BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20368_g1_i1 len=595 path=[1627:0-93 2596:94-192 1721:193-594]

Length=595
                                                                      Score     E

gb|EYU36811.1|  hypothetical protein MIMGU_mgv1a011044mg              95.9    3e-20   
ref|XP_009620049.1|  PREDICTED: probable prolyl 4-hydroxylase 3       94.7    7e-20   
ref|XP_009798871.1|  PREDICTED: probable prolyl 4-hydroxylase 3       94.0    2e-19   
ref|XP_004238387.1|  PREDICTED: probable prolyl 4-hydroxylase 3       89.7    4e-18   
ref|XP_006342080.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  88.6    1e-17   
emb|CDP07346.1|  unnamed protein product                              87.8    2e-17   
ref|XP_011083428.1|  PREDICTED: probable prolyl 4-hydroxylase 3       81.3    3e-15   
ref|XP_011074717.1|  PREDICTED: probable prolyl 4-hydroxylase 3       68.9    7e-11   
gb|EYU17560.1|  hypothetical protein MIMGU_mgv1a0210092mg             65.9    7e-11   
gb|EPS68098.1|  hypothetical protein M569_06675                       65.9    1e-09   
ref|XP_010536435.1|  PREDICTED: probable prolyl 4-hydroxylase 3       65.9    1e-09   
ref|XP_010266054.1|  PREDICTED: probable prolyl 4-hydroxylase 3       65.5    1e-09   
ref|XP_002510597.1|  prolyl 4-hydroxylase alpha subunit, putative     64.3    3e-09   Ricinus communis
ref|XP_010266900.1|  PREDICTED: probable prolyl 4-hydroxylase 3       62.0    2e-08   
ref|XP_008809398.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  62.0    2e-08   
ref|XP_008809399.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  61.2    3e-08   
ref|XP_006305481.1|  hypothetical protein CARUB_v10009921mg           61.2    5e-08   
ref|XP_008809395.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  61.2    5e-08   
ref|XP_010539828.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  60.8    5e-08   
ref|XP_009149624.1|  PREDICTED: probable prolyl 4-hydroxylase 3       60.1    5e-08   
ref|XP_004151664.1|  PREDICTED: uncharacterized protein LOC101218099  57.4    1e-07   
gb|AAM61711.1|  putative prolyl 4-hydroxylase, alpha subunit          59.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564109.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  59.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51328.1|  BnaCnng20650D                                        59.7    1e-07   
emb|CDY29362.1|  BnaA06g14340D                                        59.7    1e-07   
ref|XP_002893096.1|  oxidoreductase                                   59.7    1e-07   
gb|KHG14293.1|  Prolyl 4-hydroxylase subunit alpha-2                  59.3    2e-07   
ref|XP_009386075.1|  PREDICTED: probable prolyl 4-hydroxylase 3       59.3    2e-07   
ref|XP_009392830.1|  PREDICTED: probable prolyl 4-hydroxylase 3       58.9    3e-07   
ref|XP_008387906.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  58.9    3e-07   
ref|XP_008802369.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  58.9    3e-07   
ref|XP_009334602.1|  PREDICTED: probable prolyl 4-hydroxylase 3       58.9    3e-07   
ref|XP_008387904.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  58.9    3e-07   
ref|XP_002285898.1|  PREDICTED: probable prolyl 4-hydroxylase 3       58.9    3e-07   Vitis vinifera
gb|KCW68010.1|  hypothetical protein EUGRSUZ_F01696                   57.8    4e-07   
ref|XP_008347372.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  56.6    4e-07   
ref|XP_002307750.2|  oxidoreductase family protein                    58.2    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011003088.1|  PREDICTED: probable prolyl 4-hydroxylase 3       58.2    5e-07   
ref|XP_010918438.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  57.8    6e-07   
ref|XP_010480555.1|  PREDICTED: probable prolyl 4-hydroxylase 3       57.4    7e-07   
ref|NP_001241692.1|  prolyl 4-hydroxylase 8-2                         56.2    8e-07   
ref|XP_007017904.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...  57.4    8e-07   
ref|XP_008456388.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  57.4    9e-07   
gb|KDO75956.1|  hypothetical protein CISIN_1g0230532mg                55.8    9e-07   
ref|XP_007017903.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...  57.0    9e-07   
ref|XP_010498461.1|  PREDICTED: probable prolyl 4-hydroxylase 3       57.4    1e-06   
ref|XP_008456383.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  57.4    1e-06   
ref|XP_010459709.1|  PREDICTED: probable prolyl 4-hydroxylase 3       57.4    1e-06   
ref|XP_010061109.1|  PREDICTED: probable prolyl 4-hydroxylase 3       57.4    1e-06   
ref|XP_010477260.1|  PREDICTED: probable prolyl 4-hydroxylase 3       57.4    1e-06   
ref|XP_007017902.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...  57.0    1e-06   
ref|XP_010100124.1|  Prolyl 4-hydroxylase subunit alpha-2             57.0    1e-06   
gb|KDO75955.1|  hypothetical protein CISIN_1g0230532mg                55.8    1e-06   
ref|XP_008456352.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  56.6    1e-06   
ref|XP_004167095.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  56.6    1e-06   
gb|KGN60775.1|  hypothetical protein Csa_2G009620                     56.6    1e-06   
ref|XP_004139389.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  56.6    1e-06   
ref|XP_010935631.1|  PREDICTED: probable prolyl 4-hydroxylase 3       57.0    1e-06   
ref|XP_008802391.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  56.6    2e-06   
ref|XP_004171765.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  56.6    2e-06   
ref|XP_007223346.1|  hypothetical protein PRUPE_ppa009548mg           56.6    2e-06   
gb|AFW63914.1|  hypothetical protein ZEAMMB73_179176                  55.8    2e-06   
ref|XP_010918436.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  56.2    2e-06   
gb|KDP36874.1|  hypothetical protein JCGZ_08165                       56.2    2e-06   
gb|EEE58093.1|  hypothetical protein OsJ_08962                        56.2    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74283.1|  hypothetical protein OsI_09531                        56.2    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008377129.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  55.8    3e-06   
ref|XP_003570489.1|  PREDICTED: probable prolyl 4-hydroxylase 3       55.8    3e-06   
dbj|BAD23054.1|  putative prolyl 4-hydroxylase                        55.8    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009110235.1|  PREDICTED: probable prolyl 4-hydroxylase 3       55.8    3e-06   
emb|CDX96644.1|  BnaA08g21870D                                        55.8    3e-06   
emb|CDY54327.1|  BnaCnng26730D                                        55.8    3e-06   
dbj|BAK01841.1|  predicted protein                                    55.8    4e-06   
ref|XP_006648159.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  55.8    4e-06   
ref|XP_004954469.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  55.8    4e-06   
ref|XP_002453082.1|  hypothetical protein SORBIDRAFT_04g038020        55.5    4e-06   Sorghum bicolor [broomcorn]
ref|NP_001241694.1|  prolyl 4-hydroxylase 8-4                         55.5    4e-06   
ref|NP_001159002.1|  prolyl 4-hydroxylase alpha-2 subunit             55.5    4e-06   Zea mays [maize]
ref|NP_001241695.1|  prolyl 4-hydroxylase 8-5                         55.5    4e-06   
ref|NP_001151238.1|  LOC100284871                                     55.5    4e-06   Zea mays [maize]
ref|NP_001241693.1|  prolyl 4-hydroxylase 8-3                         54.3    4e-06   
gb|KDO75954.1|  hypothetical protein CISIN_1g0230532mg                54.7    7e-06   
ref|XP_006449333.1|  hypothetical protein CICLE_v10016152mg           54.7    7e-06   
ref|XP_008221210.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1  54.7    7e-06   
gb|EMS46850.1|  hypothetical protein TRIUR3_31584                     53.5    8e-06   
ref|XP_010063298.1|  PREDICTED: probable prolyl 4-hydroxylase 3       53.9    8e-06   
gb|KCW70504.1|  hypothetical protein EUGRSUZ_F03711                   53.9    1e-05   
ref|XP_009388317.1|  PREDICTED: probable prolyl 4-hydroxylase 3       52.0    2e-05   
ref|XP_004291329.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  53.5    2e-05   
ref|XP_009418644.1|  PREDICTED: probable prolyl 4-hydroxylase 3       53.1    3e-05   
ref|XP_010266901.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  53.1    3e-05   
ref|XP_010266902.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  53.1    3e-05   
emb|CDM81384.1|  unnamed protein product                              51.2    3e-05   
tpg|DAA49454.1|  TPA: hypothetical protein ZEAMMB73_536273            52.4    4e-05   
gb|KHG08442.1|  Prolyl 4-hydroxylase subunit alpha-1                  52.8    4e-05   
ref|XP_010667434.1|  PREDICTED: probable prolyl 4-hydroxylase 3       52.4    4e-05   
ref|XP_009397948.1|  PREDICTED: probable prolyl 4-hydroxylase 3       52.4    5e-05   
ref|XP_010029633.1|  PREDICTED: probable prolyl 4-hydroxylase 10      52.4    6e-05   
ref|XP_004982729.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  52.4    6e-05   
gb|EMS46596.1|  Prolyl 4-hydroxylase subunit alpha-2                  52.0    6e-05   
ref|XP_010266056.1|  PREDICTED: probable prolyl 4-hydroxylase 3       52.0    6e-05   
ref|NP_001131953.1|  uncharacterized protein LOC100193348             52.0    7e-05   Zea mays [maize]
ref|XP_002467008.1|  hypothetical protein SORBIDRAFT_01g018200        52.0    7e-05   Sorghum bicolor [broomcorn]
tpg|DAA49456.1|  TPA: hypothetical protein ZEAMMB73_536273            52.0    8e-05   
ref|XP_003603827.1|  Prolyl 4-hydroxylase alpha-2 subunit             51.6    8e-05   
dbj|BAJ85763.1|  predicted protein                                    51.6    1e-04   
ref|XP_006467024.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  51.2    1e-04   
gb|KDO71350.1|  hypothetical protein CISIN_1g023009mg                 51.2    1e-04   
ref|XP_006661912.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  50.4    1e-04   
gb|KDO71358.1|  hypothetical protein CISIN_1g023009mg                 49.7    2e-04   
ref|XP_006425365.1|  hypothetical protein CICLE_v10026208mg           50.4    2e-04   
gb|EEE51215.1|  hypothetical protein OsJ_32038                        50.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ACU17088.1|  unknown                                               50.1    2e-04   Glycine max [soybeans]
gb|KDO71354.1|  hypothetical protein CISIN_1g023009mg                 50.4    2e-04   
gb|AAL58274.1|AC068923_16  putative prolyl 4-hydroxylase, alpha s...  50.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006386160.1|  hypothetical protein POPTR_0002s01820g           50.8    2e-04   
ref|XP_003574128.1|  PREDICTED: probable prolyl 4-hydroxylase 3       50.8    2e-04   
ref|XP_004134841.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  50.8    2e-04   
ref|NP_001064962.1|  Os10g0497800                                     50.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004158845.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  50.8    2e-04   
emb|CDP15792.1|  unnamed protein product                              50.4    2e-04   
gb|KHN35999.1|  Prolyl 4-hydroxylase subunit alpha-1                  50.4    2e-04   
ref|XP_003612250.1|  Prolyl 4-hydroxylase alpha-2 subunit             49.7    3e-04   
ref|XP_008440878.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  50.1    3e-04   
ref|NP_001242522.1|  uncharacterized protein LOC100806046             50.1    3e-04   
gb|EMT09490.1|  Prolyl 4-hydroxylase subunit alpha-1                  50.1    3e-04   
ref|XP_010266057.1|  PREDICTED: probable prolyl 4-hydroxylase 10      50.1    3e-04   
ref|XP_009363441.1|  PREDICTED: probable prolyl 4-hydroxylase 10      50.1    3e-04   
gb|KDO71357.1|  hypothetical protein CISIN_1g023009mg                 49.3    3e-04   
ref|XP_007046593.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...  50.1    3e-04   
ref|XP_007046594.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...  50.1    3e-04   
ref|XP_002263060.1|  PREDICTED: probable prolyl 4-hydroxylase 10      50.1    4e-04   Vitis vinifera
emb|CAN64470.1|  hypothetical protein VITISV_014644                   49.7    4e-04   Vitis vinifera
ref|XP_007157869.1|  hypothetical protein PHAVU_002G104900g           49.7    4e-04   
ref|XP_008778312.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  49.7    5e-04   
ref|XP_003538892.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1  49.7    5e-04   
ref|XP_008778322.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...  49.7    5e-04   
ref|XP_009337076.1|  PREDICTED: probable prolyl 4-hydroxylase 10      49.3    5e-04   
ref|XP_009394475.1|  PREDICTED: probable prolyl 4-hydroxylase 3       49.3    5e-04   
gb|KHN18012.1|  hypothetical protein glysoja_041646                   47.0    5e-04   
ref|XP_007136121.1|  hypothetical protein PHAVU_009G019600g           49.3    6e-04   
ref|XP_003612249.1|  Prolyl 4-hydroxylase alpha-2 subunit             49.3    6e-04   
ref|XP_006425362.1|  hypothetical protein CICLE_v10026208mg           49.3    6e-04   
gb|KDO71356.1|  hypothetical protein CISIN_1g023009mg                 48.9    6e-04   
ref|XP_002530636.1|  prolyl 4-hydroxylase alpha subunit, putative     48.9    7e-04   Ricinus communis
ref|XP_006467023.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  48.9    8e-04   
gb|KDO71351.1|  hypothetical protein CISIN_1g023009mg                 48.9    8e-04   
ref|XP_006425363.1|  hypothetical protein CICLE_v10026208mg           48.9    8e-04   
ref|XP_006577957.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  48.5    0.001   
ref|XP_006577956.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...  48.5    0.001   
ref|XP_009801759.1|  PREDICTED: probable prolyl 4-hydroxylase 10      48.5    0.001   



