BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20361_g2_i1 len=698 path=[2108:0-344 2453:345-518 2627:519-697]

Length=698
                                                                      Score     E

ref|XP_009773274.1|  PREDICTED: hippocampus abundant transcript-l...    297   3e-95   
ref|XP_009594349.1|  PREDICTED: hippocampus abundant transcript-l...    292   2e-93   
ref|XP_011076924.1|  PREDICTED: hippocampus abundant transcript-l...    289   6e-92   
ref|XP_010312533.1|  PREDICTED: hippocampus abundant transcript-l...    283   2e-89   
ref|XP_006361454.1|  PREDICTED: hippocampus abundant transcript-l...    282   3e-89   
gb|EYU19784.1|  hypothetical protein MIMGU_mgv1a006484mg                278   6e-88   
ref|XP_002266084.1|  PREDICTED: hippocampus abundant transcript-l...    274   4e-86   Vitis vinifera
ref|XP_007214409.1|  hypothetical protein PRUPE_ppa026350mg             273   9e-86   
ref|XP_008232010.1|  PREDICTED: hippocampus abundant transcript-l...    272   2e-85   
ref|XP_006436628.1|  hypothetical protein CICLE_v10031562mg             270   8e-85   
emb|CDP20482.1|  unnamed protein product                                270   1e-84   
gb|KDP35841.1|  hypothetical protein JCGZ_10322                         263   3e-84   
ref|XP_009773275.1|  PREDICTED: hippocampus abundant transcript-l...    267   4e-84   
ref|XP_010681370.1|  PREDICTED: hippocampus abundant transcript-l...    268   8e-84   
ref|XP_007010348.1|  Major facilitator superfamily protein isoform 2    266   5e-83   
ref|XP_010244469.1|  PREDICTED: hippocampus abundant transcript-l...    265   1e-82   
ref|XP_010067148.1|  PREDICTED: hippocampus abundant transcript-l...    265   2e-82   
ref|XP_007010347.1|  Major facilitator superfamily protein isoform 1    265   5e-82   
gb|KEH43443.1|  hippocampus abundant transcript-like protein            260   2e-81   
ref|XP_010681372.1|  PREDICTED: hippocampus abundant transcript-l...    261   4e-81   
ref|XP_006851495.1|  hypothetical protein AMTR_s00040p00148020          260   5e-81   
ref|XP_004308556.1|  PREDICTED: hippocampus abundant transcript-l...    261   5e-81   
ref|XP_002524989.1|  Hippocampus abundant transcript 1 protein, p...    260   8e-81   Ricinus communis
gb|KEH43442.1|  hippocampus abundant transcript-like protein            260   9e-81   
gb|KDP35836.1|  hypothetical protein JCGZ_10317                         259   2e-80   
emb|CAN74055.1|  hypothetical protein VITISV_026070                     259   2e-80   Vitis vinifera
ref|XP_003591772.1|  Hippocampus abundant transcript-like protein       259   3e-80   
ref|XP_011032839.1|  PREDICTED: hippocampus abundant transcript-l...    258   5e-80   
ref|XP_010088768.1|  Hippocampus abundant transcript-like protein 1     266   7e-80   
ref|XP_006361453.1|  PREDICTED: hippocampus abundant transcript-l...    255   6e-79   
ref|XP_002311018.2|  hypothetical protein POPTR_0008s02280g             255   8e-79   Populus trichocarpa [western balsam poplar]
ref|XP_003535506.2|  PREDICTED: hippocampus abundant transcript-l...    253   5e-78   
gb|KHN37831.1|  Hippocampus abundant transcript-like protein 1          253   5e-78   
ref|XP_003591771.1|  Hippocampus abundant transcript-like protein       253   7e-78   
ref|XP_004250476.1|  PREDICTED: hippocampus abundant transcript-l...    253   7e-78   
ref|XP_011076925.1|  PREDICTED: hippocampus abundant transcript-l...    250   9e-78   
ref|XP_007143809.1|  hypothetical protein PHAVU_007G103300g             252   2e-77   
gb|EPS69092.1|  hypothetical protein M569_05672                         251   2e-77   
ref|XP_009416863.1|  PREDICTED: hippocampus abundant transcript-l...    251   2e-77   
gb|AFK40263.1|  unknown                                                 251   2e-77   
ref|XP_002524988.1|  Hippocampus abundant transcript 1 protein, p...    251   2e-77   Ricinus communis
ref|XP_007143808.1|  hypothetical protein PHAVU_007G103300g             251   2e-77   
ref|XP_002315443.2|  hypothetical protein POPTR_0010s24380g             253   5e-76   Populus trichocarpa [western balsam poplar]
ref|XP_010681371.1|  PREDICTED: hippocampus abundant transcript-l...    248   7e-76   
ref|XP_009407349.1|  PREDICTED: hippocampus abundant transcript-l...    241   1e-73   
ref|XP_010032090.1|  PREDICTED: hippocampus abundant transcript-l...    241   3e-73   
ref|XP_010681373.1|  PREDICTED: hippocampus abundant transcript-l...    239   6e-73   
gb|KCW51480.1|  hypothetical protein EUGRSUZ_J00999                     241   2e-72   
gb|KGN46030.1|  hypothetical protein Csa_6G045090                       236   9e-72   
gb|EPS69924.1|  hypothetical protein M569_04837                         232   3e-71   
ref|XP_004140989.1|  PREDICTED: hippocampus abundant transcript-l...    235   4e-71   
ref|XP_011024228.1|  PREDICTED: hippocampus abundant transcript-l...    235   4e-71   
gb|KCW51477.1|  hypothetical protein EUGRSUZ_J00997                     235   5e-71   
ref|XP_004169983.1|  PREDICTED: hippocampus abundant transcript-l...    235   6e-71   
ref|XP_010032083.1|  PREDICTED: hippocampus abundant transcript-l...    234   9e-71   
ref|XP_006485218.1|  PREDICTED: hippocampus abundant transcript-l...    230   6e-70   
ref|XP_008456592.1|  PREDICTED: hippocampus abundant transcript-l...    231   1e-69   
ref|XP_007010349.1|  Major facilitator superfamily protein isoform 3    229   2e-69   
emb|CDP20480.1|  unnamed protein product                                228   4e-69   
ref|XP_010681374.1|  PREDICTED: hippocampus abundant transcript-l...    225   4e-68   
ref|XP_011032840.1|  PREDICTED: hippocampus abundant transcript-l...    220   3e-66   
ref|XP_010032084.1|  PREDICTED: hippocampus abundant transcript-l...    216   4e-64   
ref|XP_010907145.1|  PREDICTED: hippocampus abundant transcript-l...    217   4e-64   
ref|XP_010312534.1|  PREDICTED: hippocampus abundant transcript-l...    214   6e-64   
ref|XP_006589383.1|  PREDICTED: hippocampus abundant transcript-l...    214   9e-64   
ref|XP_008788273.1|  PREDICTED: hippocampus abundant transcript-l...    211   9e-63   
ref|XP_008788264.1|  PREDICTED: hippocampus abundant transcript-l...    211   2e-62   
gb|AFK42472.1|  unknown                                                 206   2e-62   
ref|XP_008788255.1|  PREDICTED: hippocampus abundant transcript-l...    212   5e-62   
ref|XP_010032091.1|  PREDICTED: hippocampus abundant transcript-l...    208   3e-61   
ref|XP_010032085.1|  PREDICTED: hippocampus abundant transcript-l...    200   2e-58   
ref|XP_010682914.1|  PREDICTED: hippocampus abundant transcript-l...    200   1e-57   
ref|XP_011024229.1|  PREDICTED: hippocampus abundant transcript-l...    198   1e-57   
gb|KDO42035.1|  hypothetical protein CISIN_1g0164182mg                  192   2e-56   
ref|XP_002450280.1|  hypothetical protein SORBIDRAFT_05g003130          195   1e-55   Sorghum bicolor [broomcorn]
ref|NP_001140664.1|  uncharacterized protein LOC100272739 precursor     191   4e-54   Zea mays [maize]
ref|XP_004978692.1|  PREDICTED: hippocampus abundant transcript-l...    185   8e-52   
emb|CDO99891.1|  unnamed protein product                                176   2e-51   
emb|CDO99893.1|  unnamed protein product                                173   1e-50   
ref|XP_003577047.1|  PREDICTED: uncharacterized protein LOC100833312    177   8e-49   
ref|XP_006662736.1|  PREDICTED: hippocampus abundant transcript-l...    176   2e-48   
gb|EEE51661.1|  hypothetical protein OsJ_32986                          176   2e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67684.1|  hypothetical protein OsI_35133                          175   2e-48   Oryza sativa Indica Group [Indian rice]
ref|NP_001065767.2|  Os11g0151500                                       175   3e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003577048.1|  PREDICTED: uncharacterized protein LOC100833620    175   6e-48   
ref|XP_010032089.1|  PREDICTED: hippocampus abundant transcript-l...    176   6e-48   
emb|CBX25325.1|  hypothetical_protein                                   172   2e-47   
gb|AAX94836.1|  Major Facilitator Superfamily, putative                 175   4e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010032087.1|  PREDICTED: hippocampus abundant transcript-l...    167   4e-46   
gb|KCW51478.1|  hypothetical protein EUGRSUZ_J00997                     166   9e-46   
gb|EMS64155.1|  Hippocampus abundant transcript-like protein 1          158   8e-42   
gb|EMT19766.1|  Hippocampus abundant transcript-like protein 1          156   1e-39   
gb|KHN00908.1|  Glycine-rich RNA-binding protein 2, mitochondrial       152   9e-39   
gb|AFK48179.1|  unknown                                                 141   2e-38   
ref|XP_007142795.1|  hypothetical protein PHAVU_007G017500g             149   2e-38   
ref|XP_004253206.1|  PREDICTED: uncharacterized protein LOC101250386    145   6e-37   
gb|KDO84973.1|  hypothetical protein CISIN_1g013411mg                   144   6e-37   
ref|XP_006435264.1|  hypothetical protein CICLE_v10001166mg             144   1e-36   
ref|XP_003555206.1|  PREDICTED: hippocampus abundant transcript 1...    144   1e-36   
emb|CAN64703.1|  hypothetical protein VITISV_038996                     143   2e-36   Vitis vinifera
ref|XP_002284761.1|  PREDICTED: hippocampus abundant transcript 1...    143   3e-36   Vitis vinifera
gb|KHG11074.1|  Hippocampus abundant transcript 1                       142   4e-36   
ref|XP_011088646.1|  PREDICTED: hippocampus abundant transcript 1...    142   6e-36   
ref|XP_008236069.1|  PREDICTED: hippocampus abundant transcript-l...    142   6e-36   
ref|XP_010100117.1|  Hippocampus abundant transcript 1 protein          142   6e-36   
ref|XP_009776326.1|  PREDICTED: solute carrier family 46 member 3...    141   9e-36   
ref|XP_003535759.1|  PREDICTED: hippocampus abundant transcript 1...    141   1e-35   
gb|EYU37985.1|  hypothetical protein MIMGU_mgv1a006613mg                141   1e-35   
ref|XP_010086842.1|  Hippocampus abundant transcript 1 protein          140   2e-35   
ref|XP_007201037.1|  hypothetical protein PRUPE_ppa005784mg             141   2e-35   
gb|KHG18467.1|  Hippocampus abundant transcript 1                       140   2e-35   
ref|XP_008791950.1|  PREDICTED: hippocampus abundant transcript-l...    140   3e-35   
ref|XP_011034951.1|  PREDICTED: uncharacterized protein LOC105132...    139   8e-35   
ref|XP_009767684.1|  PREDICTED: uncharacterized protein LOC104218795    139   8e-35   
ref|XP_006342707.1|  PREDICTED: hippocampus abundant transcript-l...    139   8e-35   
ref|XP_010061116.1|  PREDICTED: hippocampus abundant transcript-l...    139   8e-35   
ref|XP_002313691.1|  hypothetical protein POPTR_0009s14090g             139   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002510601.1|  tetracycline transporter, putative                 139   1e-34   Ricinus communis
ref|XP_003527649.1|  PREDICTED: hippocampus abundant transcript-l...    138   2e-34   
ref|XP_009624104.1|  PREDICTED: solute carrier family 46 member 3...    138   2e-34   
gb|KHN20137.1|  Hippocampus abundant transcript-like protein 1          138   2e-34   
emb|CDP07341.1|  unnamed protein product                                137   3e-34   
ref|XP_002306959.1|  hypothetical protein POPTR_0005s26720g             137   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002968361.1|  hypothetical protein SELMODRAFT_169638             137   4e-34   
ref|XP_003523261.1|  PREDICTED: hippocampus abundant transcript-l...    137   4e-34   
ref|XP_002965935.1|  hypothetical protein SELMODRAFT_167756             137   6e-34   
ref|XP_009400334.1|  PREDICTED: hippocampus abundant transcript-l...    136   7e-34   
gb|KDO68187.1|  hypothetical protein CISIN_1g011514mg                   135   1e-33   
ref|XP_008382447.1|  PREDICTED: hippocampus abundant transcript 1...    136   1e-33   
ref|XP_007017917.1|  Major facilitator superfamily protein isoform 3    135   1e-33   
ref|XP_007017916.1|  Major facilitator superfamily protein isoform 2    135   2e-33   
ref|XP_009355593.1|  PREDICTED: hippocampus abundant transcript 1...    135   2e-33   
ref|XP_006386158.1|  hypothetical protein POPTR_0002s01760g             135   2e-33   
gb|EMT05362.1|  Hippocampus abundant transcript 1 protein               135   2e-33   
ref|XP_006486682.1|  PREDICTED: hippocampus abundant transcript 1...    134   2e-33   
ref|XP_011046630.1|  PREDICTED: hippocampus abundant transcript-l...    135   2e-33   
ref|XP_011034952.1|  PREDICTED: uncharacterized protein LOC105132...    135   2e-33   
ref|XP_010028772.1|  PREDICTED: uncharacterized protein LOC104418982    134   3e-33   
gb|KDO68186.1|  hypothetical protein CISIN_1g011514mg                   134   3e-33   
ref|XP_006486681.1|  PREDICTED: hippocampus abundant transcript 1...    134   4e-33   
ref|XP_010061115.1|  PREDICTED: hippocampus abundant transcript-l...    134   4e-33   
ref|XP_004497200.1|  PREDICTED: hippocampus abundant transcript 1...    134   4e-33   
ref|XP_006655183.1|  PREDICTED: hippocampus abundant transcript 1...    134   4e-33   
ref|XP_011045660.1|  PREDICTED: hippocampus abundant transcript-l...    134   5e-33   
gb|KDO68183.1|  hypothetical protein CISIN_1g011514mg                   134   5e-33   
ref|XP_006422528.1|  hypothetical protein CICLE_v10028321mg             134   5e-33   
ref|XP_004238394.1|  PREDICTED: uncharacterized protein LOC101248671    134   5e-33   
ref|XP_002280708.1|  PREDICTED: hippocampus abundant transcript-l...    134   5e-33   Vitis vinifera
ref|XP_006422527.1|  hypothetical protein CICLE_v10028321mg             134   5e-33   
ref|XP_011045668.1|  PREDICTED: hippocampus abundant transcript-l...    134   5e-33   
ref|XP_004291324.1|  PREDICTED: hippocampus abundant transcript 1...    134   7e-33   
ref|XP_010266910.1|  PREDICTED: hippocampus abundant transcript 1...    133   8e-33   
gb|KCW55587.1|  hypothetical protein EUGRSUZ_I01458                     134   9e-33   
gb|KDP36870.1|  hypothetical protein JCGZ_08161                         132   1e-32   
gb|EYU40457.1|  hypothetical protein MIMGU_mgv1a021568mg                133   1e-32   
ref|XP_006342087.1|  PREDICTED: hippocampus abundant transcript-l...    132   1e-32   
ref|XP_009620054.1|  PREDICTED: uncharacterized protein LOC104111941    132   2e-32   
gb|KHN37832.1|  hypothetical protein glysoja_016956                     132   2e-32   
ref|XP_010539088.1|  PREDICTED: hippocampus abundant transcript-l...    132   3e-32   
ref|XP_007136127.1|  hypothetical protein PHAVU_009G020100g             132   3e-32   
ref|XP_007017915.1|  Major facilitator superfamily protein isoform 1    132   3e-32   
ref|XP_004292638.1|  PREDICTED: hippocampus abundant transcript 1...    132   3e-32   
ref|XP_006280482.1|  hypothetical protein CARUB_v10026419mg             132   3e-32   
ref|XP_010539087.1|  PREDICTED: hippocampus abundant transcript-l...    132   3e-32   
ref|XP_004248636.1|  PREDICTED: hippocampus abundant transcript-l...    131   4e-32   
ref|XP_004983780.1|  PREDICTED: hippocampus abundant transcript 1...    130   4e-32   
ref|XP_004983779.1|  PREDICTED: hippocampus abundant transcript 1...    131   6e-32   
ref|XP_002465000.1|  hypothetical protein SORBIDRAFT_01g030220          130   7e-32   Sorghum bicolor [broomcorn]
ref|XP_004500910.1|  PREDICTED: hippocampus abundant transcript-l...    130   9e-32   
gb|KDO68185.1|  hypothetical protein CISIN_1g011514mg                   130   1e-31   
ref|XP_010943478.1|  PREDICTED: hippocampus abundant transcript 1...    130   2e-31   
ref|XP_004500906.1|  PREDICTED: hippocampus abundant transcript-l...    129   2e-31   
ref|XP_004500908.1|  PREDICTED: hippocampus abundant transcript-l...    129   2e-31   
ref|XP_011003093.1|  PREDICTED: uncharacterized protein LOC105109921    128   5e-31   
gb|KDO68188.1|  hypothetical protein CISIN_1g011514mg                   125   6e-31   
gb|KEH44396.1|  MFS transporter                                         127   7e-31   
ref|XP_011088647.1|  PREDICTED: hippocampus abundant transcript 1...    127   9e-31   
emb|CDY02382.1|  BnaA02g22910D                                          127   1e-30   
ref|XP_004290751.1|  PREDICTED: hippocampus abundant transcript-l...    127   1e-30   
gb|KEH44398.1|  MFS transporter                                         127   1e-30   
gb|KFK32943.1|  hypothetical protein AALP_AA6G309500                    127   2e-30   
ref|XP_007222153.1|  hypothetical protein PRUPE_ppa005755mg             127   2e-30   
gb|AES74091.2|  MFS transporter                                         127   2e-30   
gb|KEH44397.1|  MFS transporter                                         126   2e-30   
gb|EYU37987.1|  hypothetical protein MIMGU_mgv1a019548mg                127   2e-30   
ref|XP_008445313.1|  PREDICTED: hippocampus abundant transcript 1...    126   2e-30   
ref|XP_010494157.1|  PREDICTED: hippocampus abundant transcript-l...    126   2e-30   
ref|XP_010494158.1|  PREDICTED: hippocampus abundant transcript-l...    126   3e-30   
gb|KDP33281.1|  hypothetical protein JCGZ_13068                         126   3e-30   
ref|XP_010494154.1|  PREDICTED: hippocampus abundant transcript-l...    126   3e-30   
ref|XP_010494156.1|  PREDICTED: hippocampus abundant transcript-l...    126   3e-30   
gb|EYU37986.1|  hypothetical protein MIMGU_mgv1a006358mg                126   3e-30   
tpg|DAA46149.1|  TPA: hypothetical protein ZEAMMB73_581598              125   3e-30   
ref|XP_010690317.1|  PREDICTED: hippocampus abundant transcript 1...    126   3e-30   
gb|EMT20897.1|  Hippocampus abundant transcript 1 protein               125   4e-30   
ref|XP_009775454.1|  PREDICTED: hippocampus abundant transcript 1...    125   4e-30   
ref|XP_008221200.1|  PREDICTED: hippocampus abundant transcript 1...    125   4e-30   
ref|XP_007041737.1|  Major facilitator superfamily protein, putat...    125   8e-30   
ref|XP_008445315.1|  PREDICTED: hippocampus abundant transcript-l...    125   8e-30   
ref|NP_001130498.1|  tetracycline transporter protein                   125   9e-30   Zea mays [maize]
ref|XP_007041738.1|  Major facilitator superfamily protein, putat...    125   9e-30   
ref|XP_008447923.1|  PREDICTED: hippocampus abundant transcript-l...    124   9e-30   
tpg|DAA46150.1|  TPA: hypothetical protein ZEAMMB73_581598              125   9e-30   
ref|XP_008447922.1|  PREDICTED: hippocampus abundant transcript-l...    124   1e-29   
gb|EYU37988.1|  hypothetical protein MIMGU_mgv1a006415mg                124   1e-29   
ref|XP_009783818.1|  PREDICTED: hippocampus abundant transcript-l...    122   2e-29   
ref|XP_008447920.1|  PREDICTED: hippocampus abundant transcript 1...    124   2e-29   
ref|XP_006360887.1|  PREDICTED: hippocampus abundant transcript-l...    124   2e-29   
ref|XP_004167746.1|  PREDICTED: hippocampus abundant transcript 1...    124   2e-29   
ref|XP_010442182.1|  PREDICTED: hippocampus abundant transcript-l...    124   2e-29   
ref|XP_004142991.1|  PREDICTED: hippocampus abundant transcript 1...    123   3e-29   
ref|XP_004144923.1|  PREDICTED: tetracycline resistance protein, ...    123   3e-29   
ref|XP_008445314.1|  PREDICTED: hippocampus abundant transcript-l...    123   3e-29   
ref|XP_009783817.1|  PREDICTED: hippocampus abundant transcript 1...    122   3e-29   
ref|XP_009588093.1|  PREDICTED: hippocampus abundant transcript-l...    123   4e-29   
ref|XP_004143076.1|  PREDICTED: uncharacterized protein LOC101213676    125   4e-29   
ref|XP_010482014.1|  PREDICTED: hippocampus abundant transcript 1...    122   4e-29   
ref|XP_010482015.1|  PREDICTED: hippocampus abundant transcript 1...    122   5e-29   
ref|XP_010482011.1|  PREDICTED: hippocampus abundant transcript 1...    122   5e-29   
ref|XP_009802649.1|  PREDICTED: hippocampus abundant transcript-l...    122   6e-29   
gb|KDP33282.1|  hypothetical protein JCGZ_13069                         122   6e-29   
ref|XP_009783815.1|  PREDICTED: hippocampus abundant transcript 1...    122   9e-29   
ref|XP_011083420.1|  PREDICTED: hippocampus abundant transcript 1...    122   9e-29   
ref|XP_009124113.1|  PREDICTED: hippocampus abundant transcript-l...    122   9e-29   
ref|XP_009783816.1|  PREDICTED: hippocampus abundant transcript-l...    122   1e-28   
ref|XP_002301947.2|  hypothetical protein POPTR_0002s01760g             122   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009334544.1|  PREDICTED: uncharacterized protein LOC103927348    122   1e-28   
ref|XP_004953398.1|  PREDICTED: hippocampus abundant transcript 1...    122   1e-28   
ref|XP_004161094.1|  PREDICTED: uncharacterized protein LOC101225919    124   1e-28   
ref|XP_010315397.1|  PREDICTED: hippocampus abundant transcript-l...    120   2e-28   
ref|XP_003570066.1|  PREDICTED: hippocampus abundant transcript 1...    121   2e-28   
ref|XP_004231065.1|  PREDICTED: hippocampus abundant transcript-l...    120   3e-28   
ref|XP_010315396.1|  PREDICTED: hippocampus abundant transcript-l...    120   3e-28   
ref|XP_004500907.1|  PREDICTED: hippocampus abundant transcript-l...    119   1e-27   
gb|EYU17555.1|  hypothetical protein MIMGU_mgv1a006533mg                118   2e-27   
ref|XP_009124111.1|  PREDICTED: hippocampus abundant transcript-l...    118   2e-27   
ref|XP_002865555.1|  hypothetical protein ARALYDRAFT_331182             117   3e-27   
ref|XP_002454504.1|  hypothetical protein SORBIDRAFT_04g032320          117   5e-27   Sorghum bicolor [broomcorn]
ref|XP_003603840.1|  Hippocampus abundant transcript-like protein       117   5e-27   
dbj|BAF00568.1|  hypothetical protein                                   112   7e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008387898.1|  PREDICTED: hippocampus abundant transcript 1...    116   8e-27   
ref|XP_009617454.1|  PREDICTED: hippocampus abundant transcript 1...    115   8e-27   
gb|EPS73404.1|  hypothetical protein M569_01349                         116   9e-27   
ref|XP_010327393.1|  PREDICTED: uncharacterized protein LOC101267...    116   9e-27   
emb|CAN70291.1|  hypothetical protein VITISV_019346                     116   1e-26   Vitis vinifera
gb|KHN37382.1|  Hippocampus abundant transcript 1 protein               115   1e-26   
