLGNYQEAHVFSPKSGGCAAFLANYDSKSIATV  303

Query  1831  AFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEE-TSSYD  1655
              F  MHYNLPPWSISILPDCKNTV+NTA VG Q S MKMT       W+SYNEE +SSY 
Sbjct  304   QFNGMHYNLPPWSISILPDCKNTVFNTAEVGVQISDMKMTGTGTELYWESYNEEVSSSYT  363

Query  1654  DNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFIN  1475
             ++  T  GLLEQIN TRD +DYLWYMTDV I   E+FL GG+ P L+  SAGHALH FIN
Sbjct  364   EDPMTVVGLLEQINVTRDTTDYLWYMTDVDISSSESFLNGGELPVLSAQSAGHALHAFIN  423

Query  1474  GQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSL  1295
             GQL GT+YGSLE+P++T +    L++G N+I+LLSIAVGLPNVG  FETWNAGVLGPV L
Sbjct  424   GQLAGTAYGSLEDPRLTLTTNAKLKSGSNRIALLSIAVGLPNVGKRFETWNAGVLGPVML  483

Query  1294  SGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDA  1115
              GLNEG+RDLTWQKWSYK+GL GE L+LH+LSGSSSVEWV+GS IAQKQPLTWYK TF+A
Sbjct  484   KGLNEGRRDLTWQKWSYKVGLTGETLNLHTLSGSSSVEWVKGSLIAQKQPLTWYKATFNA  543

Query  1114  PAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGE  935
             P G+EPLALDM +MGKGQ+WINGQS+GRYWP Y A  G+CG C+Y+G ++EK C S CGE
Sbjct  544   PGGDEPLALDMGSMGKGQVWINGQSIGRYWPAYTAK-GSCGDCSYSGTYNEKNCQSNCGE  602

Query  934   ASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWEMQ  755
              SQRWYHVPR WL PTGNLLV FEEWGG+P G+SLVKR V SVCAD+ EW   + NW ++
Sbjct  603   PSQRWYHVPRPWLNPTGNLLVVFEEWGGDPSGISLVKRSVGSVCADVSEWHLTIKNWHIK  662

Query  754   ASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYCI  575
               GK  R  R K HL C  GQ ITSIKFASFGTP+G+CG+F +G CH+ +SY +FQK C+
Sbjct  663   TYGKPERLQRAKVHLGCDQGQTITSIKFASFGTPQGACGNFQQGACHSPNSYAVFQKKCV  722

Query  574   GWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             G  +C V ++P+ FGGDPC SVMK+++VE +C+
Sbjct  723   GQQACAVTISPDVFGGDPCFSVMKRVAVEAICN  755



>gb|ABR16628.1| unknown [Picea sitchensis]
Length=836

 Score =  1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/814 (64%), Positives = 635/814 (78%), Gaps = 3/814 (0%)
 Frame = -2

Query  2914  VSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQP  2735
             V+YD  + +ING+R+IL+SGSIHYPRST EMWPDL +KAK+GGLDV+QTYVFWN HEP P
Sbjct  25    VTYDHKALVINGERRILISGSIHYPRSTAEMWPDLFRKAKDGGLDVIQTYVFWNMHEPSP  84

Query  2734  GKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGP  2555
             G Y FEGR+DLVKF+KLAQ+AGLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN P
Sbjct  85    GNYNFEGRFDLVKFVKLAQEAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  144

Query  2554  FKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMA  2375
             FK AM+ FT  +V++MKS+ L+ESQGGPIIL+Q+ENEY P E E G  G  Y  WAA+MA
Sbjct  145   FKNAMEGFTKKVVDLMKSEGLFESQGGPIILAQVENEYKPEEMEYGLAGAQYMNWAAQMA  204

Query  2374  VGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVP  2195
             VG+ TGVPWVMCKQDDAPDPV+N CNGFYCD F PNK YKP MWTEAW+ W+TEFGG  P
Sbjct  205   VGMDTGVPWVMCKQDDAPDPVINTCNGFYCDNFVPNKPYKPTMWTEAWSGWYTEFGGASP  264

Query  2194  YRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLRE  2015
             +RP EDLA+AVA+F +KGGSF+NYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GL+R+
Sbjct  265   HRPVEDLAFAVARFFVKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLIRQ  324

Query  2014  PKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAK  1835
             PKWGHLK+LH+AIKLCEPALVSGDP V SLG++Q+A V+ + +G CAAF+ N + +S  +
Sbjct  325   PKWGHLKELHKAIKLCEPALVSGDPVVTSLGHFQQAYVYSAGAGNCAAFIVNYDSNSVGR  384

Query  1834  VAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSYD  1655
             V F    Y + PWS+SILPDC+N V+NTA+V  Q+S+MKMTPV  GF W+S +E  +S++
Sbjct  385   VIFNGQRYKIAPWSVSILPDCRNVVFNTAKVDVQTSQMKMTPVG-GFGWESIDENIASFE  443

Query  1654  DNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFIN  1475
             DN+ +A GLLEQIN TRD +DYLWY+T V +D  E F+K G  P LTV SAG ALHVFIN
Sbjct  444   DNSISAVGLLEQINITRDNTDYLWYITSVEVDEDEPFIKNGGLPVLTVQSAGDALHVFIN  503

Query  1474  GQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSL  1295
               L G+ YG  ENPKV FS  V L  G NKISLLS+ VGL N+GPHFE  NAGVLGP++L
Sbjct  504   DDLAGSQYGRKENPKVRFSSGVRLNVGTNKISLLSMTVGLQNIGPHFEMANAGVLGPITL  563

Query  1294  SGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDA  1115
             SG  +G RDL+ Q+WSY+IGLKGE ++LH+   ++       + + Q QPL WYK  FDA
Sbjct  564   SGFKDGTRDLSSQRWSYQIGLKGETMNLHTSGDNTVEWMKGVA-VPQSQPLRWYKAEFDA  622

Query  1114  PAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGE  935
             PAG +PL LD+++MGKGQ W+NGQS+GRYWP Y A G     C+Y G +   KC + CG+
Sbjct  623   PAGEDPLGLDLSSMGKGQAWVNGQSIGRYWPSYLAEGVCSDGCSYEGTYRPHKCDTNCGQ  682

Query  934   ASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN-WEM  758
             +SQRWYHVPRSWL+P+GN LV FEE GGNP GVSLV R V SVCA + E   Q +N W +
Sbjct  683   SSQRWYHVPRSWLQPSGNTLVLFEEIGGNPSGVSLVTRSVDSVCAHVSESHSQSINFWRL  742

Query  757   QASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKYC  578
             +++ +  +   PK HL C  GQ+I++IKFASFGTP+G CGSF +G CH+ +S    QK C
Sbjct  743   ESTDQVQKLHIPKVHLQCSKGQRISAIKFASFGTPQGLCGSFQQGDCHSPNSVATIQKKC  802

Query  577   IGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +G   C++ V+ + FGGDPCP V K +++E VCS
Sbjct  803   MGLRKCSLSVSEKIFGGDPCPGVRKGVAIEAVCS  836



>dbj|BAK07157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =  1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/818 (66%), Positives = 647/818 (79%), Gaps = 8/818 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YD+ + +INGQR+IL SGSIHYPRSTPEMW  L++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  31    AVTYDRKAVLINGQRRILFSGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  90

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLVKFIK AQ+AGL+VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  91    PGSYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  150

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFKAAMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP E E GA GKSY+ WAAKM
Sbjct  151   PFKAAMQGFTEKIVGMMKSEELFASQGGPIILSQIENEYGPEEKEFGAAGKSYSDWAAKM  210

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCKQ+DAPDPV+NACNGFYCD F+PN   KP MWTEAWT WFTEFGG +
Sbjct  211   AVGLDTGVPWVMCKQEDAPDPVINACNGFYCDAFTPNTPSKPTMWTEAWTGWFTEFGGTI  270

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP EDL++AVA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL R
Sbjct  271   RKRPVEDLSFAVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLAR  330

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             EPK+GHLK+LH+AIKLCE ALVS DP V SLG+ QEA V++S SG CAAFLAN N +S A
Sbjct  331   EPKYGHLKELHKAIKLCEQALVSVDPTVTSLGSMQEAHVYRSPSG-CAAFLANYNSNSHA  389

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQSYNEETSS  1661
             K+ F N HY+LPPWSISILPDCK  VYNTA VG Q+S+M+M +  +    W+ Y+EE  S
Sbjct  390   KIVFDNEHYSLPPWSISILPDCKTVVYNTATVGVQTSQMQMWSDGASSMMWERYDEEVGS  449

Query  1660  YDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
                    T TGLLEQ+N TRD SDYLWYMT V + P E  L+GGK   LTV SAGHALH+
Sbjct  450   LAAAPLLTTTGLLEQLNATRDTSDYLWYMTSVDVSPSEKSLQGGKPLSLTVQSAGHALHI  509

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             F+NGQL G++ G+ E+ ++++   V LRAG NKISLLS+A GLPN+G H+ETWN GV GP
Sbjct  510   FVNGQLQGSASGTREDKRISYKGDVKLRAGTNKISLLSVACGLPNIGVHYETWNTGVNGP  569

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ-PLTWYKT  1127
             V L GL+EG RDLTWQ W+Y++GLKGE ++L+SL G+SSVEW++GS IAQ Q PL WY+ 
Sbjct  570   VVLHGLDEGSRDLTWQTWTYQVGLKGEQMNLNSLEGASSVEWMQGSLIAQNQMPLAWYRA  629

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              FD P+G+EPLALDM +MGKGQIWINGQS+GRY   Y    G C  C+Y G F   KC +
Sbjct  630   YFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYSLAYAT--GDCKDCSYTGSFRAIKCQA  687

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QRWYHVP+ WL+PT NLLV FEE GG+   +SLVKR V++VCAD+ E+ P + N
Sbjct  688   GCGQPTQRWYHVPKPWLQPTRNLLVVFEELGGDTSKISLVKRSVSNVCADVSEFHPSIKN  747

Query  766   WEMQASGKATRPL-RPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             W+ + SG+A   L R K HL C  GQ I++IKFASFGTP G+CGSF +G CH+  S  + 
Sbjct  748   WQTENSGEAKPELRRSKVHLRCAPGQSISAIKFASFGTPLGTCGSFEQGQCHSTKSQTVL  807

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +  CIG   C V ++P+ FGGDPCP+VMK+++VE VCS
Sbjct  808   EN-CIGKQRCAVTISPDNFGGDPCPNVMKRVAVEAVCS  844



>ref|NP_001049068.1| Os03g0165400 [Oryza sativa Japonica Group]
 sp|Q10RB4.1|BGAL5_ORYSJ RecName: Full=Beta-galactosidase 5; Short=Lactase 5; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABF94149.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10982.1| Os03g0165400 [Oryza sativa Japonica Group]
 dbj|BAG95436.1| unnamed protein product [Oryza sativa Japonica Group]
Length=841

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/817 (65%), Positives = 647/817 (79%), Gaps = 7/817 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YDK + +++GQR+IL SGSIHYPRSTPEMW  L++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  26    AVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHEPT  85

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+FIK  Q+AG++VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  86    PGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  145

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP   E GA GK+Y  WAAKM
Sbjct  146   PFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQIENEYGPEGKEFGAAGKAYINWAAKM  205

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCK+DDAPDPV+NACNGFYCD FSPNK YKP MWTEAW+ WFTEFGG +
Sbjct  206   AVGLDTGVPWVMCKEDDAPDPVINACNGFYCDTFSPNKPYKPTMWTEAWSGWFTEFGGTI  265

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP EDLA+ VA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL R
Sbjct  266   RQRPVEDLAFGVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLAR  325

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             EPK+GHLK+LHRA+KLCE  LVS DP V +LG+ QEA VF+S SG CAAFLAN N +S+A
Sbjct  326   EPKFGHLKELHRAVKLCEQPLVSADPTVTTLGSMQEAHVFRSSSG-CAAFLANYNSNSYA  384

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQSYNEETSS  1661
             KV F N +Y+LPPWSISILPDCKN V+NTA VG Q+++M+M    +    W+ Y+EE  S
Sbjct  385   KVIFNNENYSLPPWSISILPDCKNVVFNTATVGVQTNQMQMWADGASSMMWEKYDEEVDS  444

Query  1660  YDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
                    T+TGLLEQ+N TRD SDYLWY+T V +DP E FL+GG    LTV SAGHALHV
Sbjct  445   LAAAPLLTSTGLLEQLNVTRDTSDYLWYITSVEVDPSEKFLQGGTPLSLTVQSAGHALHV  504

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G++YG+ E+ K+++S    LRAG NK++LLS+A GLPNVG H+ETWN GV+GP
Sbjct  505   FINGQLQGSAYGTREDRKISYSGNANLRAGTNKVALLSVACGLPNVGVHYETWNTGVVGP  564

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYKT  1127
             V + GL+EG RDLTWQ WSY++GLKGE ++L+SL GS SVEW++GS +AQ +QPL WY+ 
Sbjct  565   VVIHGLDEGSRDLTWQTWSYQVGLKGEQMNLNSLEGSGSVEWMQGSLVAQNQQPLAWYRA  624

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              FD P+G+EPLALDM +MGKGQIWINGQS+GRYW  Y  + G C  C+Y G +   KC +
Sbjct  625   YFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAY--AEGDCKGCHYTGSYRAPKCQA  682

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QRWYHVPRSWL+PT NLLV FEE GG+   ++L KR V+ VCAD+ E+ P + N
Sbjct  683   GCGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALAKRTVSGVCADVSEYHPNIKN  742

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W++++ G+       K HL C  GQ I++IKFASFGTP G+CG+F +G CH+ +S  + +
Sbjct  743   WQIESYGEPEFH-TAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSINSNSVLE  801

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K CIG   C V ++P  FGGDPCP VMK+++VE VCS
Sbjct  802   KKCIGLQRCVVAISPSNFGGDPCPEVMKRVAVEAVCS  838



>ref|XP_002263382.2| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI38026.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =  1112 bits (2877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/823 (64%), Positives = 646/823 (78%), Gaps = 6/823 (1%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
             + L   SV+YD+ + IINGQR+IL SGSIHYPRSTP+MW  L++KAK+GGLD + TYVFW
Sbjct  20    IQLTQCSVTYDRKALIINGQRRILFSGSIHYPRSTPQMWEGLIQKAKDGGLDAIDTYVFW  79

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             N HEP PGKY FEGRYDLV+FIKL Q+AGLYVHLR+GPY CAEWNFGGFPVWLK+VPGVS
Sbjct  80    NLHEPSPGKYNFEGRYDLVRFIKLIQKAGLYVHLRIGPYICAEWNFGGFPVWLKFVPGVS  139

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDN PFK AMQ+FT  IV MMK+++L+ESQGGPII+SQIENEYG      GAPG +Y 
Sbjct  140   FRTDNEPFKMAMQRFTQKIVQMMKNEKLFESQGGPIIISQIENEYGHESRAFGAPGYAYL  199

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAAKMAV + TGVPWVMCK+DDAPDPV+N CNGFYCD+FSPNK  KP +WTEAW+ WFT
Sbjct  200   TWAAKMAVAMDTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPNKPTLWTEAWSGWFT  259

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
             EF GP+  RP EDL++AV +FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAPID
Sbjct  260   EFAGPIQQRPVEDLSFAVTRFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPID  319

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             E+GL+R+PK+GHLK+LH+AIKLCE AL+S DP   SLG Y +A+VF S+SG CAAFL+N 
Sbjct  320   EYGLIRQPKYGHLKELHKAIKLCERALLSADPAETSLGTYAKAQVFYSESGGCAAFLSNY  379

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSY  1679
             N  S A+V F +MHYNL PWSISILPDCKN V+NTA VG Q+S+M+M P  S   SW+++
Sbjct  380   NPTSAARVTFNSMHYNLAPWSISILPDCKNVVFNTATVGVQTSQMQMLPTNSELLSWETF  439

Query  1678  NEETSSYDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             NE+ SS DD+ T T  GLLEQ+N TRD SDYLWY T + I   E+FL GG+ P L V S 
Sbjct  440   NEDISSADDDSTITVVGLLEQLNVTRDTSDYLWYSTRIDISSSESFLHGGQHPTLIVQST  499

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHA+HVFING L G+++G+ E+ + TF+  V L+ G N IS+LSIAVGLPN GPHFETW+
Sbjct  500   GHAMHVFINGHLSGSAFGTREDRRFTFTGDVNLQTGSNIISVLSIAVGLPNNGPHFETWS  559

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QP  1145
              GVLGPV L GL+EGK+DL+WQKWSY++GLKGE ++L S +  S+++W++GS  AQK QP
Sbjct  560   TGVLGPVVLHGLDEGKKDLSWQKWSYQVGLKGEAMNLVSPNVISNIDWMKGSLFAQKQQP  619

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTWYK  FDAP G+EPLALDM +MGKGQ+WINGQS+GRYW  Y  + G C  C+Y+G F 
Sbjct  620   LTWYKAYFDAPDGDEPLALDMGSMGKGQVWINGQSIGRYWTAY--AKGNCSGCSYSGTFR  677

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
               KC   CG+ +QRWYHVPRSWL+PT NLLV FEE GG+   +S +KR V +VCA++ E 
Sbjct  678   TTKCQFGCGQPTQRWYHVPRSWLKPTQNLLVLFEELGGDASKISFMKRSVTTVCAEVSEH  737

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
              P + NW +++  +     +PK HL C +GQ I++IKFASFGTP G+CG+F +GTCHA  
Sbjct  738   HPNIKNWHIESQERPEEMSKPKVHLHCASGQSISAIKFASFGTPSGTCGNFQKGTCHAPT  797

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             S  + +K CIG   C+V V+   F  +PCP++ KKLSVE VC+
Sbjct  798   SQAVLEKKCIGQQKCSVAVSSSNF-ANPCPNMFKKLSVEAVCA  839



>gb|KHN17668.1| Beta-galactosidase [Glycine soja]
Length=771

 Score =  1112 bits (2876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/783 (70%), Positives = 638/783 (81%), Gaps = 14/783 (2%)
 Frame = -2

Query  2824  MWPDLLKKAKEGGLDVVQTYVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVG  2645
             MWPDL++KAK+GGLDV+QTYVFWNGHEP PGKYYFE RYDLVKFIKL QQAGLYVHLR+G
Sbjct  1     MWPDLIQKAKDGGLDVIQTYVFWNGHEPSPGKYYFEDRYDLVKFIKLVQQAGLYVHLRIG  60

Query  2644  PYACAEWNFGGFPVWLKYVPGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPII  2465
             PY CAEWNFGGFPVWLKYVPG++FRTDN PFKAAMQKFT  IV++MK ++L+++QG    
Sbjct  61    PYICAEWNFGGFPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSIMKEEKLFQTQG----  116

Query  2464  LSQIENEYGPMEYELGAPGKSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYC  2285
                 ENEYGP+E+E+GAPGK+Y +W ++MAVGL TGVPW+MCKQ D PDP+++ CNG+YC
Sbjct  117   ----ENEYGPVEWEIGAPGKAYTKWFSQMAVGLDTGVPWIMCKQIDTPDPLIDTCNGYYC  172

Query  2284  DWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGG  2105
             + F+PNK YKPKMWTE WT W+TEFGG VP RPAED+A++VA+F+  GGSF+NYYM+HGG
Sbjct  173   ENFTPNKKYKPKMWTENWTGWYTEFGGAVPRRPAEDMAFSVARFVQNGGSFVNYYMYHGG  232

Query  2104  TNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISL  1925
             TNF RT+ G FIATSYDYD PIDE+GLL EPKWGHL+DLH+AIKLCEPALVS DP V   
Sbjct  233   TNFDRTSSGLFIATSYDYDGPIDEYGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVTWP  292

Query  1924  GNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTAR  1745
             GN  E  VFK+ SGACAAFLAN +  S A V FGN  Y+LPPWSISILPDCK  V+NTAR
Sbjct  293   GNNLEVHVFKT-SGACAAFLANYDTKSSASVKFGNGQYDLPPWSISILPDCKTAVFNTAR  351

Query  1744  VGAQSSRMKMTPVSRGFSWQSYNEE-TSSYDDNTFTATGLLEQINTTRDASDYLWYMTDV  1568
             +GAQSS MKMT V+  F WQSYNEE  SS +D++ TA  L EQIN TRD++DYLWYMTDV
Sbjct  352   LGAQSSLMKMTAVNSAFDWQSYNEEPASSNEDDSLTAYALWEQINVTRDSTDYLWYMTDV  411

Query  1567  RIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVN  1388
              ID  E F+K G+ P LTV SAGH LHV IN QL GT YG L++ K+TFS +V LR G N
Sbjct  412   NIDANEGFIKNGQSPVLTVMSAGHVLHVLINDQLSGTVYGGLDSHKLTFSDSVKLRVGNN  471

Query  1387  KISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslh  1208
             KISLLSIAVGLPNVGPHFETWNAGVLGPV+L GLNEG RDL+ QKWSYKIGLKGE L+L+
Sbjct  472   KISLLSIAVGLPNVGPHFETWNAGVLGPVTLKGLNEGTRDLSKQKWSYKIGLKGEALNLN  531

Query  1207  slsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRY  1028
             ++SGSSSVEWV+GS +A++QPL WYKTTF  PAGN+PLALDM +MGKGQ WING+S+GR+
Sbjct  532   TVSGSSSVEWVQGSLLAKQQPLAWYKTTFSTPAGNDPLALDMISMGKGQAWINGRSIGRH  591