>gb|EYU36811.1| hypothetical protein MIMGU_mgv1a011044mg [Erythranthe guttata]
Length=294

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 87/130 (67%), Gaps = 30/130 (23%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK RGSRHQG+R+ST+ LVLSMLLMLT+VLLMLL LGI++LP+GSD++ S I  RI+ K
Sbjct  1    MAKGRGSRHQGKRSSTVVLVLSMLLMLTIVLLMLLGLGIVSLPVGSDEDSSPIGERIKLK  60

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            R+++D+ G                                E DG G+RG+QWTE+LSWEP
Sbjct  61   RLTIDIKG------------------------------ESEGDGLGERGDQWTEVLSWEP  90

Query  30   RAFVYHNFLS  1
            RAFVYHNFLS
Sbjct  91   RAFVYHNFLS  100



>ref|XP_009620049.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana tomentosiformis]
Length=291

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 86/130 (66%), Gaps = 33/130 (25%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK R +RHQG+R+ST+ LVLSMLLMLT+VLLMLLALGI NLP+GSDDEPSS    I+FK
Sbjct  1    MAKGRLNRHQGKRSSTVVLVLSMLLMLTVVLLMLLALGIFNLPVGSDDEPSSAHDHIKFK  60

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            R+SLD+                                  E DG G+RG+QWTEILSWEP
Sbjct  61   RLSLDIG---------------------------------EGDGLGERGDQWTEILSWEP  87

Query  30   RAFVYHNFLS  1
            RAFVYHNFLS
Sbjct  88   RAFVYHNFLS  97



>ref|XP_009798871.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana sylvestris]
 ref|XP_009798872.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana sylvestris]
Length=291

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 86/130 (66%), Gaps = 33/130 (25%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK R +R+QG+R+ST+ LVLSMLLMLT+VLLMLLALGI NLP+GSDDEPSS    I+FK
Sbjct  1    MAKGRLNRNQGKRSSTVVLVLSMLLMLTVVLLMLLALGIFNLPVGSDDEPSSAHDHIKFK  60

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            R+SLD+                                  E DG GKRG+QWTEILSWEP
Sbjct  61   RLSLDIG---------------------------------EGDGLGKRGDQWTEILSWEP  87

Query  30   RAFVYHNFLS  1
            RAFVYHNFLS
Sbjct  88   RAFVYHNFLS  97



>ref|XP_004238387.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Solanum lycopersicum]
Length=292

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 86/131 (66%), Gaps = 34/131 (26%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSS-IRSRIRF  214
            MAK R +RHQG+R+ST+ LVLSMLLMLT+VLLMLLALGI NLP+GSDDE SS ++  I+F
Sbjct  1    MAKGRLNRHQGKRSSTVVLVLSMLLMLTVVLLMLLALGIFNLPVGSDDESSSTVQDHIKF  60

Query  213  KRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWE  34
            KR +LD+                                  E DG GKRGEQWTEILSWE
Sbjct  61   KRFNLDIG---------------------------------EGDGLGKRGEQWTEILSWE  87

Query  33   PRAFVYHNFLS  1
            PRAFVYHNFLS
Sbjct  88   PRAFVYHNFLS  98



>ref|XP_006342080.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=292

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 85/131 (65%), Gaps = 34/131 (26%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSI-RSRIRF  214
            MAK R +RHQG+R+ST+ LVLSMLLMLT+VLLMLLALGI NLP+GSDDE SS  +  I+F
Sbjct  1    MAKGRLNRHQGKRSSTVVLVLSMLLMLTVVLLMLLALGIFNLPVGSDDESSSTAQDHIKF  60

Query  213  KRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWE  34
            KR +LD+                                  E DG GKRGEQWTEILSWE
Sbjct  61   KRFNLDIG---------------------------------EGDGLGKRGEQWTEILSWE  87

Query  33   PRAFVYHNFLS  1
            PRAFVYHNFLS
Sbjct  88   PRAFVYHNFLS  98



>emb|CDP07346.1| unnamed protein product [Coffea canephora]
Length=293

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 85/132 (64%), Gaps = 35/132 (27%)
 Frame = -2

Query  390  MAKPRGSR--HQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIR  217
            MAK R SR  H G+RTST++LVLSMLLMLT+VLLMLLALGI +LP+GSDD P  +  RI+
Sbjct  1    MAKGRFSRQQHPGKRTSTVALVLSMLLMLTIVLLMLLALGIFSLPLGSDDGPYPVYDRIK  60

Query  216  FKRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSW  37
            FKR++LD+                                  E +G GKRGEQWTE+LSW
Sbjct  61   FKRVALDIG---------------------------------EGEGLGKRGEQWTEVLSW  87

Query  36   EPRAFVYHNFLS  1
            EPRAF+YHNFLS
Sbjct  88   EPRAFIYHNFLS  99



>ref|XP_011083428.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083429.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083430.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083431.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
Length=292

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 87/130 (67%), Gaps = 32/130 (25%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK RG+RHQG+R+S++ LVLSMLLMLT+VLLMLL LGIL+LPIGSD++ S I SRI+ K
Sbjct  1    MAKWRGNRHQGKRSSSVVLVLSMLLMLTIVLLMLLGLGILSLPIGSDEDYSPIASRIKLK  60