ref|XP_010918152.1|  PREDICTED: hippocampus abundant transcript-l...    115   2e-26   
ref|XP_009617452.1|  PREDICTED: hippocampus abundant transcript 1...    115   2e-26   
ref|XP_009617453.1|  PREDICTED: hippocampus abundant transcript 1...    115   2e-26   
ref|XP_009588092.1|  PREDICTED: hippocampus abundant transcript-l...    114   3e-26   
ref|XP_009407351.1|  PREDICTED: uncharacterized protein LOC103990...    114   4e-26   
ref|XP_010315398.1|  PREDICTED: hippocampus abundant transcript-l...    113   5e-26   
gb|KGN62272.1|  hypothetical protein Csa_2G347110                       112   1e-25   
gb|EMS58246.1|  Tetracycline resistance protein, class A                113   2e-25   
gb|KHG05703.1|  Hippocampus abundant transcript-like protein 1          112   2e-25   
ref|XP_006364509.1|  PREDICTED: hippocampus abundant transcript-l...    112   2e-25   
ref|XP_010548123.1|  PREDICTED: uncharacterized protein LOC104819660    112   4e-25   
ref|NP_001144256.1|  uncharacterized protein LOC100277128 precursor     111   4e-25   Zea mays [maize]
ref|XP_004242975.1|  PREDICTED: hippocampus abundant transcript-l...    111   5e-25   
gb|KGN62271.1|  hypothetical protein Csa_2G347100                       111   5e-25   
gb|AFW72716.1|  hypothetical protein ZEAMMB73_747947                    111   5e-25   
ref|XP_010918154.1|  PREDICTED: uncharacterized protein LOC105042...    110   7e-25   
gb|EEC78948.1|  hypothetical protein OsI_19397                          110   9e-25   Oryza sativa Indica Group [Indian rice]
gb|EEE63183.1|  hypothetical protein OsJ_17992                          110   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006409366.1|  hypothetical protein EUTSA_v10022689mg             110   1e-24   
gb|AFW72717.1|  hypothetical protein ZEAMMB73_747947                    110   1e-24   
dbj|BAJ86597.1|  predicted protein                                      110   1e-24   
gb|KCW68015.1|  hypothetical protein EUGRSUZ_F01701                     109   2e-24   
ref|XP_006297657.1|  hypothetical protein CARUB_v10013679mg             108   4e-24   
gb|EAY87003.1|  hypothetical protein OsI_08398                          108   7e-24   Oryza sativa Indica Group [Indian rice]
tpg|DAA46148.1|  TPA: hypothetical protein ZEAMMB73_581598              107   2e-23   
ref|XP_010467440.1|  PREDICTED: uncharacterized protein LOC104747...    106   3e-23   
ref|XP_010467439.1|  PREDICTED: uncharacterized protein LOC104747...    105   4e-23   
ref|XP_008668533.1|  PREDICTED: tetracycline transporter protein ...    107   4e-23   
ref|XP_010467438.1|  PREDICTED: uncharacterized protein LOC104747...    105   5e-23   
ref|XP_006409365.1|  hypothetical protein EUTSA_v10022688mg             104   7e-23   
ref|XP_004500909.1|  PREDICTED: hippocampus abundant transcript-l...    105   8e-23   
ref|XP_010515798.1|  PREDICTED: uncharacterized protein LOC104791...    104   8e-23   
ref|XP_006297712.1|  hypothetical protein CARUB_v10013741mg             104   1e-22   
ref|XP_009124108.1|  PREDICTED: hippocampus abundant transcript-l...    104   1e-22   
ref|XP_010515782.1|  PREDICTED: uncharacterized protein LOC104791...    104   2e-22   
ref|XP_006409364.1|  hypothetical protein EUTSA_v10022688mg             104   2e-22   
ref|NP_179290.3|  major facilitator protein                             103   3e-22   
ref|XP_002884030.1|  tetracycline transporter                           103   5e-22   
ref|NP_973476.1|  major facilitator protein                             103   5e-22   
ref|XP_011088648.1|  PREDICTED: hippocampus abundant transcript-l...    101   1e-21   
dbj|BAF00204.1|  putative tetracycline transporter protein              102   1e-21   
ref|XP_010489311.1|  PREDICTED: uncharacterized protein LOC104767...    102   1e-21   
ref|XP_010515758.1|  PREDICTED: uncharacterized protein LOC104791538    102   1e-21   
ref|XP_006299476.1|  hypothetical protein CARUB_v10015641mg             102   1e-21   
ref|XP_006648918.1|  PREDICTED: hippocampus abundant transcript 1...    101   2e-21   
ref|XP_008347370.1|  PREDICTED: hippocampus abundant transcript 1...    100   2e-21   
ref|XP_010467449.1|  PREDICTED: uncharacterized protein LOC104747...    100   2e-21   
ref|XP_010489313.1|  PREDICTED: uncharacterized protein LOC104767002    101   2e-21   
ref|XP_002884027.1|  hypothetical protein ARALYDRAFT_480580             100   3e-21   
ref|XP_009136357.1|  PREDICTED: uncharacterized protein LOC103860...    100   4e-21   
ref|XP_010467445.1|  PREDICTED: uncharacterized protein LOC104747...    100   4e-21   
ref|XP_010490360.1|  PREDICTED: uncharacterized protein LOC104768128    100   4e-21   
ref|XP_008357148.1|  PREDICTED: hippocampus abundant transcript 1...    100   5e-21   
ref|XP_006362772.1|  PREDICTED: uncharacterized protein LOC102586357  99.0    7e-21   
ref|XP_009136349.1|  PREDICTED: uncharacterized protein LOC103860...  99.8    8e-21   
ref|XP_010467437.1|  PREDICTED: uncharacterized protein LOC104747497  99.8    8e-21   
ref|XP_006828834.1|  hypothetical protein AMTR_s00001p00145830        97.1    1e-20   
ref|XP_002305536.2|  hypothetical protein POPTR_0004s18510g           98.6    1e-20   
ref|XP_009112409.1|  PREDICTED: hippocampus abundant transcript 1...  97.4    5e-20   
ref|XP_010467432.1|  PREDICTED: uncharacterized protein LOC104747...  97.4    7e-20   
ref|NP_179291.2|  major facilitator protein                           97.1    7e-20   
ref|XP_010515842.1|  PREDICTED: hippocampus abundant transcript 1...  96.3    2e-19   
ref|XP_009121173.1|  PREDICTED: uncharacterized protein LOC103846...  95.5    2e-19   
ref|XP_009121172.1|  PREDICTED: uncharacterized protein LOC103846...  95.5    3e-19   
ref|XP_010467436.1|  PREDICTED: uncharacterized protein LOC104747...  93.6    6e-19   
ref|XP_010467435.1|  PREDICTED: uncharacterized protein LOC104747...  94.4    9e-19   
gb|AAQ22617.1|  At2g16980                                             92.4    4e-18   
ref|XP_010467430.1|  PREDICTED: uncharacterized protein LOC104747...  89.7    4e-17   
gb|KFK40087.1|  hypothetical protein AALP_AA3G328800                  90.5    5e-17   
ref|XP_010515790.1|  PREDICTED: uncharacterized protein LOC104791...  86.7    2e-16   
emb|CDY31390.1|  BnaA07g03250D                                        86.3    4e-16   
ref|XP_002884029.1|  predicted protein                                84.7    1e-15   
ref|XP_009136351.1|  PREDICTED: uncharacterized protein LOC103860...  84.7    1e-15   
emb|CDO99892.1|  unnamed protein product                              81.6    3e-15   
ref|XP_002865559.1|  hypothetical protein ARALYDRAFT_917584           79.3    5e-15   
emb|CDO99890.1|  unnamed protein product                              80.9    7e-15   
gb|KGN62273.1|  hypothetical protein Csa_2G347120                     79.0    7e-15   
ref|XP_010467434.1|  PREDICTED: uncharacterized protein LOC104747...  82.0    1e-14   
gb|KFK40086.1|  hypothetical protein AALP_AA3G328800                  83.2    1e-14   
ref|XP_009112410.1|  PREDICTED: hippocampus abundant transcript 1...  80.1    5e-14   
emb|CDY02224.1|  BnaA03g39430D                                        80.1    6e-14   
ref|XP_008785091.1|  PREDICTED: hippocampus abundant transcript-l...  78.6    2e-13   
ref|XP_010918153.1|  PREDICTED: hippocampus abundant transcript-l...  75.9    1e-12   
ref|NP_179289.4|  tetracycline transporter-like protein 1             73.6    9e-12   
ref|XP_009802650.1|  PREDICTED: hippocampus abundant transcript-l...  72.4    2e-11   
ref|XP_009136350.1|  PREDICTED: uncharacterized protein LOC103860...  72.4    2e-11   
ref|XP_009124112.1|  PREDICTED: hippocampus abundant transcript-l...  71.6    3e-11   
ref|XP_010467431.1|  PREDICTED: uncharacterized protein LOC104747...  71.6    3e-11   
gb|AAM15009.1|  putative tetracycline transporter protein             70.5    8e-11   
ref|XP_003468440.1|  PREDICTED: hippocampus abundant transcript-l...  70.1    2e-10   
gb|ENN73221.1|  hypothetical protein YQE_10118                        69.3    2e-10   
gb|ERL84089.1|  hypothetical protein D910_01426                       68.9    4e-10   
gb|ERL84098.1|  hypothetical protein D910_01435                       68.9    4e-10   
ref|XP_010467443.1|  PREDICTED: uncharacterized protein LOC104747...  68.2    5e-10   
ref|XP_004452323.1|  PREDICTED: hippocampus abundant transcript-l...  68.6    5e-10   
ref|NP_649238.3|  CG5078                                              68.2    6e-10   
ref|XP_002085672.1|  GD14896                                          68.2    6e-10   
ref|XP_006717368.1|  PREDICTED: hippocampus abundant transcript-l...  67.4    9e-10   
ref|XP_008179803.1|  PREDICTED: hippocampus abundant transcript 1...  67.8    9e-10   
ref|XP_004442775.1|  PREDICTED: hippocampus abundant transcript-l...  67.8    9e-10   
dbj|BAG62308.1|  unnamed protein product                              66.6    9e-10   
gb|EAW92610.1|  hippocampus abundant transcript-like 1, isoform C...  64.7    1e-09   
ref|XP_007968012.1|  PREDICTED: hippocampus abundant transcript-l...  67.4    1e-09   
ref|NP_115947.2|  hippocampus abundant transcript-like protein 1      67.4    1e-09   
ref|XP_002820022.1|  PREDICTED: hippocampus abundant transcript-l...  67.4    1e-09   
ref|XP_009455214.1|  PREDICTED: hippocampus abundant transcript-l...  67.0    1e-09   
ref|XP_010373435.1|  PREDICTED: hippocampus abundant transcript-l...  67.0    1e-09   
gb|EHH24288.1|  Hippocampus abundant transcript-like protein 1        67.0    1e-09   
gb|EHH57523.1|  Hippocampus abundant transcript-like protein 1        67.0    1e-09   
gb|AAI06063.1|  Hippocampus abundant transcript-like 1                67.0    1e-09   
ref|NP_001181213.1|  hippocampus abundant transcript-like protein 1   67.0    1e-09   
ref|XP_005582340.1|  PREDICTED: hippocampus abundant transcript-l...  67.0    1e-09   
ref|XP_003260560.1|  PREDICTED: hippocampus abundant transcript-l...  67.0    1e-09   
ref|NP_598441.3|  hippocampus abundant transcript-like protein 1      67.0    2e-09   
ref|XP_008155111.1|  PREDICTED: hippocampus abundant transcript-l...  67.0    2e-09   
ref|XP_004048342.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  67.0    2e-09   
ref|XP_005385035.1|  PREDICTED: hippocampus abundant transcript-l...  67.0    2e-09   
gb|AAH33469.1|  Hippocampus abundant transcript-like 1                67.0    2e-09   
emb|CBY24621.1|  unnamed protein product                              67.0    2e-09   
ref|XP_008053481.1|  PREDICTED: hippocampus abundant transcript-l...  66.6    2e-09   
ref|XP_005892617.1|  PREDICTED: hippocampus abundant transcript-l...  66.6    2e-09   
ref|XP_008194638.1|  PREDICTED: hippocampus abundant transcript 1...  66.6    2e-09   
gb|EFA05115.1|  hypothetical protein TcasGA2_TC015216                 66.6    2e-09   
gb|ELR58660.1|  Hippocampus abundant transcript-like protein 1        66.2    2e-09   
ref|XP_007529249.1|  PREDICTED: hippocampus abundant transcript-l...  66.2    2e-09   
ref|NP_001077131.1|  hippocampus abundant transcript-like protein 1   66.2    3e-09   
ref|XP_005977372.1|  PREDICTED: hippocampus abundant transcript-l...  66.2    3e-09   
ref|XP_010851095.1|  PREDICTED: hippocampus abundant transcript-l...  66.2    3e-09   
ref|XP_008689077.1|  PREDICTED: hippocampus abundant transcript-l...  66.2    3e-09   
tpg|DAA27103.1|  TPA: hippocampus abundant transcript-like 1          66.2    3e-09   
ref|XP_004004514.1|  PREDICTED: hippocampus abundant transcript-l...  66.2    3e-09   
ref|XP_010851096.1|  PREDICTED: hippocampus abundant transcript-l...  66.2    3e-09   
ref|XP_006047602.1|  PREDICTED: hippocampus abundant transcript-l...  66.2    3e-09   
ref|XP_005683559.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  66.2    3e-09   
ref|XP_004393640.1|  PREDICTED: hippocampus abundant transcript-l...  66.2    3e-09   
ref|XP_006900786.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    3e-09   
ref|XP_006299583.1|  hypothetical protein CARUB_v10015760mg           65.9    3e-09   
ref|XP_009121174.1|  PREDICTED: uncharacterized protein LOC103846...  65.9    3e-09   
ref|XP_002708269.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    3e-09   
ref|XP_003795084.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    3e-09   
ref|XP_008255027.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    3e-09   
ref|XP_004766222.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    3e-09   
ref|XP_004643895.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    3e-09   
ref|XP_006922851.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    4e-09   
ref|XP_006742552.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    4e-09   
ref|XP_010609262.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    4e-09   
ref|XP_008848913.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  65.9    4e-09   
ref|XP_003995350.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    4e-09   
ref|XP_003938256.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    4e-09   
ref|XP_004384271.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    4e-09   
ref|XP_533564.3|  PREDICTED: hippocampus abundant transcript-like...  65.9    4e-09   
gb|ELK03383.1|  Hippocampus abundant transcript-like protein 1        65.9    4e-09   
ref|XP_006140634.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    4e-09   
gb|EAW92612.1|  hippocampus abundant transcript-like 1, isoform C...  65.5    4e-09   
ref|XP_004620186.1|  PREDICTED: hippocampus abundant transcript-l...  65.9    4e-09   
ref|XP_003912052.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  65.9    4e-09   
ref|XP_004803163.1|  PREDICTED: hippocampus abundant transcript-l...  65.5    4e-09   
ref|XP_006922852.1|  PREDICTED: hippocampus abundant transcript-l...  65.5    4e-09   
gb|EAW92611.1|  hippocampus abundant transcript-like 1, isoform C...  65.5    4e-09   
ref|XP_010489312.1|  PREDICTED: uncharacterized protein LOC104767...  65.5    4e-09   
ref|XP_004656580.1|  PREDICTED: hippocampus abundant transcript-l...  65.5    4e-09   
ref|NP_001230329.1|  hippocampus abundant transcript-like protein 1   65.5    5e-09   
ref|XP_004876777.1|  PREDICTED: hippocampus abundant transcript-l...  65.5    5e-09   
ref|XP_005616057.1|  PREDICTED: hippocampus abundant transcript-l...  65.5    5e-09   
ref|XP_006102258.1|  PREDICTED: hippocampus abundant transcript-l...  65.1    5e-09   
ref|XP_007951192.1|  PREDICTED: hippocampus abundant transcript-l...  65.5    5e-09   
ref|XP_007182462.1|  PREDICTED: hippocampus abundant transcript-l...  65.1    5e-09   
ref|XP_005881715.1|  PREDICTED: hippocampus abundant transcript-l...  65.1    5e-09   
ref|XP_004713979.1|  PREDICTED: hippocampus abundant transcript-l...  65.5    6e-09   
ref|XP_010598957.1|  PREDICTED: hippocampus abundant transcript-l...  65.1    6e-09   
ref|XP_007462843.1|  PREDICTED: hippocampus abundant transcript-l...  65.1    6e-09   
ref|XP_007182460.1|  PREDICTED: hippocampus abundant transcript-l...  65.1    6e-09   
ref|XP_002095441.1|  GE19692                                          65.1    6e-09   
gb|EPQ17285.1|  Hippocampus abundant transcript-like protein 1        65.1    6e-09   
ref|XP_007097412.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  65.1    6e-09   
ref|XP_004276872.1|  PREDICTED: hippocampus abundant transcript-l...  65.1    6e-09   
ref|XP_005321186.1|  PREDICTED: hippocampus abundant transcript-l...  65.1    7e-09   
ref|XP_007122354.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  64.7    8e-09   
ref|XP_008991417.1|  PREDICTED: hippocampus abundant transcript-l...  64.7    8e-09   
ref|XP_004322713.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  64.7    8e-09   
ref|XP_005605172.1|  PREDICTED: hippocampus abundant transcript-l...  64.3    1e-08   
ref|XP_008534891.1|  PREDICTED: hippocampus abundant transcript-l...  63.9    1e-08   
ref|XP_001957292.1|  GF20116                                          63.9    1e-08   
gb|EWM30276.1|  hippocampus abundant transcript 1                     64.3    1e-08   
ref|XP_004685105.1|  PREDICTED: hippocampus abundant transcript-l...  64.3    1e-08   
gb|EEE57537.1|  hypothetical protein OsJ_07859                        63.9    1e-08   
ref|NP_001100804.1|  hippocampus abundant transcript-like protein 1   63.9    2e-08   
ref|XP_009136353.1|  PREDICTED: uncharacterized protein LOC103860...  63.5    2e-08   
ref|XP_005371711.1|  PREDICTED: hippocampus abundant transcript-l...  63.9    2e-08   
ref|XP_009136358.1|  PREDICTED: uncharacterized protein LOC103860...  63.5    2e-08   
ref|XP_006209272.1|  PREDICTED: hippocampus abundant transcript-l...  63.5    2e-08   
ref|XP_007609087.1|  PREDICTED: hippocampus abundant transcript-l...  63.5    2e-08   
ref|XP_002026865.1|  GL12795                                          63.5    2e-08   
ref|XP_001973506.1|  GG16124                                          63.2    2e-08   
ref|XP_005078505.1|  PREDICTED: hippocampus abundant transcript-l...  63.5    2e-08   
ref|XP_007652260.1|  PREDICTED: hippocampus abundant transcript-l...  63.5    2e-08   
gb|ERE78691.1|  hippocampus abundant transcript-like protein 1        63.2    2e-08   
emb|CCD80846.1|  drug efflux protein-related                          62.8    3e-08   
ref|XP_008591367.1|  PREDICTED: hippocampus abundant transcript-l...  62.8    3e-08   
ref|XP_010960080.1|  PREDICTED: hippocampus abundant transcript-l...  60.8    3e-08   
ref|XP_004983781.1|  PREDICTED: hippocampus abundant transcript 1...  62.4    4e-08   
emb|CDY07888.1|  BnaC03g47340D                                        62.0    5e-08   
emb|CDY54428.1|  BnaCnng26960D                                        62.4    5e-08   
ref|XP_004591912.1|  PREDICTED: hippocampus abundant transcript-l...  62.0    5e-08   
emb|CAX74902.1|  Hippocampus abundant transcript 1 protein            62.4    5e-08   
emb|CAX74901.1|  Hippocampus abundant transcript 1 protein            62.4    6e-08   
emb|CAX74900.1|  Hippocampus abundant transcript 1 protein            62.4    6e-08   
emb|CAX74899.1|  Hippocampus abundant transcript 1 protein            62.4    6e-08   
ref|XP_006997532.1|  PREDICTED: hippocampus abundant transcript-l...  62.0    7e-08   
gb|KGB38627.1|  Hippocampus abundant transcript 1 protein             62.0    7e-08   
ref|XP_009858603.1|  PREDICTED: hippocampus abundant transcript 1...  61.6    9e-08   
ref|XP_010965794.1|  PREDICTED: LOW QUALITY PROTEIN: hippocampus ...  61.2    1e-07   
ref|XP_009121175.1|  PREDICTED: uncharacterized protein LOC103846...  60.8    1e-07   
ref|XP_004863999.1|  PREDICTED: hippocampus abundant transcript-l...  61.2    1e-07   
ref|XP_010973123.1|  PREDICTED: hippocampus abundant transcript-l...  61.2    1e-07   
gb|EPY77946.1|  hypothetical protein CB1_001157001                    60.8    2e-07   
ref|XP_009043957.1|  hypothetical protein LOTGIDRAFT_228011           60.5    2e-07   
gb|KIH49189.1|  hypothetical protein ANCDUO_20737                     57.8    3e-07   
ref|XP_006189099.1|  PREDICTED: uncharacterized protein LOC102524456  60.1    3e-07   
gb|AAC64231.1|  putative tetracycline transporter protein             60.1    3e-07   
emb|CDQ70513.1|  unnamed protein product                              60.1    3e-07   
ref|XP_009094347.1|  PREDICTED: hippocampus abundant transcript-l...  59.7    3e-07   
ref|XP_001369811.2|  PREDICTED: hippocampus abundant transcript-l...  59.7    3e-07   
emb|CAG07189.1|  unnamed protein product                              59.7    4e-07   
ref|XP_005423623.1|  PREDICTED: hippocampus abundant transcript-l...  59.3    4e-07   
ref|XP_006792287.1|  PREDICTED: hippocampus abundant transcript 1...  59.7    4e-07   
gb|ELW72272.1|  Hippocampus abundant transcript-like protein 1        59.3    5e-07   
ref|XP_003448540.2|  PREDICTED: hippocampus abundant transcript 1...  59.3    5e-07   
gb|ELU06448.1|  hypothetical protein CAPTEDRAFT_182946                59.3    5e-07   
gb|EFB16663.1|  hypothetical protein PANDA_021878                     59.3    5e-07   
ref|XP_002931117.1|  PREDICTED: hippocampus abundant transcript-l...  59.3    6e-07   
ref|XP_005110458.1|  PREDICTED: hippocampus abundant transcript 1...  58.9    6e-07   
ref|XP_007182461.1|  PREDICTED: hippocampus abundant transcript-l...  58.9    7e-07   
emb|CCD91441.1|  putative tetracycline-efflux transporter             58.9    7e-07   
ref|XP_009074311.1|  PREDICTED: hippocampus abundant transcript-l...  58.9    8e-07   
ref|WP_035639059.1|  MFS transporter                                  58.9    8e-07   
ref|WP_015809197.1|  MFS transporter                                  58.5    8e-07   
ref|NP_955878.1|  hippocampus abundant transcript 1 protein           58.5    8e-07   
ref|XP_005530117.1|  PREDICTED: hippocampus abundant transcript-l...  58.5    9e-07   
ref|XP_004555395.1|  PREDICTED: hippocampus abundant transcript 1...  58.5    9e-07   
ref|XP_004346353.1|  hippocampus abundant transcript 1 protein        58.9    9e-07   
ref|XP_011058067.1|  PREDICTED: hippocampus abundant transcript 1...  58.5    9e-07   
ref|XP_002135605.1|  GA28643                                          58.5    9e-07   
ref|XP_005936710.1|  PREDICTED: hippocampus abundant transcript 1...  58.5    1e-06   
ref|XP_011058068.1|  PREDICTED: hippocampus abundant transcript 1...  58.5    1e-06   
gb|AAH76868.1|  LOC445835 protein                                     58.5    1e-06   
ref|XP_003425499.1|  PREDICTED: hippocampus abundant transcript 1...  58.5    1e-06   
ref|XP_011058066.1|  PREDICTED: hippocampus abundant transcript 1...  58.5    1e-06   
gb|EGI63290.1|  Hippocampus abundant transcript 1 protein             58.2    1e-06   
ref|XP_008202701.1|  PREDICTED: hippocampus abundant transcript 1...  58.2    1e-06   
ref|WP_012794312.1|  MFS transporter                                  58.2    1e-06   
ref|XP_008202703.1|  PREDICTED: hippocampus abundant transcript 1...  58.2    1e-06   
ref|XP_010398249.1|  PREDICTED: hippocampus abundant transcript-l...  58.2    1e-06   
ref|XP_011058069.1|  PREDICTED: hippocampus abundant transcript 1...  58.2    1e-06   