Query  1027  WPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGN  848
             WPGY A G  CG C YAG + +KKC + CGE SQRWYH+PRSWL P+GN LV FEEWGG+
Sbjct  592   WPGYIARGN-CGDCYYAGTYTDKKCRTNCGEPSQRWYHIPRSWLNPSGNYLVVFEEWGGD  650

Query  847   PYGVSLVKREVASVCADIYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFA  668
             P G++LVKR  ASVCADIY+ QP L N +M  SGK    +RPKAHL C  G+ I+ IKFA
Sbjct  651   PTGITLVKRTTASVCADIYQGQPTLKNRQMLDSGKV---VRPKAHLWCPPGKNISQIKFA  707

Query  667   SFGTPRGSCGSFSEGTCHAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVE  488
             S+G P+G+CG+F EG+CHA  SYD  QK CIG  SC V V PE FGGDPCP + KKLS+E
Sbjct  708   SYGLPQGTCGNFREGSCHAHKSYDAPQKNCIGKQSCLVTVAPEVFGGDPCPGIAKKLSLE  767

Query  487   VVC  479
              +C
Sbjct  768   ALC  770



>ref|NP_849506.1| beta-galactosidase 3 [Arabidopsis thaliana]
 gb|AEE86647.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=855

 Score =  1112 bits (2875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/827 (63%), Positives = 650/827 (79%), Gaps = 9/827 (1%)
 Frame = -2

Query  2947  GTSWVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQT  2768
             G  +V  G   V+YD+ + +INGQR+IL SGSIHYPRSTP+MW DL++KAK+GG+DV++T
Sbjct  25    GVGFVQCG---VTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGIDVIET  81

Query  2767  YVFWNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYV  2588
             YVFWN HEP PGKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYV
Sbjct  82    YVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYV  141

Query  2587  PGVSFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPG  2408
             PG+SFRTDN PFK AM+ FT  IV +MKS+ L+ESQGGPIILSQIENEYG     LGA G
Sbjct  142   PGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQIENEYGRQGQLLGAEG  201

Query  2407  KSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWT  2228
              +Y  WAAKMA+   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+
Sbjct  202   HNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPLIWTEAWS  261

Query  2227  AWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYD  2048
              WFTEFGGP+ +RP +DLA+ VA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYD
Sbjct  262   GWFTEFGGPMHHRPVQDLAFGVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYD  321

Query  2047  APIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAF  1868
             APIDE+GL+R+PK+GHLK+LHRAIK+CE ALVS DP V S+GN Q+A V+ ++SG C+AF
Sbjct  322   APIDEYGLIRQPKYGHLKELHRAIKMCEKALVSADPVVTSIGNKQQAHVYSAESGDCSAF  381

Query  1867  LANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFS  1691
             LAN +  S A+V F N+HYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  ++ F 
Sbjct  382   LANYDTESAARVLFNNVHYNLPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTDTKNFQ  441

Query  1690  WQSYNEETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLT  1514
             W+SY E+ SS DD +TFT  GLLEQIN TRD SDYLWYMT V I   E+FL GG+ P L 
Sbjct  442   WESYLEDLSSLDDSSTFTTHGLLEQINVTRDTSDYLWYMTSVDIGDSESFLHGGELPTLI  501

Query  1513  VYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHF  1334
             + S GHA+H+F+NGQL G+++G+ +N + T+   + L +G N+I+LLS+AVGLPNVG HF
Sbjct  502   IQSTGHAVHIFVNGQLSGSAFGTRQNRRFTYQGKINLHSGTNRIALLSVAVGLPNVGGHF  561

Query  1333  ETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ  1154
             E+WN G+LGPV+L GL++GK DL+WQKW+Y++GLKGE ++L   + + S+ W++ S   Q
Sbjct  562   ESWNTGILGPVALHGLSQGKMDLSWQKWTYQVGLKGEAMNLAFPTNTPSIGWMDASLTVQ  621

Query  1153  K-QPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYA  977
             K QPLTW+KT FDAP GNEPLALDM  MGKGQIW+NG+S+GRYW  +    G C  C+Y 
Sbjct  622   KPQPLTWHKTYFDAPEGNEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCSHCSYT  679

Query  976   GWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCAD  797
             G +   KC + CG+ +QRWYHVPR+WL+P+ NLLV FEE GGNP  VSLVKR V+ VCA+
Sbjct  680   GTYKPNKCQTGCGQPTQRWYHVPRAWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAE  739

Query  796   IYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTC  617
             + E+ P + NW++++ GK     RPK HL C  GQ I SIKFASFGTP G+CGS+ +G C
Sbjct  740   VSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSPGQAIASIKFASFGTPLGTCGSYQQGEC  799

Query  616   HAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             HA  SY I ++ C+G   C V ++   FG DPCP+V+K+L+VE VC+
Sbjct  800   HAATSYAILER-CVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCA  845



>ref|XP_002465807.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
 gb|EER92805.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
Length=842

 Score =  1112 bits (2875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/816 (66%), Positives = 651/816 (80%), Gaps = 8/816 (1%)
 Frame = -2

Query  2911  SYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPG  2732
             +YDK + +I+GQR+IL SGSIHYPRSTP+MW  L++KAK+GGLDV+QTYVFWNGHEP PG
Sbjct  28    TYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPTPG  87

Query  2731  KYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPF  2552
              YYFE RYDLV+FIK  Q+AGL+VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN PF
Sbjct  88    NYYFEERYDLVRFIKTVQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  147

Query  2551  KAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAV  2372
             K AMQ FT  IV MMKS++L+ SQGGPIILSQIENEYGP   ELGA G++Y  WAAKMA+
Sbjct  148   KTAMQGFTEKIVGMMKSEKLFASQGGPIILSQIENEYGPEGKELGAAGQAYINWAAKMAI  207

Query  2371  GLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPY  2192
             GLGTGVPWVMCK++DAPDPV+NACNGFYCD FSPNK YKP MWTEAW+ WFTEFGG +  
Sbjct  208   GLGTGVPWVMCKEEDAPDPVINACNGFYCDAFSPNKPYKPTMWTEAWSGWFTEFGGTIRQ  267

Query  2191  RPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREP  2012
             RP EDLA+AVA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+REP
Sbjct  268   RPVEDLAFAVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLVREP  327

Query  2011  KWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKV  1832
             K  HLK+LHRA+KLCE ALVS DP + +LG  QEA VF+S SG CAAFLAN N +S+AKV
Sbjct  328   KHSHLKELHRAVKLCEQALVSVDPAITTLGTMQEAHVFRSPSG-CAAFLANYNSNSYAKV  386

Query  1831  AFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQSYNEETSSYD  1655
              F N  Y+LPPWSISILPDCKN V+N+A VG Q+S+M+M    +    W+ Y+EE  S  
Sbjct  387   VFNNEQYSLPPWSISILPDCKNVVFNSATVGVQTSQMQMWGDGASSMMWERYDEEVDSLA  446

Query  1654  DN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPW-LTVYSAGHALHVF  1481
                  T TGLLEQ+N TRD+SDYLWY+T V I P E FL+GG  P  L+V SAGHALHVF
Sbjct  447   AAPLLTTTGLLEQLNVTRDSSDYLWYITSVDISPSENFLQGGGKPLSLSVLSAGHALHVF  506

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NG+L G++YG+ E+ ++ ++    LRAG NKI+LLS+A GLPNVG H+ETWN GV GPV
Sbjct  507   VNGELQGSAYGTREDRRIKYNGNANLRAGTNKIALLSVACGLPNVGVHYETWNTGVGGPV  566

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYKTT  1124
              L GLNEG RDLTWQ WSY++GLKGE ++L+SL GS+SVEW++GS IAQ +QPL+WY+  
Sbjct  567   GLHGLNEGSRDLTWQTWSYQVGLKGEQMNLNSLEGSTSVEWMQGSLIAQNQQPLSWYRAY  626

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F+ P+G+EPLALDM +MGKGQIWINGQS+GRYW  Y  + G C  C+Y G F   KC + 
Sbjct  627   FETPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAY--ADGDCKECSYTGTFRAPKCQAG  684

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +QRWYHVPRSWL+PT NLLV FEE GG+   ++LVKR V+SVCAD+ E  P + NW
Sbjct  685   CGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALVKRSVSSVCADVSEDHPNIKNW  744

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             ++++ G+     R K HL C  GQ I++IKFASFGTP G+CG+F +G CH+ +S+ + +K
Sbjct  745   QIESYGEREYH-RAKVHLRCSPGQSISAIKFASFGTPMGTCGNFQQGDCHSANSHTVLEK  803

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CIG   C V ++PE+FGGDPCP V K+++VE VCS
Sbjct  804   KCIGLQRCAVAISPESFGGDPCPRVTKRVAVEAVCS  839



>ref|XP_009760186.1| PREDICTED: beta-galactosidase-like isoform X3 [Nicotiana sylvestris]
Length=809

 Score =  1111 bits (2874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/818 (67%), Positives = 645/818 (79%), Gaps = 39/818 (5%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             A+VSYD  + IING+R+IL+SGSIHYPRSTPEMWP L++KAK+GGLD+++TYVFWNGHEP
Sbjct  26    ATVSYDDRAIIINGKRRILISGSIHYPRSTPEMWPGLIQKAKDGGLDIIETYVFWNGHEP  85

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGK+ FEGRYDLVKFIKL QQAGLYV+LR+GPY C EWNFGGFPVWLKYVPG+ FR DN
Sbjct  86    SPGKFKFEGRYDLVKFIKLVQQAGLYVNLRIGPYICGEWNFGGFPVWLKYVPGMEFRADN  145

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ F   IVNMMKS+ L+E QGGPIIL+QIENEYGP+E+E+G+PGK+Y +WAA+
Sbjct  146   HPFKLAMQGFVEKIVNMMKSENLFEPQGGPIILAQIENEYGPIEWEVGSPGKAYTKWAAE  205

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL  GVPW+MCKQ+DAPD V++ CNGFYC+ F PNK YKPKMWTE WTAW+T+FGGP
Sbjct  206   MAVGLEIGVPWIMCKQEDAPDHVIDTCNGFYCEDFRPNKPYKPKMWTEVWTAWYTKFGGP  265

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VP RPAEDLA++VA+FI   GSF NYYM+HGGTNFGRT    FIATSYDYDAP+DE+GLL
Sbjct  266   VPRRPAEDLAFSVARFIQNNGSFFNYYMYHGGTNFGRTTSALFIATSYDYDAPLDEYGLL  325

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQE--ARVFKSKSGACAAFLANNNQH  1847
              EPK+GHL+DLH+AIKL EPAL+S  P V  LG  QE  A VF+SKSG CAAFL+N    
Sbjct  326   NEPKYGHLRDLHKAIKLSEPALISSYPTVNWLGKNQEQQAHVFRSKSGDCAAFLSN----  381

Query  1846  SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA-RVGAQSSRMKMTPVSRGFSWQSYNEE  1670
                                          Y+T   + +Q S+M M PV    SWQSY+EE
Sbjct  382   -----------------------------YDTKYSISSQCSQMMMAPVVGSLSWQSYSEE  412

Query  1669  T-SSYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHA  1493
             T S+ + +T +A GLLEQIN TRD+SDYLWYMTDV + P E FLK GK P+LTV SAGHA
Sbjct  413   TPSAEESDTLSANGLLEQINITRDSSDYLWYMTDVNVGPDEGFLKNGKDPFLTVMSAGHA  472

Query  1492  LHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGV  1313
             +HVFINGQL GT YG L+NPK+T+S  V LRAG+NKISLLS+AVGLPNVG HFE+WN GV
Sbjct  473   MHVFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINKISLLSVAVGLPNVGLHFESWNTGV  532

Query  1312  LGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWY  1133
             LGPV+LSGLN+G RDLT Q+WSYK+GLKGE LS H+ SG SSVEWVEGS +AQ+QPLTWY
Sbjct  533   LGPVTLSGLNDGTRDLTIQRWSYKVGLKGESLSFHTSSGGSSVEWVEGSLLAQRQPLTWY  592

Query  1132  KTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKC  953
             K TFDAP GN+P+ALDM +MGKGQIW+NG+ VGR WPGY A  G CG CNYAG + EKKC
Sbjct  593   KATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGRQWPGYIAK-GHCGECNYAGEYTEKKC  651

Query  952   LSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQL  773
              + CG+ SQRWYHVPRSWL+P+GNLLV FEEWGG P  +SLV+R  A VCADI + QP L
Sbjct  652   QTNCGQPSQRWYHVPRSWLKPSGNLLVVFEEWGGVPTRISLVRRATARVCADIVDGQPTL  711

Query  772   MNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDI  593
              NW   +SGK+   + PKAHL C  G+KI+ I+FAS+G P+G+CG+F EGTCHA  SYD 
Sbjct  712   KNWRTVSSGKSNN-MHPKAHLCCPDGKKISKIQFASYGVPQGTCGNFREGTCHAHKSYDA  770

Query  592   FQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             F+K CIG  SC++ V PE FGGDPCP+  KKLSVE +C
Sbjct  771   FEKNCIGRQSCSLNVVPEVFGGDPCPNTSKKLSVEAIC  808



>gb|KFK30264.1| hypothetical protein AALP_AA7G238600 [Arabis alpina]
Length=849

 Score =  1111 bits (2874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/823 (63%), Positives = 643/823 (78%), Gaps = 5/823 (1%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
             V     SV+YD+ + +INGQR+IL SGSIHYPRSTP+MW  L++KAK+GG+DV++TYVFW
Sbjct  19    VGFVQCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFW  78

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             N HEP PGKY FEGR DLV+F+K   +AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+S
Sbjct  79    NLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGIS  138

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDN PFK AM+ FT  IV +MKS  L+ESQGGPIILSQIENEYG     LGA G +Y 
Sbjct  139   FRTDNEPFKRAMKGFTERIVELMKSDNLFESQGGPIILSQIENEYGRQGQLLGAEGHNYM  198

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAAKMA+   TGVPWVMCK+DDAPDPV+N CNGFYCD F+PNK YKP +WTEAW+ WFT
Sbjct  199   TWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPTIWTEAWSGWFT  258

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
             EFGGP+  RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPF+ TSYDYDAPID
Sbjct  259   EFGGPMHKRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFVTTSYDYDAPID  318

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             E+GL+R+PK+GHLK+LHRAIK+CE ALVS DP V SLGN Q+A V+ S+SG C+AFLAN 
Sbjct  319   EYGLIRQPKYGHLKELHRAIKMCEKALVSTDPVVTSLGNKQQAHVYSSESGGCSAFLANY  378

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVS-RGFSWQSY  1679
             +  S A+V F N+HYN+PPWSISILPDC+N V+NTA+VG Q+S+M+M P +   F WQSY
Sbjct  379   DTESAARVLFNNVHYNIPPWSISILPDCRNAVFNTAKVGVQTSQMEMLPTNIENFQWQSY  438

Query  1678  NEETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
              E+ SS DD +TFT  GLLEQIN TRD SDYLWY T V ID  E+ L GG+ P L + S 
Sbjct  439   MEDLSSLDDSSTFTTHGLLEQINVTRDTSDYLWYTTSVDIDETESSLHGGELPTLIIQST  498

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             GHA+H+F+NGQL G+++G+ +N + T+   V L +G N+I+LLS+AVGLPNVG HFE+WN
Sbjct  499   GHAVHIFVNGQLSGSAFGTRQNRRFTYRGKVNLHSGTNRIALLSVAVGLPNVGGHFESWN  558

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QP  1145
              G+LGPV++ GL +GK DL+WQKW+Y++GLKGE ++L   + + S  W++ S   QK QP
Sbjct  559   TGILGPVAMHGLKQGKLDLSWQKWTYQVGLKGEAMNLAFPTNTPSNGWMDVSLTVQKPQP  618

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTW+KT FDAP G+EPLALDM  MGKGQIW+NG+S+GRYW  +    G C  C+Y G + 
Sbjct  619   LTWHKTYFDAPEGDEPLALDMEGMGKGQIWVNGESIGRYWTAFAT--GDCSHCSYTGTYK  676

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
               KC S CG+ +QRWYHVPRSWL+P+ NLLV FEE GGNP  VSLVKR V+ VCA++ E+
Sbjct  677   PNKCQSGCGQPTQRWYHVPRSWLKPSQNLLVIFEELGGNPSTVSLVKRSVSGVCAEVSEY  736

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
              P + NW++++ GK     RPK HL C  GQ I++IKFASFGTP G+CGS+ +G CHA  
Sbjct  737   HPNIKNWQIESYGKGQTFHRPKVHLKCSPGQAISAIKFASFGTPLGTCGSYQQGECHAAT  796

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             SY I ++ C+G   C V ++   FG DPCP+V+K+L+VE VC+
Sbjct  797   SYAILERKCVGKARCAVTISNSNFGKDPCPNVLKRLTVEAVCA  839



>ref|XP_008660537.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5-like [Zea 
mays]
Length=842

 Score =  1111 bits (2874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/818 (66%), Positives = 651/818 (80%), Gaps = 8/818 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YDK + +I+GQR+IL SGSIHYPRSTP+MW  L++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  26    AVTYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  85

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG YYFE RYDLV+FIK  Q+AGL+VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  86    PGNYYFEERYDLVRFIKTVQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  145

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP   E GA G++Y  WAAKM
Sbjct  146   PFKTAMQGFTEKIVGMMKSENLFASQGGPIILSQIENEYGPEGREFGAAGQAYINWAAKM  205

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGLGTGVPWVMCK++DAPDPV+NACNGFYCD FSPNK YKP MWTEAW+ WFTEFGG +
Sbjct  206   AVGLGTGVPWVMCKEEDAPDPVINACNGFYCDAFSPNKPYKPTMWTEAWSGWFTEFGGTI  265

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP EDLA+AVA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+R
Sbjct  266   RQRPVEDLAFAVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLVR  325

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             EPK  HLK+LHRA+KLCE ALVS DP + +LG  QEARVF+S SG CAAFLAN N +S+A
Sbjct  326   EPKHSHLKELHRAVKLCEQALVSVDPAITTLGTMQEARVFQSPSG-CAAFLANYNSNSYA  384

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQSYNEETSS  1661
             KV F N  Y+LPPWSISILPDCKN V+N+A VG Q+S+M+M    +   +W+ Y+EE  S
Sbjct  385   KVVFNNEQYSLPPWSISILPDCKNVVFNSATVGVQTSQMQMWGDGASSMTWERYDEEVDS  444

Query  1660  YDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPW-LTVYSAGHALH  1487
                    T TGLLEQ+N TRD+SDYLWY+T V I   E FL+GG  P  L+V SAGHALH
Sbjct  445   LAAAPLLTTTGLLEQLNVTRDSSDYLWYITSVDISSSENFLQGGGKPLSLSVQSAGHALH  504

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VF+NGQL G++YG+ E+ ++ ++    LRAG NKI+LLS+A GLPNVG H+ETWN GV G
Sbjct  505   VFVNGQLQGSAYGTREDRRIKYNGNASLRAGTNKIALLSVACGLPNVGVHYETWNTGVGG  564

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYK  1130
             PV L GL+EG RDLTWQ WSY++GLKGE ++L+S+ GSSSVEW++GS IAQ +QPL WY+
Sbjct  565   PVVLHGLDEGSRDLTWQTWSYQVGLKGEQMNLNSIEGSSSVEWMQGSLIAQNQQPLAWYR  624

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               F+ P+G+EPLALDM +MGKGQIWINGQS+GRYW  Y  + G C  C+Y G F   KC 
Sbjct  625   AYFETPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAY--ADGDCKECSYTGTFRAPKCQ  682

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             S CG+ +QRWYHVP+SWL+PT NLLV FEE GG+   ++LVKR V+SVCAD+ E  P + 
Sbjct  683   SGCGQPTQRWYHVPKSWLQPTRNLLVVFEELGGDSSKIALVKRSVSSVCADVSEDHPNIK  742

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW++++ G+     R K HL C  GQ I++IKFASFGTP G+CG F +G CH+ +S+ + 
Sbjct  743   NWQIESYGEREYH-RAKVHLRCARGQSISAIKFASFGTPTGTCGDFQQGDCHSANSHTVL  801

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K CIG   C V ++PE+FGGDPCPSV K+++V+ VCS
Sbjct  802   EKKCIGLQRCVVAISPESFGGDPCPSVTKRVAVQAVCS  839



>ref|XP_006340680.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=845

 Score =  1111 bits (2873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/821 (64%), Positives = 650/821 (79%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L    V+YD+ + +INGQR++L SGSIHYPRSTPEMW DL+ KAKEGGLDVV+TYVFWN 
Sbjct  23    LVHCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLINKAKEGGLDVVETYVFWNV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
              DN PFK AM+ +   IVN+MKS  L+ESQGGPIILSQIENEYGP    LGAPG  YA W
Sbjct  143   ADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAPGHQYATW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MAVGL TGVPWVMCK++DAPDPV+N CNGFYCD F PNK YKP +WTEAW+ WF+EF
Sbjct  203   AANMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDNFFPNKPYKPAIWTEAWSGWFSEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP +DLA+AVA+FI +GGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+
Sbjct  263   GGPLHQRPVQDLAFAVAQFIQRGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHRA+K+CE ++VS DP + SLGN Q+A V+ S++G CAAFL+NN+ 
Sbjct  323   GLIRQPKYGHLKELHRAVKMCEKSIVSADPAITSLGNLQQAYVYSSETGECAAFLSNNDW  382