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            RM LDV                                + E +G GKRG+QWTEILSWEP
Sbjct  61   RMRLDV--------------------------------KSEGEGLGKRGDQWTEILSWEP  88

Query  30   RAFVYHNFLS  1
            RAF+YHNFLS
Sbjct  89   RAFLYHNFLS  98



>ref|XP_011074717.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011074718.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
Length=289

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 84/130 (65%), Gaps = 32/130 (25%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK RG+RHQG+R+ST+ LVLSMLLMLT+VLL+LL LGIL+LPIG +++   I  RI+ K
Sbjct  1    MAKGRGNRHQGKRSSTVVLVLSMLLMLTIVLLLLLGLGILSLPIGFNEDSLPIGDRIKLK  60

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            R+++D+                                + E +G G+R EQWTE+LSWEP
Sbjct  61   RLTIDI--------------------------------KDEGEGLGERREQWTEVLSWEP  88

Query  30   RAFVYHNFLS  1
            RAF+YHNFLS
Sbjct  89   RAFLYHNFLS  98



>gb|EYU17560.1| hypothetical protein MIMGU_mgv1a0210092mg, partial [Erythranthe 
guttata]
Length=89

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 70/129 (54%), Gaps = 40/129 (31%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK  G RHQG+R ST+   L MLLMLT++LL+LL +GI ++PIGSD++ S I   ++ K
Sbjct  1    MAKWSGRRHQGKRFSTVVSALFMLLMLTVMLLILLGIGIFSIPIGSDEDSSPIGDPVKMK  60

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            R++L                                          K GEQWTE+LSWEP
Sbjct  61   RVTLPT----------------------------------------KSGEQWTEVLSWEP  80

Query  30   RAFVYHNFL  4
            RAF+YHNFL
Sbjct  81   RAFLYHNFL  89



>gb|EPS68098.1| hypothetical protein M569_06675 [Genlisea aurea]
Length=283

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 79/130 (61%), Gaps = 38/130 (29%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK RG+RHQG+R+ST+ LVL MLLMLT+VLLMLL LG+L+LPIG DD  + I   IR K
Sbjct  1    MAK-RGNRHQGKRSSTVGLVLVMLLMLTVVLLMLLGLGVLSLPIGFDD--AQIGDSIRLK  57

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            R+ LDV  S                                    G+RG+QWTEI+SWEP
Sbjct  58   RLKLDVSKSR-----------------------------------GERGQQWTEIISWEP  82

Query  30   RAFVYHNFLS  1
            RAFVYHNFLS
Sbjct  83   RAFVYHNFLS  92



>ref|XP_010536435.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Tarenaya hassleriana]
Length=289

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 72/129 (56%), Gaps = 36/129 (28%)
 Frame = -2

Query  387  AKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFKR  208
            AK R SR   R+ ST+ LVLSML ML++V +MLL LGI ++P+ +DDE S+I     ++R
Sbjct  3    AKLRHSRFHARKLSTLMLVLSMLFMLSVVFVMLLTLGIFSIPV-NDDESSTIDLSTSYRR  61

Query  207  MSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEPR  28
            M+ +                                     +G GKRGEQWTE+LSWEPR
Sbjct  62   MAAE-----------------------------------RGEGLGKRGEQWTEVLSWEPR  86

Query  27   AFVYHNFLS  1
            AFVYHNFLS
Sbjct  87   AFVYHNFLS  95



>ref|XP_010266054.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
 ref|XP_010266055.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=289

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 71/130 (55%), Gaps = 35/130 (27%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAKPR  R   +R+ + +LVL MLLMLT VLL+LLALGI +LPI ++D P +        
Sbjct  1    MAKPRHHRPSSKRSPSFTLVLVMLLMLTFVLLVLLALGIFSLPINTNDAPKAN-------  53

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
                D+       AY                          D GFG+RGEQWTE++SWEP
Sbjct  54   ----DLSSFVRKSAYR------------------------NDGGFGERGEQWTEVISWEP  85

Query  30   RAFVYHNFLS  1
            RAFVYHNFLS
Sbjct  86   RAFVYHNFLS  95



>ref|XP_002510597.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
 gb|EEF52784.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
Length=289

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 73/130 (56%), Gaps = 35/130 (27%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK R SR Q R+ ST++LV SML MLT+VLLMLLALGI +LP+ +DD P +        
Sbjct  1    MAKMRHSRLQARKMSTLTLVFSMLFMLTVVLLMLLALGIFSLPMSTDDSPPN--------  52

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
                D+  S+   A   D                        DG GKR EQWTEI+SWEP
Sbjct  53   ----DLAASYRRMAAERDY-----------------------DGLGKRVEQWTEIISWEP  85

Query  30   RAFVYHNFLS  1
            RAFVYHNFLS
Sbjct  86   RAFVYHNFLS  95



>ref|XP_010266900.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=289

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 72/130 (55%), Gaps = 35/130 (27%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAKPR  R   +R+ST +L L+MLLMLT VLLMLLALGI +LP+ S+D   +        
Sbjct  1    MAKPRPFRTPNKRSSTYTLALAMLLMLTFVLLMLLALGIFSLPVSSNDTSKA-------N  53

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
             +S  V+ + H                              D GFG+RGEQWTE+LSWEP
Sbjct  54   DLSSFVHRTVH----------------------------RNDGGFGERGEQWTEVLSWEP  85

Query  30   RAFVYHNFLS  1
            RAF+YH FLS
Sbjct  86   RAFIYHTFLS  95



>ref|XP_008809398.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=289

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 72/130 (55%), Gaps = 41/130 (32%)
 Frame = -2

Query  378  RGSRHQ----GRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            RG+RH     GRR+S  +L+L+ LLML++VLLMLLALGI +LP+ S+D P S   R+   
Sbjct  3    RGARHNRVLSGRRSSPYTLILAALLMLSVVLLMLLALGIFSLPVNSNDAPKSKADRVS--  60

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
                      HI                            E +G G+RGEQWTE+LSWEP
Sbjct  61   ----------HISVR-------------------------ETNGMGQRGEQWTEVLSWEP  85

Query  30   RAFVYHNFLS  1
            RAF+YHNFLS
Sbjct  86   RAFIYHNFLS  95



>ref|XP_008809399.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X3 [Phoenix 
dactylifera]
Length=267

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 72/130 (55%), Gaps = 40/130 (31%)
 Frame = -2

Query  378  RGSRHQ----GRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            RG+RH     GRR+S  +L+L+ LLML++VLLMLLALGI +LP+ S+D P S   R+   
Sbjct  3    RGARHNRVLSGRRSSPYTLILAALLMLSVVLLMLLALGIFSLPVNSNDAPKSKADRVS--  60

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
                      HI                          R   +G G+RGEQWTE+LSWEP
Sbjct  61   ----------HIS------------------------VRETRNGMGQRGEQWTEVLSWEP  86

Query  30   RAFVYHNFLS  1
            RAF+YHNFLS
Sbjct  87   RAFIYHNFLS  96



>ref|XP_006305481.1| hypothetical protein CARUB_v10009921mg [Capsella rubella]
 gb|EOA38379.1| hypothetical protein CARUB_v10009921mg [Capsella rubella]
Length=287

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 71/130 (55%), Gaps = 37/130 (28%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK R SR Q R+ ST+ LVL ML MLT+VLLMLLA G+ +LPI +D+  SS      F+
Sbjct  1    MAKVRQSRFQARKWSTLMLVLFMLFMLTIVLLMLLAFGVFSLPINNDE--SSPMDLSYFR  58

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            R + +                                     +G GKRG+QWTE+LSWEP
Sbjct  59   RAATE-----------------------------------RSEGLGKRGDQWTEVLSWEP  83

Query  30   RAFVYHNFLS  1
            RAFVYHNFLS
Sbjct  84   RAFVYHNFLS  93



>ref|XP_008809395.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008809396.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008809397.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=290

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 72/130 (55%), Gaps = 40/130 (31%)
 Frame = -2

Query  378  RGSRHQ----GRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            RG+RH     GRR+S  +L+L+ LLML++VLLMLLALGI +LP+ S+D P S   R+   
Sbjct  3    RGARHNRVLSGRRSSPYTLILAALLMLSVVLLMLLALGIFSLPVNSNDAPKSKADRVS--  60

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
                      HI                          R   +G G+RGEQWTE+LSWEP
Sbjct  61   ----------HISV------------------------RETRNGMGQRGEQWTEVLSWEP  86

Query  30   RAFVYHNFLS  1
            RAF+YHNFLS
Sbjct  87   RAFIYHNFLS  96



>ref|XP_010539828.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539829.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539830.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
Length=288

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 74/130 (57%), Gaps = 36/130 (28%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK R SR + R+ ST  LVLSML ML++VLLMLLALGI +LP+ +DDE SSI     ++
Sbjct  1    MAKTRPSRLRARKLSTSMLVLSMLFMLSVVLLMLLALGIFSLPV-NDDESSSIYLSTSYR  59

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            RM+ +                                     +G  KRGEQ+TE+LSWEP
Sbjct  60   RMAAE-----------------------------------RGEGIEKRGEQYTEVLSWEP  84

Query  30   RAFVYHNFLS  1
            RAFVYHNFLS
Sbjct  85   RAFVYHNFLS  94



>ref|XP_009149624.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brassica rapa]
Length=237

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  87  DDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           ++G GKRG+QWTE+LSWEPRAFVYHNFLS
Sbjct  69  EEGLGKRGDQWTEVLSWEPRAFVYHNFLS  97



>ref|XP_004151664.1| PREDICTED: uncharacterized protein LOC101218099, partial [Cucumis 
sativus]
Length=122