>ref|XP_009773274.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Nicotiana sylvestris]
Length=441

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 187/232 (81%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G S+CS++ YING+Q TVVG+ KM+V+P LGQLSD+YGRKPLLLLT STTIIPF 
Sbjct  39   SALCPGNSTCSEAIYINGVQQTVVGIFKMLVLPILGQLSDEYGRKPLLLLTISTTIIPFG  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL INKS+GFVYAYYV++TISYIISQGSIFCIS+AYAADVVDE++RA  FSWITGLFSAS
Sbjct  99   LLTINKSKGFVYAYYVLRTISYIISQGSIFCISVAYAADVVDESSRAAVFSWITGLFSAS  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GN+ +RFL   Y I Q ++ LLIFVP+YM L L ETV+P+  V QS    SK  K  
Sbjct  159  HVMGNVLARFLPVGY-IFQVSIGLLIFVPIYMILFLEETVSPNTEVNQSSTVKSKALKVV  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +E+   +R    +V SSPTLKC  LVSFFY+LG+SGI SVL +YLK+AFGF+
Sbjct  218  QERYNSMRYAANIVTSSPTLKCISLVSFFYELGMSGISSVLLYYLKSAFGFN  269



>ref|XP_009594349.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Nicotiana 
tomentosiformis]
Length=417

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 186/232 (80%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G S+CS++ YING+Q TVVG+ KM+V+P LGQLSD+YGRKPLLLLT STTIIPF 
Sbjct  39   SALCPGNSTCSEAIYINGVQQTVVGIFKMLVLPILGQLSDEYGRKPLLLLTLSTTIIPFG  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL INKS+GFVYAYYV++TISYIISQGSIFCIS+AYAADVVDE++RA  FSWITGLFSAS
Sbjct  99   LLTINKSKGFVYAYYVLRTISYIISQGSIFCISVAYAADVVDESSRAAVFSWITGLFSAS  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GN+ +RFL   Y I Q ++ LLIFVP+Y+ L L ETV+P   V QS    SK  K  
Sbjct  159  HVMGNVLARFLPVGY-IFQVSIGLLIFVPVYLILLLEETVSPKTEVNQSSTVKSKALKVV  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +E+   +R    +V SSPTLKC  LVSFFY+LG+SGI SVL +YLK+AFGF+
Sbjct  218  QERYNSMRYAANIVTSSPTLKCISLVSFFYELGMSGISSVLLYYLKSAFGFN  269



>ref|XP_011076924.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Sesamum indicum]
Length=436

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 183/232 (79%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC G  +C Q+ YING+Q TVVG+ KM+V+P LGQL+D++GRKPLLL+T STTI+PF 
Sbjct  34   NALCPGHKTCPQAIYINGIQQTVVGIFKMIVLPLLGQLADEHGRKPLLLITVSTTIVPFT  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLAIN+S+  +YAYYV++TISYIISQGSIFCIS+AYAADV+D+  RA AFSWITGLFSAS
Sbjct  94   LLAINQSKASIYAYYVLRTISYIISQGSIFCISVAYAADVIDDDKRAAAFSWITGLFSAS  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL EDY I   ++ LLIFVP+YM+L L ETV P    +Q +PC +K  K  
Sbjct  154  HVLGNILARFLPEDY-IFAVSIALLIFVPIYMSLFLTETVRPTRKPDQHIPCLNKAFKIV  212

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +E+ Y ++    VV SS TLK   LVSFFY+LG+SGI SVL +YLK+ FGF+
Sbjct  213  QERYYSMKHAAHVVTSSSTLKRISLVSFFYELGMSGISSVLLYYLKSVFGFN  264



>ref|XP_010312533.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Solanum 
lycopersicum]
Length=441

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+++CS++ YING+Q TVVG+ KM+V+P LGQL+D+YGRKPLL+LT STTIIPF 
Sbjct  39   GALCPGKTTCSEAIYINGVQQTVVGIFKMIVLPILGQLADEYGRKPLLILTVSTTIIPFG  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL INKSR  VYAYYV++TISYIISQGSIFCIS+AYAADVVD ++RA  FSWITGLFSAS
Sbjct  99   LLTINKSREMVYAYYVLRTISYIISQGSIFCISVAYAADVVDVSSRAAVFSWITGLFSAS  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL   Y I Q ++ LLIFVP+YM L L ETV+P   V +S    S   K  
Sbjct  159  HVLGNVLARFLPVGY-IFQVSIGLLIFVPVYMTLFLEETVSPKTEVTRSSTLKSNTLKIV  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +E+   +R    +V SSPTLKC  LVSFFY+LG+SGI  VL +YLK+AFGF+
Sbjct  218  QERYNSMRYAANLVTSSPTLKCISLVSFFYELGMSGISGVLLYYLKSAFGFN  269



>ref|XP_006361454.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=441

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 180/232 (78%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+++CS++ YING+Q TVVG+ KM+V+P LGQL+D+YGRKPLL+LT STTIIPF 
Sbjct  39   GALCPGKTTCSEAIYINGVQQTVVGIFKMIVLPILGQLADEYGRKPLLILTVSTTIIPFG  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL INKSR  VYAYY+++TISYIISQGSIFCIS+AYAADVVD ++RA  FSWITGLFSAS
Sbjct  99   LLTINKSREMVYAYYILRTISYIISQGSIFCISVAYAADVVDVSSRAAVFSWITGLFSAS  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL   Y I Q ++ LLIFVP+YM + L ETV P   V QS    S   K  
Sbjct  159  HVLGNVLARFLPVGY-IFQVSIGLLIFVPVYMQVFLEETVAPKTEVSQSSTLKSNTLKIV  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +E+   +R    +V SSPTLKC  LVSFFY+LG+SGI  VL +YLK+AFGF+
Sbjct  218  KERYNSMRYAANLVTSSPTLKCISLVSFFYELGMSGISGVLLYYLKSAFGFN  269



>gb|EYU19784.1| hypothetical protein MIMGU_mgv1a006484mg [Erythranthe guttata]
Length=442

 Score =   278 bits (712),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 180/232 (78%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC GQ +C Q+ YING+Q TVVG+ KM+V+P LGQL+D+YGRKPLLLLT STTI PF 
Sbjct  42   NALCPGQLTCPQAIYINGIQQTVVGIFKMIVLPLLGQLADEYGRKPLLLLTVSTTIFPFT  101

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLAIN+S+G VYAYY ++T+SYIISQGSIFCIS+AYAADVVDE+ RA AFSWITGLFSAS
Sbjct  102  LLAINQSKGSVYAYYGIRTVSYIISQGSIFCISVAYAADVVDESRRAAAFSWITGLFSAS  161

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GNL +RFL E Y I + ++ LLIF  +YMA  L ETV P     Q++PC  K  +  
Sbjct  162  HVVGNLLARFLPE-YYIFEVSIALLIFCSVYMAKFLKETVRPTQTPAQNIPCLKKPFEIV  220

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +E+ Y ++    VV SS TLK   L+SFFY+LG+SGI  VL +YLK+AFGF+
Sbjct  221  KERYYSMKNAAYVVTSSSTLKRISLISFFYELGMSGISGVLLYYLKSAFGFN  272



>ref|XP_002266084.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Vitis 
vinifera]
 emb|CBI35249.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 181/231 (78%), Gaps = 1/231 (0%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G S+C++  YINGLQ TVVG+ KMVV+P LGQL+D+YGRKPLL++T ST+I PF +
Sbjct  34   ALCSGASTCAEVIYINGLQQTVVGIFKMVVLPVLGQLADEYGRKPLLMVTVSTSIFPFAV  93

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA NKS+GFVYAYYV++T+SYI+SQGSIFCIS+AY ADVV+++ RA AFSWITG+FSASH
Sbjct  94   LAWNKSKGFVYAYYVLRTVSYILSQGSIFCISVAYVADVVEDSKRAAAFSWITGIFSASH  153

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            VLGN+ +RFL E Y I + ++ LLIF P+YM L LVETV      +Q     +K+ K  +
Sbjct  154  VLGNVLARFLPEKY-IFEVSIALLIFGPVYMQLFLVETVRRAPRQDQHSTGCTKIFKVLQ  212

Query  154  EQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            E+C  ++    +V+SSPTLK   ++SFFY+LG+SGI  VL +YLKAAFGF+
Sbjct  213  ERCLSMKHAATLVLSSPTLKGISIISFFYELGMSGISGVLLYYLKAAFGFN  263



>ref|XP_007214409.1| hypothetical protein PRUPE_ppa026350mg [Prunus persica]
 gb|EMJ15608.1| hypothetical protein PRUPE_ppa026350mg [Prunus persica]
Length=436

 Score =   273 bits (697),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 177/232 (76%), Gaps = 2/232 (1%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC  QS+CSQ+ YING+Q TVVG+ KMVV+P LGQL+D+ GRKPLLLLT STTI PFVL
Sbjct  39   ALCPSQSTCSQAIYINGVQQTVVGLFKMVVLPLLGQLADERGRKPLLLLTVSTTIFPFVL  98

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA N+S+ FVYAYYV++T+SYI+SQGSIFCI++AY ADVV+E  RA  FSWITGLFSASH
Sbjct  99   LAWNQSKEFVYAYYVIRTVSYILSQGSIFCIAVAYVADVVNENKRAAVFSWITGLFSASH  158

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDG-GVEQSLPCPSKVKKFC  158
            VLGN+ +RFL E Y I   ++ LLIF P+YM + L ET+       +Q L C +K+    
Sbjct  159  VLGNVLARFLPEKY-IFAVSIALLIFCPVYMQMFLTETINKRAPKSDQGLSCLTKIVTII  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            R++   +R    +VVSSPTL+   LVSFFY LG+SGI SVL +YLKAAFGFD
Sbjct  218  RKRYASMRDAATIVVSSPTLRSISLVSFFYDLGMSGISSVLLYYLKAAFGFD  269



>ref|XP_008232010.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Prunus 
mume]
Length=439

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 176/232 (76%), Gaps = 2/232 (1%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC  QS+CSQ+ YING+Q TVVG+ KMVV+P LGQL+D++GRKPLLLLT STTI PF L
Sbjct  42   ALCPSQSTCSQAIYINGVQQTVVGLFKMVVLPLLGQLADEHGRKPLLLLTVSTTIFPFAL  101

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA N+S+ FVYAYYV++TISYI+SQGSIFCI++AY ADVV+E  RA  FSWITGLFSASH
Sbjct  102  LAWNQSKEFVYAYYVIRTISYILSQGSIFCIAVAYVADVVNENKRAAVFSWITGLFSASH  161

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDG-GVEQSLPCPSKVKKFC  158
            VLGN+ +RFL E Y I   ++ LLIF P+YM + L ET        +Q L C +K+    
Sbjct  162  VLGNVLARFLPEKY-IFSVSIALLIFCPVYMQMFLTETTNKRAPKSDQGLSCLTKIVTII  220

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            R++   +R    +VVSSPTL+   LVSFFY LG+SGI SVL +YLKAAFGFD
Sbjct  221  RKRYASMRNAATIVVSSPTLRSISLVSFFYDLGMSGISSVLLYYLKAAFGFD  272



>ref|XP_006436628.1| hypothetical protein CICLE_v10031562mg [Citrus clementina]
 ref|XP_006485217.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Citrus sinensis]
 gb|ESR49868.1| hypothetical protein CICLE_v10031562mg [Citrus clementina]
Length=439

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 175/232 (75%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC GQ +CS++ YI+GLQ TVVGV KMVV+P LGQL+D+YGRKPLLL+T STTI+PF 
Sbjct  38   NALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFT  97

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA N+S+ FVYAYYV++TISYIISQGSIFCI++AYAADVV+E  RATAFSWITGLFSAS
Sbjct  98   LLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAADVVNENKRATAFSWITGLFSAS  157

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL E Y I   ++ LLIFVP+YM   LVETV      +Q      K     
Sbjct  158  HVLGNVLARFLPEKY-IFPVSIALLIFVPVYMQFFLVETVESAPRKDQESSGLKKAVNVL  216

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   +R    +VVSSPTL+    VSFFY+LG+SGI +VL  YLKA FGF+
Sbjct  217  DRRYKSMRDAALMVVSSPTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFN  268



>emb|CDP20482.1| unnamed protein product [Coffea canephora]
Length=441

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 175/232 (75%), Gaps = 2/232 (1%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G S+C ++ Y+NGLQ TVVG+ KMVV+P LGQLSDDYGRKPLLL+T STTI PF 
Sbjct  40   DALCPGHSTCEEAIYLNGLQQTVVGIFKMVVLPVLGQLSDDYGRKPLLLITVSTTIFPFS  99

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL I+KS+ FVYAYYV++TIS+IISQGSIFCI+ AY ADV+D+  R T   W+ GLFSAS
Sbjct  100  LLIISKSKSFVYAYYVLRTISFIISQGSIFCIAAAYVADVIDDNKRTTGLCWMMGLFSAS  159

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL ED NI   ++ LLIF  LYMAL L ETVT     +Q LP   K  K  
Sbjct  160  HVLGNVLARFLPED-NIF-VSITLLIFCSLYMALFLPETVTSAPIGDQRLPFLKKAFKIV  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             ++   +R    +V+SSP LKC  L+SFFY+LG+SGIDSVL +YLKAAFGFD
Sbjct  218  EQRYNSMRRAAIIVISSPALKCISLISFFYELGMSGIDSVLLYYLKAAFGFD  269



>gb|KDP35841.1| hypothetical protein JCGZ_10322 [Jatropha curcas]
Length=269

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 177/231 (77%), Gaps = 1/231 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC G+S+C ++ Y+NGLQ TVVG+ KMVV+P LGQL+D+YGRKPLLLLT ST++IPF 
Sbjct  12   NALCPGESTCDEAIYLNGLQQTVVGIFKMVVLPLLGQLADEYGRKPLLLLTISTSMIPFA  71

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA N+SRGFVYA+YV++T+SY++SQGS+FCIS+AYAAD V E  RA AFSWITGLFSAS
Sbjct  72   LLAWNESRGFVYAFYVLRTVSYVLSQGSVFCISVAYAADFVKEGKRAAAFSWITGLFSAS  131

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            H+LGN+ +RFL ++Y I   ++ LLI  P+Y+   LVET+ P    +Q  P  S++ K  
Sbjct  132  HLLGNVVARFLPDNY-IFPVSVALLICCPVYLQFFLVETIEPTRSRDQDSPFFSRIIKLF  190

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
              +   +R  + +  SS TL+   ++SFFYQLG+SGI SVL +YLKAAFGF
Sbjct  191  HTRYESMRDAVIISFSSHTLRDISIISFFYQLGMSGISSVLFYYLKAAFGF  241



>ref|XP_009773275.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Nicotiana sylvestris]
Length=382

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  631  VVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISY  452
            VVG+ KM+V+P LGQLSD+YGRKPLLLLT STTIIPF LL INKS+GFVYAYYV++TISY
Sbjct  2    VVGIFKMLVLPILGQLSDEYGRKPLLLLTISTTIIPFGLLTINKSKGFVYAYYVLRTISY  61

Query  451  IISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAAL  272
            IISQGSIFCIS+AYAADVVDE++RA  FSWITGLFSASHV+GN+ +RFL   Y I Q ++
Sbjct  62   IISQGSIFCISVAYAADVVDESSRAAVFSWITGLFSASHVMGNVLARFLPVGY-IFQVSI  120

Query  271  CLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKC  92
             LLIFVP+YM L L ETV+P+  V QS    SK  K  +E+   +R    +V SSPTLKC
Sbjct  121  GLLIFVPIYMILFLEETVSPNTEVNQSSTVKSKALKVVQERYNSMRYAANIVTSSPTLKC  180

Query  91   ACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              LVSFFY+LG+SGI SVL +YLK+AFGF+
Sbjct  181  ISLVSFFYELGMSGISSVLLYYLKSAFGFN  210



>ref|XP_010681370.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 177/232 (76%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC  Q++CS++ Y+NG+Q TVVG+ KMVV+P LGQL+D+YGRKPLL++T STTI+PF 
Sbjct  43   RALCPAQTTCSEAIYLNGVQQTVVGIFKMVVLPLLGQLADEYGRKPLLIITLSTTILPFT  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLAI +SR FVYAYY ++TISYIISQGSIFCI++AYAADV++++ RA  FSWITGLFSAS
Sbjct  103  LLAIEQSREFVYAYYFLRTISYIISQGSIFCIAVAYAADVIEDSKRAATFSWITGLFSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL E Y I + ++ LLIF P+YM   L ETV      E      SK   F 
Sbjct  163  HVLGNMLARFLPEKY-IFKVSIALLIFCPVYMLFFLPETVKQRQREEPQSSLLSKFLTFP  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +++   ++    VV+SSPTL+   LVSFFY+LG+SGI SVL +YLKAAFGF+
Sbjct  222  KQRYNSMKYAATVVISSPTLRGISLVSFFYELGMSGISSVLLYYLKAAFGFN  273



>ref|XP_007010348.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY19158.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=447

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 175/231 (76%), Gaps = 1/231 (0%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC  QS+CS++ YI+G+Q TVVGVLKM+V+P LGQL+D+YGRKPLLLLT STTI+PF L
Sbjct  46   ALCPSQSTCSEAIYISGIQQTVVGVLKMLVLPLLGQLADEYGRKPLLLLTVSTTIVPFAL  105

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA N+SR FVY YYV++TISYIISQGSIFCI++AYAADVV   NRA  FS ITGLFSASH
Sbjct  106  LAWNQSREFVYIYYVLRTISYIISQGSIFCIAVAYAADVVSVRNRAAVFSLITGLFSASH  165

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            VLGN+ +RFL E Y I   ++ LLIF P+YM   LVETV  D   EQ   C +K  K   
Sbjct  166  VLGNVLARFLPEKY-IFLVSIVLLIFCPVYMQFFLVETVEIDTTREQDSGCLTKSMKVLN  224

Query  154  EQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            ++   ++    +V+SSPTL+    VSFFY+LG SGI S+L +YLKAAFGFD
Sbjct  225  KRYKSMKDAAGIVISSPTLRGISFVSFFYELGTSGITSILLYYLKAAFGFD  275



>ref|XP_010244469.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Nelumbo 
nucifera]
Length=443

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 173/232 (75%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC GQ +C ++ Y+ GLQ TVVG+ KM V+P LGQL+DDYGRKP+LLLT STTIIPF 
Sbjct  39   GALCPGQMTCPEAIYLTGLQQTVVGIFKMFVLPLLGQLADDYGRKPVLLLTISTTIIPFA  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA N+S+ FVYAYYV++TISYIISQGSIFCIS+AYAAD V+ + R  AF WITGLFS S
Sbjct  99   LLAWNESKEFVYAYYVLRTISYIISQGSIFCISVAYAADFVEGSKRVAAFGWITGLFSFS  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RF+ EDY I + ++ LLIF P+YM L LVETV      EQ   C + +    
Sbjct  159  HVLGNVLARFVPEDY-IFEVSILLLIFCPVYMQLFLVETVKRIPRNEQHSSCSTVISNVF  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            RE+   +R ++ VV+ S TLK   LVSFFY+LG+SGI SVL +YLK+ FGF 
Sbjct  218  RERFKSMRNSVNVVLRSETLKGIALVSFFYELGMSGISSVLLYYLKSVFGFS  269



>ref|XP_010067148.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Eucalyptus 
grandis]
 gb|KCW65211.1| hypothetical protein EUGRSUZ_G02698 [Eucalyptus grandis]
Length=459

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 176/232 (76%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC GQS+CSQ+ YING+Q TVVGV KMVV+P LGQL+D+ GRKP+LLLT STTI PF 
Sbjct  51   SALCPGQSTCSQAVYINGIQQTVVGVFKMVVLPLLGQLADECGRKPMLLLTLSTTIFPFA  110

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA+N+S+ FVYAYY ++T+SYIISQGSIFCIS+AYAADV++++ RA AFSWITGLFSAS
Sbjct  111  LLAMNQSKEFVYAYYAIRTVSYIISQGSIFCISVAYAADVIEDSKRAAAFSWITGLFSAS  170

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL E Y I   ++ LLI  P+Y+ L L ETV      +Q      K+ K  
Sbjct  171  HVLGNVLARFLPEKY-IFHVSIALLILCPVYIQLFLRETVKSTPKQDQESSTLGKIAKVL  229

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             ++   +R    +V SSP L+   LVSFFY+LG+SGI SVL +YLKAAFG++
Sbjct  230  HKRYTSMRNAATIVASSPALRGISLVSFFYELGMSGISSVLLYYLKAAFGYN  281



>ref|XP_007010347.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY19157.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=509

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 175/231 (76%), Gaps = 1/231 (0%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC  QS+CS++ YI+G+Q TVVGVLKM+V+P LGQL+D+YGRKPLLLLT STTI+PF L
Sbjct  109  ALCPSQSTCSEAIYISGIQQTVVGVLKMLVLPLLGQLADEYGRKPLLLLTVSTTIVPFAL  168

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA N+SR FVY YYV++TISYIISQGSIFCI++AYAADVV   NRA  FS ITGLFSASH
Sbjct  169  LAWNQSREFVYIYYVLRTISYIISQGSIFCIAVAYAADVVSVRNRAAVFSLITGLFSASH  228

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            VLGN+ +RFL E Y I   ++ LLIF P+YM   LVETV  D   EQ   C +K  K   
Sbjct  229  VLGNVLARFLPEKY-IFLVSIVLLIFCPVYMQFFLVETVEIDTTREQDSGCLTKSMKVLN  287

Query  154  EQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            ++   ++    +V+SSPTL+    VSFFY+LG SGI S+L +YLKAAFGFD
Sbjct  288  KRYKSMKDAAGIVISSPTLRGISFVSFFYELGTSGITSILLYYLKAAFGFD  338



>gb|KEH43443.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=387

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 169/232 (73%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC  QSSCS++ YINGLQ T+ G+ KM+V+P LGQLSDD+GRKP LLLT STTI PF 
Sbjct  40   TALCPQQSSCSKAIYINGLQETIAGIFKMMVLPLLGQLSDDHGRKPFLLLTMSTTIFPFA  99

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA N+S  FVYAYYV++TISYIIS+GSIFCIS+AY ADVV+E  RA  F WITGLFSAS
Sbjct  100  LLAWNQSEEFVYAYYVLRTISYIISKGSIFCISVAYVADVVNENKRAAVFGWITGLFSAS  159

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GN+ +RFL ++Y I   ++ LLIF P+YM   LVETV       Q L   SKV    
Sbjct  160  HVVGNVLARFLPQNY-IFVVSIALLIFCPVYMQFFLVETVKLAPRKNQELGFCSKVSYVV  218

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   +R   E+V+ SP L+   LVSFFY+LG+SGI +VL +YLKA FGF+
Sbjct  219  SRRYKSMRNAAEIVIFSPALRGMALVSFFYELGMSGITTVLLYYLKAVFGFN  270