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  S   SW++Y+E
Sbjct  383   KSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTNSEMLSWETYSE  442

Query  1672  ETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + S+ DD ++  + GLLEQIN TRD SDYLWY+T V I   E+FL GG+ P L V + GH
Sbjct  443   DMSALDDSSSIRSFGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELPTLIVETTGH  502

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+HVFINGQL G+++G+ +N +  F   V LRAG N+I+LLS+AVGLPN+G HFETW+ G
Sbjct  503   AMHVFINGQLSGSAFGTRKNRRFVFKGKVNLRAGSNRIALLSVAVGLPNIGGHFETWSTG  562

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             VLGPV++ GL++GK DL+W KW+Y++GLKGE ++L S +G S+V+W++GS IAQK QPLT
Sbjct  563   VLGPVAIQGLDQGKWDLSWAKWTYQVGLKGEAMNLVSTNGISAVDWMQGSLIAQKQQPLT  622

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+K  F+ P G+EPLALDM++MGKGQ+WINGQS+GRYW  Y    G C  C Y+G F   
Sbjct  623   WHKAYFNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYAT--GDCNGCQYSGTFRPP  680

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CGE +Q+WYHVPRSWL+PT NLLV FEE GG+P  +SLVKR V +VC+++ E+ P
Sbjct  681   KCQLGCGEPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVTNVCSNVAEYHP  740

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW+++  GK      PK  + C  GQ I+SIKFASFGTP G+CGSF +GTCHA  S+
Sbjct  741   NIKNWQIENYGKTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFKQGTCHAPDSH  800

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + +K C+G  SC V ++   FG DPCP+V+K+LSVE  C+
Sbjct  801   AVVEKKCLGRQSCAVTISNSNFGEDPCPNVLKRLSVEAHCT  841



>ref|XP_003612092.1| Beta-galactosidase [Medicago truncatula]
 gb|AES95050.1| beta-galactosidase [Medicago truncatula]
Length=843

 Score =  1110 bits (2872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/817 (65%), Positives = 646/817 (79%), Gaps = 4/817 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             + V+YD+ + IINGQR+IL SGSIHYPRSTP+MW DL+ KAKEGGLDV++TYVFWN HEP
Sbjct  24    SDVTYDRKAIIINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGGLDVIETYVFWNVHEP  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEGR DLV+FI+   +AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR DN
Sbjct  84    SPGNYNFEGRNDLVRFIQTVHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRQDN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ FT  IV MMKS+RLYESQGGPIILSQIENEYG     LG  G +Y  WAAK
Sbjct  144   EPFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQIENEYGAQSKMLGPVGYNYMSWAAK  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAV +GTGVPW+MCK+DDAPDPV+N CNGFYCD F+PNK YKP MWTEAW+ WF+EFGGP
Sbjct  204   MAVEMGTGVPWIMCKEDDAPDPVINTCNGFYCDKFTPNKPYKPTMWTEAWSGWFSEFGGP  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             +  RP +DLA+AVA+FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL+
Sbjct  264   IHKRPVQDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLI  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LH+AIK+CE AL+S DP V SLGN+Q+A V+ ++SG C+AFL+N +  S 
Sbjct  324   RQPKYGHLKELHKAIKMCEKALISTDPVVTSLGNFQQAYVYTTESGDCSAFLSNYDSKSS  383

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F NMHYNLPPWS+SILPDC+N V+NTA+VG Q+S+M+M P  S  FSW+S+ E+TS
Sbjct  384   ARVMFNNMHYNLPPWSVSILPDCRNAVFNTAKVGVQTSQMQMLPTNSERFSWESFEEDTS  443

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             S    T TA+GLLEQIN TRD SDYLWY+T V +   E+FL GGK P L V S GHA+HV
Sbjct  444   SSSATTITASGLLEQINVTRDTSDYLWYITSVDVGSSESFLHGGKLPSLIVQSTGHAVHV  503

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FING+L G++YG+ E+ +  ++  V LRAG N I+LLS+AVGLPNVG HFETWN G+LGP
Sbjct  504   FINGRLSGSAYGTREDRRFRYTGDVNLRAGTNTIALLSVAVGLPNVGGHFETWNTGILGP  563

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKT  1127
             V + GL++GK DL+WQKW+Y++GLKGE ++L S  G SSVEW++ + + Q+ QPLTW+KT
Sbjct  564   VVIHGLDKGKLDLSWQKWTYQVGLKGEAMNLASPDGISSVEWMQSAVVVQRNQPLTWHKT  623

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLS  947
              FDAP G EPLALDM+ MGKGQIWING S+GRYW     + G+C  CNYAG F   KC  
Sbjct  624   FFDAPEGEEPLALDMDGMGKGQIWINGISIGRYWTA--IATGSCNDCNYAGSFRPPKCQL  681

Query  946   KCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMN  767
              CG+ +QRWYHVPRSWL+   NLLV FEE GG+P  +SL KR V+SVCAD+ E+ P L N
Sbjct  682   GCGQPTQRWYHVPRSWLKQNHNLLVVFEELGGDPSKISLAKRSVSSVCADVSEYHPNLKN  741

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W + + GK+     PK HL C  GQ I+SIKFASFGTP G+CGS+ +G CH+  SYDI +
Sbjct  742   WHIDSYGKSENFRPPKVHLHCNPGQAISSIKFASFGTPLGTCGSYEQGACHSSSSYDILE  801

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             + CIG   C V V+   FG DPCP+V+K+LSVE VC+
Sbjct  802   QKCIGKPRCIVTVSNSNFGRDPCPNVLKRLSVEAVCA  838



>ref|XP_007225291.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
 gb|EMJ26490.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
Length=851

 Score =  1110 bits (2871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/824 (65%), Positives = 651/824 (79%), Gaps = 8/824 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
              +V+YDK + IINGQR++L+SGSIHYPRSTPEMW  L++KAK+GGLDV+ TYVFWNGHEP
Sbjct  27    TTVTYDKKAIIINGQRRLLISGSIHYPRSTPEMWEGLIQKAKDGGLDVIDTYVFWNGHEP  86

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEGRYDLV+FIK  Q+AGLY+HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  87    SPGNYNFEGRYDLVRFIKTVQKAGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  146

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFK AMQ FT  IV MMK++ L+ SQGGPIILSQIENEYGP    LGA G +Y  WAAK
Sbjct  147   GPFKMAMQGFTQKIVQMMKNEMLFASQGGPIILSQIENEYGPESKALGAAGHAYINWAAK  206

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAV L TGVPWVMCK+DDAPDP++NACNGFYCD FSPNK YKP MWTEAW+ WFTEFGG 
Sbjct  207   MAVALDTGVPWVMCKEDDAPDPMINACNGFYCDGFSPNKPYKPTMWTEAWSGWFTEFGGT  266

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             + +RP +DLA++VA+FI KGGS+INYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+
Sbjct  267   IHHRPVQDLAFSVARFIQKGGSYINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLI  326

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LH+AIKLCE ALVS DP V SLG YQ+A VF S    CAAFL+N +  + 
Sbjct  327   RQPKYGHLKELHKAIKLCEHALVSSDPTVTSLGAYQQAYVFNSGPRRCAAFLSNFHS-TG  385

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F NMHY+LP WSISILPDC+N V+NTA+VG Q+SR++M P  SR FSWQ+Y+E+ S
Sbjct  386   ARVTFNNMHYDLPAWSISILPDCRNVVFNTAKVGVQTSRVQMIPTNSRLFSWQTYDEDVS  445

Query  1663  S-YDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S ++ ++  A GLLEQIN TRD SDYLWYMT+V I   E  L+GGK P LTV SAGHALH
Sbjct  446   SLHERSSIAAGGLLEQINVTRDTSDYLWYMTNVDISSSE--LRGGKKPTLTVQSAGHALH  503

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VF+NGQ  G+++G+ E+ + TF+K V+LRAG+NKI+LLSIAVGLPNVG H+E+W  G+LG
Sbjct  504   VFVNGQFSGSAFGTREHRQFTFAKPVHLRAGINKIALLSIAVGLPNVGLHYESWKTGILG  563

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYK  1130
             PV L GL +G++DLT QKW  K+GLKGE + L S +G SSV+W+ GS   Q KQ L WYK
Sbjct  564   PVFLDGLGQGRKDLTMQKWFNKVGLKGEAMDLVSPNGGSSVDWIRGSLATQTKQTLKWYK  623

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               F+AP G+EPLALDM +MGKGQ+WINGQS+GRYW  Y  + G C  C+Y G F   KC 
Sbjct  624   AYFNAPGGDEPLALDMRSMGKGQVWINGQSIGRYWMAY--ANGDCSLCSYIGTFRPTKCQ  681

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CG+ +QRWYHVPRSWL+PT NL+V FEE GG+P  ++LVKR VA VCAD+ E  P   
Sbjct  682   LGCGQPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVKRSVAGVCADLQEHHPNAE  741

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
               ++ +  ++    + + HL C  GQ I+SIKFASFGTP G+CGSF +GTCHA +S+ I 
Sbjct  742   KLDIDSHEESKTLHQAQVHLQCVPGQSISSIKFASFGTPTGTCGSFQQGTCHATNSHAIV  801

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS**FATS  458
             +K CIG  SC V V+   FG DPCP+V+K+LSVE VCS   AT+
Sbjct  802   EKNCIGRESCLVTVSNSIFGTDPCPNVLKRLSVEAVCSTGIATN  845



>ref|XP_003558743.1| PREDICTED: beta-galactosidase 5 [Brachypodium distachyon]
Length=839

 Score =  1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/816 (66%), Positives = 644/816 (79%), Gaps = 7/816 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YDK + +I+GQR+IL SGSIHYPRSTPEMW  L +KAK+GGLDV+QTYVFWNGHEP 
Sbjct  26    AVTYDKKAVLIDGQRRILFSGSIHYPRSTPEMWEGLFQKAKDGGLDVIQTYVFWNGHEPT  85

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLVKFIK AQ+AGL+VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  86    PGNYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  145

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP     GA GKSY+ WAAKM
Sbjct  146   PFKTAMQGFTEKIVGMMKSEELFASQGGPIILSQIENEYGPEGKSFGAAGKSYSNWAAKM  205

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCKQDDAPDPV+NACNGFYCD FSPNK YKP MWTEAWT WFTEFGG +
Sbjct  206   AVGLDTGVPWVMCKQDDAPDPVINACNGFYCDAFSPNKPYKPTMWTEAWTGWFTEFGGTI  265

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP EDL++AVA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL R
Sbjct  266   RKRPVEDLSFAVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLAR  325

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             EPK+GHLK+LHRA+KLCEPALVS DP V +LG+ QEA VF+S S +CAAFLAN N +S A
Sbjct  326   EPKYGHLKELHRAVKLCEPALVSVDPAVTTLGSMQEAHVFRSPS-SCAAFLANYNSNSHA  384

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQSYNEETSS  1661
              V F N HY+LPPWSISILPDCK  V+NTA VG Q+S+M+M         W+ Y+EE  S
Sbjct  385   NVVFNNEHYSLPPWSISILPDCKTVVFNTATVGVQTSQMQMWADGESSMMWERYDEEVGS  444

Query  1660  YDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
                    T TGLLEQ+N TRD+SDYLWY+T V + P E FL+GG+   LTV SAGHALH+
Sbjct  445   LAAAPLLTTTGLLEQLNVTRDSSDYLWYITSVDVSPSEKFLQGGEPLSLTVQSAGHALHI  504

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G++ G+ E  K ++     LRAG NKI+LLSIA GLPNVG H+ETWN G++GP
Sbjct  505   FINGQLQGSASGTREAKKFSYKGNANLRAGTNKIALLSIACGLPNVGVHYETWNTGIVGP  564

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V L GL+ G RDLTWQ WSY++GLKGE ++L+SL G+SSVEW++GS +AQ  PL+WY+  
Sbjct  565   VVLHGLDVGSRDLTWQTWSYQVGLKGEQMNLNSLEGASSVEWMQGSLLAQA-PLSWYRAY  623

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FD P G+EPLALDM +MGKGQIWINGQS+GRY   Y +  G C AC+YAG +   KC + 
Sbjct  624   FDTPTGDEPLALDMGSMGKGQIWINGQSIGRYSTSYAS--GDCKACSYAGSYRAPKCQAG  681

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNW  764
             CG+ +QRWYHVP+SWL+P+ NLLV FEE GG+   +SLVKR V+SVCAD+ E+   + NW
Sbjct  682   CGQPTQRWYHVPKSWLQPSRNLLVVFEELGGDSSKISLVKRSVSSVCADVSEYHTNIKNW  741

Query  763   EMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQK  584
             +++ +G+     RPK HL C  GQ I++IKFASFGTP G+CG+F +G CH+  S+ + +K
Sbjct  742   QIENAGEVEFH-RPKVHLRCAPGQTISAIKFASFGTPLGTCGNFQQGDCHSTKSHAVLEK  800

Query  583   YCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              CIG   C V ++P+ FGGDPCP  MKK++VE VCS
Sbjct  801   NCIGQQRCAVTISPDNFGGDPCPKEMKKVAVEAVCS  836



>gb|EMT10014.1| Beta-galactosidase 5 [Aegilops tauschii]
Length=851

 Score =  1108 bits (2865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/821 (66%), Positives = 649/821 (79%), Gaps = 11/821 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YD+ + +I+G+R+IL SGSIHYPRST EMW  L++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  32    AVTYDRKAVLISGERRILFSGSIHYPRSTQEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  91

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+FIK AQ+AGL+VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  92    PGNYNFEGRYDLVRFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  151

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQ---IENEYGPMEYELGAPGKSYAQWA  2387
             PFKAAMQ FT  IV MMKS+ L+ SQGGPIILSQ   IENEYGP E E GA GKSY+ WA
Sbjct  152   PFKAAMQGFTEKIVGMMKSEELFASQGGPIILSQAMQIENEYGPEEKEFGAAGKSYSDWA  211

Query  2386  AKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFG  2207
             AKMAVGL TGVPWVMCKQ+DAPDPV+NACNGFYCD F+PN   KP MWTEAWT WFTEFG
Sbjct  212   AKMAVGLDTGVPWVMCKQEDAPDPVINACNGFYCDAFTPNSPSKPTMWTEAWTGWFTEFG  271

Query  2206  GPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFG  2027
             G +  RP EDL++AVA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+G
Sbjct  272   GTIRKRPVEDLSFAVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYG  331

Query  2026  LLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQH  1847
             L REPK+GHLK+LHR IKLCEPALVS DP V SLG+ QEA V++S SG CAAFLAN N +
Sbjct  332   LAREPKYGHLKELHRTIKLCEPALVSVDPTVTSLGSMQEAHVYRSPSG-CAAFLANYNSN  390

Query  1846  SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQSYNEE  1670
             S AKV F N HY+LPPWSISILPDCK  VYNTA VG Q+S+M+M +  +    W+ Y+EE
Sbjct  391   SHAKVVFDNEHYSLPPWSISILPDCKTVVYNTATVGVQTSQMQMWSNGASSMMWERYDEE  450

Query  1669  TSSYDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHA  1493
               S       T +GLLEQ+N TRD SDYLWYMT V + P E FL+GGK   L+V SAGHA
Sbjct  451   VGSLAAAPLLTTSGLLEQLNVTRDTSDYLWYMTSVDVSPSEKFLQGGKPLSLSVQSAGHA  510

Query  1492  LHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGV  1313
             LH+FINGQL G++ G+ E+ ++++   V LRAG NKISLLS+A GLPN+G H+ETWN GV
Sbjct  511   LHIFINGQLQGSASGTREDKRISYKGNVNLRAGTNKISLLSVACGLPNIGVHYETWNTGV  570

Query  1312  LGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQ-PLTW  1136
              GPV L GL+EG RDLTWQ W+Y++GLKGE ++L+SL G+SSVEW++GS IAQ Q PL W
Sbjct  571   NGPVVLHGLDEGSRDLTWQTWTYQVGLKGEQMNLNSLEGASSVEWMQGSLIAQNQMPLAW  630

Query  1135  YKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKK  956
             Y+  FD P+G+EPLALDM +MGKGQIWINGQS+GRY   Y    G C   +Y G F   K
Sbjct  631   YRAYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYSLAYAT--GDCKDYSYTGSFRATK  688

Query  955   CLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQ  776
             C + CG+ +QRWYHVP+SWL+P+ NLLV FEE GG+   +SLVKR V+SVCAD+ E+ P 
Sbjct  689   CQAGCGQPTQRWYHVPKSWLQPSRNLLVVFEELGGDTSKISLVKRSVSSVCADVSEFHPS  748

Query  775   LMNWEMQASGKATRPL-RPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
             + NW+ ++SG+A   L R K HL C  GQ I++IKFASFGTP G+CGSF +G CH+  S 
Sbjct  749   IKNWQTESSGEAKPELRRSKVHLRCAPGQSISAIKFASFGTPSGTCGSFEQGECHSTKSQ  808

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + +K CIG   C V ++P+ FGGDPCP+VMK+++VE VCS
Sbjct  809   TVLEK-CIGKQRCAVAISPDNFGGDPCPNVMKRVAVEAVCS  848



>ref|NP_001234317.1| TBG6 protein precursor [Solanum lycopersicum]
 gb|AAF70825.1|AF154424_1 putative beta-galactosidase [Solanum lycopersicum]
Length=845

 Score =  1107 bits (2864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/821 (63%), Positives = 649/821 (79%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L    V+YD+ + +INGQR++L SGSIHYPRSTPEMW DL+ KAKEGGLDVV+TYVFWN 
Sbjct  23    LVHCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLINKAKEGGLDVVETYVFWNV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
              DN PFK AM+ +   IVN+MKS  L+ESQGGPIILSQIENEYGP    LGAPG  Y+ W
Sbjct  143   ADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAPGHQYSTW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MAVGL TGVPWVMCK++DAPDPV+N CNGFYCD F PNK YKP +WTEAW+ WF+EF
Sbjct  203   AANMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDNFFPNKPYKPAIWTEAWSGWFSEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP +DLA+AVA+FI +GGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+
Sbjct  263   GGPLHQRPVQDLAFAVAQFIQRGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHRA+K+CE ++VS DP + SLGN Q+A V+ S++G CAAFL+NN+ 
Sbjct  323   GLIRQPKYGHLKELHRAVKMCEKSIVSADPAITSLGNLQQAYVYSSETGGCAAFLSNNDW  382

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  S   SW++Y+E
Sbjct  383   KSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTNSEMLSWETYSE  442

Query  1672  ETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + S+ DD ++  + GLLEQIN TRD SDYLWY+T V I   E+FL GG+ P L V + GH
Sbjct  443   DISALDDSSSIRSFGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELPTLIVETTGH  502

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+HVFINGQL G+++G+ +N +  F   V LRAG N+I+LLS+AVGLPN+G HFETW+ G
Sbjct  503   AMHVFINGQLSGSAFGTRKNRRFVFKGKVNLRAGSNRIALLSVAVGLPNIGGHFETWSTG  562

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             VLGPV++ GL+ GK DL+W KW+Y++GLKGE ++L S +G S+V+W++GS IAQK QPLT
Sbjct  563   VLGPVAIQGLDHGKWDLSWAKWTYQVGLKGEAMNLVSTNGISAVDWMQGSLIAQKQQPLT  622

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+K  F+ P G+EPLALDM++MGKGQ+WINGQS+GRYW  Y    G C  C Y+G F   
Sbjct  623   WHKAYFNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYAT--GDCNGCQYSGVFRPP  680

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CGE +Q+WYHVPRSWL+PT NLLV FEE GG+P  +SLVKR V +VC+++ E+ P
Sbjct  681   KCQLGCGEPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVTNVCSNVAEYHP  740

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW+++  GK      PK  + C  GQ I+SIKFASFGTP G+CGSF +GTCHA  S+
Sbjct  741   NIKNWQIENYGKTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFKQGTCHAPDSH  800

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + +K C+G  +C V ++   FG DPCP+V+K+LSVE  C+
Sbjct  801   AVVEKKCLGRQTCAVTISNSNFGEDPCPNVLKRLSVEAHCT  841



>gb|ADO34791.1| beta-galactosidase STBG6 [Solanum lycopersicum]
Length=845

 Score =  1107 bits (2864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/821 (63%), Positives = 648/821 (79%), Gaps = 5/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L    V+YD+ + +INGQR++L SGSIHYPRSTPEMW DL+ KAKEGGLDVV+TYVFWN 
Sbjct  23    LVHCDVTYDREAIVINGQRRLLFSGSIHYPRSTPEMWEDLINKAKEGGLDVVETYVFWNV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+F+K  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
              DN PFK AM+ +   IVN+MKS  L+ESQGGPIILSQIENEYGP    LGAPG  Y+ W
Sbjct  143   ADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAPGHQYSTW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MAVGL TGVPWVMCK++DAPDPV+N CNGFYCD F PNK YKP  WTEAW+ WF+EF
Sbjct  203   AANMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDNFFPNKPYKPATWTEAWSGWFSEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP+  RP +DLA+AVA+FI +GGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+
Sbjct  263   GGPLHQRPVQDLAFAVAQFIQRGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHRA+K+CE ++VS DP + SLGN Q+A V+ S++G CAAFL+NN+ 
Sbjct  323   GLIRQPKYGHLKELHRAVKMCEKSIVSADPAITSLGNLQQAYVYSSETGGCAAFLSNNDW  382