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  87  DDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            DG GKRG+QW E +SWEPRAFVYHNFLS
Sbjct  63  SDGLGKRGDQWVEFISWEPRAFVYHNFLS  91



>gb|AAM61711.1| putative prolyl 4-hydroxylase, alpha subunit [Arabidopsis thaliana]
Length=287

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 71/130 (55%), Gaps = 37/130 (28%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK R SR Q R+ ST+ LVL ML MLT+VLLMLLA G+ +LPI +D+  SS      F+
Sbjct  1    MAKLRHSRFQARKWSTLMLVLFMLFMLTIVLLMLLAFGVFSLPINNDE--SSPIDLSYFR  58

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            R + +                                     +G GKRG+QWTE+LSWEP
Sbjct  59   RAATE-----------------------------------RSEGLGKRGDQWTEVLSWEP  83

Query  30   RAFVYHNFLS  1
            RAFVYHNFLS
Sbjct  84   RAFVYHNFLS  93



>ref|NP_564109.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
 sp|Q9LN20.1|P4H3_ARATH RecName: Full=Probable prolyl 4-hydroxylase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF88161.1|AC026234_12 Contains similarity to a prolyl 4-hydroxylase alpha subunit protein 
from Gallus gallus gi|212530 [Arabidopsis thaliana]
 gb|ABE02413.1| At1g20270 [Arabidopsis thaliana]
 gb|AEE29956.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=287

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 71/130 (55%), Gaps = 37/130 (28%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK R SR Q R+ ST+ LVL ML MLT+VLLMLLA G+ +LPI +D+  SS      F+
Sbjct  1    MAKLRHSRFQARKWSTLMLVLFMLFMLTIVLLMLLAFGVFSLPINNDE--SSPIDLSYFR  58

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            R + +                                     +G GKRG+QWTE+LSWEP
Sbjct  59   RAATE-----------------------------------RSEGLGKRGDQWTEVLSWEP  83

Query  30   RAFVYHNFLS  1
            RAFVYHNFLS
Sbjct  84   RAFVYHNFLS  93



>emb|CDY51328.1| BnaCnng20650D [Brassica napus]
Length=291

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  87  DDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           ++G GKRG+QWTE+LSWEPRAFVYHNFLS
Sbjct  69  EEGLGKRGDQWTEVLSWEPRAFVYHNFLS  97



>emb|CDY29362.1| BnaA06g14340D [Brassica napus]
Length=291

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  87  DDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           ++G GKRG+QWTE+LSWEPRAFVYHNFLS
Sbjct  69  EEGLGKRGDQWTEVLSWEPRAFVYHNFLS  97



>ref|XP_002893096.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69355.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=287

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 71/130 (55%), Gaps = 37/130 (28%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK R SR Q R+ ST+ LVL ML MLT+VLLMLLA G+ +LPI +D+  SS      F+
Sbjct  1    MAKLRHSRFQARKWSTLMLVLFMLFMLTIVLLMLLAFGVFSLPINNDE--SSPIDLSYFR  58

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            R + +                                     +G GKRG+QWTE+LSWEP
Sbjct  59   RAATE-----------------------------------RSEGLGKRGDQWTEVLSWEP  83

Query  30   RAFVYHNFLS  1
            RAFVYHNFLS
Sbjct  84   RAFVYHNFLS  93



>gb|KHG14293.1| Prolyl 4-hydroxylase subunit alpha-2 [Gossypium arboreum]
Length=287

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  81  GFGKRGEQWTEILSWEPRAFVYHNFLS  1
           G GKRGEQWTE+LSWEPRAF+YHNFLS
Sbjct  67  GLGKRGEQWTEVLSWEPRAFIYHNFLS  93



>ref|XP_009386075.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009386076.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=288

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 68/130 (52%), Gaps = 42/130 (32%)
 Frame = -2

Query  378  RGSRHQ----GRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            RG+RH     GRR+S  +L+L+ LL  ++VLLMLLALGI +LP+ SD  P          
Sbjct  3    RGARHPRKLPGRRSSPFTLILAALLTASVVLLMLLALGIFSLPVNSDGPP----------  52

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            ++    + S H                               DG G+RG+QWTE+LSWEP
Sbjct  53   KLDHRPHRSIHEMR----------------------------DGMGERGDQWTEVLSWEP  84

Query  30   RAFVYHNFLS  1
            RAF+YHNFLS
Sbjct  85   RAFIYHNFLS  94



>ref|XP_009392830.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392831.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=301

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            DG G+RG+QWTE++SWEPRAFVYHNFLS
Sbjct  80   DGLGQRGQQWTEVISWEPRAFVYHNFLS  107



>ref|XP_008387906.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Malus domestica]
 ref|XP_008350487.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Malus domestica]
Length=286

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG G RGEQWTE++SWEPRAF+YHNFLS
Sbjct  65  DGLGNRGEQWTEVISWEPRAFIYHNFLS  92



>ref|XP_008802369.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802377.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802385.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=306

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 45/93 (48%), Gaps = 28/93 (30%)
 Frame = -2

Query  279  GILNLPIGSDDEPSSIRSRIRFKRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*  100
            GI +LP+ S+  P  +  R R  R   +   ++                     + DG  
Sbjct  48   GIFSLPVPSNSAPEGVDIRQRHDRSVFEATTTY---------------------LGDG--  84

Query  99   CRVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
                 +G GKRG QWTE++SWEPRAF+YHNFLS
Sbjct  85   -----NGLGKRGVQWTEVVSWEPRAFIYHNFLS  112



>ref|XP_009334602.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Pyrus x bretschneideri]
Length=287

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG G RGEQWTE++SWEPRAF+YHNFLS
Sbjct  66  DGLGNRGEQWTEVISWEPRAFIYHNFLS  93



>ref|XP_008387904.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Malus domestica]
 ref|XP_008350486.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Malus domestica]
Length=291

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG G RGEQWTE++SWEPRAF+YHNFLS
Sbjct  70  DGLGNRGEQWTEVISWEPRAFIYHNFLS  97



>ref|XP_002285898.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 ref|XP_010664132.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 ref|XP_010664133.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 emb|CBI18919.3| unnamed protein product [Vitis vinifera]
Length=288

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +G GKRGEQWTEI+SWEPRAF+YHNFLS
Sbjct  67  EGLGKRGEQWTEIVSWEPRAFIYHNFLS  94



>gb|KCW68010.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
Length=235

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            DG G+RGEQWTE+LSWEPRAF+YH FLS
Sbjct  100  DGLGQRGEQWTEVLSWEPRAFIYHGFLS  127



>ref|XP_008347372.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Malus domestica]
Length=167

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG G R EQWTE++SWEPRAFVYHNFLS
Sbjct  66  DGLGNRVEQWTEVISWEPRAFVYHNFLS  93



>ref|XP_002307750.2| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE94746.2| oxidoreductase family protein [Populus trichocarpa]
Length=288

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG GKR EQWTEILSWEPRAF+YHNFLS
Sbjct  67  DGMGKREEQWTEILSWEPRAFLYHNFLS  94



>ref|XP_011003088.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Populus euphratica]
 ref|XP_011003089.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Populus euphratica]
Length=288

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG GKR EQWTEILSWEPRAF+YHNFLS
Sbjct  67  DGMGKREEQWTEILSWEPRAFLYHNFLS  94



>ref|XP_010918438.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Elaeis 
guineensis]
Length=289

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  90  EDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           E +G G+RGEQWTE+LSWEPRAF+YH+FLS
Sbjct  66  ETNGMGQRGEQWTEVLSWEPRAFIYHHFLS  95



>ref|XP_010480555.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=272

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +G G RG+QWTE+LSWEPRAFVYHNFLS
Sbjct  70  EGLGTRGDQWTEVLSWEPRAFVYHNFLS  97



>ref|NP_001241692.1| prolyl 4-hydroxylase 8-2 [Zea mays]
 gb|AEP37759.1| prolyl 4-hydroxylase 8-2 [Zea mays]
Length=184

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  86   EGLGERGAQWTEVISWEPRAFVYHNFLS  113



>ref|XP_007017904.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 3 [Theobroma cacao]
 gb|EOY15129.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 3 [Theobroma cacao]
Length=284

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  78  FGKRGEQWTEILSWEPRAFVYHNFLS  1
            GKRGEQWTE+LSWEPRAF+YHNFLS
Sbjct  68  LGKRGEQWTEVLSWEPRAFIYHNFLS  93



>ref|XP_008456388.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Cucumis melo]
Length=284

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  90  EDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           + DG GKRG+QW E +SWEPRAFVYHNFLS
Sbjct  62  QSDGLGKRGDQWVEFISWEPRAFVYHNFLS  91



>gb|KDO75956.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=164

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 71/134 (53%), Gaps = 44/134 (33%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEP----SSIRSR  223
            M K R SR Q ++ ST++LVLSML MLT+VLLMLLA+GI  +PIG DD P    +S R R
Sbjct  1    MVKLRHSRLQAKKWSTLTLVLSMLFMLTIVLLMLLAMGIFYIPIGDDDSPPNDLTSFRRR  60

Query  222  IRFKRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEIL  43
               KR S+                                          ++GEQWTEI+
Sbjct  61   AFEKRSSIA----------------------------------------EEKGEQWTEIV  80

Query  42   SWEPRAFVYHNFLS  1
            +WEPRAFVYHNFLS
Sbjct  81   AWEPRAFVYHNFLS  94



>ref|XP_007017903.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY15128.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
Length=260