>ref|XP_010681372.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 170/232 (73%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC  Q++CS+  Y+NGLQ TVVG+ KMVV+P LGQLSD+YGRKP+LL+T ST I PF 
Sbjct  43   RALCPDQTTCSEVIYLNGLQQTVVGIFKMVVLPLLGQLSDEYGRKPMLLITISTAIFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLAIN+SR FVYAYYV++TIS+IISQGSIFC ++AY ADV+++T RA  FSWITGLFSAS
Sbjct  103  LLAINQSREFVYAYYVLRTISHIISQGSIFCTAVAYTADVIEDTKRAATFSWITGLFSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL E Y I   ++ LL F P+Y+   L ETV      E      SK   F 
Sbjct  163  HVLGNVLARFLPEKY-IFHISIALLTFCPIYILFFLPETVKQKQKEELQSSLLSKFLAFP  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            + +   +R    VVVSSPTL+   LVSFFY+LG+SGI  VL +YLKAAFGF+
Sbjct  222  KARYNSMRYAANVVVSSPTLRGISLVSFFYELGMSGISYVLLYYLKAAFGFN  273



>ref|XP_006851495.1| hypothetical protein AMTR_s00040p00148020 [Amborella trichopoda]
 gb|ERN13076.1| hypothetical protein AMTR_s00040p00148020 [Amborella trichopoda]
Length=424

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 177/232 (76%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+S+CSQ+ Y++GLQ TVVGV KM V+P LGQL+D+YGRKP+LLLT ST+I+PF 
Sbjct  39   SALCPGKSTCSQAIYLSGLQQTVVGVFKMFVLPLLGQLADEYGRKPILLLTISTSIVPFA  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA +KS+ FVY YYV +TISYIISQGSIFCIS+AYAADVV+ + RATAF  ITGLFSAS
Sbjct  99   LLAWSKSKVFVYVYYVARTISYIISQGSIFCISVAYAADVVEVSKRATAFGCITGLFSAS  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL EDY I + ++CLLI   +Y+ L L+ETV     +EQ +P    V+   
Sbjct  159  HVLGNILARFLPEDY-IFEVSVCLLIISTVYLKLFLIETVNSSSRLEQHVPLMLMVQNVF  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             E+   ++ T+ VV    TLK   +VSFFY+LG+SGI SVL +YLK+AFGF 
Sbjct  218  NERWNSMKDTVTVVSHRGTLKHITIVSFFYELGMSGISSVLLYYLKSAFGFS  269



>ref|XP_004308556.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Fragaria vesca subsp. vesca]
Length=444

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 174/233 (75%), Gaps = 2/233 (1%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC   S+CSQ  YING+Q T+VG+ KMVV+P LGQL+D+ GRKP+LLLT STTI PF 
Sbjct  46   TALCPAHSTCSQPIYINGIQQTIVGLFKMVVLPILGQLADENGRKPVLLLTVSTTIFPFA  105

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA N+S+GFVYAYYV++TISYI+SQGSIFCI+IAY ADVV E NRA  FSWITGLFSAS
Sbjct  106  LLAWNQSKGFVYAYYVLRTISYILSQGSIFCIAIAYVADVVSENNRAAVFSWITGLFSAS  165

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDG-GVEQSLPCPSKVKKF  161
            HVLGN+ +RFL E Y I   ++ L+IF P+YM + LVET       ++Q L C +K    
Sbjct  166  HVLGNVLARFLPEIY-IFPVSIALMIFCPVYMQIFLVETTNKLAPQMDQDLSCLTKRVAI  224

Query  160  CREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              ++   +R   +VV+SS TL+   LVSFFY++G+SGI +VL +YLKA FGFD
Sbjct  225  IHKRYVSMRDAAKVVMSSSTLRSISLVSFFYEMGMSGISAVLLYYLKATFGFD  277



>ref|XP_002524989.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
 gb|EEF37396.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
Length=443

 Score =   260 bits (665),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 172/231 (74%), Gaps = 1/231 (0%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQS+C+Q+ YI+GLQ  VVG+ KMVV+P LGQL+D+YGRKP LLLT ST+I PF L
Sbjct  44   ALCPGQSTCAQAIYISGLQQVVVGIFKMVVLPLLGQLADEYGRKPFLLLTVSTSIFPFAL  103

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++SRGFVYAYYV++TISYI+SQGSIFCIS+AYAAD V E  RA  FSW+TGLFSASH
Sbjct  104  LAYDQSRGFVYAYYVLRTISYILSQGSIFCISVAYAADFVQEDKRAAVFSWMTGLFSASH  163

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            VLGN+ +RFL E Y I   ++ LLIF P+YM   LVETV      +Q+    +K+ K   
Sbjct  164  VLGNILARFLPEKY-IFLVSIALLIFGPIYMQFFLVETVERAQRKDQNSTFLTKIIKVFH  222

Query  154  EQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             +   +R    +V SSPTL+    VSFFY+LG+SGI++VL  YLK+ FGF+
Sbjct  223  TRYKSMRDAAIIVFSSPTLRGISFVSFFYELGMSGINAVLLFYLKSVFGFN  273



>gb|KEH43442.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=436

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 169/232 (73%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC  QSSCS++ YINGLQ T+ G+ KM+V+P LGQLSDD+GRKP LLLT STTI PF 
Sbjct  40   TALCPQQSSCSKAIYINGLQETIAGIFKMMVLPLLGQLSDDHGRKPFLLLTMSTTIFPFA  99

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA N+S  FVYAYYV++TISYIIS+GSIFCIS+AY ADVV+E  RA  F WITGLFSAS
Sbjct  100  LLAWNQSEEFVYAYYVLRTISYIISKGSIFCISVAYVADVVNENKRAAVFGWITGLFSAS  159

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GN+ +RFL ++Y I   ++ LLIF P+YM   LVETV       Q L   SKV    
Sbjct  160  HVVGNVLARFLPQNY-IFVVSIALLIFCPVYMQFFLVETVKLAPRKNQELGFCSKVSYVV  218

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   +R   E+V+ SP L+   LVSFFY+LG+SGI +VL +YLKA FGF+
Sbjct  219  SRRYKSMRNAAEIVIFSPALRGMALVSFFYELGMSGITTVLLYYLKAVFGFN  270



>gb|KDP35836.1| hypothetical protein JCGZ_10317 [Jatropha curcas]
Length=444

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 172/232 (74%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC GQ++CSQ+ YI+GLQ TVVG+ KMVV+P LGQL+D+YGRKP LLLT ST+I PF 
Sbjct  43   SALCPGQTTCSQAIYISGLQQTVVGIFKMVVLPLLGQLADEYGRKPFLLLTVSTSIFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA ++++ FVYAYYV++TIS+I+SQGSIFCIS+AYAAD+V E  RA  FSW+TGLFSAS
Sbjct  103  LLAYSQTKEFVYAYYVLRTISFILSQGSIFCISVAYAADIVKENKRAAVFSWMTGLFSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GN+ +RFL   Y I   ++ LLIF P YM   LVETV      EQ     +K+ K  
Sbjct  163  HVIGNVLARFLPWRY-IFTVSIILLIFGPFYMQFFLVETVERAQRKEQKSNLLTKIVKVS  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            R++   +R    VV SSPTL+    VSFFY+LG+SGI +VL +YLK+ FGF 
Sbjct  222  RKRYESMRDAATVVFSSPTLRGITFVSFFYELGMSGISAVLLYYLKSVFGFS  273



>emb|CAN74055.1| hypothetical protein VITISV_026070 [Vitis vinifera]
Length=467

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 177/240 (74%), Gaps = 17/240 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV-  518
            ALC G S+C++  YINGLQ TVVG+ KMVV+P LGQL+D+YGRKPLL       ++P+V 
Sbjct  34   ALCSGASTCAEVIYINGLQQTVVGIFKMVVLPVLGQLADEYGRKPLL-------MVPYVF  86

Query  517  --------LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSW  362
                    +LA NKS+GFVYAYYV++T+SYI+SQGSIFCIS+AY ADVV+++ RA AFSW
Sbjct  87   IAHVPVSAVLAWNKSKGFVYAYYVLRTVSYILSQGSIFCISVAYVADVVEDSKRAAAFSW  146

Query  361  ITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPC  182
            ITG+FSASHVLGN+ +RFL E Y I + ++ LLIF P+YM L LVETV      +Q    
Sbjct  147  ITGIFSASHVLGNVLARFLPEKY-IFEVSIALLIFGPVYMQLFLVETVRRAPRQDQHSTG  205

Query  181  PSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             +K+ K  +E+C  ++    +V+SSPTLK   ++SFFY+LG+SGI  VL +YLKAAFGF+
Sbjct  206  CTKIFKVLQERCLSMKHAATLVLSSPTLKGISIISFFYELGMSGISGVLLYYLKAAFGFN  265



>ref|XP_003591772.1| Hippocampus abundant transcript-like protein [Medicago truncatula]
 gb|AES62023.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=441

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 169/232 (73%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC  QSSCS++ YINGLQ T+ G+ KM+V+P LGQLSDD+GRKP LLLT STTI PF 
Sbjct  40   TALCPQQSSCSKAIYINGLQETIAGIFKMMVLPLLGQLSDDHGRKPFLLLTMSTTIFPFA  99

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA N+S  FVYAYYV++TISYIIS+GSIFCIS+AY ADVV+E  RA  F WITGLFSAS
Sbjct  100  LLAWNQSEEFVYAYYVLRTISYIISKGSIFCISVAYVADVVNENKRAAVFGWITGLFSAS  159

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GN+ +RFL ++Y I   ++ LLIF P+YM   LVETV       Q L   SKV    
Sbjct  160  HVVGNVLARFLPQNY-IFVVSIALLIFCPVYMQFFLVETVKLAPRKNQELGFCSKVSYVV  218

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   +R   E+V+ SP L+   LVSFFY+LG+SGI +VL +YLKA FGF+
Sbjct  219  SRRYKSMRNAAEIVIFSPALRGMALVSFFYELGMSGITTVLLYYLKAVFGFN  270



>ref|XP_011032839.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Populus euphratica]
Length=444

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 171/232 (74%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC GQ+ CS++ YI+GLQ TVVG+ KMVV+PFLGQL+D+YGRKPLLL+T ST+I PF 
Sbjct  43   SALCPGQTKCSEAIYISGLQQTVVGIFKMVVLPFLGQLADEYGRKPLLLITVSTSIFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N+SRG VY YYV++TIS+IISQGSIFCI++AYAAD+++E NRA AFSWITG FSAS
Sbjct  103  VLAWNQSRGSVYVYYVLRTISFIISQGSIFCIAVAYAADIIEEGNRAAAFSWITGFFSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGNL +RFL E Y I   ++  LIF P+YM   L ETV      ++     +K+    
Sbjct  163  HVLGNLLARFLPEQY-IFVVSIAFLIFSPVYMHFLLAETVEQVPKRDRDSTFLTKIINVA  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             ++   +R    VV  SPTL+    VSFFY+LG+SGI SVL  YLKA FGF+
Sbjct  222  HKRYESMRDAAAVVFESPTLRGISFVSFFYELGMSGISSVLLFYLKAVFGFN  273



>ref|XP_010088768.1| Hippocampus abundant transcript-like protein 1 [Morus notabilis]
 gb|EXB36951.1| Hippocampus abundant transcript-like protein 1 [Morus notabilis]
Length=793

 Score =   266 bits (680),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 176/231 (76%), Gaps = 1/231 (0%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQS+CS++ YING+Q T+VGV KMVV+P LGQL+D++GRKPLLL+T STTIIPF L
Sbjct  42   ALCPGQSTCSEAIYINGIQQTIVGVFKMVVLPLLGQLADEHGRKPLLLVTVSTTIIPFAL  101

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA N+S+ FVYAYYV++TISYIISQGSIFCI++AY ADVV ++ RA  FSWITGLFSASH
Sbjct  102  LAWNQSKEFVYAYYVLRTISYIISQGSIFCIAVAYTADVVSDSKRAAVFSWITGLFSASH  161

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            VLGN+ +RFL E Y I   ++ LLIF P+YM L L ETV P     +   C     K  +
Sbjct  162  VLGNVLARFLPEKY-IFLVSIALLIFGPVYMQLFLKETVKPAPRTNRDSDCLRWTLKVVQ  220

Query  154  EQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            ++   ++    +V+SS TL+   LVSFFY+LG+SGI SVL +YLKAAFGF+
Sbjct  221  KRFRAMKDAATLVISSQTLRSISLVSFFYELGMSGISSVLLYYLKAAFGFN  271



>ref|XP_006361453.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=439

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 169/232 (73%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC  +S+CSQ+ YINGLQ  VVG+ KMVV+P LGQL+D+YGRKPLLLL  ST I P  
Sbjct  40   NALCPSKSTCSQAIYINGLQQMVVGICKMVVIPVLGQLADEYGRKPLLLLIVSTAIFPSA  99

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LAI++S+GFVYAYYV++ IS+I+SQGSIFCIS AYAAD++D  +RA AF WI G+ S S
Sbjct  100  ILAIDESKGFVYAYYVLRIISHIMSQGSIFCISAAYAADILDGRSRAAAFGWIHGILSLS  159

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGNL +R L   Y I + ++ LLI  P+YM + L ETV     + Q L   SK  K  
Sbjct  160  HVLGNLLARLLPGTY-IFEVSVALLIIAPVYMIIFLTETVKLTPNLNQHLRWSSKAYKLV  218

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +++   +R  L VV SS TLKC CLVSFFY +G+SGI SVL +YLK+AF F+
Sbjct  219  QDRYSSMRYALHVVTSSSTLKCICLVSFFYDMGMSGISSVLMYYLKSAFDFN  270



>ref|XP_002311018.2| hypothetical protein POPTR_0008s02280g [Populus trichocarpa]
 gb|EEE88385.2| hypothetical protein POPTR_0008s02280g [Populus trichocarpa]
Length=444

 Score =   255 bits (651),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 171/232 (74%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC GQ++CS++ YI+GLQ TVVG+ KMVV+P LGQL+D+YGRKPLLL+T ST+I PF 
Sbjct  43   SALCPGQTTCSEAIYISGLQQTVVGIFKMVVLPLLGQLADEYGRKPLLLITVSTSIFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N+SRG VY YYV++TIS+IISQGSIFCI++AYAAD+++E NRA AFSWITG FSAS
Sbjct  103  VLAWNQSRGSVYVYYVLRTISFIISQGSIFCIAVAYAADIIEEGNRAAAFSWITGFFSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGNL +RFL E Y I   ++  LIF P+YM   L ETV      ++     +++    
Sbjct  163  HVLGNLLARFLPEKY-IFVVSIAFLIFSPVYMHFLLAETVEQVPKRDRDSTFLTRIINVA  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             ++   +R    VV  SPTL+    VSFFY+LG+SGI SVL  YLKA FGF+
Sbjct  222  HKRYESMRDAAAVVFKSPTLRGISFVSFFYELGMSGISSVLLFYLKAVFGFN  273



>ref|XP_003535506.2| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Glycine max]
Length=450

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 172/232 (74%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+S+CS++ YING+Q T+VG+ KMVV+P LGQLSD+YGRKPLLL+T ST I PFV
Sbjct  48   SALCPGESTCSKAIYINGVQQTIVGIFKMVVLPLLGQLSDEYGRKPLLLITISTAIFPFV  107

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL  ++S  +VYAYYV++TIS IISQGSIFCIS+AYAADVV+E+ RA  F WITGL SAS
Sbjct  108  LLVWHQSEEYVYAYYVLRTISNIISQGSIFCISVAYAADVVNESKRAAVFGWITGLLSAS  167

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLG++ +  L E Y I   ++ LL   P+YM   LVETV P    ++   C +K+    
Sbjct  168  HVLGDVLAWSLPEKY-IFAVSIVLLTSCPVYMKFFLVETVIPAPKNDRESGCWAKIVDVP  226

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            R++   +R   E+V+ SPTL+   LVSFFY+LG+SGI SVL +YLKA FGF+
Sbjct  227  RQRYISMRRAAEIVIFSPTLRGMALVSFFYELGMSGISSVLLYYLKAVFGFN  278



>gb|KHN37831.1| Hippocampus abundant transcript-like protein 1 [Glycine soja]
Length=442

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 171/232 (74%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+S+CS++ YING Q T+VG+ KMVV+P LGQLSD+YGRKPLLL+T ST I PFV
Sbjct  40   SALCPGESTCSKAIYINGFQQTIVGIFKMVVLPLLGQLSDEYGRKPLLLITISTAIFPFV  99

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL  ++S  +VYAYYV++TIS IISQGSIFCIS+AYAADVV+E+ RA  F WITGL SAS
Sbjct  100  LLVWHQSEEYVYAYYVLRTISNIISQGSIFCISVAYAADVVNESKRAAVFGWITGLLSAS  159

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLG++ +  L E Y I   ++ LL   P+YM   LVETV P    ++   C +K+    
Sbjct  160  HVLGDVLAWSLPEKY-IFAVSIVLLTSCPVYMKFFLVETVIPAPKNDRESGCWAKIVDVP  218

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            R++   +R   E+V+ SPTL+   LVSFFY+LG+SGI SVL +YLKA FGF+
Sbjct  219  RQRYISMRRAAEIVIFSPTLRGMALVSFFYELGMSGISSVLLYYLKAVFGFN  270



>ref|XP_003591771.1| Hippocampus abundant transcript-like protein [Medicago truncatula]
 gb|AES62022.1| hippocampus abundant transcript-like protein [Medicago truncatula]
Length=442

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 170/232 (73%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC  QSSCS++ YINGLQ T+ G+ KM V+P LGQLSD++GRKPLLLLT ST+IIPF 
Sbjct  40   TALCPQQSSCSKAIYINGLQQTITGIFKMAVLPLLGQLSDEHGRKPLLLLTISTSIIPFA  99

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA N+S+ FVYAYYV++T S+IISQGSIFCIS+AY ADVV E+ R   FSWITGL SA+
Sbjct  100  LLAWNQSKEFVYAYYVLRTFSHIISQGSIFCISVAYVADVVHESKRVAVFSWITGLSSAA  159

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+ N+ +RFL ++Y I   ++ LL F PLYM   LVETV  D G  Q L   ++V    
Sbjct  160  HVIANVFARFLPQNY-IFVVSITLLTFCPLYMHFFLVETVKLDPGKNQELGFCTRVIYVL  218

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   +R   E+V+ SPTL+   LVSFFY+LG++GI SVL +YLKA FGF+
Sbjct  219  SRRYKSMRNAAEIVIFSPTLRGVALVSFFYKLGMTGIHSVLLYYLKAVFGFN  270



>ref|XP_004250476.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Solanum lycopersicum]
Length=439

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 171/234 (73%), Gaps = 5/234 (2%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC  +S+CSQ+ YINGLQ  VVG+ KMVV+P LGQL+D+YGRKPLLLL  ST I P  
Sbjct  40   NALCPSKSTCSQAIYINGLQQMVVGICKMVVIPVLGQLADEYGRKPLLLLIVSTAIFPSA  99

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LAI++S+GFVYAYYV++ IS+I+SQGSIFCIS AYAAD++D  +RA AF W+ G+ S S
Sbjct  100  ILAIDESKGFVYAYYVLRMISHIMSQGSIFCISAAYAADILDGRSRAAAFGWMHGILSLS  159

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV--TPDGGVEQSLPCPSKVKK  164
            HVLGN  +R L   Y I + ++ LLI  P+YM + L ETV  TPD  V Q L   SK  +
Sbjct  160  HVLGNFLARLLPGTY-IFEVSVALLIIAPMYMLIFLTETVKLTPD--VNQHLRWSSKAYQ  216

Query  163  FCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +++   +R  L VV SS TLKC CLVSFFY +G+SGI SVL +YLK+AF F+
Sbjct  217  LVQDRYSSMRYALHVVTSSSTLKCICLVSFFYDMGMSGISSVLMYYLKSAFDFN  270



>ref|XP_011076925.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011076926.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Sesamum indicum]
Length=375

 Score =   250 bits (639),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 162/204 (79%), Gaps = 1/204 (0%)
 Frame = -2

Query  613  MVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGS  434
            M+V+P LGQL+D++GRKPLLL+T STTI+PF LLAIN+S+  +YAYYV++TISYIISQGS
Sbjct  1    MIVLPLLGQLADEHGRKPLLLITVSTTIVPFTLLAINQSKASIYAYYVLRTISYIISQGS  60

Query  433  IFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFV  254
            IFCIS+AYAADV+D+  RA AFSWITGLFSASHVLGN+ +RFL EDY I   ++ LLIFV
Sbjct  61   IFCISVAYAADVIDDDKRAAAFSWITGLFSASHVLGNILARFLPEDY-IFAVSIALLIFV  119

Query  253  PLYMALHLVETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSF  74
            P+YM+L L ETV P    +Q +PC +K  K  +E+ Y ++    VV SS TLK   LVSF
Sbjct  120  PIYMSLFLTETVRPTRKPDQHIPCLNKAFKIVQERYYSMKHAAHVVTSSSTLKRISLVSF  179

Query  73   FYQLGISGIDSVLPHYLKAAFGFD  2
            FY+LG+SGI SVL +YLK+ FGF+
Sbjct  180  FYELGMSGISSVLLYYLKSVFGFN  203



>ref|XP_007143809.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
 gb|ESW15803.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
Length=448

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 171/232 (74%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G S+CS++ YINGLQ T+VGV KMVV+P LGQLSD++GRKPLLL T ST+I PF 
Sbjct  47   SALCPGDSTCSKAIYINGLQQTIVGVFKMVVLPLLGQLSDEHGRKPLLLFTISTSIFPFA  106

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL   +S  FVYAYYV++TIS IISQGSIFCIS+AY ADVV+E+ RA  FSWI+GL SAS
Sbjct  107  LLVWRQSEEFVYAYYVLRTISNIISQGSIFCISVAYVADVVNESKRAAVFSWISGLLSAS  166

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLG+L +RFL E Y I   ++ LLI  P+YM   LVE++      ++   C +K+    
Sbjct  167  HVLGDLLARFLPEKY-IFAVSIVLLIVCPVYMKFFLVESMILAPKNDRESGCWAKIVNVP  225

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +++   +R   E+V+ SPTL+   LVSFFY+LG+SGI SVL +YLKA FGF+
Sbjct  226  QQRFKSMRRAAEIVIFSPTLRGMALVSFFYELGMSGISSVLLYYLKAVFGFN  277



>gb|EPS69092.1| hypothetical protein M569_05672, partial [Genlisea aurea]
Length=441

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 174/233 (75%), Gaps = 2/233 (1%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC  Q +CS++ Y+NG+Q TVVG+ KM+V+P +GQL+D+YGRKPLLLLT STTI PF 
Sbjct  35   NALCPAQKTCSEAIYLNGIQQTVVGIFKMIVLPLMGQLADEYGRKPLLLLTISTTIFPFA  94

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDE-TNRATAFSWITGLFSA  341
            L+A+N+SRG VYAYY ++TI  ++SQGSIF ISI YAADVVD+ + RA  FSW+TGL SA
Sbjct  95   LIAVNQSRGAVYAYYAIRTICNVLSQGSIFTISIIYAADVVDDGSKRAVVFSWMTGLMSA  154

Query  340  SHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKF  161
            SHV+G+L +RFL   Y I +A   LLIF P+Y++L L ETV     ++Q+LP   K  K 
Sbjct  155  SHVVGDLIARFLPSQY-IFEACSSLLIFCPIYLSLFLQETVVRSEKLDQNLPLLRKTVKV  213

Query  160  CREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             R++ + ++  +++V  S  LKC  LVSFFY+LG S I+SVL +YLK+ FGF+
Sbjct  214  VRDRFHSMKHAVDIVTDSSILKCISLVSFFYELGTSAINSVLSYYLKSVFGFN  266



>ref|XP_009416863.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Musa 
acuminata subsp. malaccensis]
Length=447