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  S   SW++Y+E
Sbjct  383   KSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTNSEMLSWETYSE  442

Query  1672  ETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + S+ DD ++  + GLLEQIN TRD SDYLWY+T V I   E+FL GG+ P L V + GH
Sbjct  443   DISALDDSSSIRSFGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELPTLIVETTGH  502

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             A+HVFINGQL G+++G+ +N +  F   V LRAG N+I+LLS+AVGLPN+G HFETW+ G
Sbjct  503   AMHVFINGQLSGSAFGTRKNRRFVFKGKVNLRAGSNRIALLSVAVGLPNIGGHFETWSTG  562

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             VLGPV++ GL+ GK DL+W KW+Y++GLKGE ++L S +G S+V+W++GS IAQK QPLT
Sbjct  563   VLGPVAIQGLDHGKWDLSWAKWTYQVGLKGEAMNLVSTNGISAVDWMQGSLIAQKQQPLT  622

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+K  F+ P G+EPLALDM++MGKGQ+WINGQS+GRYW  Y    G C  C Y+G F   
Sbjct  623   WHKAYFNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYAT--GDCNGCQYSGVFRPP  680

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CGE +Q+WYHVPRSWL+PT NLLV FEE GG+P  +SLVKR V +VC+++ E+ P
Sbjct  681   KCQLGCGEPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVTNVCSNVAEYHP  740

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW+++  GK      PK  + C  GQ I+SIKFASFGTP G+CGSF +GTCHA  S+
Sbjct  741   NIKNWQIENYGKTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFKQGTCHAPDSH  800

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + +K C+G  +C V ++   FG DPCP+V+K+LSVE  C+
Sbjct  801   AVVEKKCLGRQTCAVTISNSNFGEDPCPNVLKRLSVEAHCT  841



>ref|XP_011100972.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=848

 Score =  1107 bits (2863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/825 (64%), Positives = 647/825 (78%), Gaps = 9/825 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L   SV+YDK + +INGQR+IL+SGSIHYPRSTPEMW DL+ KAKEGGLDV++TYVFWN 
Sbjct  23    LVQCSVTYDKKAMVINGQRRILISGSIHYPRSTPEMWEDLINKAKEGGLDVIETYVFWNV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+FIK  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HEPSPGNYNFEGRYDLVRFIKTIQRAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
             TDN PFK AM+ FT  IVN+MKS+ LYESQGGPIILSQIENEYGP    LGAPG  YA W
Sbjct  143   TDNEPFKMAMKGFTEKIVNLMKSENLYESQGGPIILSQIENEYGPQAKALGAPGHQYATW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MAVG+ TGVPWVMCK++DAPDPV+N CNGFYCD FSPNK YKP +WTEAW+ WFTEF
Sbjct  203   AANMAVGMDTGVPWVMCKEEDAPDPVINTCNGFYCDAFSPNKPYKPTIWTEAWSGWFTEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GGP   RP +DLA+AVA+FI +GGSF+NYYM+HGGTNFGR+AGGPFI TSYDYDAP+DE+
Sbjct  263   GGPTHERPVQDLAFAVARFIQRGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPLDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHRA+KLCE ALVS DP V SLG+ Q+A V+ S+SG CAAFL+N + 
Sbjct  323   GLIRQPKYGHLKELHRAVKLCEKALVSSDPVVTSLGSLQQAHVYSSESGDCAAFLSNYDT  382

Query  1849  HSFAKVAFGNMHYNLPPWSISIL----PDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQ  1685
              S  +V F NMHYNL      I         +T  +  +VG Q+S+M+M P  S  FSW+
Sbjct  383   KSAVRVMFNNMHYNLITLYTYISTVKHSPSDDTFLSEPQVGVQTSQMEMLPTNSEIFSWE  442

Query  1684  SYNEETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVY  1508
             +YNE+ SS DD +TF+  GLLEQIN TRDASDYLWY T V I   E+FL GGK P L V 
Sbjct  443   TYNEDLSSLDDSSTFSTVGLLEQINVTRDASDYLWYTTSVDISSSESFLHGGKLPTLVVQ  502

Query  1507  SAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFET  1328
             S GHALHVF+NGQL G++ G+ +N + TF++ V LRAG NKISLLS+AVGLPNVG H+ET
Sbjct  503   STGHALHVFVNGQLSGSASGTRQNRRFTFNEKVNLRAGSNKISLLSVAVGLPNVGGHYET  562

Query  1327  WNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-  1151
             W+ GVLGPV+L GL++GK DL+W KW+Y++GLKGE ++L S +  SSV+W++GS IAQ+ 
Sbjct  563   WSTGVLGPVALLGLDQGKWDLSWSKWTYQVGLKGEAMNLVSPNAISSVDWMQGSLIAQRQ  622

Query  1150  QPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGW  971
             QPLTW+K  F+AP G+EPLALDM++MGKGQ+W+NGQS+GRYW  Y    G C  C+Y G 
Sbjct  623   QPLTWHKAYFNAPDGDEPLALDMSSMGKGQVWVNGQSLGRYWTAYAT--GHCNGCSYTGS  680

Query  970   FDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIY  791
             +   KC   CG+ +QRWYH+PRSWL+PT NLLV FEE GG+P  ++LVKR + SVCAD+ 
Sbjct  681   YRPPKCQLGCGQPTQRWYHLPRSWLKPTQNLLVLFEELGGDPTRITLVKRSMTSVCADVA  740

Query  790   EWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHA  611
             E+ P + NW++++ G+     +PK HL CG GQ I+SIKFASFGTP G+CGSF +GTCHA
Sbjct  741   EYHPNIRNWQIESYGRPEEFHKPKVHLRCGPGQSISSIKFASFGTPLGTCGSFQQGTCHA  800

Query  610   FHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
               SY I +K CIG   C+V ++   FG DPCP V+K+LSVE +C+
Sbjct  801   PTSYAILEKKCIGQQKCSVTISNSNFGQDPCPKVLKRLSVEAICA  845



>gb|AAM22973.1|AF499737_1 beta-galactosidase [Oryza sativa Japonica Group]
 gb|AAM34271.1|AF508799_1 beta-galactosidase [Oryza sativa Japonica Group]
Length=843

 Score =  1107 bits (2863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/819 (65%), Positives = 647/819 (79%), Gaps = 9/819 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YDK + +++GQR+IL SGSIHYPRSTPEMW  L++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  26    AVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHEPT  85

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+FIK  Q+AG++VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  86    PGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  145

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP   E GA GK+Y  WAAKM
Sbjct  146   PFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQIENEYGPEGKEFGAAGKAYINWAAKM  205

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCK+DDAPDPV+NACNGFYCD FSPNK YKP MWTEAW+ WFTEFGG +
Sbjct  206   AVGLDTGVPWVMCKEDDAPDPVINACNGFYCDTFSPNKPYKPTMWTEAWSGWFTEFGGTI  265

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP EDLA+ VA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+GL R
Sbjct  266   RQRPVEDLAFGVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGLAR  325

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             EPK+GHLK+LHRA+KLCE  LVS DP V +LG+ QEA VF+S SG CAAFLAN N +S+A
Sbjct  326   EPKFGHLKELHRAVKLCEQPLVSADPTVTTLGSMQEAHVFRSSSG-CAAFLANYNSNSYA  384

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQSYNEETSS  1661
             KV F N +Y+LPPWSISILPDCKN V+NTA VG Q+++M+M    +    W+ Y+EE  S
Sbjct  385   KVIFNNENYSLPPWSISILPDCKNVVFNTATVGVQTNQMQMWADGASSMMWEKYDEEVDS  444

Query  1660  YDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
                    T+TGLLEQ+N TRD SDYLWY+T V +DP E FL+GG    LTV SAGHALHV
Sbjct  445   LAAAPLLTSTGLLEQLNVTRDTSDYLWYITRVEVDPSEKFLQGGTPLSLTVQSAGHALHV  504

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G++YG+ E+ K+++S    LRAG NK++LLS+A GLPNVG H+ETWN GV+GP
Sbjct  505   FINGQLQGSAYGTREDRKISYSGNANLRAGTNKVALLSVACGLPNVGVHYETWNTGVVGP  564

Query  1303  VSLSGLNEGKRDLTWQKWSY--KIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWY  1133
             V + GL+EG RDLTWQ WSY  ++GLKGE ++L+SL GS SVEW++GS +AQ +QPL WY
Sbjct  565   VVIHGLDEGSRDLTWQTWSYQFQVGLKGEQMNLNSLEGSGSVEWMQGSLVAQNQQPLAWY  624

Query  1132  KTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKC  953
             +  FD P+G+EPLALDM +MGKGQIWINGQS+GRYW  Y  + G C  C+Y G +   KC
Sbjct  625   RAYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAY--AEGDCKGCHYTGSYRAPKC  682

Query  952   LSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQL  773
              + CG+ +QRWYHVPRSWL+PT NLLV FEE GG+   ++L KR V+ VCAD+ E+ P +
Sbjct  683   QAGCGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALAKRTVSGVCADVSEYHPNI  742

Query  772   MNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDI  593
              NW++++ G+       K HL C  GQ I++IKFASFGTP G+CG+F +G CH+ +S  +
Sbjct  743   KNWQIESYGEPEFHT-AKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGECHSINSNSV  801

Query  592   FQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              +K CIG   C V ++P  FGGDPCP VMK+++VE VCS
Sbjct  802   LEKKCIGLQRCVVAISPSNFGGDPCPEVMKRVAVEAVCS  840



>ref|XP_008450853.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=721

 Score =  1107 bits (2862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/704 (75%), Positives = 616/704 (88%), Gaps = 3/704 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASV+YD  + IING+R+IL+SGSIHYPRSTP+MWPDL++KAK+GGLDV+ TYVFWNGHEP
Sbjct  20    ASVTYDHKAIIINGRRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIDTYVFWNGHEP  79

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FE RYDLV+F+KL QQAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG++FRTDN
Sbjct  80    SPGHYNFEDRYDLVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  139

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFKAAMQKFT  IV +MK ++LYESQGGPIILSQIENEYGP+E+E+GAPGKSY++WAA+
Sbjct  140   GPFKAAMQKFTEKIVGVMKGEKLYESQGGPIILSQIENEYGPVEWEIGAPGKSYSKWAAQ  199

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MA+ L TGVPWVMCKQDDAPDPV++ CNGFYC+ F PN+ YKPKMWTEAWT WFTEFGGP
Sbjct  200   MALDLDTGVPWVMCKQDDAPDPVIDTCNGFYCENFKPNQVYKPKMWTEAWTGWFTEFGGP  259

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
              PYRP ED+AY+VA+FI  GGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GLL
Sbjct  260   APYRPVEDMAYSVARFIQNGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLL  319

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             REPKW HL+DLH+AIKLCEPALVS DP V SLG+ QEA VFK++SG+CAAFLAN +  S 
Sbjct  320   REPKWSHLRDLHKAIKLCEPALVSVDPTVSSLGSNQEAHVFKTRSGSCAAFLANYDASSS  379

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET-S  1664
             A V FGN  Y+LPPWS+SILPDCK+ V+NTA+VGA +S+ KMTPVS  FSW SYNEET S
Sbjct  380   ATVTFGNNQYDLPPWSVSILPDCKSAVFNTAKVGAPTSQPKMTPVSS-FSWLSYNEETAS  438

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y ++T T  GL+EQI+ TRD++DYLWYMTD+RIDP E FLK G+WP LTV+SAGHALHV
Sbjct  439   AYTEDTTTMAGLVEQISVTRDSTDYLWYMTDIRIDPNEGFLKSGQWPLLTVFSAGHALHV  498

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT+YG  EN K+TFSK V LRAG+NK+S+LS+AVGLPN G H+ETWN G+LGP
Sbjct  499   FINGQLSGTTYGGAENYKLTFSKYVNLRAGINKLSILSVAVGLPNGGLHYETWNTGILGP  558

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L GLNE  RD++  KWSYKIGLKGE L+LH+ SGSSSVEWV GS +AQKQPLTWYKTT
Sbjct  559   VTLKGLNEDTRDMSGYKWSYKIGLKGEALNLHTASGSSSVEWVAGSLVAQKQPLTWYKTT  618

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FD+P GNEPLALDM++MGKGQIWINGQS+GR+WP Y A  G+CG CNY G F+EKKC S 
Sbjct  619   FDSPEGNEPLALDMSSMGKGQIWINGQSIGRHWPAYTAR-GSCGKCNYGGIFNEKKCHSN  677

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVA  812
             CGE SQRWYH+PR+WL+ +GN+LV FEEWGGNP G+SLVKR ++
Sbjct  678   CGEPSQRWYHIPRAWLKSSGNMLVIFEEWGGNPEGISLVKRSIS  721



>ref|XP_008221339.1| PREDICTED: beta-galactosidase 5 [Prunus mume]
Length=851

 Score =  1106 bits (2861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/818 (65%), Positives = 647/818 (79%), Gaps = 8/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
              +V+YDK + IINGQR++L+SGSIHYPRSTPEMW  L++KAK+GGLDV+ TYVFWNGHEP
Sbjct  27    TTVTYDKKAIIINGQRRLLISGSIHYPRSTPEMWEGLIQKAKDGGLDVIDTYVFWNGHEP  86

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEGRYDLV+FIK  Q+AGLY+HLR+GPY CAEWNFGGFPVWLKYVPG+SFRT+N
Sbjct  87    SPGNYNFEGRYDLVRFIKTVQKAGLYLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTNN  146

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFK AMQ FT  IV MMK+++L+ SQGGPIILSQIENEYGP    LGA G +Y  WAAK
Sbjct  147   GPFKMAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPESKALGAAGHAYINWAAK  206

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAV L TGVPWVMCK+DDAPDP++NACNGFYCD FSPNK YKP MWTEAW+ WFTEFGG 
Sbjct  207   MAVALDTGVPWVMCKEDDAPDPMINACNGFYCDGFSPNKPYKPTMWTEAWSGWFTEFGGT  266

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             + +RP +DLA++VA+FI KGGS+INYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+
Sbjct  267   IHHRPVQDLAFSVARFIQKGGSYINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLI  326

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LH+AIKLCE ALVS DP V SLG YQ+A VF S    CAAFL+N +  + 
Sbjct  327   RQPKYGHLKELHKAIKLCEHALVSSDPTVTSLGTYQQAYVFNSGPRRCAAFLSNFHS-TG  385

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
              +V F NMHY+LP WSISILPDC+N V+NTA+VG Q+SR++M P  S  FSWQ+Y+E+ S
Sbjct  386   TRVTFNNMHYDLPAWSISILPDCRNVVFNTAKVGVQTSRVQMIPTNSPLFSWQTYDEDVS  445

Query  1663  S-YDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S ++ ++  A GLLEQIN TRD SDYLWYMT+V I   E  L+GGK P LTV SAGHALH
Sbjct  446   SLHERSSIAAGGLLEQINVTRDTSDYLWYMTNVDISSSE--LRGGKKPTLTVQSAGHALH  503

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VF+NGQ  G+++G+ E  + TF+K V+LRAG+NKI+LLSIAVGLPNVG H+E+W  G+LG
Sbjct  504   VFVNGQFSGSAFGTREQRQFTFAKPVHLRAGINKIALLSIAVGLPNVGLHYESWKTGILG  563

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYK  1130
             PV L GL +G++DLT QKW  K+GLKGE + L S +G SSV+W+ GS   Q KQ L WYK
Sbjct  564   PVFLDGLGQGRKDLTMQKWFNKVGLKGEAMDLVSPNGGSSVDWIRGSLATQTKQTLKWYK  623

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               F+AP G+EPLALDM +MGKGQ+WINGQS+GRYW  Y  + G C  C+Y G F   KC 
Sbjct  624   AYFNAPGGDEPLALDMRSMGKGQVWINGQSIGRYWMAY--ANGDCSLCSYIGTFRPTKCQ  681

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CG+ +QRWYHVPRSWL+PT NL+V FEE GG+P  ++LVKR VA VCAD+ E  P   
Sbjct  682   LGCGQPTQRWYHVPRSWLKPTKNLMVMFEELGGDPSKITLVKRSVAGVCADLQEHHPNAE  741

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
              +++ +  ++    + + HL C  GQ I+SIKFASFGTP G+CGSF +GTCHA +S+ I 
Sbjct  742   KFDIDSHEESKTLHQAQVHLQCVPGQSISSIKFASFGTPTGTCGSFQQGTCHATNSHAIV  801

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K CIG  SC V V+   FG DPCP+V+K+LSVE VCS
Sbjct  802   EKNCIGRESCLVTVSNSIFGTDPCPNVLKRLSVEAVCS  839



>ref|XP_009628690.1| PREDICTED: beta-galactosidase 3 [Nicotiana tomentosiformis]
Length=844

 Score =  1105 bits (2857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/821 (64%), Positives = 647/821 (79%), Gaps = 6/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L    V+YD+ + +INGQR++L SGSIHYPRSTPEMW DL+ KAKEGGLDVV+TYVFWN 
Sbjct  23    LIQCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLINKAKEGGLDVVETYVFWNV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+FIK  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
              DN PFK AM+ +   IVN+MKS  L+ESQGGPIILSQIENEYGP    LGA G  Y+ W
Sbjct  143   ADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKALGATGHQYSTW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MAVGL TGVPWVMCK++DAPDPV+N CNGFYCD F PNK YKP +WTEAW+ WF+EF
Sbjct  203   AANMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDNFFPNKPYKPAIWTEAWSGWFSEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             G  +  RP +DLA+AVA+FI +GGSF+NYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+
Sbjct  263   GSTLHQRPVQDLAFAVAQFIQRGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LHRA+K+CE ALVS DP + SLGN Q+A V+ S++G CAAFL+NN+ 
Sbjct  323   GLIRQPKYGHLKELHRAVKMCEKALVSADPAITSLGNLQQAYVYSSETGDCAAFLSNNDW  382

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  S   SW+SYNE
Sbjct  383   KSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTNSEMLSWESYNE  442

Query  1672  ETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + S+ DD ++  + GLLEQIN TRD SDYLWY+T V I   E+FL GG+ P L V S GH
Sbjct  443   DISALDDSSSIRSFGLLEQINVTRDTSDYLWYITSVDISSTESFLHGGELPTLIVESTGH  502

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             ALHVFINGQL G+++G+ +N +  F   V LRAG N+ISLLS+AVGLPN+G HFETW+ G
Sbjct  503   ALHVFINGQLSGSAFGTRKNRRFVFKGKVNLRAGTNRISLLSVAVGLPNMGGHFETWSTG  562

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             VLGPV++ GL++GK DL+W KW+Y++GLKGE ++L S +G S+V+W++GS IAQ+ QPLT
Sbjct  563   VLGPVAVHGLDQGKWDLSWAKWTYQVGLKGEAMNLVSPNGISAVDWMQGSLIAQRQQPLT  622

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+K  F+ P G+EPLALDM++MGKGQ+WINGQS+GRYW  Y    G C  C+Y+G F   
Sbjct  623   WHKAYFNTPNGDEPLALDMSSMGKGQVWINGQSIGRYWTAYAT--GDCNGCHYSGNFRPP  680

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG+ +Q+WYHVPRSWL+PT NLLV FEE GG+P  +SLVKR V+SVCAD+ E+ P
Sbjct  681   KCQFGCGQPTQKWYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRTVSSVCADVAEYHP  740

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW+++  G+      PK  + C  GQ I+SIKFASFGTP G+CGSF +GTCHA  SY
Sbjct  741   NIKNWQIENYGRTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFQQGTCHAPTSY  800

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + +K C+G   C V +    F GDPCP+V+K+LSVE  C+
Sbjct  801   AVVEKKCLGRQRCAVTIANSNF-GDPCPNVLKRLSVEAHCT  840



>ref|XP_008466519.1| PREDICTED: beta-galactosidase 5-like [Cucumis melo]
Length=844

 Score =  1105 bits (2857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/814 (64%), Positives = 643/814 (79%), Gaps = 8/814 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YDK + +INGQR+IL+SGSIHYPRSTPEMW DL++KAK+GGLDVV TYVFWN HEP 
Sbjct  28    TVTYDKKAILINGQRRILISGSIHYPRSTPEMWEDLMQKAKDGGLDVVDTYVFWNVHEPS  87

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+FIK AQ+ GLY+HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDNG
Sbjct  88    PGNYDFEGRYDLVRFIKTAQRVGLYIHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNG  147

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV MMK+++L+ SQGGPIILSQIENEYGP    LGA G +Y  WAAKM
Sbjct  148   PFKMAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPQSRALGAAGHAYMNWAAKM  207

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCK+DDAPDPV+N+CNGFYCD+FSPNK YKP +WTEAW+ WFTEFGGPV
Sbjct  208   AVGLNTGVPWVMCKEDDAPDPVINSCNGFYCDYFSPNKPYKPTLWTEAWSGWFTEFGGPV  267

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLA+AVA+F+ KGGS  NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+G++R
Sbjct  268   YGRPVQDLAFAVARFVQKGGSLFNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGMIR  327

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LHRAIKLCE ALVS DP V SLG Y++A VF S  G CAAFLAN + +S A
Sbjct  328   QPKYGHLKNLHRAIKLCEHALVSSDPTVTSLGAYEQAHVFSSGPGRCAAFLANYHTNSAA  387

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSY  1658
              V F NM Y LPPWSISILPDCK  V++TA+VG   +R +M P     SW++YNE+T S 
Sbjct  388   TVVFNNMRYILPPWSISILPDCKRVVFSTAQVGVHIARTQMLPTISKLSWETYNEDTYSL  447