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  78  FGKRGEQWTEILSWEPRAFVYHNFLS  1
            GKRGEQWTE+LSWEPRAF+YHNFLS
Sbjct  68  LGKRGEQWTEVLSWEPRAFIYHNFLS  93



>ref|XP_010498461.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010498463.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=292

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +G G RG+QWTE+LSWEPRAFVYHNFLS
Sbjct  71  EGLGTRGDQWTEVLSWEPRAFVYHNFLS  98



>ref|XP_008456383.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Cucumis melo]
Length=290

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  90  EDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           + DG GKRG+QW E +SWEPRAFVYHNFLS
Sbjct  62  QSDGLGKRGDQWVEFISWEPRAFVYHNFLS  91



>ref|XP_010459709.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010459710.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=292

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +G G RG+QWTE+LSWEPRAFVYHNFLS
Sbjct  71  EGLGTRGDQWTEVLSWEPRAFVYHNFLS  98



>ref|XP_010061109.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Eucalyptus grandis]
 ref|XP_010061110.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Eucalyptus grandis]
 gb|KCW68007.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
 gb|KCW68008.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
 gb|KCW68009.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
Length=321

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            DG G+RGEQWTE+LSWEPRAF+YH FLS
Sbjct  100  DGLGQRGEQWTEVLSWEPRAFIYHGFLS  127



>ref|XP_010477260.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010477261.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=291

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +G G RG+QWTE+LSWEPRAFVYHNFLS
Sbjct  70  EGLGTRGDQWTEVLSWEPRAFVYHNFLS  97



>ref|XP_007017902.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY15127.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
Length=287

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  78  FGKRGEQWTEILSWEPRAFVYHNFLS  1
            GKRGEQWTE+LSWEPRAF+YHNFLS
Sbjct  68  LGKRGEQWTEVLSWEPRAFIYHNFLS  93



>ref|XP_010100124.1| Prolyl 4-hydroxylase subunit alpha-2 [Morus notabilis]
 gb|EXB81507.1| Prolyl 4-hydroxylase subunit alpha-2 [Morus notabilis]
Length=287

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 72/130 (55%), Gaps = 37/130 (28%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK R +R  GR+ ST +LV S+L ML++VLLMLLALGI++LP+ SDD P +  S  R +
Sbjct  1    MAKGRYTRLHGRKWSTFTLVFSILFMLSVVLLMLLALGIVSLPVSSDDSPPNDLSSFRRR  60

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
                                          ++E G       D  GKR EQWTE+LSWEP
Sbjct  61   ------------------------------IVERG-------DELGKREEQWTEVLSWEP  83

Query  30   RAFVYHNFLS  1
            RAF+YHN LS
Sbjct  84   RAFIYHNVLS  93



>gb|KDO75955.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=202

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 71/134 (53%), Gaps = 44/134 (33%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEP----SSIRSR  223
            M K R SR Q ++ ST++LVLSML MLT+VLLMLLA+GI  +PIG DD P    +S R R
Sbjct  1    MVKLRHSRLQAKKWSTLTLVLSMLFMLTIVLLMLLAMGIFYIPIGDDDSPPNDLTSFRRR  60

Query  222  IRFKRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEIL  43
               KR S+                                          ++GEQWTEI+
Sbjct  61   AFEKRSSIA----------------------------------------EEKGEQWTEIV  80

Query  42   SWEPRAFVYHNFLS  1
            +WEPRAFVYHNFLS
Sbjct  81   AWEPRAFVYHNFLS  94



>ref|XP_008456352.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
 ref|XP_008456362.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
 ref|XP_008456370.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
Length=284

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG GKRG+QW E +SWEPRAFVYHNFLS
Sbjct  64  DGLGKRGDQWVEFISWEPRAFVYHNFLS  91



>ref|XP_004167095.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=249

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG GKRG+QW E +SWEPRAFVYHNFLS
Sbjct  29  DGLGKRGDQWVEFISWEPRAFVYHNFLS  56



>gb|KGN60775.1| hypothetical protein Csa_2G009620 [Cucumis sativus]
Length=259

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG GKRG+QW E +SWEPRAFVYHNFLS
Sbjct  39  DGLGKRGDQWVEFISWEPRAFVYHNFLS  66



>ref|XP_004139389.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=284

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG GKRG+QW E +SWEPRAFVYHNFLS
Sbjct  64  DGLGKRGDQWVEFISWEPRAFVYHNFLS  91



>ref|XP_010935631.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Elaeis guineensis]
Length=297

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G GKRG QWTE++SWEPRAF+YHNFLS
Sbjct  76   NGLGKRGPQWTEVVSWEPRAFIYHNFLS  103



>ref|XP_008802391.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=303

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 43/93 (46%), Gaps = 31/93 (33%)
 Frame = -2

Query  279  GILNLPIGSDDEPSSIRSRIRFKRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*  100
            GI +LP+ S+  P  +  R R  R   +   +                        DG  
Sbjct  48   GIFSLPVPSNSAPEGVDIRQRHDRSVFEATTT------------------------DG--  81

Query  99   CRVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
                 +G GKRG QWTE++SWEPRAF+YHNFLS
Sbjct  82   -----NGLGKRGVQWTEVVSWEPRAFIYHNFLS  109



>ref|XP_004171765.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=284

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG GKRG+QW E +SWEPRAFVYHNFLS
Sbjct  64  DGLGKRGDQWVEFISWEPRAFVYHNFLS  91



>ref|XP_007223346.1| hypothetical protein PRUPE_ppa009548mg [Prunus persica]
 gb|EMJ24545.1| hypothetical protein PRUPE_ppa009548mg [Prunus persica]
Length=287

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DGFG+R +QWTE++SWEPRAF+YHNFLS
Sbjct  66  DGFGEREDQWTEVISWEPRAFIYHNFLS  93



>gb|AFW63914.1| hypothetical protein ZEAMMB73_179176 [Zea mays]
Length=222

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  87   EGLGERGAQWTEVISWEPRAFVYHNFLS  114



>ref|XP_010918436.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Elaeis 
guineensis]
 ref|XP_010918437.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Elaeis 
guineensis]
Length=290

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +G G+RGEQWTE+LSWEPRAF+YH+FLS
Sbjct  69  NGMGQRGEQWTEVLSWEPRAFIYHHFLS  96



>gb|KDP36874.1| hypothetical protein JCGZ_08165 [Jatropha curcas]
Length=289

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 76/130 (58%), Gaps = 35/130 (27%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK R SR Q R+ STM+L+L+ML MLT+VLLMLLALGI +LPI ++D  + I     ++
Sbjct  1    MAKVRHSRFQARKWSTMTLILTMLFMLTVVLLMLLALGIFSLPISNEDS-TPIDLTTSYR  59

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            RM+++                            DG       DG  KR EQWTEI+SWEP
Sbjct  60   RMTVE---------------------------RDG-------DGQEKREEQWTEIVSWEP  85

Query  30   RAFVYHNFLS  1
            RAF+YHNFLS
Sbjct  86   RAFLYHNFLS  95



>gb|EEE58093.1| hypothetical protein OsJ_08962 [Oryza sativa Japonica Group]
Length=387

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  89   EGLGERGAQWTEVISWEPRAFVYHNFLS  116



>gb|EEC74283.1| hypothetical protein OsI_09531 [Oryza sativa Indica Group]
Length=376

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  89   EGLGERGAQWTEVISWEPRAFVYHNFLS  116



>ref|XP_008377129.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Malus domestica]
Length=287

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG G R EQWTE++SWEPRAFVYHNFLS
Sbjct  66  DGLGNRVEQWTEVISWEPRAFVYHNFLS  93



>ref|XP_003570489.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brachypodium distachyon]
Length=318

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  87   DDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
             +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  96   SEGLGERGAQWTEVISWEPRAFVYHNFLS  124



>dbj|BAD23054.1| putative prolyl 4-hydroxylase [Oryza sativa Japonica Group]
Length=310

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  89   EGLGERGAQWTEVISWEPRAFVYHNFLS  116



>ref|XP_009110235.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brassica rapa]
Length=290

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +G GKRG+QWTEILSWEPRAF+YH FLS
Sbjct  69  EGIGKRGDQWTEILSWEPRAFLYHGFLS  96



>emb|CDX96644.1| BnaA08g21870D [Brassica napus]
Length=290

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +G GKRG+QWTEILSWEPRAF+YH FLS
Sbjct  69  EGIGKRGDQWTEILSWEPRAFLYHGFLS  96



>emb|CDY54327.1| BnaCnng26730D [Brassica napus]
Length=290

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +G GKRG+QWTEILSWEPRAF+YH FLS
Sbjct  69  EGIGKRGDQWTEILSWEPRAFLYHGFLS  96



>dbj|BAK01841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=315

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  94   EGLGERGAQWTEVISWEPRAFVYHNFLS  121



>ref|XP_006648159.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Oryza brachyantha]
Length=306

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  85   EGLGERGAQWTEVISWEPRAFVYHNFLS  112



>ref|XP_004954469.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Setaria 
italica]
Length=311

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  90   EGLGERGAQWTEVISWEPRAFVYHNFLS  117



>ref|XP_002453082.1| hypothetical protein SORBIDRAFT_04g038020 [Sorghum bicolor]
 gb|EES06058.1| hypothetical protein SORBIDRAFT_04g038020 [Sorghum bicolor]
Length=307

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  86   EGLGERGAQWTEVISWEPRAFVYHNFLS  113



>ref|NP_001241694.1| prolyl 4-hydroxylase 8-4 [Zea mays]
 gb|AEP37761.1| prolyl 4-hydroxylase 8-4 [Zea mays]
Length=307