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 173/232 (75%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+ SC+++ YI GLQ TVVGV KMVV+P LGQL+D+YGRKPLLL+T ST+I+PF 
Sbjct  39   GALCPGERSCAEAIYITGLQQTVVGVFKMVVLPILGQLADEYGRKPLLLITISTSIVPFA  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA + SR  VY Y+V++TISYIISQGSI CISIAYAADV++   R+ AF WITGLFSA+
Sbjct  99   ILAWDDSRAAVYWYFVLRTISYIISQGSILCISIAYAADVIEVGKRSAAFGWITGLFSAA  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL E + I + ++CLL+   LY+ + LVETV       ++  C S V K  
Sbjct  159  HVLGNILARFLPEGW-IFEVSICLLVCSTLYLKIFLVETVMVSPRQSENRSCSSIVLKVF  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             E+ Y ++  + V+ SS TLKC   +SFFY+LG+SGI SVL +YLK+AFGF+
Sbjct  218  VERWYSMKDNIFVINSSATLKCISSISFFYELGMSGISSVLLYYLKSAFGFN  269



>gb|AFK40263.1| unknown [Medicago truncatula]
Length=442

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 170/232 (73%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC  QSSCS++ YING+Q T+ G+ KM V+P LGQLSD++GRKPLLLLT ST+IIPF 
Sbjct  40   TALCPQQSSCSKAIYINGVQQTITGIFKMAVLPLLGQLSDEHGRKPLLLLTISTSIIPFA  99

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA N+S+ FVYAYYV++T S+IISQGSIFCIS+AY ADVV E+ R   FSWITGL SA+
Sbjct  100  LLAWNQSKEFVYAYYVLRTFSHIISQGSIFCISVAYVADVVHESKRVAVFSWITGLSSAA  159

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+ N+ +RFL ++Y I   ++ LL F PLYM   LVETV  D G  Q L   ++V    
Sbjct  160  HVIANVFARFLPQNY-IFVVSITLLTFCPLYMHFFLVETVKLDPGKNQELGFCTRVIYVL  218

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   +R   E+V+ SPTL+   LVSFFY+LG++GI SVL +YLKA FGF+
Sbjct  219  SRRYKSMRNAAEIVIFSPTLRGVALVSFFYKLGMTGIHSVLLYYLKAVFGFN  270



>ref|XP_002524988.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
 gb|EEF37395.1| Hippocampus abundant transcript 1 protein, putative [Ricinus 
communis]
Length=442

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 168/232 (72%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G S+CSQ+ Y++GLQ TVVG+ KMVV+P LGQL+D++GRKP LLLT ST+IIPF 
Sbjct  43   DALCPGDSTCSQAIYLSGLQQTVVGIFKMVVLPLLGQLADEHGRKPFLLLTISTSIIPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L  N+S+GFVYAYYV+ TISYI+SQGSIFCI++AYAAD V E  R  AFSWITGLFSAS
Sbjct  103  VLVWNQSKGFVYAYYVLHTISYILSQGSIFCIAVAYAADFVKEGKRVAAFSWITGLFSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            H+LGN+ +R L E Y I   ++ LLI  PLYM   LVET+ P    +Q     +K  K  
Sbjct  163  HLLGNVLARLLPEKY-IFMVSVALLICCPLYMQFFLVETIQPAQRRDQDSTFLTKTIKVL  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   ++    +V SS TL+    VSFFY+LG+SGI +VL +YLKAAFGF 
Sbjct  222  HTRYKSMKDAATIVFSSHTLRGISFVSFFYELGMSGISTVLFYYLKAAFGFS  273



>ref|XP_007143808.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
 gb|ESW15802.1| hypothetical protein PHAVU_007G103300g [Phaseolus vulgaris]
Length=448

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 172/232 (74%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G S+CS++ YINGLQ T+VGV KMVV+P LGQLSD++GRKPLLL T ST+I PF 
Sbjct  47   SALCPGDSTCSKAIYINGLQQTIVGVFKMVVLPLLGQLSDEHGRKPLLLFTISTSIFPFA  106

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL   +S  FVYAYYV++TIS IISQGSIFCIS+AY ADVV+E+ RA  FSWI+GL SAS
Sbjct  107  LLVWRQSEEFVYAYYVLRTISNIISQGSIFCISVAYVADVVNESKRAAVFSWISGLLSAS  166

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLG+L +RFL E+ +  Q ++ LLI  P+YM   LVE++      ++   C +K+    
Sbjct  167  HVLGDLLARFLPEN-STFQVSIVLLIVCPVYMKFFLVESMILAPKNDRESGCWAKIVNVP  225

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +++   +R   E+V+ SPTL+   LVSFFY+LG+SGI SVL +YLKA FGF+
Sbjct  226  QQRFKSMRRAAEIVIFSPTLRGMALVSFFYELGMSGISSVLLYYLKAVFGFN  277



>ref|XP_002315443.2| hypothetical protein POPTR_0010s24380g [Populus trichocarpa]
 gb|EEF01614.2| hypothetical protein POPTR_0010s24380g [Populus trichocarpa]
Length=668

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 171/232 (74%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC GQ++CS+  YI+GLQ TVVG+ KMVV+P LGQL+D+YGRKPLLL+T ST++ PF 
Sbjct  12   SALCPGQTTCSEVIYISGLQQTVVGIFKMVVIPLLGQLADEYGRKPLLLITVSTSMFPFA  71

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N+SR  VY YYV++TIS+I+SQGSIFCI++AYAAD++ E NRATAFSWITG FSAS
Sbjct  72   VLACNQSRDAVYVYYVLRTISFILSQGSIFCIAVAYAADIIKEENRATAFSWITGFFSAS  131

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GNL +RFL E Y I   ++ LLIF  +YM   LVETV      E+     +K+    
Sbjct  132  HVVGNLLARFLPEKY-IFVVSIALLIFGSVYMYFFLVETVERVDKRERDSTFLTKIINVT  190

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            R++   +R    VV  SPTLK    VSFFY+LG+SGI SVL  YLKA FGF+
Sbjct  191  RKRYESMRYAAVVVFRSPTLKIISFVSFFYELGMSGISSVLLFYLKAVFGFN  242



>ref|XP_010681371.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   248 bits (632),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 167/232 (72%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC   + CS+  Y+NGLQ TVVG+ KMV++P LGQL+D+YGRKPLLL+T ST I PF 
Sbjct  43   RALCPAHTICSEPIYLNGLQQTVVGIFKMVILPLLGQLADEYGRKPLLLITLSTAIFPFT  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLAIN+SR  VY YYV++TIS IIS GSIFCI++AYAADVV+++ RAT F WITGLFSAS
Sbjct  103  LLAINQSREVVYGYYVLRTISQIISHGSIFCITVAYAADVVEDSKRATTFGWITGLFSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN  +RFL E + I Q ++ LLIF  +YM   L ET+      E      SK     
Sbjct  163  HVLGNGLARFLPERH-IFQVSVSLLIFAVVYMQFFLPETIKQRQREELQSSLLSKFMTSP  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +++   ++    VVV+SPTL+   LVSFFY+LG+SGI SVL +YLKAAFGFD
Sbjct  222  KQRYNSMKHAAIVVVNSPTLRGIALVSFFYELGMSGIVSVLLYYLKAAFGFD  273



>ref|XP_009407349.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 172/232 (74%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC GQSSC+++ YINGLQ TVVG+ KMVV+P LGQL+D+YGRKPLLL+T ST+I+PF 
Sbjct  39   RALCPGQSSCAKAIYINGLQQTVVGIFKMVVLPILGQLADEYGRKPLLLITISTSIVPFA  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA + SR  VY Y+V++TISYIISQGSI CIS+AYAADV++ + R+T F WITGLFS S
Sbjct  99   ILAWDVSRAAVYIYFVLRTISYIISQGSILCISVAYAADVIEVSKRSTTFGWITGLFSVS  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL E + I + ++ LL+   LYM + L+ETV       ++  C   V +  
Sbjct  159  HVLGNILARFLPEGW-IFEVSIFLLVCATLYMKIFLIETVKVAPRQSENRSCSFIVLEVL  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +++   ++ T+ V  SS TLK    +SF+Y+LG+SGI S+L +YLK+AFGF+
Sbjct  218  QDRWNSMKDTIFVFSSSTTLKRISFISFYYELGMSGISSILLYYLKSAFGFN  269



>ref|XP_010032090.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Eucalyptus grandis]
Length=450

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 169/231 (73%), Gaps = 1/231 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G ++CS+  Y NGL+ T+ GV KM  +P LGQL+D+YGRKP+LL+  ST++ PF 
Sbjct  43   DALCPGDTTCSEVIYFNGLEQTIAGVFKMFSIPILGQLADEYGRKPVLLVIISTSVFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SRGFVYAYYV++TISYI+SQGSIFCIS+AYAADVV+   RA+AFSWITGL+SAS
Sbjct  103  MLAWDQSRGFVYAYYVLRTISYILSQGSIFCISVAYAADVVETGKRASAFSWITGLYSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGNL +RFL E Y I   ++ LL+  P+Y+   L ETV      +Q     +++ +  
Sbjct  163  HVLGNLLARFLPEKY-IFDVSIALLLCCPIYIYFFLRETVNYGPRQDQESTWSTRIFRGV  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
             ++   +R    +V+ S TL+   +VSFFYQLG++GI +VL +YL+AAFGF
Sbjct  222  SKRYRSMRDAAIIVIRSQTLRGISIVSFFYQLGMTGISNVLLYYLEAAFGF  272



>ref|XP_010681373.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=435

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 163/232 (70%), Gaps = 11/232 (5%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC  Q++CS+          VVG+ KMVV+P LGQLSD+YGRKP+LL+T ST I PF 
Sbjct  43   RALCPDQTTCSE----------VVGIFKMVVLPLLGQLSDEYGRKPMLLITISTAIFPFA  92

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLAIN+SR FVYAYYV++TIS+IISQGSIFC ++AY ADV+++T RA  FSWITGLFSAS
Sbjct  93   LLAINQSREFVYAYYVLRTISHIISQGSIFCTAVAYTADVIEDTKRAATFSWITGLFSAS  152

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL E Y I   ++ LL F P+Y+   L ETV      E      SK   F 
Sbjct  153  HVLGNVLARFLPEKY-IFHISIALLTFCPIYILFFLPETVKQKQKEELQSSLLSKFLAFP  211

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            + +   +R    VVVSSPTL+   LVSFFY+LG+SGI  VL +YLKAAFGF+
Sbjct  212  KARYNSMRYAANVVVSSPTLRGISLVSFFYELGMSGISYVLLYYLKAAFGFN  263



>gb|KCW51480.1| hypothetical protein EUGRSUZ_J00999 [Eucalyptus grandis]
Length=523

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 169/231 (73%), Gaps = 1/231 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G ++CS+  Y NGL+ T+ GV KM  +P LGQL+D+YGRKP+LL+  ST++ PF 
Sbjct  116  DALCPGDTTCSEVIYFNGLEQTIAGVFKMFSIPILGQLADEYGRKPVLLVIISTSVFPFA  175

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SRGFVYAYYV++TISYI+SQGSIFCIS+AYAADVV+   RA+AFSWITGL+SAS
Sbjct  176  MLAWDQSRGFVYAYYVLRTISYILSQGSIFCISVAYAADVVETGKRASAFSWITGLYSAS  235

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGNL +RFL E Y I   ++ LL+  P+Y+   L ETV      +Q     +++ +  
Sbjct  236  HVLGNLLARFLPEKY-IFDVSIALLLCCPIYIYFFLRETVNYGPRQDQESTWSTRIFRGV  294

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
             ++   +R    +V+ S TL+   +VSFFYQLG++GI +VL +YL+AAFGF
Sbjct  295  SKRYRSMRDAAIIVIRSQTLRGISIVSFFYQLGMTGISNVLLYYLEAAFGF  345



>gb|KGN46030.1| hypothetical protein Csa_6G045090 [Cucumis sativus]
Length=416

 Score =   236 bits (602),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 162/232 (70%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC   ++C Q+ Y NG + T+VG+ KMVV+P LGQL+D+YGRKPLLLLT ST+I PF 
Sbjct  43   NALCSQNTTCPQAIYFNGTEQTIVGIFKMVVLPLLGQLADEYGRKPLLLLTVSTSIFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL  ++S+G++YAYYV++TIS I+SQGSIF IS+AYAAD V E+ RA  F WITGL SAS
Sbjct  103  LLVWDQSKGYIYAYYVLRTISKILSQGSIFFISVAYAADTVQESRRAAVFGWITGLSSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GNL +RFL E Y I   ++ LL+F P+YM   L ETV P    ++     SK     
Sbjct  163  HVVGNLLARFLPEKY-IFVVSIVLLMFCPIYMYFFLHETVKPIPKNDEEPNWLSKTVNVL  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   +R  +E+V+ +PTL+    VSFF  LG++GI +VL  YLKA FGFD
Sbjct  222  NRRFRTMRDAIEIVIDNPTLRSITYVSFFLNLGMTGITNVLMFYLKAVFGFD  273



>gb|EPS69924.1| hypothetical protein M569_04837, partial [Genlisea aurea]
Length=333

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 174/235 (74%), Gaps = 4/235 (2%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC GQ++C ++ Y+NG+Q TVVG+ KMV++P +GQL+D+YGRKPLLLLT STTI+PF 
Sbjct  39   SALCPGQNTCPEAIYLNGIQQTVVGIFKMVILPLMGQLADEYGRKPLLLLTISTTIVPFA  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVV-DETNRATAFSWITGLFSA  341
            LLAI++SRG VYAYY+++T   I+S+GSIF ISI YAAD+V D + RAT FSW++GL SA
Sbjct  99   LLAIDQSRGSVYAYYIIRTFCNILSKGSIFTISIIYAADLVEDGSKRATVFSWMSGLMSA  158

Query  340  SHVLGNLASRFLHEDYNILQA--ALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVK  167
            + V+G+LA+RF+   Y I +A  ++ LLIF P+Y++L L ETV  +    Q LP   KV 
Sbjct  159  AQVIGDLAARFVPSKY-IFEACVSIALLIFGPIYISLFLKETVVRNEQPVQHLPLWRKVL  217

Query  166  KFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +  + +   ++  + +V  S  LKC  LVSFFY+LG S I+SVL +YLK+ FGF+
Sbjct  218  QAVQTRYCSMKNAVNIVTESSILKCISLVSFFYELGTSAINSVLMYYLKSVFGFN  272



>ref|XP_004140989.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Cucumis sativus]
Length=444

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 162/232 (70%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC   ++C Q+ Y NG + T+VG+ KMVV+P LGQL+D+YGRKPLLLLT ST+I PF 
Sbjct  43   NALCSQNTTCPQAIYFNGTEQTIVGIFKMVVLPLLGQLADEYGRKPLLLLTVSTSIFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL  ++S+G++YAYYV++TIS I+SQGSIF IS+AYAAD V E+ RA  F WITGL SAS
Sbjct  103  LLVWDQSKGYIYAYYVLRTISKILSQGSIFFISVAYAADTVQESRRAAVFGWITGLSSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GNL +RFL E Y I   ++ LL+F P+YM   L ETV P    ++     SK     
Sbjct  163  HVVGNLLARFLPEKY-IFVVSIVLLMFCPIYMYFFLHETVKPIPKNDEEPNWLSKTVNVL  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   +R  +E+V+ +PTL+    VSFF  LG++GI +VL  YLKA FGFD
Sbjct  222  NRRFRTMRDAIEIVIDNPTLRSITYVSFFLNLGMTGITNVLMFYLKAVFGFD  273



>ref|XP_011024228.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Populus euphratica]
Length=456

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 170/232 (73%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC GQ++CS+  YI+GLQ TVVG+ KMVV+P LGQL+D+YGRKPLLL+  ST+I PF 
Sbjct  55   SALCPGQTTCSEVIYISGLQQTVVGIFKMVVLPLLGQLADEYGRKPLLLIAVSTSIFPFA  114

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N+SR  VY YYV++TIS+I+SQGSIFCI+IAYAAD++ E NRATAFSWITG FSAS
Sbjct  115  VLACNQSRDAVYVYYVLRTISFILSQGSIFCIAIAYAADIIKEENRATAFSWITGFFSAS  174

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GNL +RFL E + I   ++ LLIF  +YM   LVETV      E+     +K+    
Sbjct  175  HVVGNLLARFLPEKF-IFVVSIALLIFGSVYMYFFLVETVERVDKRERDSTFLTKIINVA  233

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            R++   +R    VV  SPTL+    VSFFY+LG+SGI SVL  YLKA FGF+
Sbjct  234  RKRYESMRYAAAVVFRSPTLRVISFVSFFYELGMSGISSVLLFYLKAVFGFN  285



>gb|KCW51477.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus grandis]
Length=443

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 165/231 (71%), Gaps = 1/231 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G ++CS+  Y NGL+ T+VGV KM  +P LGQLSD+YGRKP+LL   +T++ PF 
Sbjct  43   DALCPGDTTCSEVIYFNGLEQTIVGVFKMFSIPILGQLSDEYGRKPVLLAIIATSVFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SRGFVYAYYV++TIS I+SQGSI C+S+AYAADVV+   RA AFSWITGL SAS
Sbjct  103  MLAWSQSRGFVYAYYVLRTISNILSQGSILCVSVAYAADVVESGKRAFAFSWITGLLSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGNL +RFL E Y I    + LL+  P+YM + L ETV      ++     +++ +  
Sbjct  163  HVLGNLLARFLPEKY-IFDITIALLLCPPIYMYVFLRETVAYAPRQDEESTWQTRIFRGV  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
             ++   +R    +V+ S TL+   +VSFFYQLG++GI +VL +YL+AAFGF
Sbjct  222  SKRYRSMRDAAIIVIRSQTLRGISIVSFFYQLGMTGISNVLLYYLEAAFGF  272



>ref|XP_004169983.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Cucumis sativus]
Length=444

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 162/232 (70%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC   ++C Q+ Y NG + T+VG+ KMVV+P LGQL+D+YGRKPLLLLT ST+I PF 
Sbjct  43   NALCSQNTTCPQAIYFNGTEQTIVGIFKMVVLPLLGQLADEYGRKPLLLLTVSTSIFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL  ++S+G++YAYYV++TIS I+SQGSIF IS+AYAAD V E+ RA  F WITGL SAS
Sbjct  103  LLVWDQSKGYIYAYYVLRTISKILSQGSIFFISVAYAADTVQESRRAAVFGWITGLSSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GNL +RFL E Y I   ++ LL+F P+YM   L ETV P    ++     SK     
Sbjct  163  HVVGNLLARFLPEKY-IFVVSIVLLMFCPIYMYFFLHETVKPILKNDEEPNWLSKTVNVL  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   +R  +E+V+ +PTL+    VSFF  LG++GI +VL  YLKA FGFD
Sbjct  222  NRRFRTMRDAIEIVIDNPTLRSITYVSFFLNLGMTGITNVLMFYLKAVFGFD  273



>ref|XP_010032083.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW51476.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus grandis]
Length=450

 Score =   234 bits (598),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 165/231 (71%), Gaps = 1/231 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G ++CS+  Y NGL+ T+VGV KM  +P LGQLSD+YGRKP+LL   +T++ PF 
Sbjct  43   DALCPGDTTCSEVIYFNGLEQTIVGVFKMFSIPILGQLSDEYGRKPVLLAIIATSVFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SRGFVYAYYV++TIS I+SQGSI C+S+AYAADVV+   RA AFSWITGL SAS
Sbjct  103  MLAWSQSRGFVYAYYVLRTISNILSQGSILCVSVAYAADVVESGKRAFAFSWITGLLSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGNL +RFL E Y I    + LL+  P+YM + L ETV      ++     +++ +  
Sbjct  163  HVLGNLLARFLPEKY-IFDITIALLLCPPIYMYVFLRETVAYAPRQDEESTWQTRIFRGV  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
             ++   +R    +V+ S TL+   +VSFFYQLG++GI +VL +YL+AAFGF
Sbjct  222  SKRYRSMRDAAIIVIRSQTLRGISIVSFFYQLGMTGISNVLLYYLEAAFGF  272



>ref|XP_006485218.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X2 [Citrus sinensis]
 ref|XP_006485219.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X3 [Citrus sinensis]
Length=374

 Score =   230 bits (587),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 152/204 (75%), Gaps = 1/204 (0%)
 Frame = -2

Query  613  MVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGS  434
            MVV+P LGQL+D+YGRKPLLL+T STTI+PF LLA N+S+ FVYAYYV++TISYIISQGS
Sbjct  1    MVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGS  60

Query  433  IFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFV  254
            IFCI++AYAADVV+E  RATAFSWITGLFSASHVLGN+ +RFL E Y I   ++ LLIFV
Sbjct  61   IFCIAVAYAADVVNENKRATAFSWITGLFSASHVLGNVLARFLPEKY-IFPVSIALLIFV  119

Query  253  PLYMALHLVETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSF  74
            P+YM   LVETV      +Q      K       +   +R    +VVSSPTL+    VSF
Sbjct  120  PVYMQFFLVETVESAPRKDQESSGLKKAVNVLDRRYKSMRDAALMVVSSPTLRGISFVSF  179

Query  73   FYQLGISGIDSVLPHYLKAAFGFD  2
            FY+LG+SGI +VL  YLKA FGF+
Sbjct  180  FYKLGMSGISAVLLFYLKAVFGFN  203



>ref|XP_008456592.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Cucumis 
melo]
Length=443

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 160/232 (69%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC    +C Q+ Y NG + T+VG+ KMVV+P LGQL+D+YGRKPLLLLT ST+I PF 
Sbjct  43   KALCPQNPTCPQAIYFNGTEQTIVGIFKMVVLPLLGQLADEYGRKPLLLLTVSTSIFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LL  ++S+G++YAYYV++TIS I+SQGSIF IS+AYAAD+V E+ RA  F WITGL SAS
Sbjct  103  LLVWDQSKGYIYAYYVLRTISKILSQGSIFFISVAYAADIVQESRRAAVFGWITGLCSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HV+GNL +RFL E Y I   ++ LL+F P+YM   L ETV P    +      SK     
Sbjct  163  HVVGNLLARFLPEKY-IFVVSIVLLMFCPIYMYFFLHETVKPILKNDGEPNWLSKTVNVL  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   +R   E+V+ +PTL+    VSFF +LG++GI SVL  YLKA FGFD
Sbjct  222  NRRFRTMRDATEIVIDNPTLRSITYVSFFLKLGMTGITSVLMFYLKAVFGFD  273



>ref|XP_007010349.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 ref|XP_007010350.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY19159.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY19160.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
Length=374

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 152/204 (75%), Gaps = 1/204 (0%)
 Frame = -2

Query  613  MVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGS  434
            M+V+P LGQL+D+YGRKPLLLLT STTI+PF LLA N+SR FVY YYV++TISYIISQGS
Sbjct  1    MLVLPLLGQLADEYGRKPLLLLTVSTTIVPFALLAWNQSREFVYIYYVLRTISYIISQGS  60

Query  433  IFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFV  254
            IFCI++AYAADVV   NRA  FS ITGLFSASHVLGN+ +RFL E Y I   ++ LLIF 
Sbjct  61   IFCIAVAYAADVVSVRNRAAVFSLITGLFSASHVLGNVLARFLPEKY-IFLVSIVLLIFC  119

Query  253  PLYMALHLVETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSF  74
            P+YM   LVETV  D   EQ   C +K  K   ++   ++    +V+SSPTL+    VSF
Sbjct  120  PVYMQFFLVETVEIDTTREQDSGCLTKSMKVLNKRYKSMKDAAGIVISSPTLRGISFVSF  179

Query  73   FYQLGISGIDSVLPHYLKAAFGFD  2
            FY+LG SGI S+L +YLKAAFGFD
Sbjct  180  FYELGTSGITSILLYYLKAAFGFD  203



>emb|CDP20480.1| unnamed protein product [Coffea canephora]
Length=373

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 151/204 (74%), Gaps = 2/204 (1%)
 Frame = -2

Query  613  MVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGS  434
            MVV+P LGQLSDDYGRKPLLL+T STTI PF LL I+KS+ FVYAYYV++TIS+IISQGS
Sbjct  1    MVVLPVLGQLSDDYGRKPLLLITVSTTIFPFSLLIISKSKSFVYAYYVLRTISFIISQGS  60

Query  433  IFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFV  254
            IFCI+ AY ADV+D++ R T   W+ GLFSASHVLGN+ +RFL ED   +  ++  L F 
Sbjct  61   IFCIAAAYVADVIDDSKRTTGLCWMMGLFSASHVLGNVLARFLPEDS--IFVSIAFLTFC  118