Query  1657  DDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
               ++  T  GLLEQIN TRDASDYLWYMT V I   EAFL+GG+ P L+V SAGHA+HVF
Sbjct  448   GGSSRMTVAGLLEQINVTRDASDYLWYMTSVGISSSEAFLRGGQKPTLSVRSAGHAVHVF  507

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             INGQ  G++YGS E+P+ T++  + LRAG+NKI+LLSIAVGLPNVG HFE    G+LGP+
Sbjct  508   INGQFSGSAYGSREHPEFTYTGPINLRAGMNKIALLSIAVGLPNVGLHFEKLQTGILGPI  567

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTF  1121
             S+SGLNEGK+DLTWQKWSY++GLKGE ++L S + ++SV+W++GS    ++PLTWYK +F
Sbjct  568   SISGLNEGKKDLTWQKWSYQVGLKGEAMNLVSPTEATSVDWIKGSLSQGQRPLTWYKASF  627

Query  1120  DAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKC  941
             +AP GNEPLALD+ +MGKGQ WINGQS+GRYW  Y  + G CG C YAG +   KC + C
Sbjct  628   NAPGGNEPLALDLRSMGKGQAWINGQSIGRYWMAY--AKGGCGRCTYAGTYRPSKCENGC  685

Query  940   GEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWE  761
             G+ +QRWYH+PRSWL+PT N+LV FEE GG+   +SL++R V  +C +  E   +  ++ 
Sbjct  686   GQPTQRWYHIPRSWLKPTNNVLVLFEELGGDASKISLLRRSVTGLCGEAVEHHAKNESYI  745

Query  760   MQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKY  581
             ++++ +         HL C  GQ I++IKFASFGTP G+CGS+ +GTCHA  S+ I +K 
Sbjct  746   IESNEEPN-----SLHLQCNPGQVISAIKFASFGTPSGTCGSYQKGTCHAPDSHAIIEKK  800

Query  580   CIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             CIG  SC+V  T + FG DPCPS +K+L VEV C
Sbjct  801   CIGLESCSVSTTRDNFGVDPCPSELKQLLVEVDC  834



>gb|EEE58382.1| hypothetical protein OsJ_09539 [Oryza sativa Japonica Group]
Length=851

 Score =  1104 bits (2856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/827 (64%), Positives = 647/827 (78%), Gaps = 17/827 (2%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YDK + +++GQR+IL SGSIHYPRSTPEMW  L++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  26    AVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHEPT  85

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+FIK  Q+AG++VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  86    PGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  145

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQ----------IENEYGPMEYELGAPG  2408
             PFK AMQ FT  IV MMKS+ L+ SQGGPIILSQ          IENEYGP   E GA G
Sbjct  146   PFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQASAKLCFPCHIENEYGPEGKEFGAAG  205

Query  2407  KSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWT  2228
             K+Y  WAAKMAVGL TGVPWVMCK+DDAPDPV+NACNGFYCD FSPNK YKP MWTEAW+
Sbjct  206   KAYINWAAKMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDTFSPNKPYKPTMWTEAWS  265

Query  2227  AWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYD  2048
              WFTEFGG +  RP EDLA+ VA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYD
Sbjct  266   GWFTEFGGTIRQRPVEDLAFGVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYD  325

Query  2047  APIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAF  1868
             AP+DE+GL REPK+GHLK+LHRA+KLCE  LVS DP V +LG+ QEA VF+S SG CAAF
Sbjct  326   APLDEYGLAREPKFGHLKELHRAVKLCEQPLVSADPTVTTLGSMQEAHVFRSSSG-CAAF  384

Query  1867  LANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFS  1691
             LAN N +S+AKV F N +Y+LPPWSISILPDCKN V+NTA VG Q+++M+M    +    
Sbjct  385   LANYNSNSYAKVIFNNENYSLPPWSISILPDCKNVVFNTATVGVQTNQMQMWADGASSMM  444

Query  1690  WQSYNEETSSYDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLT  1514
             W+ Y+EE  S       T+TGLLEQ+N TRD SDYLWY+T V +DP E FL+GG    LT
Sbjct  445   WEKYDEEVDSLAAAPLLTSTGLLEQLNVTRDTSDYLWYITSVEVDPSEKFLQGGTPLSLT  504

Query  1513  VYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHF  1334
             V SAGHALHVFINGQL G++YG+ E+ K+++S    LRAG NK++LLS+A GLPNVG H+
Sbjct  505   VQSAGHALHVFINGQLQGSAYGTREDRKISYSGNANLRAGTNKVALLSVACGLPNVGVHY  564

Query  1333  ETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ  1154
             ETWN GV+GPV + GL+EG RDLTWQ WSY++GLKGE ++L+SL GS SVEW++GS +AQ
Sbjct  565   ETWNTGVVGPVVIHGLDEGSRDLTWQTWSYQVGLKGEQMNLNSLEGSGSVEWMQGSLVAQ  624

Query  1153  -KQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYA  977
              +QPL WY+  FD P+G+EPLALDM +MGKGQIWINGQS+GRYW  Y  + G C  C+Y 
Sbjct  625   NQQPLAWYRAYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAY--AEGDCKGCHYT  682

Query  976   GWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCAD  797
             G +   KC + CG+ +QRWYHVPRSWL+PT NLLV FEE GG+   ++L KR V+ VCAD
Sbjct  683   GSYRAPKCQAGCGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALAKRTVSGVCAD  742

Query  796   IYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTC  617
             + E+ P + NW++++ G+       K HL C  GQ I++IKFASFGTP G+CG+F +G C
Sbjct  743   VSEYHPNIKNWQIESYGEPEFH-TAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGEC  801

Query  616   HAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             H+ +S  + +K CIG   C V ++P  FGGDPCP VMK+++VE VCS
Sbjct  802   HSINSNSVLEKKCIGLQRCVVAISPSNFGGDPCPEVMKRVAVEAVCS  848



>ref|XP_004158444.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase-like [Cucumis 
sativus]
Length=725

 Score =  1103 bits (2854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/704 (75%), Positives = 616/704 (88%), Gaps = 3/704 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASV+YD  + IING+R+IL+SGSIHYPRS P+MWPDL++KAK+GGLDV++TYVFWNGHEP
Sbjct  24    ASVTYDHKAIIINGRRRILISGSIHYPRSIPQMWPDLIQKAKDGGLDVIETYVFWNGHEP  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG+Y FE RYDLV+F+KL  QAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG++FRTDN
Sbjct  84    SPGQYNFEDRYDLVRFVKLVHQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFKAAMQKFT  IV +MK ++LYESQGGPIILSQIENEYGP+E+E+GAPGKSY +WAA+
Sbjct  144   GPFKAAMQKFTEKIVGLMKGEKLYESQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQ  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MA+GL TGVPWVMCKQDDAPDPV++ CNGFYC+ F PNK YKPKMWTEAWT WFTEFGGP
Sbjct  204   MALGLNTGVPWVMCKQDDAPDPVIDTCNGFYCENFKPNKVYKPKMWTEAWTGWFTEFGGP  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
              PYRP ED+AY+VA+FI  GGSFINYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GLL
Sbjct  264   APYRPVEDMAYSVARFIQNGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLL  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             REPKW HL+DLH+AIKLCEPALVS DP V  LG+ QEA VFK++SG+CAAFLAN +  S 
Sbjct  324   REPKWSHLRDLHKAIKLCEPALVSVDPTVSYLGSNQEAHVFKTRSGSCAAFLANYDASSS  383

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET-S  1664
             A V FGN  Y+LPPWS+SILPDCK+ ++NTA+VGA +S+ KMTPVS  FSW SYNEET S
Sbjct  384   ATVTFGNNQYDLPPWSVSILPDCKSVIFNTAKVGAPTSQPKMTPVSS-FSWLSYNEETAS  442

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y ++T T  GL+EQI+ TRD++DYLWYMTD+RIDP E FLK G+WP LTV+SAGHALHV
Sbjct  443   AYTEDTTTMAGLVEQISVTRDSTDYLWYMTDIRIDPNEGFLKSGQWPLLTVFSAGHALHV  502

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT+YG  EN K+TFSK V LRAG+NK+S+LS+AVGLPN G H+ETWN GVLGP
Sbjct  503   FINGQLSGTTYGGSENYKLTFSKYVNLRAGINKLSILSVAVGLPNGGLHYETWNTGVLGP  562

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L GLNE  RD++  KWSYKIGLKGE L+LHS+SGSSSVEWV GS +AQKQPLTWYKTT
Sbjct  563   VTLKGLNEDTRDMSGYKWSYKIGLKGEALNLHSVSGSSSVEWVTGSLVAQKQPLTWYKTT  622

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             FD+P GNEPLALDM++MGKGQIWINGQS+GR+WP Y A  G+CG CNY G F+EKKC S 
Sbjct  623   FDSPKGNEPLALDMSSMGKGQIWINGQSIGRHWPAYTAK-GSCGKCNYGGIFNEKKCHSX  681

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVA  812
             CGE SQRWYHVPR+WL+ +GN+LV FEEWGGNP G+SLVKR ++
Sbjct  682   CGEPSQRWYHVPRAWLKSSGNVLVIFEEWGGNPEGISLVKRSIS  725



>gb|EEC74580.1| hypothetical protein OsI_10152 [Oryza sativa Indica Group]
Length=851

 Score =  1103 bits (2853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/827 (64%), Positives = 647/827 (78%), Gaps = 17/827 (2%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YDK + +++GQR+IL SGSIHYPRSTPEMW  L++KAK+GGLDV+QTYVFWNGHEP 
Sbjct  26    AVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHEPT  85

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+FIK  Q+AG++VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  86    PGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  145

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQ----------IENEYGPMEYELGAPG  2408
             PFK AMQ FT  IV MMKS+ L+ SQGGPIILSQ          IENEYGP   E GA G
Sbjct  146   PFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQASAKLCFPCHIENEYGPEGKEFGAAG  205

Query  2407  KSYAQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWT  2228
             K+Y  WAAKMAVGL TGVPWVMCK+DDAPDPV+NACNGFYCD FSPNK YKP MWTEAW+
Sbjct  206   KAYINWAAKMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDTFSPNKPYKPTMWTEAWS  265

Query  2227  AWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYD  2048
              WFTEFGG +  RP EDLA+ VA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYD
Sbjct  266   GWFTEFGGTIRQRPVEDLAFGVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYD  325

Query  2047  APIDEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAF  1868
             AP+DE+GL REPK+GHLK+LHRA+KLCE  LVS DP V +LG+ QEA VF+S SG CAAF
Sbjct  326   APLDEYGLAREPKFGHLKELHRAVKLCEQPLVSADPTVTTLGSMQEAHVFRSSSG-CAAF  384

Query  1867  LANNNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFS  1691
             LAN N +S+AKV F N +Y+LPPWSISILPDCKN V+NTA VG Q+++M+M    +    
Sbjct  385   LANYNSNSYAKVIFNNENYSLPPWSISILPDCKNVVFNTATVGVQTNQMQMWADGASSMM  444

Query  1690  WQSYNEETSSYDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLT  1514
             W+ Y+EE  S       T+TGLLEQ+N TRD SDYLWY+T V +DP E FL+GG    LT
Sbjct  445   WEKYDEEVDSLAAAPLLTSTGLLEQLNVTRDTSDYLWYITSVEVDPSEKFLQGGTPLSLT  504

Query  1513  VYSAGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHF  1334
             V SAGHALHVFINGQL G++YG+ E+ K+++S    LRAG NK++LLS+A GLPNVG H+
Sbjct  505   VQSAGHALHVFINGQLQGSAYGTREDRKISYSGNANLRAGTNKVALLSVACGLPNVGVHY  564

Query  1333  ETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ  1154
             ETWN GV+GPV + GL+EG RDLTWQ WSY++GLKGE ++L+SL GS SVEW++GS +AQ
Sbjct  565   ETWNTGVVGPVVIHGLDEGSRDLTWQTWSYQVGLKGEQMNLNSLEGSGSVEWMQGSLVAQ  624

Query  1153  -KQPLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYA  977
              +QPL WY+  FD P+G+EPLALDM +MGKGQIWINGQS+GRYW  Y  + G C  C+Y 
Sbjct  625   NQQPLAWYRAYFDTPSGDEPLALDMGSMGKGQIWINGQSIGRYWTAY--AEGDCKGCHYT  682

Query  976   GWFDEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCAD  797
             G +   KC + CG+ +QRWYHVPRSWL+PT NLLV FEE GG+   ++L KR V+ VCAD
Sbjct  683   GSYRAPKCQAGCGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDSSKIALAKRTVSGVCAD  742

Query  796   IYEWQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTC  617
             + E+ P + NW++++ G+       K HL C  GQ I++IKFASFGTP G+CG+F +G C
Sbjct  743   VSEYHPNIKNWQIESYGEPEFH-TAKVHLKCAPGQTISAIKFASFGTPLGTCGTFQQGEC  801

Query  616   HAFHSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             H+ +S  + ++ CIG   C V ++P  FGGDPCP VMK+++VE VCS
Sbjct  802   HSINSNSVLERKCIGLERCVVAISPSNFGGDPCPEVMKRVAVEAVCS  848



>ref|XP_009789452.1| PREDICTED: beta-galactosidase 3 [Nicotiana sylvestris]
Length=844

 Score =  1102 bits (2849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/821 (64%), Positives = 648/821 (79%), Gaps = 6/821 (1%)
 Frame = -2

Query  2929  LGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNG  2750
             L    V+YD+ + +INGQR++L SGSIHYPRSTPEMW DL+ KAKEGGLDVV+TYVFWN 
Sbjct  23    LIQCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLINKAKEGGLDVVETYVFWNV  82

Query  2749  HEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFR  2570
             HEP PG Y FEGRYDLV+FIK  Q+AGLY HLR+GPY CAEWNFGGFPVWLKYVPG+SFR
Sbjct  83    HEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  2569  TDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQW  2390
              DN PFK AM+ +   IVN+MKS  L+ESQGGPIILSQIENEYGP    LGA G  Y+ W
Sbjct  143   ADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKALGATGHQYSTW  202

Query  2389  AAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEF  2210
             AA MAVGL TGVPWVMCK++DAPDPV+N CNGFYCD F PNK YKP +WTEAW+ WF+EF
Sbjct  203   AANMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDNFFPNKPYKPTIWTEAWSGWFSEF  262

Query  2209  GGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEF  2030
             GG +  RP +DLA+AVA+FI +GGSF+NYYM+HGGTNFGR+AGGPFI TSYDYDAPIDE+
Sbjct  263   GGTLHQRPVQDLAFAVAQFIQRGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEY  322

Query  2029  GLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQ  1850
             GL+R+PK+GHLK+LH+A+K+CE ALVS DP + SLGN Q+A V+ S++G CAAFL+NN+ 
Sbjct  323   GLIRQPKYGHLKELHKAVKMCEKALVSADPAITSLGNLQQAYVYSSETGDCAAFLSNNDW  382

Query  1849  HSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNE  1673
              S A+V F NMHYNLPPWSISILPDC+N V+NTA+VG Q+S+M+M P  S   SW+SYNE
Sbjct  383   KSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTNSEMLSWESYNE  442

Query  1672  ETSSYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGH  1496
             + S+ DD ++  + GLLEQIN TRD SDYLWY+T V I   E+FL GG+ P L V S GH
Sbjct  443   DISALDDSSSIRSLGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELPTLIVESTGH  502

Query  1495  ALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAG  1316
             ALHVFINGQL G+++G+ +N +  F   V LRAG N+ISLLS+AVGLPN+G HFETW+ G
Sbjct  503   ALHVFINGQLSGSAFGTRKNRRFVFKGKVNLRAGTNRISLLSVAVGLPNMGGHFETWSTG  562

Query  1315  VLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLT  1139
             VLGPV++ GL++GK DL+W KW+Y++GLKGE ++L S +G S+V+W++GS IAQ+ QPLT
Sbjct  563   VLGPVAVHGLDQGKWDLSWAKWTYQVGLKGEAMNLVSPNGISAVDWMQGSLIAQRQQPLT  622

Query  1138  WYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK  959
             W+K  F++P G+EPLALDM++MGKGQ+WINGQS+GRYW  Y    G C  C+Y+G F   
Sbjct  623   WHKAYFNSPDGDEPLALDMSSMGKGQVWINGQSIGRYWTAYAT--GDCNGCHYSGNFRPP  680

Query  958   KCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQP  779
             KC   CG+ +Q+WYHVPRSWL+PT NLLV FEE GG+P  +SLVKR V+S+CAD+ E+ P
Sbjct  681   KCQLGCGQPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRTVSSICADVAEYHP  740

Query  778   QLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSY  599
              + NW+++  G+      PK  + C  GQ I+SIKFASFGTP G+CGSF +G CHA  SY
Sbjct  741   NIKNWQIENYGRTEEFHLPKVRIHCAPGQSISSIKFASFGTPLGTCGSFQQGPCHAPTSY  800

Query  598   DIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              + +K C+G   C V +    F GDPCP+V+K+LSVE  C+
Sbjct  801   AVVEKKCLGRQKCAVTIANSNF-GDPCPNVLKRLSVEAHCT  840



>ref|XP_004147848.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
 ref|XP_004154857.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=844

 Score =  1098 bits (2841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/814 (64%), Positives = 640/814 (79%), Gaps = 8/814 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +V+YDK + +INGQR+IL+SGSIHYPRSTPEMW DL++KAK+GGLDVV TYVFWN HEP 
Sbjct  28    TVTYDKKAILINGQRRILISGSIHYPRSTPEMWDDLMQKAKDGGLDVVDTYVFWNVHEPS  87

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGRYDLV+FIK AQ+ GLYVHLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDNG
Sbjct  88    PGNYDFEGRYDLVRFIKTAQRVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNG  147

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK AMQ FT  IV MMKS++L+ SQGGPIILSQIENEYGP    LGA G +Y  WAAKM
Sbjct  148   PFKMAMQGFTQKIVQMMKSEKLFASQGGPIILSQIENEYGPQSKALGAAGHAYMNWAAKM  207

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVGL TGVPWVMCK+DDAPDPV+N+CNGFYCD+FSPNK YKP +WTEAW+ WFTEFGGPV
Sbjct  208   AVGLNTGVPWVMCKEDDAPDPVINSCNGFYCDYFSPNKPYKPTLWTEAWSGWFTEFGGPV  267

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP +DLA+AVA+F+ KGGS  NYYM+HGGTNFGRTAGGPFI TSYDYDAP+DE+G+LR
Sbjct  268   YGRPVQDLAFAVARFVQKGGSLFNYYMYHGGTNFGRTAGGPFITTSYDYDAPLDEYGMLR  327

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK+GHLK+LHRAIKLCE ALVS DP V SLG Y++A VF S  G CAAFLAN + +S A
Sbjct  328   QPKYGHLKNLHRAIKLCEHALVSSDPTVTSLGAYEQAHVFSSGPGRCAAFLANYHTNSAA  387

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEETSSY  1658
              V F NM Y LP WSISILPDCK  V+NTA+VG   ++ +M P     SW++YNE+T S 
Sbjct  388   TVVFNNMRYALPAWSISILPDCKRVVFNTAQVGVHIAQTQMLPTISKLSWETYNEDTYSL  447

Query  1657  DDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVF  1481
               ++  T  GLLEQIN TRD SDYLWYMT V I   EAFL+GG+ P L+V SAGHA+HVF
Sbjct  448   GGSSRMTVAGLLEQINVTRDTSDYLWYMTSVGISSSEAFLRGGQKPTLSVRSAGHAVHVF  507

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             INGQ  G++YGS E+P  T++  + LRAG+NKI+LLSIAVGLPNVG HFE W  G+LGP+
Sbjct  508   INGQFSGSAYGSREHPAFTYTGPINLRAGMNKIALLSIAVGLPNVGLHFEKWQTGILGPI  567

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTF  1121
             S+SGLN GK+DLTWQKWSY++GLKGE ++L S + ++SV+W++GS +  ++PLTWYK +F
Sbjct  568   SISGLNGGKKDLTWQKWSYQVGLKGEAMNLVSPTEATSVDWIKGSLLQGQRPLTWYKASF  627

Query  1120  DAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKC  941
             +AP GNEPLALD+ +MGKGQ WINGQS+GRYW  Y  + G C  C YAG +    C + C
Sbjct  628   NAPRGNEPLALDLRSMGKGQAWINGQSIGRYWMAY--AKGGCSRCTYAGTYRPPTCENGC  685

Query  940   GEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLMNWE  761
             G+ +QRWYHVPRSWL+PT N+LV FEE GG+   +SL++R V  +C +  E+  +  ++ 
Sbjct  686   GQPTQRWYHVPRSWLKPTNNVLVLFEELGGDASKISLMRRSVTGLCGEAVEYHAKNDSYI  745

Query  760   MQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQKY  581
             ++++ +         HL C  GQ I++IKFASFGTP G+CGS+ +GTCHA  S+ I +K 
Sbjct  746   IESNEELD-----SLHLQCNPGQVISAIKFASFGTPSGTCGSYQKGTCHAPDSHAIIEKK  800

Query  580   CIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVC  479
             CIG  SC+V  T + FG DPCP+ +K+L VEV C
Sbjct  801   CIGLKSCSVSTTRDNFGVDPCPNELKQLLVEVDC  834