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  86   EGLGERGAQWTEVISWEPRAFVYHNFLS  113



>ref|NP_001159002.1| prolyl 4-hydroxylase alpha-2 subunit [Zea mays]
 ref|XP_008643888.1| PREDICTED: prolyl 4-hydroxylase alpha-2 subunit isoform X1 [Zea 
mays]
 gb|ACG35031.1| prolyl 4-hydroxylase alpha-2 subunit precursor [Zea mays]
 gb|AEP37757.1| prolyl 4-hydroxylase 8 [Zea mays]
 gb|AEP37758.1| prolyl 4-hydroxylase 8-1 [Zea mays]
 gb|AFW74120.1| prolyl 4-hydroxylase alpha-2 subunit isoform 1 [Zea mays]
 gb|AFW74121.1| prolyl 4-hydroxylase alpha-2 subunit isoform 2 [Zea mays]
 gb|AFW74122.1| prolyl 4-hydroxylase alpha-2 subunit isoform 3 [Zea mays]
 gb|AFW74123.1| prolyl 4-hydroxylase alpha-2 subunit isoform 4 [Zea mays]
Length=307

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  86   EGLGERGAQWTEVISWEPRAFVYHNFLS  113



>ref|NP_001241695.1| prolyl 4-hydroxylase 8-5 [Zea mays]
 gb|AEP37762.1| prolyl 4-hydroxylase 8-5 [Zea mays]
Length=307

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  86   EGLGERGAQWTEVISWEPRAFVYHNFLS  113



>ref|NP_001151238.1| LOC100284871 [Zea mays]
 ref|XP_008677412.1| PREDICTED: auxin-independent growth promoter protein isoform 
X1 [Zea mays]
 gb|ACG42089.1| prolyl 4-hydroxylase alpha-2 subunit precursor [Zea mays]
 gb|AEP37748.1| prolyl 4-hydroxylase 5 [Zea mays]
 gb|AFW63915.1| prolyl 4-hydroxylase alpha-2 subunit [Zea mays]
Length=308

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+RG QWTE++SWEPRAFVYHNFLS
Sbjct  87   EGLGERGAQWTEVISWEPRAFVYHNFLS  114



>ref|NP_001241693.1| prolyl 4-hydroxylase 8-3 [Zea mays]
 gb|AEP37760.1| prolyl 4-hydroxylase 8-3 [Zea mays]
Length=188

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFL  4
            +G G+RG QWTE++SWEPRAFVYHNFL
Sbjct  86   EGLGERGAQWTEVISWEPRAFVYHNFL  112



>gb|KDO75954.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=266

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 71/134 (53%), Gaps = 44/134 (33%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEP----SSIRSR  223
            M K R SR Q ++ ST++LVLSML MLT+VLLMLLA+GI  +PIG DD P    +S R R
Sbjct  1    MVKLRHSRLQAKKWSTLTLVLSMLFMLTIVLLMLLAMGIFYIPIGDDDSPPNDLTSFRRR  60

Query  222  IRFKRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEIL  43
               KR S+                                          ++GEQWTEI+
Sbjct  61   AFEKRSSI----------------------------------------AEEKGEQWTEIV  80

Query  42   SWEPRAFVYHNFLS  1
            +WEPRAFVYHNFLS
Sbjct  81   AWEPRAFVYHNFLS  94



>ref|XP_006449333.1| hypothetical protein CICLE_v10016152mg [Citrus clementina]
 ref|XP_006467805.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Citrus 
sinensis]
 gb|ESR62573.1| hypothetical protein CICLE_v10016152mg [Citrus clementina]
 gb|KDO75953.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=288

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 71/134 (53%), Gaps = 44/134 (33%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEP----SSIRSR  223
            M K R SR Q ++ ST++LVLSML MLT+VLLMLLA+GI  +PIG DD P    +S R R
Sbjct  1    MVKLRHSRLQAKKWSTLTLVLSMLFMLTIVLLMLLAMGIFYIPIGDDDSPPNDLTSFRRR  60

Query  222  IRFKRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEIL  43
               KR S+                                          ++GEQWTEI+
Sbjct  61   AFEKRSSIA----------------------------------------EEKGEQWTEIV  80

Query  42   SWEPRAFVYHNFLS  1
            +WEPRAFVYHNFLS
Sbjct  81   AWEPRAFVYHNFLS  94



>ref|XP_008221210.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 [Prunus mume]
Length=299

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            DG G+R +QWTE++SWEPRAF+YHNFLS
Sbjct  78   DGLGEREDQWTEVISWEPRAFIYHNFLS  105



>gb|EMS46850.1| hypothetical protein TRIUR3_31584 [Triticum urartu]
Length=184

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -2

Query  81   GFGKRGEQWTEILSWEPRAFVYHNFL  4
            G GKRG QW E++SWEPRAFVYHNFL
Sbjct  139  GLGKRGAQWMEVISWEPRAFVYHNFL  164



>ref|XP_010063298.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Eucalyptus grandis]
Length=227

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  81   GFGKRGEQWTEILSWEPRAFVYHNFLS  1
            G G+RG+QWT++LSWEPRAF+YHNFLS
Sbjct  93   GLGERGKQWTQVLSWEPRAFLYHNFLS  119



>gb|KCW70504.1| hypothetical protein EUGRSUZ_F03711 [Eucalyptus grandis]
Length=284

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  81  GFGKRGEQWTEILSWEPRAFVYHNFLS  1
           G G+RG+QWT++LSWEPRAF+YHNFLS
Sbjct  64  GLGERGKQWTQVLSWEPRAFLYHNFLS  90



>ref|XP_009388317.1| PREDICTED: probable prolyl 4-hydroxylase 3, partial [Musa acuminata 
subsp. malaccensis]
Length=149

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           D   + GEQWTE+LSWEPRAF+YHNFLS
Sbjct  58  DELQETGEQWTEVLSWEPRAFLYHNFLS  85



>ref|XP_004291329.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Fragaria 
vesca subsp. vesca]
Length=308

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 70/131 (53%), Gaps = 37/131 (28%)
 Frame = -2

Query  393  TMAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRF  214
            TMAK R  R +  + ST +LVLSML MLT+VLLML+A GI++LP  SDD P +  S  R 
Sbjct  21   TMAKGRYGRLRSSKWSTFTLVLSMLFMLTVVLLMLMAFGIVSLPESSDDSPPNDLSSFRR  80

Query  213  KRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWE  34
            +                              ++E         +G GKR  QWT+++SWE
Sbjct  81   R------------------------------IVE-------RSEGLGKRENQWTQVISWE  103

Query  33   PRAFVYHNFLS  1
            PRAF+YHNFLS
Sbjct  104  PRAFIYHNFLS  114



>ref|XP_009418644.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=301

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            +G G+ G QWTE++SWEPRAFVYHNFLS
Sbjct  80   EGLGQLGHQWTEVISWEPRAFVYHNFLS  107



>ref|XP_010266901.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Nelumbo 
nucifera]
Length=309

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 70/132 (53%), Gaps = 34/132 (26%)
 Frame = -2

Query  393  TMAK-PRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIR  217
            TMAK PR SR   RR+S+ +LV ++L+M + VL+ML  LG  + P+ +DD P S   R  
Sbjct  17   TMAKKPRSSRIPNRRSSSFTLVSAVLIMFSFVLVMLFVLGFFSPPVDTDDPPKSRDMR--  74

Query  216  FKRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSW  37
                           +++++T+     +                 G G+R EQWTE++SW
Sbjct  75   ---------------SFIHETVERNDAAV----------------GLGERREQWTEVISW  103

Query  36   EPRAFVYHNFLS  1
            EPRA +YHNFLS
Sbjct  104  EPRATLYHNFLS  115



>ref|XP_010266902.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Nelumbo 
nucifera]
Length=309

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 70/132 (53%), Gaps = 34/132 (26%)
 Frame = -2

Query  393  TMAK-PRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIR  217
            TMAK PR SR   RR+S+ +LV ++L+M + VL+ML  LG  + P+ +DD P S   R  
Sbjct  17   TMAKKPRSSRIPNRRSSSFTLVSAVLIMFSFVLVMLFVLGFFSPPVDTDDPPKSRDMR--  74

Query  216  FKRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSW  37
                           +++++T+     +                 G G+R EQWTE++SW
Sbjct  75   ---------------SFIHETVERNDAAV----------------GLGERREQWTEVISW  103

Query  36   EPRAFVYHNFLS  1
            EPRA +YHNFLS
Sbjct  104  EPRATLYHNFLS  115



>emb|CDM81384.1| unnamed protein product [Triticum aestivum]
Length=150

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  87   DDGFGKRGEQWTEILSWEPRAFVYHNFL  4
             +G GK G QW E++SWEPRAFVYHNFL
Sbjct  90   SEGLGKHGAQWMEVISWEPRAFVYHNFL  117



>tpg|DAA49454.1| TPA: hypothetical protein ZEAMMB73_536273 [Zea mays]
Length=222

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75   GKRGEQWTEILSWEPRAFVYHNFLS  1
            G++GE WTE+LSWEPRAFVYHNFLS
Sbjct  89   GEKGEPWTEVLSWEPRAFVYHNFLS  113



>gb|KHG08442.1| Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum]
Length=296

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 69/130 (53%), Gaps = 38/130 (29%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGSDDEPSSIRSRIRFK  211
            MAK R SR   ++  T++LVLS+L MLT+VLLMLL LGI +LP+ +DD  SS+     ++
Sbjct  1    MAKVRHSRFTAKKRLTVTLVLSILFMLTIVLLMLLGLGIFSLPMTTDD--SSLYDLTSYR  58