Query  253  PLYMALHLVETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSF  74
            PLYMAL L ETVT     +Q LP   K  K   ++   +R    +V+SSP LKC  L+SF
Sbjct  119  PLYMALFLPETVTSAPIRDQRLPFLKKAFKIVEQRYNSMRRAAIIVISSPALKCISLISF  178

Query  73   FYQLGISGIDSVLPHYLKAAFGFD  2
            FY+LG+SGI +VL +YLKAAFGFD
Sbjct  179  FYELGMSGIATVLLYYLKAAFGFD  202



>ref|XP_010681374.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=375

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 149/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  613  MVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGS  434
            MVV+P LGQLSD+YGRKP+LL+T ST I PF LLAIN+SR FVYAYYV++TIS+IISQGS
Sbjct  1    MVVLPLLGQLSDEYGRKPMLLITISTAIFPFALLAINQSREFVYAYYVLRTISHIISQGS  60

Query  433  IFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFV  254
            IFC ++AY ADV+++T RA  FSWITGLFSASHVLGN+ +RFL E Y I   ++ LL F 
Sbjct  61   IFCTAVAYTADVIEDTKRAATFSWITGLFSASHVLGNVLARFLPEKY-IFHISIALLTFC  119

Query  253  PLYMALHLVETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSF  74
            P+Y+   L ETV      E      SK   F + +   +R    VVVSSPTL+   LVSF
Sbjct  120  PIYILFFLPETVKQKQKEELQSSLLSKFLAFPKARYNSMRYAANVVVSSPTLRGISLVSF  179

Query  73   FYQLGISGIDSVLPHYLKAAFGFD  2
            FY+LG+SGI  VL +YLKAAFGF+
Sbjct  180  FYELGMSGISYVLLYYLKAAFGFN  203



>ref|XP_011032840.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Populus euphratica]
Length=374

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 148/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  613  MVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGS  434
            MVV+PFLGQL+D+YGRKPLLL+T ST+I PF +LA N+SRG VY YYV++TIS+IISQGS
Sbjct  1    MVVLPFLGQLADEYGRKPLLLITVSTSIFPFAVLAWNQSRGSVYVYYVLRTISFIISQGS  60

Query  433  IFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFV  254
            IFCI++AYAAD+++E NRA AFSWITG FSASHVLGNL +RFL E Y I   ++  LIF 
Sbjct  61   IFCIAVAYAADIIEEGNRAAAFSWITGFFSASHVLGNLLARFLPEQY-IFVVSIAFLIFS  119

Query  253  PLYMALHLVETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSF  74
            P+YM   L ETV      ++     +K+     ++   +R    VV  SPTL+    VSF
Sbjct  120  PVYMHFLLAETVEQVPKRDRDSTFLTKIINVAHKRYESMRDAAAVVFESPTLRGISFVSF  179

Query  73   FYQLGISGIDSVLPHYLKAAFGFD  2
            FY+LG+SGI SVL  YLKA FGF+
Sbjct  180  FYELGMSGISSVLLFYLKAVFGFN  203



>ref|XP_010032084.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Eucalyptus grandis]
Length=421

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 153/218 (70%), Gaps = 1/218 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G ++CS+  Y NGL+ T+VGV KM  +P LGQLSD+YGRKP+LL   +T++ PF 
Sbjct  43   DALCPGDTTCSEVIYFNGLEQTIVGVFKMFSIPILGQLSDEYGRKPVLLAIIATSVFPFA  102

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SRGFVYAYYV++TIS I+SQGSI C+S+AYAADVV+   RA AFSWITGL SAS
Sbjct  103  MLAWSQSRGFVYAYYVLRTISNILSQGSILCVSVAYAADVVESGKRAFAFSWITGLLSAS  162

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGNL +RFL E Y I    + LL+  P+YM + L ETV      ++     +++ +  
Sbjct  163  HVLGNLLARFLPEKY-IFDITIALLLCPPIYMYVFLRETVAYAPRQDEESTWQTRIFRGV  221

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGID  44
             ++   +R    +V+ S TL+   +VSFFYQLG++GI 
Sbjct  222  SKRYRSMRDAAIIVIRSQTLRGISIVSFFYQLGMTGIS  259



>ref|XP_010907145.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Elaeis 
guineensis]
Length=447

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 170/232 (73%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+ SCS++ Y+ G+Q TVVG+ KMVV+P LGQL+D++GRKPLLL+T+ST+IIP+ 
Sbjct  39   GALCPGEKSCSEAIYLTGVQQTVVGIFKMVVLPTLGQLADEHGRKPLLLITTSTSIIPYA  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA + S+  +Y ++ ++TIS IIS GSIFCISIAYA+DVV+   RA AF W+TGLFSAS
Sbjct  99   ILAWDNSKSSIYVFFALRTISSIISHGSIFCISIAYASDVVESRKRAVAFGWMTGLFSAS  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL E++ I + ++ LL+   LY+ ++L+ETV       Q L C S +    
Sbjct  159  HVLGNVLARFLPEEW-IFEVSIALLVCSVLYLKIYLIETVKKAPSPHQCLSCSSLILNVL  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +E+   ++ T+ VV SS TLK    VSFF++LG+SGI SVL +YLK+ FGF 
Sbjct  218  QERWKSMKDTIIVVTSSSTLKRISCVSFFFELGMSGISSVLLYYLKSVFGFS  269



>ref|XP_010312534.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010312535.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010312536.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
Length=372

 Score =   214 bits (546),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 149/206 (72%), Gaps = 5/206 (2%)
 Frame = -2

Query  613  MVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGS  434
            MVV+P LGQL+D+YGRKPLLLL  ST I P  +LAI++S+GFVYAYYV++ IS+I+SQGS
Sbjct  1    MVVIPVLGQLADEYGRKPLLLLIVSTAIFPSAILAIDESKGFVYAYYVLRMISHIMSQGS  60

Query  433  IFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFV  254
            IFCIS AYAAD++D  +RA AF W+ G+ S SHVLGN  +R L   Y I + ++ LLI  
Sbjct  61   IFCISAAYAADILDGRSRAAAFGWMHGILSLSHVLGNFLARLLPGTY-IFEVSVALLIIA  119

Query  253  PLYMALHLVETV--TPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLV  80
            P+YM + L ETV  TPD  V Q L   SK  +  +++   +R  L VV SS TLKC CLV
Sbjct  120  PMYMLIFLTETVKLTPD--VNQHLRWSSKAYQLVQDRYSSMRYALHVVTSSSTLKCICLV  177

Query  79   SFFYQLGISGIDSVLPHYLKAAFGFD  2
            SFFY +G+SGI SVL +YLK+AF F+
Sbjct  178  SFFYDMGMSGISSVLMYYLKSAFDFN  203



>ref|XP_006589383.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X2 [Glycine max]
Length=375

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 148/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  613  MVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGS  434
            MVV+P LGQLSD+YGRKPLLL+T ST I PFVLL  ++S  +VYAYYV++TIS IISQGS
Sbjct  1    MVVLPLLGQLSDEYGRKPLLLITISTAIFPFVLLVWHQSEEYVYAYYVLRTISNIISQGS  60

Query  433  IFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFV  254
            IFCIS+AYAADVV+E+ RA  F WITGL SASHVLG++ +  L E Y I   ++ LL   
Sbjct  61   IFCISVAYAADVVNESKRAAVFGWITGLLSASHVLGDVLAWSLPEKY-IFAVSIVLLTSC  119

Query  253  PLYMALHLVETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSF  74
            P+YM   LVETV P    ++   C +K+    R++   +R   E+V+ SPTL+   LVSF
Sbjct  120  PVYMKFFLVETVIPAPKNDRESGCWAKIVDVPRQRYISMRRAAEIVIFSPTLRGMALVSF  179

Query  73   FYQLGISGIDSVLPHYLKAAFGFD  2
            FY+LG+SGI SVL +YLKA FGF+
Sbjct  180  FYELGMSGISSVLLYYLKAVFGFN  203



>ref|XP_008788273.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Phoenix dactylifera]
 ref|XP_008779095.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Phoenix dactylifera]
Length=365

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 167/232 (72%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+ SC ++ Y+ G+Q TVVGV KMVV+P LGQL+D++GRKPLLL+T+ST+IIP+ 
Sbjct  39   GALCPGEKSCPEAIYLTGVQQTVVGVFKMVVLPTLGQLADEHGRKPLLLITTSTSIIPYA  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA + S+  +Y ++ ++TIS IIS GSIFCIS+AYA+DVV+   RA AF W+TGLFSAS
Sbjct  99   ILAWDNSKSSIYVFFALRTISSIISHGSIFCISVAYASDVVESRKRAVAFGWMTGLFSAS  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL E++ I + ++ LL+F  LY+ ++L+ETV       Q     + V    
Sbjct  159  HVLGNVLARFLPEEW-IFEVSIALLVFTVLYLKIYLIETVKKVPSPHQCSSFSTLVLNVL  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +E+   ++ T+ VV SS TLK    VSFF++LG+SGI  VL +YLK+ FGF 
Sbjct  218  QERWKSMKDTVIVVTSSSTLKRISFVSFFFELGMSGISGVLLYYLKSVFGFS  269



>ref|XP_008788264.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Phoenix dactylifera]
 ref|XP_008779094.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Phoenix dactylifera]
Length=382

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 167/232 (72%), Gaps = 1/232 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+ SC ++ Y+ G+Q TVVGV KMVV+P LGQL+D++GRKPLLL+T+ST+IIP+ 
Sbjct  39   GALCPGEKSCPEAIYLTGVQQTVVGVFKMVVLPTLGQLADEHGRKPLLLITTSTSIIPYA  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA + S+  +Y ++ ++TIS IIS GSIFCIS+AYA+DVV+   RA AF W+TGLFSAS
Sbjct  99   ILAWDNSKSSIYVFFALRTISSIISHGSIFCISVAYASDVVESRKRAVAFGWMTGLFSAS  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL E++ I + ++ LL+F  LY+ ++L+ETV       Q     + V    
Sbjct  159  HVLGNVLARFLPEEW-IFEVSIALLVFTVLYLKIYLIETVKKVPSPHQCSSFSTLVLNVL  217

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +E+   ++ T+ VV SS TLK    VSFF++LG+SGI  VL +YLK+ FGF 
Sbjct  218  QERWKSMKDTVIVVTSSSTLKRISFVSFFFELGMSGISGVLLYYLKSVFGFS  269



>gb|AFK42472.1| unknown [Lotus japonicus]
Length=224

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G S+C +  YINGLQ T+VG+ KMVV+P LGQLSD++GRKPLLL+T STTI  F 
Sbjct  40   SALCPGGSTCPKVIYINGLQQTIVGIFKMVVLPLLGQLSDEHGRKPLLLITMSTTIFSFA  99

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++S  FVYAYYV+ T SYIISQGSIFCIS+AY ADVV+E+ RA  FSWITGLFSAS
Sbjct  100  VLAWDQSEEFVYAYYVLHTFSYIISQGSIFCISVAYVADVVNESKRAAVFSWITGLFSAS  159

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTP  212
            HVLGN+ +RFL E+Y I   ++ LL F P+YM   LVETVTP
Sbjct  160  HVLGNVLARFLPEEY-IFAVSIALLTFCPVYMQFFLVETVTP  200



>ref|XP_008788255.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008779093.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Phoenix dactylifera]
Length=447

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 170/239 (71%), Gaps = 15/239 (6%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+ SC ++ Y+ G+Q TVVGV KMVV+P LGQL+D++GRKPLLL+T+ST+IIP+ 
Sbjct  39   GALCPGEKSCPEAIYLTGVQQTVVGVFKMVVLPTLGQLADEHGRKPLLLITTSTSIIPYA  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA + S+  +Y ++ ++TIS IIS GSIFCIS+AYA+DVV+   RA AF W+TGLFSAS
Sbjct  99   ILAWDNSKSSIYVFFALRTISSIISHGSIFCISVAYASDVVESRKRAVAFGWMTGLFSAS  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGN+ +RFL E++ I + ++ LL+F  LY+ ++L+ETV       + +P P +   F 
Sbjct  159  HVLGNVLARFLPEEW-IFEVSIALLVFTVLYLKIYLIETV-------KKVPSPHQCSSFS  210

Query  157  -------REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
                   +E+   ++ T+ VV SS TLK    VSFF++LG+SGI  VL +YLK+ FGF 
Sbjct  211  TLVLNVLQERWKSMKDTVIVVTSSSTLKRISFVSFFFELGMSGISGVLLYYLKSVFGFS  269



>ref|XP_010032091.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Eucalyptus grandis]
Length=380

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 149/203 (73%), Gaps = 1/203 (0%)
 Frame = -2

Query  613  MVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGS  434
            M  +P LGQL+D+YGRKP+LL+  ST++ PF +LA ++SRGFVYAYYV++TISYI+SQGS
Sbjct  1    MFSIPILGQLADEYGRKPVLLVIISTSVFPFAMLAWDQSRGFVYAYYVLRTISYILSQGS  60

Query  433  IFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFV  254
            IFCIS+AYAADVV+   RA+AFSWITGL+SASHVLGNL +RFL E Y I   ++ LL+  
Sbjct  61   IFCISVAYAADVVETGKRASAFSWITGLYSASHVLGNLLARFLPEKY-IFDVSIALLLCC  119

Query  253  PLYMALHLVETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSF  74
            P+Y+   L ETV      +Q     +++ +   ++   +R    +V+ S TL+   +VSF
Sbjct  120  PIYIYFFLRETVNYGPRQDQESTWSTRIFRGVSKRYRSMRDAAIIVIRSQTLRGISIVSF  179

Query  73   FYQLGISGIDSVLPHYLKAAFGF  5
            FYQLG++GI +VL +YL+AAFGF
Sbjct  180  FYQLGMTGISNVLLYYLEAAFGF  202



>ref|XP_010032085.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Eucalyptus grandis]
 ref|XP_010032086.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Eucalyptus grandis]
Length=380

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -2

Query  613  MVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGS  434
            M  +P LGQLSD+YGRKP+LL   +T++ PF +LA ++SRGFVYAYYV++TIS I+SQGS
Sbjct  1    MFSIPILGQLSDEYGRKPVLLAIIATSVFPFAMLAWSQSRGFVYAYYVLRTISNILSQGS  60

Query  433  IFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFV  254
            I C+S+AYAADVV+   RA AFSWITGL SASHVLGNL +RFL E Y I    + LL+  
Sbjct  61   ILCVSVAYAADVVESGKRAFAFSWITGLLSASHVLGNLLARFLPEKY-IFDITIALLLCP  119

Query  253  PLYMALHLVETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSF  74
            P+YM + L ETV      ++     +++ +   ++   +R    +V+ S TL+   +VSF
Sbjct  120  PIYMYVFLRETVAYAPRQDEESTWQTRIFRGVSKRYRSMRDAAIIVIRSQTLRGISIVSF  179

Query  73   FYQLGISGIDSVLPHYLKAAFGF  5
            FYQLG++GI +VL +YL+AAFGF
Sbjct  180  FYQLGMTGISNVLLYYLEAAFGF  202



>ref|XP_010682914.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=444

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 157/232 (68%), Gaps = 3/232 (1%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+++CS + Y+N LQ T+ G+L + V+P L +LSD+YGRKPLLLLT ST+I P V
Sbjct  51   SALCPGETTCSDALYLNNLQQTIAGLLMIPVLPLLCELSDEYGRKPLLLLTISTSIFPVV  110

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLAI+ SR F+ AY+ ++ +SYI+S  S+FCI+IAYAADVV++  R  AFSWITG+ SAS
Sbjct  111  LLAISNSRAFINAYFALRCLSYILSLRSVFCIAIAYAADVVEDDKRVAAFSWITGVLSAS  170

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLG L +RF+   Y I + ++ LL   PL++ L + ET       +QSL   S + K  
Sbjct  171  HVLGTLLARFVPGKY-IFELSIPLLFMCPLFIQLFVAETARRAPMTKQSL--WSILFKPI  227

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            RE+   +R    V+ + PTL+   LVSFFY+ G+ GI SVL  Y+K A   +
Sbjct  228  RERYSSIRYGATVIFTKPTLRGIYLVSFFYEFGMCGISSVLLFYMKDALNMN  279



>ref|XP_011024229.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Populus euphratica]
Length=374

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 147/204 (72%), Gaps = 1/204 (0%)
 Frame = -2

Query  613  MVVVPFLGQLSDDYGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGS  434
            MVV+P LGQL+D+YGRKPLLL+  ST+I PF +LA N+SR  VY YYV++TIS+I+SQGS
Sbjct  1    MVVLPLLGQLADEYGRKPLLLIAVSTSIFPFAVLACNQSRDAVYVYYVLRTISFILSQGS  60

Query  433  IFCISIAYAADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFV  254
            IFCI+IAYAAD++ E NRATAFSWITG FSASHV+GNL +RFL E + I   ++ LLIF 
Sbjct  61   IFCIAIAYAADIIKEENRATAFSWITGFFSASHVVGNLLARFLPEKF-IFVVSIALLIFG  119

Query  253  PLYMALHLVETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSF  74
             +YM   LVETV      E+     +K+    R++   +R    VV  SPTL+    VSF
Sbjct  120  SVYMYFFLVETVERVDKRERDSTFLTKIINVARKRYESMRYAAAVVFRSPTLRVISFVSF  179

Query  73   FYQLGISGIDSVLPHYLKAAFGFD  2
            FY+LG+SGI SVL  YLKA FGF+
Sbjct  180  FYELGMSGISSVLLFYLKAVFGFN  203



>gb|KDO42035.1| hypothetical protein CISIN_1g0164182mg, partial [Citrus sinensis]
Length=257

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 140/232 (60%), Gaps = 42/232 (18%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC GQ +CS++ YI+GLQ TVVGV KMVV+P LGQL+D+YGRKPLLL+T STTI+PF 
Sbjct  38   NALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFT  97

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            LLA N+S+ FVYAYYV++TISYIISQGSIFCI++AYA  +                    
Sbjct  98   LLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAVSI--------------------  137

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
                                   LLIFVP+YM   LVETV      +Q      K     
Sbjct  138  ----------------------ALLIFVPVYMQFFLVETVESAPRKDQESSGLKKAVNVL  175

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   +R    +VVSSPTL+    VSFFY+LG+SGI +VL  YLKA FGF+
Sbjct  176  DRRYKSMRDAALMVVSSPTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFN  227



>ref|XP_002450280.1| hypothetical protein SORBIDRAFT_05g003130 [Sorghum bicolor]
 gb|EES09268.1| hypothetical protein SORBIDRAFT_05g003130 [Sorghum bicolor]
Length=448

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 156/232 (67%), Gaps = 2/232 (1%)
 Frame = -2

Query  694  ALCDGQS-SCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            ALC     SC ++ Y+ GLQ +V G+ + +    +GQL+D+YGRKPL+LLT+ST+IIPF 
Sbjct  36   ALCPADDRSCPEALYLTGLQSSVGGIFRTIGFTLMGQLADEYGRKPLILLTASTSIIPFA  95

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N SR  VY Y V++T+S++I QG+IFC++IAY AD V+ + RA AF  +TG+FSA+
Sbjct  96   VLAWNNSRTAVYVYLVLRTLSFMIGQGTIFCLAIAYTADAVEPSRRAAAFGIMTGIFSAA  155

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            H LG++ SRFL E + I + ++ LLI   +YM ++LVETV       Q L   S + K  
Sbjct  156  HTLGSVFSRFLPEKW-IFEVSVVLLICSIIYMKIYLVETVQRASTSSQHLSMSSLLVKLP  214

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +E+   ++  + +V +S TL+     +FFY+LG+ GI  VL +YLK+ FGFD
Sbjct  215  KERWESIKENISIVKNSETLRRISYAAFFYKLGMIGISDVLMYYLKSVFGFD  266



>ref|NP_001140664.1| uncharacterized protein LOC100272739 precursor [Zea mays]
 gb|ACF84318.1| unknown [Zea mays]
Length=452

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 158/233 (68%), Gaps = 3/233 (1%)
 Frame = -2

Query  694  ALCDG-QSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            ALC     SC ++ Y+ GLQ +V G+ + V    +GQL+D+YGRKPL+LLT+ST+IIPF 
Sbjct  39   ALCPAADRSCPEALYLTGLQASVGGIFRTVGFTLMGQLADEYGRKPLILLTASTSIIPFA  98

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N SR  VYAY  ++T+S+++ QG+IFC++IAY AD V+ + RA AF ++TG+FSA+
Sbjct  99   VLAWNSSRTAVYAYLALRTLSFMVGQGTIFCLAIAYTADAVEPSRRAAAFGFLTGIFSAA  158

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV-TPDGGVEQSLPCPSKVKKF  161
            H LG++ SRFL   + I + ++ LLI   LY+ ++LVETV  P     + L  P+ + K 
Sbjct  159  HTLGSVLSRFLPGRW-IFEVSIVLLICSILYIKVYLVETVQRPPSAPSRHLSMPALLVKL  217

Query  160  CREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             +E+   ++  + +V +S TL+    V+FFY+LG+  I  VL +YLK+ FGFD
Sbjct  218  PQERWESIKDNISIVKNSETLRRISYVAFFYKLGMIAISDVLMYYLKSVFGFD  270



>ref|XP_004978692.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Setaria italica]
Length=455

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 154/233 (66%), Gaps = 3/233 (1%)
 Frame = -2

Query  694  ALCDGQS-SCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            ALC     SC ++ Y+ GLQ +V G+ + +    +GQL+D+YGRKPLLLLT+ST+IIPF 
Sbjct  44   ALCPADDRSCPEAIYLTGLQSSVGGIFRTIGFTLMGQLADEYGRKPLLLLTASTSIIPFA  103

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N SR  VY Y V++T+S++I QG+IFC+SIAY AD V+ + RA AF ++TG+FSAS
Sbjct  104  VLAWNNSRTAVYVYLVLRTLSFMIGQGTIFCLSIAYTADAVEPSRRAAAFGFMTGIFSAS  163

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV-TPDGGVEQSLPCPSKVKKF  161
            H LG++ SRFL E   I + ++ LLI   LYM ++L+ETV              + + K 
Sbjct  164  HTLGSVFSRFLPEKL-IFEVSIALLICSILYMKIYLIETVQKAPSTSSHHSSMSALLAKL  222

Query  160  CREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             +++   ++  + +V +S TL+    V+FFY+LG+  I  VL +YLK+ FGFD
Sbjct  223  PQQRWESIKENISIVKNSQTLRRISYVAFFYKLGMIAISDVLMYYLKSVFGFD  275



>emb|CDO99891.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            NALC  QS+C Q+ Y+NGLQ T VG+ KM V+P LGQLSDD+GRKP LL T ST+I PF 
Sbjct  41   NALCPAQSTCPQAIYLNGLQQTTVGIFKMAVLPVLGQLSDDHGRKPFLLFTVSTSIFPFT  100

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            L+ INKS+GFVYAYYV++TI+ I +QGSI+CI+ AY ADVVD+  +A +FSW+ GLFS S
Sbjct  101  LIVINKSKGFVYAYYVLRTINLIFTQGSIYCITAAYIADVVDDNTKAASFSWMMGLFSTS  160

Query  337  HVLGNLASRFLHEDY  293
            HVLGN  +RFL   Y
Sbjct  161  HVLGNALARFLPGAY  175



>emb|CDO99893.1| unnamed protein product [Coffea canephora]
Length=165

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            N LC GQS+C ++  +NGLQ T VG+ KMVV+P LGQLSDDYGRKPLLL T S  I+PF 
Sbjct  12   NVLCPGQSTCPEAIDLNGLQQTTVGIFKMVVLPVLGQLSDDYGRKPLLLATFSADILPFA  71

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LAINKS+GFVYA+YV++ +S I SQGSI+CI+ AY ADVVD+  +AT FSW+ GL SAS
Sbjct  72   VLAINKSKGFVYAFYVLRFVSLIFSQGSIYCIAAAYLADVVDDNKKATGFSWMMGLISAS  131

Query  337  HVLGNLASRFL  305
             VLGN+ +RFL
Sbjct  132  RVLGNVLARFL  142