>ref|XP_008643999.1| PREDICTED: uncharacterized protein LOC100382452 isoform X1 [Zea 
mays]
 tpg|DAA43552.1| TPA: hypothetical protein ZEAMMB73_935084 [Zea mays]
Length=845

 Score =  1097 bits (2838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/817 (65%), Positives = 643/817 (79%), Gaps = 9/817 (1%)
 Frame = -2

Query  2911  SYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQPG  2732
             +YDK + +I+GQR+IL SGSIHYPRSTP+MW  L++KAK+GGLDV+QTYVFWNGHEP PG
Sbjct  30    TYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPTPG  89

Query  2731  KYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNGPF  2552
              YYFE RYDLV+F+K  Q+AGL+VHLR+GPY C EWNFGGFPVWLKYVPG+SFRTDN PF
Sbjct  90    NYYFEERYDLVRFVKTVQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  149

Query  2551  KAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKMAV  2372
             K AMQ FT  IV MMKS+ L+ SQGGPIILSQIENEYGP   E GA G++Y  WAAKMAV
Sbjct  150   KTAMQGFTEKIVGMMKSENLFASQGGPIILSQIENEYGPEGKEFGAAGQAYINWAAKMAV  209

Query  2371  GLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPY  2192
             GL TGVPWVMCK++DAPDPV+NACNGFYCD FSPNK YKP MWTEAW+ WFTEFGG +  
Sbjct  210   GLDTGVPWVMCKEEDAPDPVINACNGFYCDAFSPNKPYKPTMWTEAWSGWFTEFGGTIRQ  269

Query  2191  RPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREP  2012
             RP EDLA+AVA+F+ KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+REP
Sbjct  270   RPVEDLAFAVARFVQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIREP  329

Query  2011  KWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKV  1832
             K  HLK+LHRA+KLCE ALVS DP + +LG  QEA VF+S SG CAAFLAN N +S AKV
Sbjct  330   KHSHLKELHRAVKLCEQALVSVDPTITTLGTMQEAHVFRSPSG-CAAFLANYNSNSHAKV  388

Query  1831  AFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKM-TPVSRGFSWQSYNEETSSYD  1655
              F N  Y+LPPWSISILPDCKN V+N+A VG Q+S+M+M    +    W+ Y+EE  S  
Sbjct  389   VFNNEQYSLPPWSISILPDCKNVVFNSATVGVQTSQMQMWGDGATSMMWERYDEEVDSLA  448

Query  1654  DN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLK-GGKWPWLTVYSAGHALHVF  1481
                  T TGLLEQ+N TRD+SDYLWY+T V I P E FL+ GGK P L+V SAGHALHVF
Sbjct  449   AAPLLTTTGLLEQLNVTRDSSDYLWYITSVDISPSENFLQGGGKPPSLSVQSAGHALHVF  508

Query  1480  INGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPV  1301
             +NGQL G+SYG+ E+ ++ ++  V LRAG NKI+LLS+A GLPNVG H+ETWN GV GPV
Sbjct  509   VNGQLQGSSYGTREDRRIKYNGNVNLRAGTNKIALLSVACGLPNVGVHYETWNTGVGGPV  568

Query  1300  SLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYKTT  1124
              L GLNEG RDLTWQ WSY++GLKGE ++L+S+ GS SVEW++GS IAQK QPL WYK  
Sbjct  569   VLHGLNEGSRDLTWQTWSYQVGLKGEQMNLNSVEGSGSVEWMQGSLIAQKQQPLAWYKAY  628

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F+ P+G+EPLALDM +MGKGQ+WINGQS+GRYW  Y  + G C  C+Y G F   KC + 
Sbjct  629   FETPSGDEPLALDMGSMGKGQVWINGQSIGRYWTAY--ADGDCKGCSYTGTFRAPKCQAG  686

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEW-GGNPYGVSLVKREVASVCADIYEWQPQLMN  767
             CG+ +QRWYHVPRSWL+P+ NLLV  EE  GG+   ++L KR V+SVCAD+ E  P +  
Sbjct  687   CGQPTQRWYHVPRSWLQPSRNLLVVLEELGGGDSSKIALAKRSVSSVCADVSEDHPNIKK  746

Query  766   WEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIFQ  587
             W++++ G+     R K HL C  GQ I++I+FASFGTP G+CG+F +G CH+  S+ + +
Sbjct  747   WQIESYGEREH-RRAKVHLRCAHGQSISAIRFASFGTPVGTCGNFQQGGCHSASSHAVLE  805

Query  586   KYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             K CIG   C V ++P+ FGGDPCPSV K+++VE VCS
Sbjct  806   KRCIGLQRCVVAISPDNFGGDPCPSVTKRVAVEAVCS  842



>gb|AGR44466.1| beta-D-galactosidase 7 [Pyrus x bretschneideri]
Length=852

 Score =  1097 bits (2837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/819 (64%), Positives = 643/819 (79%), Gaps = 10/819 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
              +V+YDK + +INGQR++L+SGSIHYPRSTPEMW  L++KAK+GGLDV+ TYVFWNGHEP
Sbjct  28    TTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKDGGLDVIDTYVFWNGHEP  87

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG YYFEGRYDLV+FIK  Q+AGL++HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  88    SPGNYYFEGRYDLVRFIKTVQKAGLFLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  147

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFK AMQ FT  IV MMK+++L+ SQGGPIILSQIENEYGP    LGA G++Y  WAAK
Sbjct  148   GPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPERKALGAAGQNYINWAAK  207

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPWVMCK+DDAPDP++NACNGFYCD F+PNK YKP MWTEAW+ WFTEFGG 
Sbjct  208   MAVGLDTGVPWVMCKEDDAPDPMINACNGFYCDGFTPNKPYKPTMWTEAWSGWFTEFGGT  267

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             + +RP +DLA+AVA+FI +GGS++NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+
Sbjct  268   IHHRPVQDLAFAVARFIERGGSYVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLI  327

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LH+AIKLCE +L+S +P V SLG Y +A VF S  G CAAFL+N   HS 
Sbjct  328   RQPKYGHLKELHKAIKLCEHSLLSSEPTVTSLGTYHQAYVFNSGPGRCAAFLSNF--HSV  385

Query  1840  -AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEET  1667
              A+V F N HY+LPPWS+SILPDC+N VYNTA+VG Q+S ++M P  SR FSWQ+Y+E+ 
Sbjct  386   EARVTFNNKHYDLPPWSVSILPDCRNEVYNTAKVGVQTSHVQMIPTNSRLFSWQTYDEDI  445

Query  1666  SS-YDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
             SS ++ ++  A GLLEQIN TRD SDYLWYMT+V I   +  L GGK P LTV SAGHAL
Sbjct  446   SSVHERSSIPAIGLLEQINVTRDTSDYLWYMTNVDISSSD--LSGGKKPTLTVQSAGHAL  503

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVF+NGQ  G+++G+ E  + TF+  V L AG+N+I+LLSIAVGLPNVG H+E+W  G+ 
Sbjct  504   HVFVNGQFSGSAFGTREQRQFTFADPVNLHAGINRIALLSIAVGLPNVGLHYESWKTGIQ  563

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWY  1133
             GPV L GL  GK+DLT  KW  K+GLKGE ++L S +G+SSV W+  S   Q KQ L WY
Sbjct  564   GPVFLDGLGNGKKDLTLHKWFNKVGLKGEAMNLVSPNGASSVGWIRRSLATQTKQTLKWY  623

Query  1132  KTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKC  953
             K  F+AP GNEPLALDM  MGKGQ+WINGQS+GRYW  Y  + G C +C+Y G F   KC
Sbjct  624   KAYFNAPGGNEPLALDMRMMGKGQVWINGQSIGRYWMAY--AKGDCSSCSYIGTFRPTKC  681

Query  952   LSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQL  773
                CG  +QRWYHVPRSWL+PT NL+V FEE GG+P  ++LV+R VA VC D++E  P  
Sbjct  682   QLHCGRPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVRRSVAGVCGDLHENHPNA  741

Query  772   MNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDI  593
              N+++  +  +    + + HL C  GQ I+SIKFASFGTP G+CGSF +GTCHA +S+ +
Sbjct  742   ENFDVDGNEDSKTLHQAQVHLHCAPGQSISSIKFASFGTPSGTCGSFQQGTCHATNSHAV  801

Query  592   FQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              +K CIG  SC+V V+   F  DPCP+V+K+LSVE VCS
Sbjct  802   VEKNCIGRESCSVAVSNSTFETDPCPNVLKRLSVEAVCS  840



>ref|XP_008388000.1| PREDICTED: beta-galactosidase 5 [Malus domestica]
Length=852

 Score =  1095 bits (2832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/818 (64%), Positives = 646/818 (79%), Gaps = 8/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
              +V+YDK + +INGQR++L+SGSIHYPRSTPEMW  L++KAK+GGLDV+ TYVFWNGHEP
Sbjct  28    TTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKDGGLDVIDTYVFWNGHEP  87

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG YYFEGRYDLV FIK  Q+AGL++HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  88    SPGNYYFEGRYDLVGFIKTVQKAGLFLHLRIGPYICAEWNFGGFPVWLKYVPGISFRTDN  147

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFK AMQ FT  IV MMK ++L+ SQGGPIILSQIENEYGP    LGA G +Y  WAA+
Sbjct  148   GPFKMAMQGFTQKIVQMMKDEKLFASQGGPIILSQIENEYGPESKALGAAGHNYINWAAQ  207

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPWVMCK+DDAPDP++NACNGFYCD F+PNK YKP MWTEAW+ WFTEFGG 
Sbjct  208   MAVGLDTGVPWVMCKEDDAPDPMINACNGFYCDGFTPNKPYKPAMWTEAWSGWFTEFGGT  267

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             + +RP +DLA+AV +FI KGGS++NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+
Sbjct  268   IHHRPVQDLAFAVGRFIQKGGSYVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLI  327

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             REPK+GHLK+LH+AIKLCE +L+S +P V SLG Y +A VF S    CAAFL+N +  + 
Sbjct  328   REPKYGHLKELHKAIKLCEHSLLSSEPTVTSLGTYHQAYVFNSGPNRCAAFLSNFHS-TG  386

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             AKV F N+HY+LPPWS+SILPDC+N V+NTA+VG Q+S ++M P  S  FSWQ+Y+E+ S
Sbjct  387   AKVTFNNLHYDLPPWSVSILPDCRNEVFNTAKVGVQTSHVQMIPTNSLLFSWQTYDEDIS  446

Query  1663  SYDD-NTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S +D ++  A GLLEQIN TRD SDYLWYMT+V I   +  L GGK P LTV SAGHALH
Sbjct  447   SLNDGSSIPAVGLLEQINVTRDTSDYLWYMTNVDISSSD--LGGGKKPTLTVQSAGHALH  504

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VF+NGQ  G+++G+ E  + TF++ V LR G+N+I+LLSIAVGLPNVG H+E+W  G+ G
Sbjct  505   VFVNGQFSGSAFGTREQRQFTFAEPVNLRTGINRIALLSIAVGLPNVGLHYESWKTGIQG  564

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYK  1130
             PV L GL  GK+DLT QKW YK+GLKGE ++L S +G+SSV+W+  S   Q KQ L WYK
Sbjct  565   PVFLDGLGHGKKDLTSQKWFYKVGLKGEEMNLVSPNGASSVDWIRRSLATQTKQTLKWYK  624

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               F+AP GNEPLALDM++MGKGQ+WINGQS+GRYW  Y  + G C +C+Y G F   +C 
Sbjct  625   AYFNAPGGNEPLALDMSSMGKGQVWINGQSIGRYWMAY--AKGDCSSCSYIGTFRPTECQ  682

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CG+ +QRWYHVPRSWL+PT NL+V FEE GG+P  ++LVKR V  VC D++E  P + 
Sbjct  683   LGCGQPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVKRSVTGVCGDLHENHPNVE  742

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             N++++ +  +    + + HL C  G+ I+SIKFASFGTP G+CGSF +GTCHA +S+ + 
Sbjct  743   NFDVEGNENSKTLHQAQVHLQCAPGKSISSIKFASFGTPTGTCGSFQQGTCHAKNSHGVV  802

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K CIG  SC+V VT   F  DPCP+V+K+LSVE VCS
Sbjct  803   EKNCIGRESCSVAVTNSIFKTDPCPNVLKRLSVEAVCS  840



>dbj|BAD91084.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=852

 Score =  1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/819 (64%), Positives = 642/819 (78%), Gaps = 10/819 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
              +V+YDK + +INGQR++L+SGSIHYPRSTPEMW  L++KAK+GGLDV+ TYVFWNGHEP
Sbjct  28    TTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKDGGLDVIDTYVFWNGHEP  87

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG YYFEGRYDLV+FIK  Q+AGL++HLR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  88    SPGNYYFEGRYDLVRFIKTVQKAGLFLHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  147

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFK AMQ FT  IV MMK+++L+ SQGGPIILSQIENEYGP    LGAPG++Y  WAAK
Sbjct  148   GPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPERKALGAPGQNYINWAAK  207

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPWVMCK+DDAPDP++NACNGFYCD F+PNK YKP MWTEAW+ WF EFGG 
Sbjct  208   MAVGLDTGVPWVMCKEDDAPDPMINACNGFYCDGFTPNKPYKPTMWTEAWSGWFLEFGGT  267

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             + +RP +DLA+AVA+FI +GGS++NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+
Sbjct  268   IHHRPVQDLAFAVARFIQRGGSYVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLI  327

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LH+AIKLCE +L+S +P V SLG Y +A VF S    CAAFL+N   HS 
Sbjct  328   RQPKYGHLKELHKAIKLCEHSLLSSEPTVTSLGTYHQAYVFNSGPRRCAAFLSNF--HSV  385

Query  1840  -AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEET  1667
              A+V F N HY+LPPWS+SILPDC+N VYNTA+VG Q+S ++M P  SR FSWQ+Y+E+ 
Sbjct  386   EARVTFNNKHYDLPPWSVSILPDCRNEVYNTAKVGVQTSHVQMIPTNSRLFSWQTYDEDI  445

Query  1666  SS-YDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHAL  1490
             SS ++ ++  A GLLEQIN TRD SDYLWYMT+V I   +  L GGK P LTV SAGHAL
Sbjct  446   SSVHERSSIPAIGLLEQINVTRDTSDYLWYMTNVDISSSD--LSGGKKPTLTVQSAGHAL  503

Query  1489  HVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVL  1310
             HVF+NGQ  G+++G+ E  + TF+  V L AG+N+I+LLSIAVGLPNVG H+E+W  G+ 
Sbjct  504   HVFVNGQFSGSAFGTREQRQFTFADPVNLHAGINRIALLSIAVGLPNVGLHYESWKTGIQ  563

Query  1309  GPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWY  1133
             GPV L GL  GK+DLT  KW  K+GLKGE ++L S +G+SSV W+  S   Q KQ L WY
Sbjct  564   GPVFLDGLGNGKKDLTLHKWFNKVGLKGEAMNLVSPNGASSVGWIRRSLATQTKQTLKWY  623

Query  1132  KTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKC  953
             K  F+AP GNEPLALDM  MGKGQ+WINGQS+GRYW  Y  + G C +C+Y G F   KC
Sbjct  624   KAYFNAPGGNEPLALDMRRMGKGQVWINGQSIGRYWMAY--AKGDCSSCSYIGTFRPTKC  681

Query  952   LSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQL  773
                CG  +QRWYHVPRSWL+PT NL+V FEE GG+P  ++LV+R VA VC D++E  P  
Sbjct  682   QLHCGRPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVRRSVAGVCGDLHENHPNA  741

Query  772   MNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDI  593
              N+++  +  +    + + HL C  GQ I+SIKFASFGTP G+CGSF +GTCHA +S+ +
Sbjct  742   ENFDVDGNEDSKTLHQAQVHLHCAPGQSISSIKFASFGTPSGTCGSFQQGTCHATNSHAV  801

Query  592   FQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
              +K CIG  SC+V V+   F  DPCP+V+K+LSVE VCS
Sbjct  802   VEKNCIGRESCSVAVSNSTFETDPCPNVLKRLSVEAVCS  840



>ref|XP_004135712.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=723

 Score =  1094 bits (2830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/701 (74%), Positives = 612/701 (87%), Gaps = 3/701 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASV+YD  + +I+G+R+IL+SGSIHYPRSTP+MWPDL++KAK+GGLDV++TYVFWNGHEP
Sbjct  24    ASVTYDHKALVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHEP  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG+YYFE RY+LV+F+KL QQAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG++FRTDN
Sbjct  84    SPGQYYFEDRYELVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFKAAMQKFT  IV+MMK ++LY SQGGPIILSQIENEYGP+E+E+GAPGKSY +WAA+
Sbjct  144   GPFKAAMQKFTAKIVSMMKGEKLYHSQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQ  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MA+GL TGVPWVMCKQ+DAPDP+++ CNGFYC+ F PNKAYKPKMWTEAWT WFTEFGGP
Sbjct  204   MALGLDTGVPWVMCKQEDAPDPMIDTCNGFYCENFEPNKAYKPKMWTEAWTGWFTEFGGP  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VPYRP EDLAYAVA+FI   GS INYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GL+
Sbjct  264   VPYRPVEDLAYAVARFIQNRGSLINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLI  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PKWGHL+DLH+AIKLCEPALVS DP V SLG+ QEA V+ ++SG CAAFLAN +  + 
Sbjct  324   RQPKWGHLRDLHKAIKLCEPALVSVDPTVSSLGSKQEAHVYNTRSGECAAFLANYDPSTS  383

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET-S  1664
              +V FGN  Y+LPPWS+SILPDCK  V+NTA+V A S   KMTP+S  FSW SYNEET S
Sbjct  384   VRVTFGNHPYDLPPWSVSILPDCKTVVFNTAKVNAPSYWPKMTPIS-SFSWHSYNEETAS  442

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y D+T T  GL+EQI+ TRDA+DYLWYMTD+RID  E FLK G+WP LT++SAGHALHV
Sbjct  443   AYADDTTTMAGLVEQISITRDATDYLWYMTDIRIDSNEGFLKSGQWPLLTIFSAGHALHV  502

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT YG L+NPK+TFSK V LR GVNK+S+LS+AVGLPNVG HFETWNAG+LGP
Sbjct  503   FINGQLSGTVYGGLDNPKLTFSKYVNLRPGVNKLSMLSVAVGLPNVGVHFETWNAGILGP  562

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L GLNEG RD++  KWSYK+GLKGE L+LH++SGSSSVEW+ GS ++QKQPLTWYKTT
Sbjct  563   VTLKGLNEGTRDMSGYKWSYKVGLKGEALNLHTVSGSSSVEWMTGSLVSQKQPLTWYKTT  622

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F+AP GNEPLALDM +MGKGQ+WING+S+GR+WP Y A  G+CG C Y G F EKKC   
Sbjct  623   FNAPGGNEPLALDMGSMGKGQVWINGESIGRHWPAYTAR-GSCGKCYYGGIFTEKKCHFS  681

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKR  821
             CGE SQRWYHVPR+WL+P+GN+LV FEEWGGNP G+SLVKR
Sbjct  682   CGEPSQRWYHVPRAWLKPSGNILVIFEEWGGNPDGISLVKR  722



>ref|XP_008450854.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=723

 Score =  1094 bits (2829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/701 (74%), Positives = 611/701 (87%), Gaps = 3/701 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASV+YD  + +I+G+R+IL+SGSIHYPRSTP+MWPDL++KAK+GGLDV++TYVFWNGHEP
Sbjct  24    ASVTYDHKALVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHEP  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG+YYFE RYDLV+F+KL QQAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG++FRTDN
Sbjct  84    SPGQYYFEDRYDLVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFKAAMQKFT  IV+MMK ++LY SQGGPIILSQIENEYGP+E+E+GAPGKSY +WAA+
Sbjct  144   GPFKAAMQKFTAKIVSMMKGEKLYHSQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQ  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MA+GL TGVPWVMCKQ+DAPDPV++ CNGFYC+ F PNKAYKPKMWTEAWT WFTEFGGP
Sbjct  204   MALGLDTGVPWVMCKQEDAPDPVIDTCNGFYCENFEPNKAYKPKMWTEAWTGWFTEFGGP  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VPYRP EDLAYAVA+FI   GS INYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GL+
Sbjct  264   VPYRPVEDLAYAVARFIQNRGSLINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLI  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PKWGHL+DLH+AIKLCEPALVS DP V SLG+ QEA VF ++SG CAAFLAN +  + 
Sbjct  324   RQPKWGHLRDLHKAIKLCEPALVSVDPTVSSLGSKQEAHVFDTRSGQCAAFLANYDPSTS  383

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET-S  1664
              +V FGN  Y+LPPWS+SILPDCK  V+NTA+V A S   KMTP+S  FSW SYNEET S
Sbjct  384   VRVIFGNHPYDLPPWSVSILPDCKTVVFNTAKVNAPSYWPKMTPISS-FSWHSYNEETAS  442

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y D+T T  GL+EQI+ TRD +DYLWYMTD+RID  E FLK G+WP LT++SAGHALHV
Sbjct  443   AYADDTTTMAGLVEQISVTRDGTDYLWYMTDIRIDSNEGFLKSGQWPLLTIFSAGHALHV  502

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT YG L+NPK+TFSK V LR GVNK+S+LS+AVGLPNVG HFETWNAG+LGP
Sbjct  503   FINGQLSGTVYGGLDNPKLTFSKYVNLRPGVNKLSMLSVAVGLPNVGLHFETWNAGILGP  562