Query  210  RMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWEP  31
            RM+                                     E    G RGE+WT++LSWEP
Sbjct  59   RMA------------------------------------SERGRLGNRGEKWTQVLSWEP  82

Query  30   RAFVYHNFLS  1
            RA +YHNFLS
Sbjct  83   RASIYHNFLS  92



>ref|XP_010667434.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010667435.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010667436.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
Length=285

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -2

Query  81  GFGKRGEQWTEILSWEPRAFVYHNFLS  1
           G GKR EQW EILSWEPRAF+YH+FLS
Sbjct  65  GIGKRDEQWVEILSWEPRAFLYHHFLS  91



>ref|XP_009397948.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=288

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           D  G+ G+QWTE+LSWEPRAF+YHNFLS
Sbjct  67  DEMGQIGDQWTEMLSWEPRAFIYHNFLS  94



>ref|XP_010029633.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Eucalyptus grandis]
 gb|KCW56575.1| hypothetical protein EUGRSUZ_I02306 [Eucalyptus grandis]
Length=343

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75   GKRGEQWTEILSWEPRAFVYHNFLS  1
            G+RGEQW E++SWEPRAFVYHNFLS
Sbjct  125  GERGEQWVELISWEPRAFVYHNFLS  149



>ref|XP_004982729.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Setaria 
italica]
Length=308

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75   GKRGEQWTEILSWEPRAFVYHNFLS  1
            G++GE WTE+LSWEPRAFVYHNFLS
Sbjct  90   GEKGEPWTEVLSWEPRAFVYHNFLS  114



>gb|EMS46596.1| Prolyl 4-hydroxylase subunit alpha-2 [Triticum urartu]
Length=257

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75  GKRGEQWTEILSWEPRAFVYHNFLS  1
           G++GE WTE+LSWEPRAF+YHNFLS
Sbjct  14  GEKGEPWTEVLSWEPRAFIYHNFLS  38



>ref|XP_010266056.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=309

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 7/40 (18%)
 Frame = -2

Query  120  LIEDGF*CRVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            LI DG        G G+RG QWTE++SWEPRA +YHNFLS
Sbjct  83   LINDGV-------GLGERGLQWTEVISWEPRATLYHNFLS  115



>ref|NP_001131953.1| uncharacterized protein LOC100193348 [Zea mays]
 gb|ACF80592.1| unknown [Zea mays]
 gb|AEP37741.1| prolyl 4-hydroxylase 1 [Zea mays]
 tpg|DAA49455.1| TPA: hypothetical protein ZEAMMB73_536273 [Zea mays]
Length=307

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75   GKRGEQWTEILSWEPRAFVYHNFLS  1
            G++GE WTE+LSWEPRAFVYHNFLS
Sbjct  89   GEKGEPWTEVLSWEPRAFVYHNFLS  113



>ref|XP_002467008.1| hypothetical protein SORBIDRAFT_01g018200 [Sorghum bicolor]
 gb|EER94006.1| hypothetical protein SORBIDRAFT_01g018200 [Sorghum bicolor]
Length=307

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75   GKRGEQWTEILSWEPRAFVYHNFLS  1
            G++GE WTE+LSWEPRAFVYHNFLS
Sbjct  89   GEKGEPWTEVLSWEPRAFVYHNFLS  113



>tpg|DAA49456.1| TPA: hypothetical protein ZEAMMB73_536273 [Zea mays]
Length=364

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75   GKRGEQWTEILSWEPRAFVYHNFLS  1
            G++GE WTE+LSWEPRAFVYHNFLS
Sbjct  146  GEKGEPWTEVLSWEPRAFVYHNFLS  170



>ref|XP_003603827.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES74078.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=280

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +   ++ EQWTEILSWEPRAFVYHNFLS
Sbjct  59  ESLAEKKEQWTEILSWEPRAFVYHNFLS  86



>dbj|BAJ85763.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75   GKRGEQWTEILSWEPRAFVYHNFLS  1
            G++GE WTE+LSWEPRAF+YHNFLS
Sbjct  82   GEKGEPWTEVLSWEPRAFIYHNFLS  106



>ref|XP_006467024.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Citrus sinensis]
Length=287

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 66/131 (50%), Gaps = 39/131 (30%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGS-DDEPSSIRSRIRF  214
            MAKPR SR   R++S+ +L+L++L+M T  +L+LLA GIL++P  S D   ++  S I  
Sbjct  1    MAKPRYSRFPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIVR  60

Query  213  KRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWE  34
            K M                                      E +G   R EQW E++SWE
Sbjct  61   KSM--------------------------------------ESEGDEGRAEQWVEVISWE  82

Query  33   PRAFVYHNFLS  1
            PRAFVYHNFLS
Sbjct  83   PRAFVYHNFLS  93



>gb|KDO71350.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=287

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 66/131 (50%), Gaps = 39/131 (30%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGS-DDEPSSIRSRIRF  214
            MAKPR SR   R++S+ +L+L++L+M T  +L+LLA GIL++P  S D   ++  S I  
Sbjct  1    MAKPRYSRFPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIVR  60

Query  213  KRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWE  34
            K M                                      E +G   R EQW E++SWE
Sbjct  61   KSM--------------------------------------ESEGDEGRAEQWVEVISWE  82

Query  33   PRAFVYHNFLS  1
            PRAFVYHNFLS
Sbjct  83   PRAFVYHNFLS  93



>ref|XP_006661912.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Oryza brachyantha]
Length=221

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75  GKRGEQWTEILSWEPRAFVYHNFLS  1
           G++GE WTE+LSWEPRAF+YHNFLS
Sbjct  3   GEKGEPWTEVLSWEPRAFLYHNFLS  27



>gb|KDO71358.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=174

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  69  RGEQWTEILSWEPRAFVYHNFLS  1
           R EQW E++SWEPRAFVYHNFLS
Sbjct  72  RAEQWVEVISWEPRAFVYHNFLS  94



>ref|XP_006425365.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38605.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=235

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 2/35 (6%)
 Frame = -2

Query  105  F*CRVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            F CR E D    R EQW E++SWEPRAFVYHNFLS
Sbjct  9    FLCRSEGDE--GRAEQWVEVISWEPRAFVYHNFLS  41



>gb|EEE51215.1| hypothetical protein OsJ_32038 [Oryza sativa Japonica Group]
Length=222

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75  GKRGEQWTEILSWEPRAFVYHNFLS  1
           G++GE WTE+LSWEPRAF+YHNFLS
Sbjct  4   GEKGEPWTEVLSWEPRAFLYHNFLS  28



>gb|ACU17088.1| unknown [Glycine max]
Length=207

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 2/30 (7%)
 Frame = -2

Query  90  EDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +DD    RGEQW E++SWEPRAFVYHNFL+
Sbjct  69  DDDDV--RGEQWVEVVSWEPRAFVYHNFLT  96



>gb|KDO71354.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=235

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 2/35 (6%)
 Frame = -2

Query  105  F*CRVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            F CR E D    R EQW E++SWEPRAFVYHNFLS
Sbjct  9    FLCRSEGDE--GRAEQWVEVISWEPRAFVYHNFLS  41



>gb|AAL58274.1|AC068923_16 putative prolyl 4-hydroxylase, alpha subunit [Oryza sativa Japonica 
Group]
Length=343

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75   GKRGEQWTEILSWEPRAFVYHNFLS  1
            G++GE WTE+LSWEPRAF+YHNFLS
Sbjct  103  GEKGEPWTEVLSWEPRAFLYHNFLS  127



>ref|XP_006386160.1| hypothetical protein POPTR_0002s01820g [Populus trichocarpa]
 gb|ERP63957.1| hypothetical protein POPTR_0002s01820g [Populus trichocarpa]
Length=278

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  90  EDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           E D   K+ E+WTEILSWEPRAF+YHNFLS
Sbjct  65  EGDRMEKKEEKWTEILSWEPRAFLYHNFLS  94



>ref|XP_003574128.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brachypodium distachyon]
Length=306

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75   GKRGEQWTEILSWEPRAFVYHNFLS  1
            G++GE WTE+LSWEPRAF+YHNFLS
Sbjct  88   GEKGEPWTEVLSWEPRAFLYHNFLS  112



>ref|XP_004134841.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
 gb|KGN48959.1| hypothetical protein Csa_6G507320 [Cucumis sativus]
Length=287

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  96  RVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +  DD   ++GEQW E++SWEPRAFVYHNFL+
Sbjct  62  KTSDDVDEEKGEQWVEVISWEPRAFVYHNFLT  93



>ref|NP_001064962.1| Os10g0497800 [Oryza sativa Japonica Group]
 gb|ABB47828.1| prolyl 4-hydroxylase alpha subunit, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26876.1| Os10g0497800 [Oryza sativa Japonica Group]
 dbj|BAH00081.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67248.1| hypothetical protein OsI_34188 [Oryza sativa Indica Group]
Length=321

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  75   GKRGEQWTEILSWEPRAFVYHNFLS  1
            G++GE WTE+LSWEPRAF+YHNFLS
Sbjct  103  GEKGEPWTEVLSWEPRAFLYHNFLS  127



>ref|XP_004158845.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=287

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  96  RVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +  DD   ++GEQW E++SWEPRAFVYHNFL+
Sbjct  62  KTSDDVDEEKGEQWVEVISWEPRAFVYHNFLT  93



>emb|CDP15792.1| unnamed protein product [Coffea canephora]
Length=229

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  105  F*CRVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            F C VE  G G+R +QWTE+LS EPRA ++HNFLS
Sbjct  9    FLCVVEGGGLGQRHKQWTEVLSSEPRASIFHNFLS  43