>ref|XP_003577047.1| PREDICTED: uncharacterized protein LOC100833312 [Brachypodium 
distachyon]
Length=451

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 151/236 (64%), Gaps = 6/236 (3%)
 Frame = -2

Query  694  ALC-DGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            ALC +  SSC ++ Y+ G Q TV G+ + V    +GQLSD+YGRKPLLLL +  ++ P  
Sbjct  36   ALCPETTSSCPEAIYLTGFQETVGGIFRAVGFTLMGQLSDEYGRKPLLLLAAGASVFPCC  95

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA++ ++  VYAY V++T+ ++I +G++ C+++AY ADVV+ + RA AF  +TG+ SAS
Sbjct  96   VLALSSTKAAVYAYLVLRTLCFMIGKGTVSCLALAYTADVVEPSKRAFAFGCVTGINSAS  155

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDG----GVEQSLPCPSKV  170
              LGN+ SRFL E + + + +L LLI   LYM + LVET+        G  Q L  PS V
Sbjct  156  RALGNVLSRFLPERW-VFKVSLVLLICSVLYMKIFLVETLQKAAPSASGSCQRLSVPSLV  214

Query  169  KKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
                R++   ++  + ++ ++ TL+    VSFFY+LG+ GI  VL +YLK  FGFD
Sbjct  215  LGLPRQRWESIKENIRMIKTNDTLRRITYVSFFYELGMEGISDVLLYYLKLVFGFD  270



>ref|XP_006662736.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Oryza brachyantha]
Length=454

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 151/234 (65%), Gaps = 3/234 (1%)
 Frame = -2

Query  697  NALC-DGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPF  521
             ALC    ++C ++ Y+NGL  TV G+ + V    +GQL+D+YGRKPLLLLT+ST+I+P+
Sbjct  42   RALCPSDDNACPEAIYLNGLHQTVGGIFRAVGYTLMGQLADEYGRKPLLLLTASTSILPY  101

Query  520  VLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSA  341
             +LA NKS+  +Y Y +++T+S++I QG+I  +++ Y ADVV+ + RA AF  ITG+ SA
Sbjct  102  GVLACNKSKAAIYIYLILRTLSFMIGQGTITSLAVTYTADVVEPSKRALAFGCITGVLSA  161

Query  340  SHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV-TPDGGVEQSLPCPSKVKK  164
            SH LGN  SRFL E + I Q ++ LLI   +YM + LVET      G  + +   S V K
Sbjct  162  SHALGNGFSRFLPERW-IFQVSVVLLICSVIYMKISLVETFQRASSGSFEHMSFSSLVVK  220

Query  163  FCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
                +   ++  + ++  S TL+    +SFFY+LG+ GI  VL +YLK+ FGFD
Sbjct  221  LPLRRWESIKDNISIIRRSETLRRITYISFFYELGMIGISDVLMYYLKSVFGFD  274



>gb|EEE51661.1| hypothetical protein OsJ_32986 [Oryza sativa Japonica Group]
 tpd|FAA00733.1| TPA: nicotianamine efflux transporter [Oryza sativa Japonica 
Group]
Length=436

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 150/234 (64%), Gaps = 3/234 (1%)
 Frame = -2

Query  697  NALCDGQS-SCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPF  521
             ALC G   +C ++ Y+ GL  TV G+ + V    +GQL+D+YGRKPLLLLT+ST+IIP+
Sbjct  27   RALCPGADIACPEAIYLTGLHQTVGGIFRAVGYTLMGQLADEYGRKPLLLLTASTSIIPY  86

Query  520  VLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSA  341
             +LA NKS+  VY + +++T+S++I QG+I  +++ Y ADVVD + RA AF  ITG+ SA
Sbjct  87   GVLACNKSKIAVYIFLILRTLSFMIGQGTITSLAVTYTADVVDPSKRAFAFGCITGILSA  146

Query  340  SHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV-TPDGGVEQSLPCPSKVKK  164
            SH LGN  SRFL E + I Q ++ LLI   +YM + LVET+     G  + +   S V +
Sbjct  147  SHALGNGFSRFLPERW-IFQVSVALLISSVIYMKISLVETLQRASSGSFEHMSFSSLVVR  205

Query  163  FCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
                +   ++  + ++  S TL     +SFFY+LG+ GI  VL +YLK+ FGFD
Sbjct  206  LPLRRWESIKENINIIRRSETLSRITYISFFYELGMIGISDVLMYYLKSVFGFD  259



>gb|EEC67684.1| hypothetical protein OsI_35133 [Oryza sativa Indica Group]
Length=436

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 150/234 (64%), Gaps = 3/234 (1%)
 Frame = -2

Query  697  NALCDGQS-SCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPF  521
             ALC G   +C ++ Y+ GL  TV G+ + V    +GQL+D+YGRKPLLLLT+ST+IIP+
Sbjct  27   RALCPGADIACPEAIYLTGLHQTVGGIFRAVGYTLMGQLADEYGRKPLLLLTASTSIIPY  86

Query  520  VLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSA  341
             +LA NKS+  VY + +++T+S++I QG+I  +++ Y ADVVD + RA AF  ITG+ SA
Sbjct  87   GVLACNKSKIAVYIFLILRTLSFMIGQGTITSLAVTYTADVVDPSKRAFAFGCITGILSA  146

Query  340  SHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV-TPDGGVEQSLPCPSKVKK  164
            SH LGN  SRFL E + I Q ++ LLI   +YM + LVET+     G  + +   S V +
Sbjct  147  SHALGNGFSRFLPERW-IFQVSVALLISSVIYMKISLVETLQRASSGSFEHMSFSSLVVR  205

Query  163  FCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
                +   ++  + ++  S TL     +SFFY+LG+ GI  VL +YLK+ FGFD
Sbjct  206  LPLRRWESIKENINIIRRSETLSRITYISFFYELGMIGISDVLMYYLKSVFGFD  259



>ref|NP_001065767.2| Os11g0151500 [Oryza sativa Japonica Group]
 dbj|BAF27612.2| Os11g0151500, partial [Oryza sativa Japonica Group]
Length=447

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 150/234 (64%), Gaps = 3/234 (1%)
 Frame = -2

Query  697  NALCDGQS-SCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPF  521
             ALC G   +C ++ Y+ GL  TV G+ + V    +GQL+D+YGRKPLLLLT+ST+IIP+
Sbjct  38   RALCPGADIACPEAIYLTGLHQTVGGIFRAVGYTLMGQLADEYGRKPLLLLTASTSIIPY  97

Query  520  VLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSA  341
             +LA NKS+  VY + +++T+S++I QG+I  +++ Y ADVVD + RA AF  ITG+ SA
Sbjct  98   GVLACNKSKIAVYIFLILRTLSFMIGQGTITSLAVTYTADVVDPSKRAFAFGCITGILSA  157

Query  340  SHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV-TPDGGVEQSLPCPSKVKK  164
            SH LGN  SRFL E + I Q ++ LLI   +YM + LVET+     G  + +   S V +
Sbjct  158  SHALGNGFSRFLPERW-IFQVSVALLISSVIYMKISLVETLQRASSGSFEHMSFSSLVVR  216

Query  163  FCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
                +   ++  + ++  S TL     +SFFY+LG+ GI  VL +YLK+ FGFD
Sbjct  217  LPLRRWESIKENINIIRRSETLSRITYISFFYELGMIGISDVLMYYLKSVFGFD  270



>ref|XP_003577048.1| PREDICTED: uncharacterized protein LOC100833620 [Brachypodium 
distachyon]
Length=460

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 150/234 (64%), Gaps = 4/234 (2%)
 Frame = -2

Query  694  ALC--DGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPF  521
            ALC  DG SSC ++ Y+ GL  TV G+ + V    +GQL+D+YGRKPLLL+ +  +IIPF
Sbjct  49   ALCPGDGTSSCPEAIYLTGLHQTVGGIFRAVGFTLMGQLADEYGRKPLLLVAAGASIIPF  108

Query  520  VLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSA  341
             +LA++ ++  VYAY V++T S++I QG+I C+++AY AD+V+ + RA AF  +TG+ SA
Sbjct  109  SVLALSSTKVAVYAYLVLRTFSFMIGQGTITCLALAYTADLVEPSKRAFAFGCMTGILSA  168

Query  340  SHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV-TPDGGVEQSLPCPSKVKK  164
            SH LGN+ SRFL E + I Q ++ LLI   LYM + LVET+        +     S +  
Sbjct  169  SHSLGNVFSRFLPEQW-IFQVSVLLLICSVLYMKMCLVETLQKAPSSSCRRSSLSSLIVG  227

Query  163  FCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              R++   ++  + ++  + T +    +SFFY+LG+ GI  VL +YLK  FGFD
Sbjct  228  LPRQRWESIKENISMIKMNDTFRRITYISFFYELGMIGISDVLLYYLKLVFGFD  281



>ref|XP_010032089.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Eucalyptus grandis]
Length=500

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 124/171 (73%), Gaps = 1/171 (1%)
 Frame = -2

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SRGFVYAYYV++TISYI+SQGSIFCIS+AYAADVV+   RA+AFSWITGL+SAS
Sbjct  153  MLAWDQSRGFVYAYYVLRTISYILSQGSIFCISVAYAADVVETGKRASAFSWITGLYSAS  212

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGNL +RFL E Y I   ++ LL+  P+Y+   L ETV      +Q     +++ +  
Sbjct  213  HVLGNLLARFLPEKY-IFDVSIALLLCCPIYIYFFLRETVNYGPRQDQESTWSTRIFRGV  271

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
             ++   +R    +V+ S TL+   +VSFFYQLG++GI +VL +YL+AAFGF
Sbjct  272  SKRYRSMRDAAIIVIRSQTLRGISIVSFFYQLGMTGISNVLLYYLEAAFGF  322



>emb|CBX25325.1| hypothetical_protein [Oryza brachyantha]
Length=391

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 151/234 (65%), Gaps = 5/234 (2%)
 Frame = -2

Query  697  NALC-DGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPF  521
             ALC    ++C ++ Y+NGL  TV G+ + V    +GQL+D+YGRKPLLLLT+ST+I+P+
Sbjct  27   RALCPSDDNACPEAIYLNGLHQTVGGIFRAVGYTLMGQLADEYGRKPLLLLTASTSILPY  86

Query  520  VLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSA  341
             +LA NKS+  +Y Y +++T+S++I QG+I  +++ Y ADVV+ + RA AF  ITG+ SA
Sbjct  87   GVLACNKSKAAIYIYLILRTLSFMIGQGTITSLAVTYTADVVEPSKRALAFGCITGVLSA  146

Query  340  SHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV-TPDGGVEQSLPCPSKVKK  164
            SH LGN  SRFL E + I Q ++ LLI   +YM + LVET      G  + +   S V K
Sbjct  147  SHALGNGFSRFLPERW-IFQVSVVLLICSVIYMKISLVETFQRASSGSFEHMSFSSLVVK  205

Query  163  FCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
                +   ++  + ++  S TL+    +SFFY+LG+ GI  VL +YLK+ FGFD
Sbjct  206  LPLRRWESIKDNISII--SETLRRITYISFFYELGMIGISDVLMYYLKSVFGFD  257



>gb|AAX94836.1| Major Facilitator Superfamily, putative [Oryza sativa Japonica 
Group]
 gb|ABA91455.1| Major Facilitator Superfamily protein, expressed [Oryza sativa 
Japonica Group]
Length=1143

 Score =   175 bits (444),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 150/234 (64%), Gaps = 3/234 (1%)
 Frame = -2

Query  697  NALCDGQS-SCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPF  521
             ALC G   +C ++ Y+ GL  TV G+ + V    +GQL+D+YGRKPLLLLT+ST+IIP+
Sbjct  734  RALCPGADIACPEAIYLTGLHQTVGGIFRAVGYTLMGQLADEYGRKPLLLLTASTSIIPY  793

Query  520  VLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSA  341
             +LA NKS+  VY + +++T+S++I QG+I  +++ Y ADVVD + RA AF  ITG+ SA
Sbjct  794  GVLACNKSKIAVYIFLILRTLSFMIGQGTITSLAVTYTADVVDPSKRAFAFGCITGILSA  853

Query  340  SHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV-TPDGGVEQSLPCPSKVKK  164
            SH LGN  SRFL E + I Q ++ LLI   +YM + LVET+     G  + +   S V +
Sbjct  854  SHALGNGFSRFLPERW-IFQVSVALLISSVIYMKISLVETLQRASSGSFEHMSFSSLVVR  912

Query  163  FCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
                +   ++  + ++  S TL     +SFFY+LG+ GI  VL +YLK+ FGFD
Sbjct  913  LPLRRWESIKENINIIRRSETLSRITYISFFYELGMIGISDVLMYYLKSVFGFD  966



>ref|XP_010032087.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Eucalyptus grandis]
 ref|XP_010032088.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Eucalyptus grandis]
Length=361

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 122/176 (69%), Gaps = 1/176 (1%)
 Frame = -2

Query  532  IIPFVLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITG  353
            +I   +LA ++SRGFVYAYYV++TIS I+SQGSI C+S+AYAADVV+   RA AFSWITG
Sbjct  9    VITSTMLAWSQSRGFVYAYYVLRTISNILSQGSILCVSVAYAADVVESGKRAFAFSWITG  68

Query  352  LFSASHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSK  173
            L SASHVLGNL +RFL E Y I    + LL+  P+YM + L ETV      ++     ++
Sbjct  69   LLSASHVLGNLLARFLPEKY-IFDITIALLLCPPIYMYVFLRETVAYAPRQDEESTWQTR  127

Query  172  VKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
            + +   ++   +R    +V+ S TL+   +VSFFYQLG++GI +VL +YL+AAFGF
Sbjct  128  IFRGVSKRYRSMRDAAIIVIRSQTLRGISIVSFFYQLGMTGISNVLLYYLEAAFGF  183



>gb|KCW51478.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus grandis]
Length=348

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -2

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SRGFVYAYYV++TIS I+SQGSI C+S+AYAADVV+   RA AFSWITGL SAS
Sbjct  1    MLAWSQSRGFVYAYYVLRTISNILSQGSILCVSVAYAADVVESGKRAFAFSWITGLLSAS  60

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
            HVLGNL +RFL E Y I    + LL+  P+YM + L ETV      ++     +++ +  
Sbjct  61   HVLGNLLARFLPEKY-IFDITIALLLCPPIYMYVFLRETVAYAPRQDEESTWQTRIFRGV  119

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
             ++   +R    +V+ S TL+   +VSFFYQLG++GI +VL +YL+AAFGF
Sbjct  120  SKRYRSMRDAAIIVIRSQTLRGISIVSFFYQLGMTGISNVLLYYLEAAFGF  170



>gb|EMS64155.1| Hippocampus abundant transcript-like protein 1 [Triticum urartu]
Length=447

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 146/233 (63%), Gaps = 18/233 (8%)
 Frame = -2

Query  694  ALC--DGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPF  521
            +LC  DG +SC ++ Y+ GL  TV G+ + V    +GQL+D+YGRKPLL+L + T+IIP+
Sbjct  35   SLCPGDGSTSCPEAIYLTGLHQTVGGIFRAVGFTLMGQLADEYGRKPLLILAAGTSIIPY  94

Query  520  VLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSA  341
             +LA++ ++  VY Y V +T+S++I QG+I C+++AY AD+V+ + RA AF  +TG+ SA
Sbjct  95   SVLALSSTKVAVYVYLVTRTLSFMIGQGTITCLALAYTADLVEPSKRAFAFGCMTGILSA  154

Query  340  SHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKF  161
            SH LGN+ SRFL E + I Q ++ LL+   +YM               + L   S V   
Sbjct  155  SHSLGNVFSRFLPEQW-IFQVSVLLLVCSVVYM---------------KRLSLSSLVLGL  198

Query  160  CREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             +++   ++  + ++  + TLK    +SFFY+LG+ GI  VL +YLK  FGFD
Sbjct  199  PQQRWESIKDNISMIKINNTLKRITYISFFYELGMIGISDVLLYYLKLVFGFD  251



>gb|EMT19766.1| Hippocampus abundant transcript-like protein 1 [Aegilops tauschii]
Length=934

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/256 (39%), Positives = 152/256 (59%), Gaps = 26/256 (10%)
 Frame = -2

Query  694  ALC--DGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPF  521
            ALC  DG +SC ++ Y+ GL  TV G+ + V    +GQL+D+YGRKPLL+L + T+IIP+
Sbjct  35   ALCPGDGSTSCPEAIYLTGLHQTVGGIFRAVGFTLMGQLADEYGRKPLLILAAGTSIIPY  94

Query  520  V----------------------LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYA  407
                                   +LA++ ++  VY Y V +T+S++I QG+I C+++AY 
Sbjct  95   KDFYLLHQQSAFHDYCVHMLVAGVLALSSTKVAVYVYLVTRTLSFMIGQGTITCLALAYT  154

Query  406  ADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLV  227
            AD+V+ + RA AF  +TG+ SASH LGN+ SRFL E + I Q ++ LL+   +YM + LV
Sbjct  155  ADLVEPSKRAFAFGCMTGILSASHSLGNVFSRFLPEHW-IFQVSVLLLVCSVVYMKICLV  213

Query  226  ETVTPDGGVE-QSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISG  50
            ET+        Q L   S V    +++   ++  + ++  + TLK    +SFFY+LG+ G
Sbjct  214  ETLQKAPSASCQRLSLSSLVLGLPQQRWESIKDNISMIKINNTLKRITYISFFYELGMIG  273

Query  49   IDSVLPHYLKAAFGFD  2
            I  VL +YLK  FGFD
Sbjct  274  ISDVLLYYLKLVFGFD  289



>gb|KHN00908.1| Glycine-rich RNA-binding protein 2, mitochondrial [Glycine soja]
Length=763

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 126/220 (57%), Gaps = 43/220 (20%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+S+CS++ YING+Q T+VG+ KMVV+P LGQLSD+YGRKPLLL+T ST I PF 
Sbjct  159  SALCPGESTCSKAIYINGVQQTIVGIFKMVVLPLLGQLSDEYGRKPLLLITISTAIFPF-  217

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
                                                  DVV+E+ RA  FSWITGL S  
Sbjct  218  --------------------------------------DVVNESKRAAVFSWITGLLS--  237

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             VLG++ +  L E Y I   ++ LL F P+YM   LVETV      +Q   C +K+    
Sbjct  238  -VLGDVLAWSLPEKY-IFAVSIVLLTFSPVYMKFFLVETVIRALKNDQYSGCWAKIVDVP  295

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSV  38
            R++   +R   E+V+ SPTL+   LVSFFY+LG+SGI SV
Sbjct  296  RQRYISMRRAAEIVIFSPTLRGMALVSFFYELGMSGISSV  335



>gb|AFK48179.1| unknown [Medicago truncatula]
Length=139

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 88/121 (73%), Gaps = 1/121 (1%)
 Frame = -2

Query  532  IIPFVLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITG  353
            I PF LLA N+S  FVYAYYV++TISYIIS+GSIFCIS+AY ADVV+E  RA  F WITG
Sbjct  17   IFPFALLAWNQSEEFVYAYYVLRTISYIISKGSIFCISVAYVADVVNENKRAAVFGWITG  76

Query  352  LFSASHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSK  173
            LFSASHV+GN+ +RFL ++Y I   ++ LLIF P+YM   LVETV       Q L   SK
Sbjct  77   LFSASHVVGNVLARFLPQNY-IFVVSIALLIFCPVYMQFFLVETVKLAPRKNQELGFCSK  135

Query  172  V  170
            V
Sbjct  136  V  136



>ref|XP_007142795.1| hypothetical protein PHAVU_007G017500g [Phaseolus vulgaris]
 gb|ESW14789.1| hypothetical protein PHAVU_007G017500g [Phaseolus vulgaris]
Length=443

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 140/243 (58%), Gaps = 16/243 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G+Q  + GV  +V+ P +G LSD YGRK L+ L  + ++IP V+
Sbjct  35   ALCPGQDQCSLAIYLSGIQQAMAGVGSVVMTPLIGNLSDRYGRKALITLPLTLSVIPSVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++   F YAYYV++T++ +  +GS  C++ AY AD V +  R +AF  + G+ SAS 
Sbjct  95   LAYSRETRFFYAYYVVKTLASMAGEGSFHCLAFAYVADKVPDGKRTSAFGILAGVGSASF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V+G LA+RFL        AA+  +I + +YM + L ++V P GGV Q  P   +V+  C 
Sbjct  155  VVGTLAARFLSTALTFQVAAVTSMIAL-MYMRIFLKDSV-PGGGVRQ--PLLKEVEGKCS  210

Query  154  EQCYCVRTT------------LEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
            E     R T            + +V  SPT   A +VSFF  L   G+ +VL +YLKA F
Sbjct  211  EDDSSQRATGAFKKLPSLGDLICLVKCSPTFSQAAVVSFFNSLVDGGLMAVLLYYLKARF  270

Query  10   GFD  2
             F+
Sbjct  271  QFN  273



>ref|XP_004253206.1| PREDICTED: uncharacterized protein LOC101250386 [Solanum lycopersicum]
Length=440

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 146/238 (61%), Gaps = 7/238 (3%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y+ G+QHT++G+  ++++P LG LSD +GRK +L+L  + +I P V
Sbjct  36   SAICPGKDECSIAIYLTGIQHTLIGLGSLIIMPLLGNLSDTHGRKVMLMLPLTLSIFPLV  95

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++++ + YAYYV++T+  I+ +G++ C+++AY ADVV E +RA+ F  ++G+ S++
Sbjct  96   ILAYSRTKYYFYAYYVLKTLVAIVCEGNVHCLALAYVADVVPENHRASVFGVLSGIASSA  155

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V GNL++RFL    +  Q A  + I   +Y  + L E +  D    + +     ++K  
Sbjct  156  FVCGNLSTRFL-SVASTFQVAAIVAIIALVYTRMFLPEPLIKDQMSTKGIETICLLEKAP  214

Query  157  REQCYCVRT------TLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            + +    +T       L ++ +S TL  A +VSFF  +   G+DS L ++LKA F F+
Sbjct  215  KNKVQLFKTLPSFNDVLCLIRNSSTLLHAAIVSFFAHVAHVGLDSSLLYFLKAQFHFN  272



>gb|KDO84973.1| hypothetical protein CISIN_1g013411mg [Citrus sinensis]
 gb|KDO84974.1| hypothetical protein CISIN_1g013411mg [Citrus sinensis]
Length=396

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 137/241 (57%), Gaps = 10/241 (4%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y++G Q  ++G+  +V++P +G LSD YGRK LL +  + +IIP  
Sbjct  34   SAVCPGRDECSLAIYLSGFQQAIIGLGTLVMMPLVGNLSDKYGRKALLTVPITLSIIPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SR F YAYYV++T++ ++ +GSI C+S+AY AD V    RA+ F   +G+ S +
Sbjct  94   ILAYSRSRNFFYAYYVLRTLTAMVCEGSIHCLSLAYVADNVPPGRRASVFGIFSGIVSGA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV------TP--DGGVEQSLPC  182
             V G +++RF+       QAA    I   +YM + L E+V      TP      E S  C
Sbjct  154  FVCGTISARFISTS-AAFQAATAGSIISAVYMRIFLPESVRDEDLYTPILSSKAEISASC  212

Query  181  PSKVKKF-CREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
                KK    ++   +   + ++ SSPT   A +V+F   L  +G+   + +YLKA F F
Sbjct  213  EESTKKLQVFKRLPSIDDMVHLLKSSPTFSQAAIVAFLSNLADAGLQGSMMYYLKAKFHF  272

Query  4    D  2
            +
Sbjct  273  N  273



>ref|XP_006435264.1| hypothetical protein CICLE_v10001166mg [Citrus clementina]
 ref|XP_006473723.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Citrus 
sinensis]
 gb|ESR48504.1| hypothetical protein CICLE_v10001166mg [Citrus clementina]
 gb|KDO84972.1| hypothetical protein CISIN_1g013411mg [Citrus sinensis]
Length=443