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L GLNEG RD++  KWSYK+GLKGE ++LH++SGSSSVEW+ GS ++QKQPLTWYKTT
Sbjct  563   VTLKGLNEGTRDMSGYKWSYKVGLKGESMNLHTISGSSSVEWMTGSLVSQKQPLTWYKTT  622

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F+AP GNEPLALDM +MGKGQ+WING+S+GR+WP Y A  G+CG C Y G F EKKC   
Sbjct  623   FNAPGGNEPLALDMGSMGKGQVWINGRSIGRHWPAYTAR-GSCGKCYYGGIFTEKKCHYS  681

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKR  821
             CGE SQ+WYHVPR+WL+P+GN+LV FEEWGGNP G+SLVKR
Sbjct  682   CGEPSQKWYHVPRAWLKPSGNILVIFEEWGGNPEGISLVKR  722



>gb|EYU32887.1| hypothetical protein MIMGU_mgv1a001295mg [Erythranthe guttata]
Length=845

 Score =  1093 bits (2828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/820 (63%), Positives = 639/820 (78%), Gaps = 6/820 (1%)
 Frame = -2

Query  2926  GTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGH  2747
             G  +V+YD  + +INGQR+ILLSGS+HYPRSTP+MW DL+ KAK GGLDV+ TYVFWNGH
Sbjct  25    GNCTVTYDNKAILINGQRRILLSGSVHYPRSTPDMWEDLILKAKNGGLDVIDTYVFWNGH  84

Query  2746  EPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRT  2567
             EP PG Y FEGRYDLV+F+K  Q+ GL+V+LR+GPY CAEWN+GGFPVWLKYVPG+SFRT
Sbjct  85    EPSPGNYNFEGRYDLVRFVKTVQKVGLFVNLRIGPYVCAEWNYGGFPVWLKYVPGISFRT  144

Query  2566  DNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWA  2387
             DN PFKAAMQ FT  IV MMKS+ L+ESQGGPIILSQIENEYG     LGA G +Y  WA
Sbjct  145   DNEPFKAAMQGFTQKIVGMMKSENLFESQGGPIILSQIENEYGSQRRALGAAGDAYMNWA  204

Query  2386  AKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFG  2207
             AKMAVGL TGVPW+MCK D+APDP++N CNGFYCD F+PNK YKP MWTEAWT WF EFG
Sbjct  205   AKMAVGLDTGVPWIMCKDDNAPDPLINTCNGFYCDAFTPNKPYKPTMWTEAWTGWFNEFG  264

Query  2206  GPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFG  2027
             G V  RP +DLA+AVA+FI  GGS+INYYMFHGGTNFGRTAGGPFI TSYDYDAPIDE+G
Sbjct  265   GTVHQRPVQDLAFAVARFIQIGGSYINYYMFHGGTNFGRTAGGPFITTSYDYDAPIDEYG  324

Query  2026  LLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQH  1847
             L+REPK+GHLK+LH+AIKLCEPALVS DP   SLG +Q+ARVF + +G+CAAFL+N + +
Sbjct  325   LIREPKYGHLKELHKAIKLCEPALVSADPTKTSLGTFQQARVFTTGNGSCAAFLSNFDSN  384

Query  1846  SFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGF-SWQSYNEE  1670
             S A+V F  MHYNLPPWSISILPDC+N V+NTA+VGAQ+S ++M   +  F SW++YNE+
Sbjct  385   SAARVIFNKMHYNLPPWSISILPDCRNVVFNTAKVGAQTSHVEMLASNSQFYSWETYNED  444

Query  1669  TSSYDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHA  1493
             T+S DD++ FTA GLLEQI+ TRD SDYLWY+T + I   E+FL+GG+ P LTV S GHA
Sbjct  445   TTSSDDSSAFTANGLLEQISVTRDTSDYLWYITSIDISSSESFLRGGQKPILTVNSKGHA  504

Query  1492  LHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGV  1313
             +HVFINGQL G++YG+    + TF+  V L+ G NKISLLSIA+GLPN G H+E W  G 
Sbjct  505   VHVFINGQLAGSAYGTRAKTRFTFTGPVNLQVGTNKISLLSIAMGLPNNGMHYENWAVG-  563

Query  1312  LGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTW  1136
             LG V L+GL++GK+DL+ Q WSYK+GL+GE+++L S    SSVEW + S I Q +QPL W
Sbjct  564   LGLVELNGLDQGKKDLSSQTWSYKVGLRGEMMNLVSPDKDSSVEWTQMSAITQNQQPLRW  623

Query  1135  YKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKK  956
             YK  FDAP G+EPLALDM +MGKGQ+W+NGQS+GRYW     + G C  C+Y G +   K
Sbjct  624   YKAYFDAPNGDEPLALDMTSMGKGQVWVNGQSIGRYW--LTNANGNCDICHYNGTYRAPK  681

Query  955   CLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQ  776
             C   CG+ +QRWYHVPRSWLRPT N +V  EE GG+   ++LVKR  + VCA+ +E  P 
Sbjct  682   CQLGCGQPTQRWYHVPRSWLRPTQNFIVLLEEIGGDASKIALVKRTTSRVCANAFEHHPT  741

Query  775   LMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYD  596
             + N++ +++       + + HLSCG GQ I++IKFASFGTP+G+CGSF  G CH+ +S  
Sbjct  742   VANYKTESTAPQKMLRQARVHLSCGPGQSISAIKFASFGTPKGTCGSFQLGNCHSQNSNA  801

Query  595   IFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             + +K C+G  SC + V+   FG DPCP V+KKLSVE +CS
Sbjct  802   LIEKMCVGKESCKIAVSNSYFGSDPCPRVLKKLSVEAICS  841



>ref|XP_004158465.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=1225

 Score =  1093 bits (2828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/701 (74%), Positives = 612/701 (87%), Gaps = 3/701 (0%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ASV+YD  + +I+G+R+IL+SGSIHYPRSTP+MWPDL++KAK+GGLDV++TYVFWNGHEP
Sbjct  24    ASVTYDHKALVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHEP  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG+YYFE RY+LV+F+KL QQAGLYVHLR+GPY CAEWNFGGFPVWLKYVPG++FRTDN
Sbjct  84    SPGQYYFEDRYELVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIAFRTDN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
             GPFKAAMQKFT  IV+MMK ++LY SQGGPIILSQIENEYGP+E+E+GAPGKSY +WAA+
Sbjct  144   GPFKAAMQKFTAKIVSMMKGEKLYHSQGGPIILSQIENEYGPVEWEIGAPGKSYTKWAAQ  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MA+GL TGVPWVMCKQ+DAPDP+++ CNGFYC+ F PNKAYKPKMWTEAWT WFTEFGGP
Sbjct  204   MALGLDTGVPWVMCKQEDAPDPMIDTCNGFYCENFEPNKAYKPKMWTEAWTGWFTEFGGP  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             VPYRP EDLAYAVA+FI   GS INYYM+HGGTNFGRTAGGPFIATSYDYDAPIDE+GL+
Sbjct  264   VPYRPVEDLAYAVARFIQNRGSLINYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLI  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PKWGHL+DLH+AIKLCEPALVS DP V SLG+ QEA V+ ++SG CAAFLAN +  + 
Sbjct  324   RQPKWGHLRDLHKAIKLCEPALVSVDPTVSSLGSKQEAHVYNTRSGECAAFLANYDPSTS  383

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFSWQSYNEET-S  1664
              +V FGN  Y+LPPWS+SILPDCK  V+NTA+V A S   KMTP+S  FSW SYNEET S
Sbjct  384   VRVTFGNHPYDLPPWSVSILPDCKTVVFNTAKVNAPSYWPKMTPIS-SFSWHSYNEETAS  442

Query  1663  SYDDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
             +Y D+T T  GL+EQI+ TRDA+DYLWYMTD+RID  E FLK G+WP LT++SAGHALHV
Sbjct  443   AYADDTTTMAGLVEQISITRDATDYLWYMTDIRIDSNEGFLKSGQWPLLTIFSAGHALHV  502

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL GT YG L+NPK+TFSK V LR GVNK+S+LS+AVGLPNVG HFETWNAG+LGP
Sbjct  503   FINGQLSGTVYGGLDNPKLTFSKYVNLRPGVNKLSMLSVAVGLPNVGVHFETWNAGILGP  562

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTT  1124
             V+L GLNEG RD++  KWSYK+GLKGE L+LH++SGSSSVEW+ GS ++QKQPLTWYKTT
Sbjct  563   VTLKGLNEGTRDMSGYKWSYKVGLKGEALNLHTVSGSSSVEWMTGSLVSQKQPLTWYKTT  622

Query  1123  FDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSK  944
             F+AP GNEPLALDM +MGKGQ+WING+S+GR+WP Y A  G+CG C Y G F EKKC   
Sbjct  623   FNAPGGNEPLALDMGSMGKGQVWINGESIGRHWPAYTAR-GSCGKCYYGGIFTEKKCHFS  681

Query  943   CGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKR  821
             CGE SQRWYHVPR+WL+P+GN+LV FEEWGGNP G+SLVKR
Sbjct  682   CGEPSQRWYHVPRAWLKPSGNILVIFEEWGGNPDGISLVKR  722


 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/505 (66%), Positives = 401/505 (79%), Gaps = 13/505 (3%)
 Frame = -2

Query  2311  VNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPVPYRPAEDLAYAVAKFIMKGGSF  2132
             ++ CNGFYC+ F PN+ YKPK+WTE W+ W+T FGGP PYRP ED+A++VA+FI  GGS 
Sbjct  723   IDTCNGFYCENFKPNQIYKPKIWTENWSGWYTAFGGPTPYRPPEDVAFSVARFIQNGGSL  782

Query  2131  INYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLREPKWGHLKDLHRAIKLCEPALV  1952
             +NYYM+HGGTNFGRT+G  F+ TSYD+DAPIDE+GLLREPKWGHL+DLH+AIKLCEPALV
Sbjct  783   VNYYMYHGGTNFGRTSG-LFVTTSYDFDAPIDEYGLLREPKWGHLRDLHKAIKLCEPALV  841

Query  1951  SGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFAKVAFGNMHYNLPPWSISILPDC  1772
             S DP    LG  QEARVFKS SGACAAFLAN +  +F +V F N  Y+LPPWSISILPDC
Sbjct  842   SADPTSTWLGKDQEARVFKSSSGACAAFLANYDTSAFVRVNFWNHPYDLPPWSISILPDC  901

Query  1771  KNTVYNTARVGAQSSRM-------KMTPVSRGFSWQSYNEE-TSSYDDNTFTATGLLEQI  1616
             K   +NTARV              KMTP+S  F W SY EE  S+Y  +T T  GL+EQ+
Sbjct  902   KTVTFNTARVRRDPKLFIPNLLMAKMTPIS-SFWWLSYKEEPASAYAKDTTTKDGLVEQV  960

Query  1615  NTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHVFINGQLVGTSYGSLEN  1436
             + T D +DYLWYMTD+RID  E FLK G+WP LTV SAGH LHVFINGQL G+ YGSLE+
Sbjct  961   SVTWDTTDYLWYMTDIRIDSTEGFLKSGQWPLLTVNSAGHILHVFINGQLSGSVYGSLED  1020

Query  1435  PKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQ  1256
             P++TFSK V L+ GVNK+S+LS+ VGLPNVG HF+TWNAGVLGPV+L GLNEG RD++  
Sbjct  1021  PRITFSKYVNLKQGVNKLSMLSVTVGLPNVGLHFDTWNAGVLGPVTLKGLNEGTRDMSKY  1080

Query  1255  KWSYKIGLKgevlslhslsgsssvewvegSFIAQKQPLTWYKTTFDAPAGNEPLALDMNT  1076
             KWSYK+GL+GE+L+L+S+ GS+SV+W++GSF  QKQPLTWYKTTF+ PAGNEPLALDM++
Sbjct  1081  KWSYKVGLRGEILNLYSVKGSNSVQWMKGSF--QKQPLTWYKTTFNTPAGNEPLALDMSS  1138

Query  1075  MGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCLSKCGEASQRWYHVPRSWL  896
             M KGQIW+NG+S+GRY+PGY AS G C  C+Y G+F EKKCL  CG  SQ+WYH+PR WL
Sbjct  1139  MSKGQIWVNGRSIGRYFPGYIAS-GKCNKCSYTGFFTEKKCLWNCGGPSQKWYHIPRDWL  1197

Query  895   RPTGNLLVAFEEWGGNPYGVSLVKR  821
              P GNLL+  EE GGNP G+SLVKR
Sbjct  1198  SPNGNLLIILEEIGGNPQGISLVKR  1222



>ref|XP_008382310.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=848

 Score =  1093 bits (2827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/824 (63%), Positives = 638/824 (77%), Gaps = 5/824 (1%)
 Frame = -2

Query  2938  WVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVF  2759
             +V     +V +D+ + +I+GQR++L SGSIHYPRSTPEMW  L++ AK+GGLD + TYVF
Sbjct  23    YVEQTECNVVFDRKALVIDGQRRLLFSGSIHYPRSTPEMWEGLIQXAKDGGLDAIDTYVF  82

Query  2758  WNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGV  2579
             WN HEP PG Y FEGR DLV+FIK   +AGLYVHLR+GPY C+EWNFGGFPVWLK+VPG+
Sbjct  83    WNLHEPSPGNYNFEGRNDLVRFIKTVHKAGLYVHLRIGPYICSEWNFGGFPVWLKFVPGI  142

Query  2578  SFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSY  2399
             SFRTDN PFK+AMQKFT  +V +MK+++L+ESQGGPIILSQIENEY P     GA G +Y
Sbjct  143   SFRTDNEPFKSAMQKFTQKVVQLMKNEKLFESQGGPIILSQIENEYEPESKAFGASGYAY  202

Query  2398  AQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWF  2219
               WAAKMAVG+GTGVPWVMCK+DDAPDPV+N CNGFYCD+FSPNK YKP MWTEAW+ WF
Sbjct  203   MTWAAKMAVGMGTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPYKPTMWTEAWSGWF  262

Query  2218  TEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPI  2039
             TEFGGP+  RP EDLA+AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPI
Sbjct  263   TEFGGPIYQRPVEDLAFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPI  322

Query  2038  DEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLAN  1859
             DE+GL+R+PK+GHLK+LH+A+KLCE AL++ DP V +LG+Y++A VF SKSG CAAFL+N
Sbjct  323   DEYGLIRQPKYGHLKELHKAVKLCELALLNADPTVTTLGSYEQAHVFSSKSGGCAAFLSN  382

Query  1858  NNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQS  1682
              N  S AKV F NM+++LPPWSISILPDCKN  +NTARV  Q+ + ++ P  S   SW  
Sbjct  383   FNTKSAAKVTFNNMNFHLPPWSISILPDCKNVAFNTARVRVQTFQTQLLPTNSELHSWGI  442

Query  1681  YNEETSSY-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             +NE+ SS   D T T  GLL+Q+N TRD+SDYLWY T V IDP E+FL+GG+ P LTV S
Sbjct  443   FNEDVSSVAGDTTITVVGLLDQLNITRDSSDYLWYTTSVDIDPSESFLRGGQHPSLTVQS  502

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AG A+HVFIN QL G++ G+ E+ + TF+  V L AG+NKISLLSIAVGL N GPHFET 
Sbjct  503   AGDAMHVFINDQLSGSASGTREHRRFTFTGNVNLHAGLNKISLLSIAVGLANNGPHFETR  562

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-Q  1148
             N GVLGPV+L GL+ G RDL+WQ+WSY++GLKGE  +L S +  S+V+W+ GS +AQK Q
Sbjct  563   NTGVLGPVALHGLDHGTRDLSWQQWSYQVGLKGEASNLDSPNSISAVDWMTGSLVAQKQQ  622

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYK  FD P G+EPLALDM +MGKGQ WINGQS+GRYW  Y  + G C AC Y+G F
Sbjct  623   PLTWYKAYFDEPNGDEPLALDMGSMGKGQAWINGQSIGRYWTIY--ADGDCSACTYSGTF  680

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
               KKC   C   +Q+WYHVPRSWL+P+ NLLV FEE GG+   V+LVK+ V SVCA++ E
Sbjct  681   RPKKCQFGCQHPTQQWYHVPRSWLKPSKNLLVVFEEIGGDVSKVALVKKSVTSVCAEVSE  740

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
               P + NW  ++ G+     +P+  L C  G  I++IKF+SFGTP GSCG F  GTCHA 
Sbjct  741   NHPHITNWHTESHGQTEVQQKPEIGLHCTDGHSISAIKFSSFGTPSGSCGKFQHGTCHAP  800

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +S  + QK C+G   C+V ++   FG DPCPS +KKLSVE VCS
Sbjct  801   NSNAVLQKECLGKQKCSVTISNTNFGADPCPSKLKKLSVEAVCS  844



>dbj|BAD91085.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=848

 Score =  1093 bits (2827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/824 (63%), Positives = 638/824 (77%), Gaps = 5/824 (1%)
 Frame = -2

Query  2938  WVSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVF  2759
             +V +   +V YD+ + +I+GQR++L SGSIHYPRSTPEMW  L++KAK+GGLD + TYVF
Sbjct  23    YVEVTKCNVVYDRKALVIDGQRRLLFSGSIHYPRSTPEMWEGLIQKAKDGGLDAIDTYVF  82

Query  2758  WNGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGV  2579
             WN HEP PG Y FEGR DLV+FIK   +AGLYVHLR+GPY C+EWNFGGFPVWLK+VPG+
Sbjct  83    WNLHEPSPGNYNFEGRNDLVRFIKTVHKAGLYVHLRIGPYICSEWNFGGFPVWLKFVPGI  142

Query  2578  SFRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSY  2399
             SFRTDN PFK+AMQKFT  +V +MK+++L+ESQGGPIILSQIENEY P     GA G +Y
Sbjct  143   SFRTDNEPFKSAMQKFTQKVVQLMKNEKLFESQGGPIILSQIENEYEPESKAFGASGYAY  202

Query  2398  AQWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWF  2219
               WAAKMAVG+GTGVPWVMCK+DDAPDPV+N CNGFYCD+FSPNK YKP MWTEAW+ WF
Sbjct  203   MTWAAKMAVGMGTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPYKPTMWTEAWSGWF  262

Query  2218  TEFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPI  2039
             TEFGGP+  RP EDL +AVA+FI KGGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPI
Sbjct  263   TEFGGPIYQRPVEDLTFAVARFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPI  322

Query  2038  DEFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLAN  1859
             DE+GL+R PK+GHLK+LH+A+KLCE AL++ DP V +LG+Y++A VF SKSG+ A FL+N
Sbjct  323   DEYGLIRRPKYGHLKELHKAVKLCELALLNADPTVTTLGSYEQAHVFSSKSGSGAVFLSN  382

Query  1858  NNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQS  1682
              N  S  KV F NM+++LPPWSISILPDCKN  +NTARVG Q+S+ ++    S   SW  
Sbjct  383   FNTKSATKVTFNNMNFHLPPWSISILPDCKNVAFNTARVGVQTSQTQLLRTNSELHSWGI  442

Query  1681  YNEETSSY-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYS  1505
             +NE+ SS   D T T TGLL+Q+N TRD+SDYLWY T V IDP E+FL GG+ P LTV S
Sbjct  443   FNEDVSSVAGDTTITVTGLLDQLNITRDSSDYLWYTTSVDIDPSESFLGGGQHPSLTVQS  502

Query  1504  AGHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETW  1325
             AG A+HVFIN QL G++ G+ E+ + TF+  V L AG+NKISLLSIAVGL N GPHFET 
Sbjct  503   AGDAMHVFINDQLSGSASGTREHRRFTFTGNVNLHAGLNKISLLSIAVGLANNGPHFETR  562

Query  1324  NAGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-Q  1148
             N GVLGPV+L GL+ G RDL+WQKWSY++GLKGE  +L S +  S+V+W+ GS +AQK Q
Sbjct  563   NTGVLGPVALHGLDHGTRDLSWQKWSYQVGLKGEATNLDSPNSISAVDWMTGSLVAQKQQ  622

Query  1147  PLTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWF  968
             PLTWYK  FD P G+EPLALDM +MGKGQ+WINGQS+GRYW  Y  S   C AC Y+G F
Sbjct  623   PLTWYKAYFDEPNGDEPLALDMGSMGKGQVWINGQSIGRYWTIYADSD--CSACTYSGTF  680

Query  967   DEKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYE  788
               KKC   C   +Q+WYHVPRSWL+P+ NLLV FEE GG+   V+LVK+ V SVCA++ E
Sbjct  681   RPKKCQFGCQHPTQQWYHVPRSWLKPSKNLLVVFEEIGGDVSKVALVKKSVTSVCAEVSE  740

Query  787   WQPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAF  608
               P++ NW  ++ G+     +P+  L C  G  I++IKF+SFGTP GSCG F  GTCHA 
Sbjct  741   NHPRITNWHTESHGQTEVQQKPEISLHCTDGHSISAIKFSSFGTPSGSCGKFQHGTCHAP  800

Query  607   HSYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +S  + QK C+G   C+V ++   FG DPCPS +KKLSVE VCS
Sbjct  801   NSNAVLQKECLGKQKCSVTISNTNFGADPCPSKLKKLSVEAVCS  844



>ref|XP_007199661.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
 gb|EMJ00860.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
Length=844

 Score =  1092 bits (2825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/823 (63%), Positives = 637/823 (77%), Gaps = 5/823 (1%)
 Frame = -2