>gb|KHN35999.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=289

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  93  VEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +E     +RGEQW E++SWEPRAFVYHNFL+
Sbjct  65  IETSDSDERGEQWVEVVSWEPRAFVYHNFLT  95



>ref|XP_003612250.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES95208.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=204

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 1/29 (3%)
 Frame = -2

Query  87  DDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DD  GK GEQW E++SWEPRAFVYHNFL+
Sbjct  68  DDEEGK-GEQWVEVVSWEPRAFVYHNFLT  95



>ref|XP_008440878.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
Length=287

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  96  RVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +  DD   ++GEQW E++SWEPRAF+YHNFL+
Sbjct  62  KTSDDVDEEKGEQWVEVISWEPRAFIYHNFLT  93



>ref|NP_001242522.1| uncharacterized protein LOC100806046 [Glycine max]
 gb|ACU24023.1| unknown [Glycine max]
Length=289

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  93  VEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +E     +RGEQW E++SWEPRAFVYHNFL+
Sbjct  65  IETSDSDERGEQWVEVVSWEPRAFVYHNFLT  95



>gb|EMT09490.1| Prolyl 4-hydroxylase subunit alpha-1 [Aegilops tauschii]
Length=257

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  75  GKRGEQWTEILSWEPRAFVYHNFL  4
           G++GE WTE+LSWEPRAF+YHNFL
Sbjct  39  GEKGEPWTEVLSWEPRAFIYHNFL  62



>ref|XP_010266057.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nelumbo nucifera]
Length=311

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  84   DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
            DG G++ +QWTE++SWEPRA V+HNFLS
Sbjct  90   DGLGEKEQQWTEVISWEPRAAVFHNFLS  117



>ref|XP_009363441.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Pyrus x bretschneideri]
Length=291

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 3/32 (9%)
 Frame = -2

Query  96  RVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           R E+DG    GEQW E++SWEPRAFVYHNFL+
Sbjct  69  RSEEDG---AGEQWVEVISWEPRAFVYHNFLT  97



>gb|KDO71357.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=202

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  69  RGEQWTEILSWEPRAFVYHNFLS  1
           R EQW E++SWEPRAFVYHNFLS
Sbjct  72  RAEQWVEVISWEPRAFVYHNFLS  94



>ref|XP_007046593.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007046596.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX90750.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX90753.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
Length=283

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG   +GEQW E++SWEPRAF+YHNFLS
Sbjct  62  DGGEGQGEQWVEVISWEPRAFIYHNFLS  89



>ref|XP_007046594.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
 ref|XP_007046595.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOX90751.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX90752.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
Length=296

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG   +GEQW E++SWEPRAF+YHNFLS
Sbjct  62  DGGEGQGEQWVEVISWEPRAFIYHNFLS  89



>ref|XP_002263060.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Vitis vinifera]
 emb|CBI24447.3| unnamed protein product [Vitis vinifera]
Length=288

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG   +GE W+E++SWEPRAFVYHNFLS
Sbjct  67  DGNDGKGEPWSEVISWEPRAFVYHNFLS  94



>emb|CAN64470.1| hypothetical protein VITISV_014644 [Vitis vinifera]
Length=288

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG   +GE W+E++SWEPRAFVYHNFLS
Sbjct  67  DGNDGKGEPWSEVISWEPRAFVYHNFLS  94



>ref|XP_007157869.1| hypothetical protein PHAVU_002G104900g [Phaseolus vulgaris]
 gb|ESW29863.1| hypothetical protein PHAVU_002G104900g [Phaseolus vulgaris]
Length=290

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           D   +RGEQW E++SWEPRAFVYHNFL+
Sbjct  69  DDDEERGEQWVEVVSWEPRAFVYHNFLT  96



>ref|XP_008778312.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=308

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  93   VEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
             + +G G RG QW E++SWEPRA V+HNFLS
Sbjct  77   TDGNGLGNRGAQWAEVISWEPRASVFHNFLS  107



>ref|XP_003538892.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 [Glycine max]
 gb|KHN41867.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=290

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 2/30 (7%)
 Frame = -2

Query  90  EDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           +DD    RGEQW E++SWEPRAFVYHNFL+
Sbjct  69  DDDDV--RGEQWVEVVSWEPRAFVYHNFLT  96



>ref|XP_008778322.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=301

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  93   VEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
             + +G G RG QW E++SWEPRA V+HNFLS
Sbjct  77   TDGNGLGNRGAQWAEVISWEPRASVFHNFLS  107



>ref|XP_009337076.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Pyrus x bretschneideri]
Length=291

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 3/32 (9%)
 Frame = -2

Query  96  RVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           R E+DG    GEQW E++SWEPRAFVYHNFL+
Sbjct  69  RNEEDG---AGEQWVEVISWEPRAFVYHNFLT  97



>ref|XP_009394475.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=293

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  90  EDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           + +GF + G QWTE++SWEPRA VYHNFLS
Sbjct  70  KTEGFVQSGRQWTEVISWEPRASVYHNFLS  99



>gb|KHN18012.1| hypothetical protein glysoja_041646 [Glycine soja]
Length=96

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/20 (95%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = -2

Query  63  EQWTEILSWEPRAFVYHNFL  4
           EQWTEILSWEPRAF+YHNFL
Sbjct  75  EQWTEILSWEPRAFIYHNFL  94



>ref|XP_007136121.1| hypothetical protein PHAVU_009G019600g [Phaseolus vulgaris]
 gb|ESW08115.1| hypothetical protein PHAVU_009G019600g [Phaseolus vulgaris]
Length=289

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  72  KRGEQWTEILSWEPRAFVYHNFLS  1
           ++ EQWTEILSWEPRAF+YHNFLS
Sbjct  72  EKTEQWTEILSWEPRAFIYHNFLS  95



>ref|XP_003612249.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES95207.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=289

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 1/29 (3%)
 Frame = -2

Query  87  DDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DD  GK GEQW E++SWEPRAFVYHNFL+
Sbjct  68  DDEEGK-GEQWVEVVSWEPRAFVYHNFLT  95



>ref|XP_006425362.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38602.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=265

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  69  RGEQWTEILSWEPRAFVYHNFLS  1
           R EQW E++SWEPRAFVYHNFLS
Sbjct  72  RAEQWVEVISWEPRAFVYHNFLS  94



>gb|KDO71356.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=265

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  69  RGEQWTEILSWEPRAFVYHNFLS  1
           R EQW E++SWEPRAFVYHNFLS
Sbjct  72  RAEQWVEVISWEPRAFVYHNFLS  94



>ref|XP_002530636.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
 gb|EEF31744.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
Length=287

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  DGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           DG   +GE+W E++SWEPRAFVYHNFL+
Sbjct  66  DGDDGKGERWAEVISWEPRAFVYHNFLT  93



>ref|XP_006467023.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Citrus sinensis]
Length=288

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 65/131 (50%), Gaps = 38/131 (29%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGS-DDEPSSIRSRIRF  214
            MAKPR SR   R++S+ +L+L++L+M T  +L+LLA GIL++P  S D   ++  S I  
Sbjct  1    MAKPRYSRFPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIVR  60

Query  213  KRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWE  34
            K M                                        +G   R EQW E++SWE
Sbjct  61   KSME-------------------------------------RSEGDEGRAEQWVEVISWE  83

Query  33   PRAFVYHNFLS  1
            PRAFVYHNFLS
Sbjct  84   PRAFVYHNFLS  94



>gb|KDO71351.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
 gb|KDO71352.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
 gb|KDO71353.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=288

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 65/131 (50%), Gaps = 38/131 (29%)
 Frame = -2

Query  390  MAKPRGSRHQGRRtstmslvlsmllmltlvllmlLALGILNLPIGS-DDEPSSIRSRIRF  214
            MAKPR SR   R++S+ +L+L++L+M T  +L+LLA GIL++P  S D   ++  S I  
Sbjct  1    MAKPRYSRFPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIVR  60

Query  213  KRMSLDVYGSFHIYAYMYDTL*IEVCSR**YLIEDGF*CRVEDDGFGKRGEQWTEILSWE  34
            K M                                        +G   R EQW E++SWE
Sbjct  61   KSME-------------------------------------RSEGDEGRAEQWVEVISWE  83

Query  33   PRAFVYHNFLS  1
            PRAFVYHNFLS
Sbjct  84   PRAFVYHNFLS  94



>ref|XP_006425363.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 ref|XP_006425364.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38603.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38604.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=288

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  69  RGEQWTEILSWEPRAFVYHNFLS  1
           R EQW E++SWEPRAFVYHNFLS
Sbjct  72  RAEQWVEVISWEPRAFVYHNFLS  94



>ref|XP_006577957.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Glycine max]
Length=289

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -2

Query  63  EQWTEILSWEPRAFVYHNFLS  1
           EQWTEILSWEPRAF+YHNFLS
Sbjct  75  EQWTEILSWEPRAFIYHNFLS  95



>ref|XP_006577956.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Glycine max]
 gb|KHN45959.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=289

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -2

Query  63  EQWTEILSWEPRAFVYHNFLS  1
           EQWTEILSWEPRAF+YHNFLS
Sbjct  75  EQWTEILSWEPRAFIYHNFLS  95



>ref|XP_009801759.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana sylvestris]
Length=290

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 2/32 (6%)
 Frame = -2

Query  96  RVEDDGFGKRGEQWTEILSWEPRAFVYHNFLS  1
           R +DDG   +G+QW E++SWEPRA VYHNFLS
Sbjct  67  RRDDDG--GKGDQWAEVISWEPRAVVYHNFLS  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 717231537738