Query  2935  VSLGTASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFW  2756
             + L   +V YD+ + II+GQR+IL SGSIHYPRSTPEMW  L++KAK+GGLD + TYVFW
Sbjct  22    LELAQCNVVYDRKALIIDGQRRILFSGSIHYPRSTPEMWEGLIQKAKDGGLDAIDTYVFW  81

Query  2755  NGHEPQPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVS  2576
             N HEP PG Y FEGRYDL +FIK   +AGLYVHLR+GPY C+EWNFGGFPVWLKYVPG+S
Sbjct  82    NLHEPSPGNYNFEGRYDLARFIKTVHKAGLYVHLRIGPYICSEWNFGGFPVWLKYVPGIS  141

Query  2575  FRTDNGPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYA  2396
             FRTDN PFK+AMQKFT  IV +MK ++L+ESQGGPIILSQIENEY P     GA G +Y 
Sbjct  142   FRTDNEPFKSAMQKFTQKIVQLMKDEKLFESQGGPIILSQIENEYEPESKAFGASGYAYM  201

Query  2395  QWAAKMAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFT  2216
              WAAKMAVG+GTGVPWVMCK+ DAPDPV+N CNGFYCD+FSPN+ YKP +WTEAWT WFT
Sbjct  202   SWAAKMAVGMGTGVPWVMCKEQDAPDPVINTCNGFYCDYFSPNRVYKPTLWTEAWTGWFT  261

Query  2215  EFGGPVPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPID  2036
             EFGGPV  RP EDLA+AVA FI KGGSF+NYYM+HGGTNFGRTAGGPFI TSYDYDAPID
Sbjct  262   EFGGPVYQRPVEDLAFAVAGFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPID  321

Query  2035  EFGLLREPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANN  1856
             E+GL+R+PK+GHLK+LH+A+KLCEPAL++ DP V SLG+Y +A VF  KSG CAAFL+N 
Sbjct  322   EYGLIRQPKYGHLKELHKAVKLCEPALLNADPTVTSLGSYGQAHVFSFKSGVCAAFLSNY  381

Query  1855  NQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGF-SWQSY  1679
             N  S A V F NM+++LPPWSISILPDCKN V+NTARVG Q+S+ ++   +    SW+ +
Sbjct  382   NTKSAATVTFNNMNFHLPPWSISILPDCKNVVFNTARVGVQTSQTQLLHTNSELRSWEIF  441

Query  1678  NEETSSY-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSA  1502
             NE+ SS   D T T  GLL+Q+N TRD+SDYLWY T V I P E+FL+GG+ P LTV S 
Sbjct  442   NEDISSVAGDTTITVIGLLDQLNITRDSSDYLWYTTSVDIGPSESFLRGGQHPSLTVQST  501

Query  1501  GHALHVFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWN  1322
             G A+HVFIN QL G++YG+ E  + TF+  V L AG+NKISLLSIAVGL N GPHFE  +
Sbjct  502   GDAMHVFINDQLSGSAYGTREYRRFTFTGNVNLHAGLNKISLLSIAVGLANNGPHFEMRS  561

Query  1321  AGVLGPVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QP  1145
              GVLGPV L GL++GKRDL+WQKWSYK+GLKGE ++L +L   S+V+W++GS +AQK QP
Sbjct  562   TGVLGPVVLHGLDQGKRDLSWQKWSYKVGLKGEDMNLGALHSISAVDWMKGSLVAQKQQP  621

Query  1144  LTWYKTTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFD  965
             LTWYK +FDAP G++PLALDM +MGKGQ+WINGQS+GRYW  Y    G C  C Y+G F 
Sbjct  622   LTWYKASFDAPKGDDPLALDMGSMGKGQVWINGQSIGRYWTTYAT--GNCSECAYSGTFR  679

Query  964   EKKCLSKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEW  785
              KKC   C   +Q+WYHVPRS+L+P+ NLLV FEE GG+   + LVK+ V SVCA++ E 
Sbjct  680   PKKCQFGCQHPTQQWYHVPRSFLKPSNNLLVVFEEIGGDVSRIGLVKKSVTSVCAEVSEN  739

Query  784   QPQLMNWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFH  605
              P   NW+ ++ G+     +P+  L C  G  I++IKF+SFGTP GSCG+F  G CHA +
Sbjct  740   HPHFRNWQTESHGQLEEQNKPEISLHCTEGHSISAIKFSSFGTPSGSCGTFQHGACHAPN  799

Query  604   SYDIFQKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             S  + +K CIG   C+V ++   FG DPCPS +KKLSVE VC+
Sbjct  800   SNAVLEKECIGKQKCSVTISNTNFGKDPCPSKLKKLSVEAVCA  842



>ref|XP_004292017.1| PREDICTED: beta-galactosidase 3-like [Fragaria vesca subsp. vesca]
Length=829

 Score =  1092 bits (2824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/818 (63%), Positives = 640/818 (78%), Gaps = 6/818 (1%)
 Frame = -2

Query  2917  SVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEPQ  2738
             +VSYD+ + +INGQRKIL SGSIHYPRSTPEMW  L++KAK+GGLDV+ TYVFWN HEP 
Sbjct  13    NVSYDRKALVINGQRKILFSGSIHYPRSTPEMWEGLIEKAKDGGLDVIDTYVFWNLHEPS  72

Query  2737  PGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDNG  2558
             PG Y FEGR DLV+FIK+ Q+A LYVHLR+GPY C+EWNFGGFPVWLKYVPG+SFRTDN 
Sbjct  73    PGNYNFEGRNDLVRFIKMVQEARLYVHLRIGPYICSEWNFGGFPVWLKYVPGISFRTDNE  132

Query  2557  PFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAKM  2378
             PFK+AMQKFT  IV +MK ++L+ESQGGPIILSQIENEY P     GA G +Y  WAA+M
Sbjct  133   PFKSAMQKFTKKIVQLMKHEKLFESQGGPIILSQIENEYEPESKLFGAAGHAYMTWAAEM  192

Query  2377  AVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGPV  2198
             AVG+GTGVPWVMCK++DAPDPV+N CNGFYCD+FSPNK YKP +WTEAWT WFTEFGGP+
Sbjct  193   AVGMGTGVPWVMCKEEDAPDPVINTCNGFYCDYFSPNKPYKPSLWTEAWTGWFTEFGGPI  252

Query  2197  PYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLLR  2018
               RP EDLA+ VA+FI  GGSFINYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GL+R
Sbjct  253   YKRPVEDLAFGVARFIQNGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLIR  312

Query  2017  EPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSFA  1838
             +PK GHLK+LH+A+KLCE AL++ D  V SLGNY++A +F SKSG CAAFL+N N  S A
Sbjct  313   QPKHGHLKELHKAVKLCEQALLNADSIVTSLGNYEQAHIFSSKSGGCAAFLSNYNTKSAA  372

Query  1837  KVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPVSRGFS-WQSYNEETSS  1661
             +V F  M+Y+LPPWSISILPDCKN VYNTA+VG Q+S+ +  P +     W++++E+ SS
Sbjct  373   RVTFNKMNYHLPPWSISILPDCKNVVYNTAQVGVQTSQKQFFPTNSKLRLWETFSEDISS  432

Query  1660  Y-DDNTFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALHV  1484
                D   T  GLL+Q+N TRD+SDYLWY T++ I   E+FL+GG+ P LTV S+G A+HV
Sbjct  433   VASDTKLTVIGLLDQLNITRDSSDYLWYTTNIDIKSSESFLRGGQHPTLTVQSSGDAMHV  492

Query  1483  FINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLGP  1304
             FINGQL G+SYG+ +N + TF+  V L AG+NKISLLSIAVGLPN GPHFET NAGVLGP
Sbjct  493   FINGQLSGSSYGTRKNKRFTFTGNVSLHAGMNKISLLSIAVGLPNNGPHFETRNAGVLGP  552

Query  1303  VSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQ-KQPLTWYKT  1127
             V+L GL++G RDL+WQKWS+K+GL GE ++L S S  S+V+W   +  A+ +QPLTWYK 
Sbjct  553   VALHGLDQGSRDLSWQKWSHKVGLIGEAMNLGSPSSISAVDWTRVNLAAKNQQPLTWYKV  612

Query  1126  TFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEK-KCL  950
              FDAP G+EPLALDM +MGKGQ+WINGQS+GRYW  Y  + G C AC+YAG F  K KC 
Sbjct  613   NFDAPEGDEPLALDMGSMGKGQLWINGQSIGRYWTTY--ANGDCSACSYAGTFRPKNKCQ  670

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
             S C   +Q+WYHVPRSWL+ + NLLV FEE  G+   ++LVK  V++VCA+++E  P + 
Sbjct  671   SGCNRPTQQWYHVPRSWLKQSKNLLVVFEEISGDVSKIALVKTSVSTVCAEVFENHPYIR  730

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW   + G+     +P   L C  G  I++IKF+SFGTP GSCG+F  GTCHA +S  + 
Sbjct  731   NWHTDSGGQLEEQKKPIMSLHCTEGYSISAIKFSSFGTPSGSCGNFQHGTCHAPNSKAVI  790

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K CIG   C++ ++   FG DPCPS++KKLSVE VC+
Sbjct  791   EKKCIGKQKCSLTISDANFGMDPCPSILKKLSVEAVCA  828



>ref|XP_004146490.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
 ref|XP_004160975.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=846

 Score =  1092 bits (2823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/818 (66%), Positives = 632/818 (77%), Gaps = 11/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ++V+YD+ + +INGQR+IL SGSIHYPRSTPEMW DL+ KAK GGLDVV+TYVFWN HEP
Sbjct  25    STVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLILKAKNGGLDVVETYVFWNVHEP  84

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEGR+DLV+FIK  Q+AGLY +LR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  85    YPGIYNFEGRFDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  144

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
               FK AMQ FT  IV +MKS+ L+ESQGGPIIL+QIENEYG      G  G +Y  WAA 
Sbjct  145   EAFKNAMQGFTEKIVALMKSENLFESQGGPIILAQIENEYGTESKLFGEAGYNYMTWAAN  204

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPWVMCK+ DAPDPV+N CNGFYCD FSPNK YKP MWTEAWT WF+EFGGP
Sbjct  205   MAVGLQTGVPWVMCKEADAPDPVINTCNGFYCDTFSPNKPYKPTMWTEAWTGWFSEFGGP  264

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             +  RP +DLA+AVA+FI +GGS +NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GLL
Sbjct  265   LHQRPVQDLAFAVARFIQRGGSLVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLL  324

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LHRAIK+CEPALVS DP V SLG+YQ+A V+ S+SG CAAFL+N +  SF
Sbjct  325   RQPKYGHLKELHRAIKMCEPALVSADPIVTSLGDYQQAHVYSSESGGCAAFLSNYDTKSF  384

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F N HYNLPPWSISILPDCKN V+NTA+VG Q+++M M P  S   SW+SY E+ S
Sbjct  385   ARVLFNNRHYNLPPWSISILPDCKNAVFNTAKVGVQTAQMGMLPAESTTLSWESYFEDIS  444

Query  1663  SYDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             + DD +  T+ GLLEQIN TRD SDYLWY+T V I   E FL GG+ P L V S GHA+H
Sbjct  445   ALDDRSMMTSPGLLEQINVTRDTSDYLWYITSVDISSSEPFLHGGELPTLLVQSTGHAVH  504

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQL G+  GS ++ + T+S  V L AG NKI LLS+AVGLPNVG HFETWN G+LG
Sbjct  505   VFINGQLSGSVSGSRKSRRFTYSGKVNLHAGTNKIGLLSVAVGLPNVGGHFETWNTGILG  564

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYK  1130
             PV L GL +GK DL+ QKW+YK+GLKGE ++L S SG S VEW++ S  AQ  QPLTW+K
Sbjct  565   PVVLYGLRQGKWDLSSQKWTYKVGLKGEAMNLISPSGFSPVEWMQASLAAQTPQPLTWHK  624

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               FDAP G EPLALDM  MGKGQIWINGQS+GRYW  Y  + G C  CNYA  F   KC 
Sbjct  625   AYFDAPEGEEPLALDMEGMGKGQIWINGQSIGRYWTAY--ARGNCSRCNYATAFRPPKCQ  682

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CG+ +QRWYHVPRSWLRP  NLLV FEE GGNP  +S+VKR V SVCAD+ E+ P   
Sbjct  683   LGCGQPTQRWYHVPRSWLRPEQNLLVVFEEVGGNPSRISIVKRLVTSVCADVSEFHPTFK  742

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW + A     + + PK HLSC  GQ I+SIKFASFGTP G+CGS+ +GTCHA  S  I 
Sbjct  743   NWHITA-----KFITPKVHLSCDPGQYISSIKFASFGTPLGTCGSYQQGTCHAPSSSGIL  797

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K C+G   C V V+   F  DPCP++MK+LSVE VC+
Sbjct  798   EKKCVGKQRCAVTVSNSNF-EDPCPNMMKRLSVEAVCN  834



>ref|XP_008452119.1| PREDICTED: beta-galactosidase 3-like [Cucumis melo]
Length=846

 Score =  1090 bits (2819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/818 (66%), Positives = 630/818 (77%), Gaps = 11/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             ++V+YD+ + +INGQR+IL SGSIHYPRSTPEMW DL+ KAK GGLDVV+TYVFWN HEP
Sbjct  25    STVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLILKAKNGGLDVVETYVFWNVHEP  84

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PG Y FEGR+DLV+FIK  Q+AGLY +LR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  85    YPGIYNFEGRFDLVRFIKTIQRAGLYANLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  144

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
               FK AMQ FT  IV MMKS+ L+ESQGGPIIL+QIENEYG      G  G +Y  WAA 
Sbjct  145   EAFKKAMQGFTEKIVAMMKSENLFESQGGPIILAQIENEYGTESKLFGEAGHNYMTWAAN  204

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL TGVPWVMCK++DAPDPV+N CNGFYCD FSPNK YKP MWTEAWT WF+EFGGP
Sbjct  205   MAVGLQTGVPWVMCKEEDAPDPVINTCNGFYCDTFSPNKPYKPTMWTEAWTGWFSEFGGP  264

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             +  RP +DLA+AVA+FI +GGS +NYYM+HGGTNFGRTAGGPFI TSYDYDAPIDE+GLL
Sbjct  265   LHQRPVQDLAFAVARFIQRGGSLVNYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLL  324

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LHRAIK+CEPALVS DP V SLG+YQ+A V+ S+SG CAAFL+N +  SF
Sbjct  325   RQPKYGHLKELHRAIKMCEPALVSADPIVTSLGDYQQAHVYSSESGGCAAFLSNYDTKSF  384

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F N HYNLPPWSI ILPDCKN V+NTA+VG Q+++M M P  S   SW+SY E+ S
Sbjct  385   ARVLFNNRHYNLPPWSIGILPDCKNAVFNTAKVGVQTAQMGMLPAESNTLSWESYFEDIS  444

Query  1663  SYDDNT-FTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             + DD +  T+ GLLEQIN TRD SDYLWY+T + I   E FL GG+ P L V S GHA+H
Sbjct  445   ALDDRSMMTSPGLLEQINVTRDTSDYLWYITSIDISSSEPFLHGGELPTLLVQSTGHAVH  504

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVYLRAGVNKISLLSIAVGLPNVGPHFETWNAGVLG  1307
             VFINGQL G+  GS ++ + T+S  V L AG NKI LLS+AVGLPNVG HFETWN G+LG
Sbjct  505   VFINGQLSGSVSGSRKSRRFTYSGKVNLHAGTNKIGLLSVAVGLPNVGGHFETWNTGILG  564

Query  1306  PVSLSGLNEGKRDLTWQKWSYKIGLKgevlslhslsgsssvewvegSFIAQK-QPLTWYK  1130
             PV L GL +GK DL+ QKW+Y++GLKGE ++L S SG S VEW++ S  AQ  QPLTW+K
Sbjct  565   PVVLYGLRQGKWDLSSQKWTYQVGLKGEAMNLISPSGFSPVEWMQASLAAQTPQPLTWHK  624

Query  1129  TTFDAPAGNEPLALDMNTMGKGQIWINGQSVGRYWPGYKASGGACGACNYAGWFDEKKCL  950
               FDAP G EPLALDM  MGKGQIWINGQS+GRYW  Y  + G C  CNYA  F   KC 
Sbjct  625   AYFDAPEGEEPLALDMEGMGKGQIWINGQSIGRYWTAY--ARGNCSRCNYATAFRPPKCQ  682

Query  949   SKCGEASQRWYHVPRSWLRPTGNLLVAFEEWGGNPYGVSLVKREVASVCADIYEWQPQLM  770
               CG+ +QRWYHVPRSWLRP  NLLV FEE GGNP  +S+VKR V SVC D+ E+ P   
Sbjct  683   LGCGQPTQRWYHVPRSWLRPEQNLLVVFEEVGGNPSRISIVKRLVTSVCGDVSEFHPTFK  742

Query  769   NWEMQASGKATRPLRPKAHLSCGAGQKITSIKFASFGTPRGSCGSFSEGTCHAFHSYDIF  590
             NW + A   A     PK HLSC  GQ I+SIKFASFGTP G+CGS+ +GTCHA  S  I 
Sbjct  743   NWHITAKFHA-----PKVHLSCDPGQYISSIKFASFGTPLGTCGSYQQGTCHAPSSRGIL  797

Query  589   QKYCIGWNSCTVPVTPEAFGGDPCPSVMKKLSVEVVCS  476
             +K C+G   C + V+   F  DPCP++MK+LSVE VC+
Sbjct  798   EKKCVGKQRCAITVSNSNF-EDPCPNMMKRLSVEAVCN  834



>gb|AHL69742.1| beta-galactosidase [Hylocereus undatus]
Length=835

 Score =  1089 bits (2817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/818 (64%), Positives = 633/818 (77%), Gaps = 9/818 (1%)
 Frame = -2

Query  2920  ASVSYDKHSFIINGQRKILLSGSIHYPRSTPEMWPDLLKKAKEGGLDVVQTYVFWNGHEP  2741
             +SV YDK   ++NGQRKIL+SGSIHYPRSTP+MW DL+ KAK GGLDV+ TYVFWNGHEP
Sbjct  24    SSVIYDKKGIVVNGQRKILISGSIHYPRSTPDMWEDLITKAKHGGLDVIDTYVFWNGHEP  83

Query  2740  QPGKYYFEGRYDLVKFIKLAQQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGVSFRTDN  2561
              PGKYYFEGRYDLV+FIK  Q+ GLYV+LR+GPY CAEWNFGGFPVWLKYVPG+SFRTDN
Sbjct  84    SPGKYYFEGRYDLVRFIKTVQRVGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDN  143

Query  2560  GPFKAAMQKFTTMIVNMMKSQRLYESQGGPIILSQIENEYGPMEYELGAPGKSYAQWAAK  2381
              PFK AMQ FT  IV MMK++RL+ SQGGPIILSQIENEYG  E   GA G SY  WAAK
Sbjct  144   EPFKRAMQGFTQKIVQMMKNERLFASQGGPIILSQIENEYGSEERAYGAAGYSYMNWAAK  203

Query  2380  MAVGLGTGVPWVMCKQDDAPDPVVNACNGFYCDWFSPNKAYKPKMWTEAWTAWFTEFGGP  2201
             MAVGL  GVPW+MCKQDDAPDPV+N CNGFYCD F PNK YKP MWTEAW+ WFTEFGGP
Sbjct  204   MAVGLDIGVPWLMCKQDDAPDPVINTCNGFYCDAFRPNKPYKPMMWTEAWSGWFTEFGGP  263

Query  2200  VPYRPAEDLAYAVAKFIMKGGSFINYYMFHGGTNFGRTAGGPFIATSYDYDAPIDEFGLL  2021
             V  RP EDLA+AVA+F+  GG++ NYYM+HGGTNF RTAGGPFI TSYDYDAPIDE+GL+
Sbjct  264   VNSRPVEDLAFAVARFVQSGGTYFNYYMYHGGTNFERTAGGPFITTSYDYDAPIDEYGLI  323

Query  2020  REPKWGHLKDLHRAIKLCEPALVSGDPNVISLGNYQEARVFKSKSGACAAFLANNNQHSF  1841
             R+PK+GHLK+LH+AIKL EPAL+S DP V SLG Y++A VF  + G CAAFL+N + ++ 
Sbjct  324   RQPKYGHLKELHQAIKLSEPALLSSDPTVTSLGAYEQAHVFSGR-GTCAAFLSNFHANAA  382

Query  1840  AKVAFGNMHYNLPPWSISILPDCKNTVYNTARVGAQSSRMKMTPV-SRGFSWQSYNEETS  1664
             A+V F N HY+LP WSISILPDCKN V+NTA+VG Q+S M+M P  SR  SW+ Y+E+ S
Sbjct  383   ARVTFRNQHYDLPAWSISILPDCKNVVFNTAKVGVQTSHMQMLPTNSRLMSWKMYDEDLS  442

Query  1663  SYDDN-TFTATGLLEQINTTRDASDYLWYMTDVRIDPREAFLKGGKWPWLTVYSAGHALH  1487
             S D+  + TA GLLEQIN TRD+SDYLWYMT V + P E     G+ P L V S GHA+H
Sbjct  443   SLDERASMTAVGLLEQINVTRDSSDYLWYMTTVEVSPSEL---QGQVPNLQVQSEGHAIH  499

Query  1486  VFINGQLVGTSYGSLENPKVTFSKAVY