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 137/241 (57%), Gaps = 10/241 (4%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y++G Q  ++G+  +V++P +G LSD YGRK LL +  + +IIP  
Sbjct  34   SAVCPGRDECSLAIYLSGFQQAIIGLGTLVMMPLVGNLSDKYGRKALLTVPITLSIIPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SR F YAYYV++T++ ++ +GSI C+S+AY AD V    RA+ F   +G+ S +
Sbjct  94   ILAYSRSRNFFYAYYVLRTLTAMVCEGSIHCLSLAYVADNVPPGRRASVFGIFSGIVSGA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV------TP--DGGVEQSLPC  182
             V G +++RF+       QAA    I   +YM + L E+V      TP      E S  C
Sbjct  154  FVCGTISARFISTS-AAFQAATAGSIISAVYMRIFLPESVRDEDLYTPILSSKAEISASC  212

Query  181  PSKVKKF-CREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
                KK    ++   +   + ++ SSPT   A +V+F   L  +G+   + +YLKA F F
Sbjct  213  EESTKKLQVFKRLPSIDDMVHLLKSSPTFSQAAIVAFLSNLADAGLQGSMMYYLKAKFHF  272

Query  4    D  2
            +
Sbjct  273  N  273



>ref|XP_003555206.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Glycine 
max]
Length=443

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 137/243 (56%), Gaps = 16/243 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  + GV  +V+ P +G LSD YGRK LL L  + ++IP V+
Sbjct  35   ALCPGQDQCSLAIYLSGFQQAMAGVGSVVMTPLIGNLSDRYGRKALLTLPLTVSVIPQVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++   F YAYYV++T++ +  +GS  C+++AY AD V +  R +AF  + G+ SAS 
Sbjct  95   LAYSRDTQFFYAYYVVKTLAAMAGEGSFHCLALAYVADKVPDGKRTSAFGILAGVGSASF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G LA+RFL       Q A  L +   +YM + L ++V P G + Q  P   +V++ C 
Sbjct  155  VGGTLAARFLSTALT-FQVASVLSMVALVYMRIFLKDSV-PGGALRQ--PLLKEVEEPCD  210

Query  154  EQCYCVRTT------------LEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
            E     R T            + ++  SPT   A +VSFF  L   G+ +VL +YLKA F
Sbjct  211  EDDSSPRATGTFKKLPSLGDLICLLRCSPTFSQAAMVSFFNSLADGGLMAVLLYYLKARF  270

Query  10   GFD  2
             F+
Sbjct  271  QFN  273



>emb|CAN64703.1| hypothetical protein VITISV_038996 [Vitis vinifera]
Length=408

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 142/241 (59%), Gaps = 11/241 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ G Q  ++G+  +V++P +G LSD YGRK LL +    TIIP  +
Sbjct  35   ALCPGRDECSIAIYLTGFQQVIIGLGTLVMMPLVGNLSDMYGRKALLTIPMCLTIIPLAI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++SR F YAY+V++T++ ++ +GS+ C+++AY AD + E  RA+AF  ++G+ S++ 
Sbjct  95   LAWSRSRNFFYAYFVLKTLTSMVCEGSVHCLTLAYVADNIPEIRRASAFGVLSGVGSSAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSL----PCPSKVK  167
            V G L++RFL    +  Q A  +     +YM L L ++V  DG +++++    PC   + 
Sbjct  155  VCGTLSARFLKTS-STFQVAASVAAVAAVYMKLFLPDSVIKDGVLDRAILEQKPCVIHLD  213

Query  166  KFCREQCYCVRT------TLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
                +     ++       L ++ +S T   A +V+FF  LG  G+ + L +YLKA F F
Sbjct  214  GESAQDSPVFKSMPSLDDMLSLLQTSSTFTKAAIVAFFSNLGDVGLHTSLMYYLKARFHF  273

Query  4    D  2
            +
Sbjct  274  N  274



>ref|XP_002284761.1| PREDICTED: hippocampus abundant transcript 1 protein [Vitis vinifera]
 emb|CBI18912.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 142/241 (59%), Gaps = 11/241 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ G Q  ++G+  +V++P +G LSD YGRK LL +    TIIP  +
Sbjct  35   ALCPGRDECSIAIYLTGFQQVIIGLGTLVMMPLVGNLSDMYGRKALLTIPMCLTIIPLAI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++SR F YAY+V++T++ ++ +GS+ C+++AY AD + E  RA+AF  ++G+ S++ 
Sbjct  95   LAWSRSRNFFYAYFVLKTLTSMVCEGSVHCLTLAYVADNIPEIRRASAFGVLSGVGSSAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSL----PCPSKVK  167
            V G L++RFL    +  Q A  +     +YM L L ++V  DG +++++    PC   + 
Sbjct  155  VCGTLSARFLKTS-STFQVAASVAAVAAVYMKLFLPDSVIKDGVLDRAILEQKPCVIHLD  213

Query  166  KFCREQCYCVRT------TLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
                +     ++       L ++ +S T   A +V+FF  LG  G+ + L +YLKA F F
Sbjct  214  GESAQDSPVFKSMPSLDDMLSLLQTSSTFTKAAIVAFFSNLGDVGLHTSLMYYLKARFHF  273

Query  4    D  2
            +
Sbjct  274  N  274



>gb|KHG11074.1| Hippocampus abundant transcript 1 [Gossypium arboreum]
Length=436

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 140/245 (57%), Gaps = 16/245 (7%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS +  ++G Q  ++G+  +V++P +G LSD YGRK LL L  + TIIP  
Sbjct  34   SALCPGEIECSLAILLSGFQQAIIGLGSLVMMPLIGNLSDKYGRKALLTLPITLTIIPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SR F YAYYV + ++ +  +GS+ C+S+AY AD V E  RA+AF  ++G+ S++
Sbjct  94   ILAYSRSRNFFYAYYVFKILTSMFCEGSVHCLSLAYVADNVPEGRRASAFGILSGIGSSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV------TP-------DGGVE  197
             V G L++RFL    +  Q A  + +   +YM + L +++      TP       DG V 
Sbjct  154  FVCGTLSTRFLSTA-STFQVATAMAMLSAVYMRVFLPDSIVNDNLSTPILSEGKLDGIVN  212

Query  196  QSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
            Q      K++ F  +    +   L ++ SS T   A +VSFF  L   G+ + L +YLKA
Sbjct  213  QDEESDKKIQMF--KTLPSIEDMLALLKSSLTFSQAAIVSFFSTLSDVGLHASLLYYLKA  270

Query  16   AFGFD  2
             F F+
Sbjct  271  RFHFN  275



>ref|XP_011088646.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Sesamum 
indicum]
Length=439

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 132/241 (55%), Gaps = 10/241 (4%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y+ G Q  + G+  ++++P +G LSD YGRK ++ +    +IIP V
Sbjct  34   SAVCPGKDECSPAIYLTGFQQAIAGIGSVIMMPLIGNLSDAYGRKNMMAIPLLLSIIPLV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA  ++  F YAYY ++T + +++QG + C+++AY AD V E  R +AF  ++G+ SA+
Sbjct  94   VLAWKRTLTFFYAYYAIKTFTAMVTQGGVACLALAYLADNVSEGKRISAFGVLSGVTSAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSL---------P  185
            +V G LA+R L     I Q A  L +   +YM + L ET   D  +EQ +          
Sbjct  154  YVGGTLAARLLSTA-QIFQVAAILSMVAAIYMGVFLKETTRGDDVLEQPILKVTEGDEDS  212

Query  184  CPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
            C +  K     +    R    ++ SS T   A  V+FF  L  +G+ S L ++LKA F F
Sbjct  213  CKASKKIEVIRKIPSPRDIYRLLKSSITFSLAACVTFFNSLAEAGLQSCLLYFLKARFQF  272

Query  4    D  2
             
Sbjct  273  K  273



>ref|XP_008236069.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Prunus 
mume]
Length=444

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 90/245 (37%), Positives = 134/245 (55%), Gaps = 18/245 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  +V+ P +G LSD YGRK LL +  + +IIP V+
Sbjct  36   ALCPGQDECSLAIYLSGFQQAIIGLGTVVMTPLIGNLSDVYGRKSLLTVPLTLSIIPLVI  95

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++   F YAY+ ++T++ ++ +GSI C+++AY AD V E  R +AF  + G  SAS 
Sbjct  96   LAYSRETNFFYAYFALRTVTAMVCEGSINCLTLAYVADTVSEGERVSAFGILAGFLSASF  155

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV-TPDGGVEQSLPCPSKVKKFC  158
            V G LA+RFL        AA   ++   +YM + L E++   DG + Q  P         
Sbjct  156  VCGTLAARFLSTASTFQVAAFASML-ATIYMRVFLKESLPARDGTLRQ--PILKGGSDAI  212

Query  157  REQCYCVRTTLEV-------------VVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
             E  Y    T+EV             + SS TL  A +VSFF  L   G+ + L ++LKA
Sbjct  213  EEDGYSPE-TIEVFKKVPSAGDLICLLRSSKTLSQAAIVSFFQSLAEGGLQASLMYFLKA  271

Query  16   AFGFD  2
             F F+
Sbjct  272  RFHFN  276



>ref|XP_010100117.1| Hippocampus abundant transcript 1 protein [Morus notabilis]
 gb|EXB81500.1| Hippocampus abundant transcript 1 protein [Morus notabilis]
Length=425

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 87/245 (36%), Positives = 136/245 (56%), Gaps = 17/245 (7%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y+ G Q  ++G+  +V++P +G+LSD YGRK LL +  + TIIP  
Sbjct  35   SALCPGKDECSLAIYLTGFQQVIIGLGTLVMMPIVGKLSDKYGRKSLLTMPMAFTIIPLG  94

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA +++R F+YAYY  +T+  +IS GS+ C+++AY AD V E  RA+AF  ++G+ S  
Sbjct  95   ILACSRTRNFIYAYYAFKTLFAMISDGSVHCLALAYVADNVPEARRASAFGILSGISSCG  154

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V G L +RFL    +  Q A  L +   +YM + L ++V  D     S+P  S  K   
Sbjct  155  FVCGTLTARFL-STASTFQVAASLAVVSLVYMRVFLPDSVIDD---NLSVPIMSTEKPNA  210

Query  157  RE-------------QCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
            +E                     + ++ +SPT   A +V+FF  L   G+ S + +YLKA
Sbjct  211  KELVKDSSKKENLFKSMPSADDMVALLNTSPTFSKAAVVAFFSNLADVGLHSSMMYYLKA  270

Query  16   AFGFD  2
             F F+
Sbjct  271  EFHFN  275



>ref|XP_009776326.1| PREDICTED: solute carrier family 46 member 3-like [Nicotiana 
sylvestris]
 ref|XP_009776327.1| PREDICTED: solute carrier family 46 member 3-like [Nicotiana 
sylvestris]
Length=440

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/238 (34%), Positives = 142/238 (60%), Gaps = 7/238 (3%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y+ G QH ++G+  ++++P LG LSD YGRK +L +  + +I P V
Sbjct  36   SAICPGKDECSLAIYLTGFQHAIIGLGSLIIMPVLGNLSDTYGRKVMLTVPLTLSIFPLV  95

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++++ F YAYYV++T+  ++ +G++ C+++AY ADVV E+ RA+ F  ++G+ S++
Sbjct  96   ILAYSRTKYFFYAYYVLRTLVAMVCEGNVHCLALAYVADVVPESRRASVFGVLSGIASSA  155

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V GNL++RFL    +  Q A  + +   +Y  + L E +  D    +       ++K  
Sbjct  156  FVCGNLSTRFL-STASTFQVAATVAVIALVYTRMFLPEPLIKDHISAKGTETICLLEKTP  214

Query  157  REQCYCVRT------TLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +E     +T       L ++ +S TL  A +VSFF  +   G++S L ++LKA F F+
Sbjct  215  KESFQLFKTLPSFNDVLCLLKNSSTLLHAAIVSFFVYVAQVGLESSLLYFLKAQFHFN  272



>ref|XP_003535759.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Glycine 
max]
Length=443

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 137/243 (56%), Gaps = 16/243 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  + GV  +V+ P +G LSD YGRK LL L  + ++IP V+
Sbjct  35   ALCPGQDQCSLAIYLSGFQQAMAGVGSVVMTPLIGNLSDRYGRKALLTLPLTVSVIPQVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++   F YAYYV++T++ +  +GS  C+++AY AD V +  R +AF  + G+ SAS 
Sbjct  95   LAYSRDTQFFYAYYVVKTLAAMAGEGSFHCLALAYVADKVPDGKRTSAFGILAGVGSASF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G LA+RFL       Q A  L +   +YM + L ++V P G + Q  P    V++ C 
Sbjct  155  VGGTLAARFLSTALT-FQVASVLSMVALVYMRIFLKDSV-PGGAIRQ--PLLKVVEESCA  210

Query  154  EQCYCVRT--TLEVVVS----------SPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
            E     ++  T + + S          SPT   A +VSFF  L   G+ +VL +YLKA F
Sbjct  211  EDDSTPKSAGTFKKLPSLGDFICLLKCSPTFSQAAIVSFFNSLADGGLMAVLLYYLKARF  270

Query  10   GFD  2
             F+
Sbjct  271  QFN  273



>gb|EYU37985.1| hypothetical protein MIMGU_mgv1a006613mg [Erythranthe guttata]
Length=437

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 130/238 (55%), Gaps = 9/238 (4%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            A+C G+  CS + Y+ G Q  + GV  ++++P +G LSD YGRK LL +    T IP V+
Sbjct  35   AVCPGKDECSAAIYLTGFQQAIAGVGSVIMMPLIGNLSDVYGRKALLSVPLVLTFIPLVV  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  ++  F YAYY+++T++ +I+Q  + C+++ Y AD V E  R +AF  + G+ +A++
Sbjct  95   LAWKRTTNFFYAYYILKTLTAMITQSGVTCLALGYLADNVKEGKRVSAFGVLQGVSAAAY  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSL--------PCP  179
            V G LA+R L     I Q A  + I   +YM + L ET      ++Q +           
Sbjct  155  VGGTLAARLLSTT-QIFQVAATISILAAIYMGVFLKETTRGTDALKQPILEVTESDDGSS  213

Query  178  SKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
              +KK   ++    R    ++ SS T   A  V+FF  L  +G+ + L ++LKA FGF
Sbjct  214  KALKKIDIKKIPSPRDIFRLLKSSITFSLAAFVAFFNSLAEAGLQTCLLYFLKARFGF  271



>ref|XP_010086842.1| Hippocampus abundant transcript 1 protein [Morus notabilis]
 gb|EXB24040.1| Hippocampus abundant transcript 1 protein [Morus notabilis]
Length=431

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 136/243 (56%), Gaps = 14/243 (6%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+  CS + Y+ G Q  + G+  +V+ P +G LSD YGRK LL L  +  IIP V
Sbjct  34   TALCPGRDECSFAIYLTGFQQAITGLGMVVMTPVIGNLSDKYGRKSLLTLPLTLNIIPLV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N++  F YAYYVM+T++ ++ +GS  C+++AY AD + +  RA+AF  ++G+ SA+
Sbjct  94   ILAYNRTTNFFYAYYVMKTLTAMVCEGSTNCLALAYVADHISDQGRASAFGIMSGVVSAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPD---------GG--VEQS  191
             V G LASRFL        AAL  +    +YM + L E++  +         GG  +E++
Sbjct  154  FVCGTLASRFLPTASTFQVAALASMT-AAVYMRVFLEESLPHEDSLRQPILKGGPDIEKN  212

Query  190  LPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
               P + +    +    ++  + ++ SS T   A  VSFF  L   G  + L ++LKA F
Sbjct  213  GEAPKRTQ--VSKTFPTMKDLISLLKSSKTFSEAATVSFFNSLAEGGFQASLMYFLKARF  270

Query  10   GFD  2
             F+
Sbjct  271  HFN  273



>ref|XP_007201037.1| hypothetical protein PRUPE_ppa005784mg [Prunus persica]
 gb|EMJ02236.1| hypothetical protein PRUPE_ppa005784mg [Prunus persica]
Length=444

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/245 (37%), Positives = 133/245 (54%), Gaps = 18/245 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  +V+ P +G LSD YGRK LL +  + +IIP V+
Sbjct  36   ALCPGQDECSLAIYLSGFQQAIIGLGTVVMTPLIGNLSDVYGRKSLLTVPLALSIIPLVI  95

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++   F YAY+ ++T++ ++ +GSI C+++AY AD V E  R  AF  + G  SAS 
Sbjct  96   LAYSRETNFFYAYFALRTVTAMVCEGSINCLTLAYVADTVSERERVPAFGILAGFLSASF  155

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVT-PDGGVEQSLPCPSKVKKFC  158
            V G LA+RFL        AA   ++   +YM + L E++   DG + Q  P         
Sbjct  156  VCGTLAARFLSTASTFQVAAFASML-ATIYMRVFLKESLPGRDGTLRQ--PILKGGSDAI  212

Query  157  REQCYCVRTTLEV-------------VVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
             E  Y    T+EV             + SS TL  A +VSFF  L   G+ + L ++LKA
Sbjct  213  EEDGYSPE-TIEVFKKVPSAGDLICLLRSSKTLSQAAIVSFFQSLAEGGLQASLMYFLKA  271

Query  16   AFGFD  2
             F F+
Sbjct  272  RFHFN  276



>gb|KHG18467.1| Hippocampus abundant transcript 1 [Gossypium arboreum]
Length=443

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 138/247 (56%), Gaps = 19/247 (8%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  ++G+   +++P +G LSD YGRK LL L  + +IIP  +
Sbjct  36   ALCPGTDECSLAIYLSGFQQAIIGLGTALMMPIIGNLSDQYGRKALLTLPMTLSIIPLAI  95

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA N++  + YAY+  +T++ ++ QGSI C+++AY AD +    RA+AF  + G+ SA++
Sbjct  96   LACNRTTNYFYAYFAFKTLTDMVCQGSINCLALAYLADNISYRQRASAFGILAGVTSAAY  155

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLP----------  185
            V G LA+RFL       Q A  + +F  +YM + L E++  D G   + P          
Sbjct  156  VCGTLAARFLSTGLA-FQVATFVSLFAVVYMRIFLEESIPADQGEGITQPILKEGEEDNI  214

Query  184  ------CPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYL  23
                   P+KV  F  ++   +   + ++ +SP+     +V+FF  LG  G++S   +YL
Sbjct  215  IQNDDNAPTKVPPF--KKIPSLGDVIYLMKNSPSFAQTAIVAFFNNLGEGGMESSSMYYL  272

Query  22   KAAFGFD  2
            KA F F+
Sbjct  273  KARFHFN  279



>ref|XP_008791950.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Phoenix 
dactylifera]
Length=444

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 90/252 (36%), Positives = 132/252 (52%), Gaps = 29/252 (12%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+  CS + Y+ G+Q  + G+  ++V P +G LSD YGRK LL L  +T IIP  
Sbjct  34   EALCPGRDQCSLAVYLGGVQQVITGLGTLIVTPLIGNLSDRYGRKALLALPMTTAIIPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SR + YAYY+++ ++ +  +GS+ C+S+AY AD V E  RATAF   +G+ +A 
Sbjct  94   ILAYDRSRAYFYAYYIIKMLTGMFCEGSMQCLSLAYVADKVGERRRATAFGVFSGVSAAG  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVET------------------VTP  212
             V G L++RFL    +  Q +  + +   +YM L LVET                   TP
Sbjct  154  FVSGTLSARFLSTS-STFQVSAIVAVIAAVYMRLFLVETDRGVAGGGGEEEASQPLCSTP  212

Query  211  --DGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSV  38
              DG     LP   K+          +   + +V  S TL  A +V FF     SG+ S 
Sbjct  213  SSDGESSPRLPALPKLPS--------LEDMIGLVRGSSTLSRAAVVVFFNSFAESGVQSA  264

Query  37   LPHYLKAAFGFD  2
            L ++LKA F F 
Sbjct  265  LLYFLKAQFQFS  276



>ref|XP_011034951.1| PREDICTED: uncharacterized protein LOC105132907 isoform X1 [Populus 
euphratica]
Length=457

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 144/255 (56%), Gaps = 29/255 (11%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y++GLQ T++G+  +V +P +G +SD YGRK LL +  S  I+P  
Sbjct  41   SALCPGEDECSLAIYLSGLQKTIIGLGTLVTMPLIGNMSDKYGRKALLTVPMSLIIVPSA  100

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA +++R F YAYYV++T+  ++ +GS+ C+++AY AD V E  RA+ F  +TG+ S++
Sbjct  101  ILAYSRTRNFFYAYYVVRTLVSMVCEGSVQCLALAYVADNVPENRRASTFGILTGIASSA  160

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP-------  179
             V GNL++RFL    +  Q +  + I   +YM   L +++     +++ L  P       
Sbjct  161  FVCGNLSTRFLSTS-STFQVSALVAIAALVYMRFFLQDSI-----IDEQLSTPILTNKGD  214

Query  178  ----SKVKKFC--RE------QCYCVRTTLE----VVVSSPTLKCACLVSFFYQLGISGI  47
                 K    C  RE      Q +    +LE    ++ SS TL  A +V+FFY L   G+
Sbjct  215  GKGKGKANAACCAREIPSKNVQVFKSAPSLEDMLCLLKSSVTLSQAAVVAFFYSLAEVGL  274

Query  46   DSVLPHYLKAAFGFD  2
             + L +YLKA F F 
Sbjct  275  HASLMYYLKAQFHFS  289



>ref|XP_009767684.1| PREDICTED: uncharacterized protein LOC104218795 [Nicotiana sylvestris]
Length=438

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 143/240 (60%), Gaps = 11/240 (5%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y+ G+Q  +VG+  +V++P LG LSD YGRK +L +  + +I P V
Sbjct  34   SAICPGKDECSLAIYLTGIQQAIVGMGSLVMMPILGNLSDTYGRKVMLTVPMTLSIFPLV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++++ F YAYYV++T+  +I +GS+ C+++AY AD V E+ RA+ F  ++G+ S++
Sbjct  94   ILAYSRTKYFFYAYYVLRTLIAMICEGSVQCLALAYVADNVPESRRASVFGVLSGIASSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGV---EQSLPC-----  182
             V GNL++RFL    +  Q A  + +   +YM + L E+VT  G +   E    C     
Sbjct  154  FVCGNLSARFLSTA-STFQVAAAMAVIALVYMKMFLPESVT-KGNICSKETETICLLENS  211

Query  181  PSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            P K  +F +         L ++ +S T   A +VSFF  +   G+++ L ++LKA F F+
Sbjct  212  PKKGFQFFKT-LPSFSDMLCLLKTSSTFLHAAVVSFFVNVAQVGVEASLLYFLKAQFHFN  270



>ref|XP_006342707.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=440

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/238 (33%), Positives = 144/238 (61%), Gaps = 7/238 (3%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y+ G+QH ++G+  ++++P LG LSD +GRK +L+L  + +I P V
Sbjct  36   SAICPGKDECSIAIYLTGIQHAIIGLGSLIIMPVLGNLSDTHGRKVMLMLPLTLSIFPLV  95

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++++ + YAYYV++T+  I+ +G++ C+++AY ADVV E+ RA+ F  ++G+ S++
Sbjct  96   ILAYSRTKYYFYAYYVLKTLVAIVCEGNVHCLALAYVADVVPESRRASVFGVLSGIASSA  155

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V GNL++RFL    +  Q A  + +   +Y  + L E +  D    + +     +++  
Sbjct  156  FVCGNLSTRFL-STASTFQVAATVAVIALVYTRMFLPEPLKKDQISTKGIETICLLERAP  214

Query  157  REQCYCVRT------TLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            + +    +T       L ++ +S T   A +VSFF  +   G+DS L ++LKA F F+
Sbjct  215  KNKFQLFKTLPSFNDVLCLLRNSSTFLHAAIVSFFANVAHVGLDSSLLYFLKAQFHFN  272



>ref|XP_010061116.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Eucalyptus grandis]
Length=443

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 140/245 (57%), Gaps = 14/245 (6%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC GQ+ CS + Y++G+Q  +VG+  +V++P +G LSD YGRK LL +    TIIP  
Sbjct  34   SALCPGQARCSLAIYLSGIQQAIVGLGSLVMMPLIGNLSDKYGRKALLTIPLVFTIIPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SR F Y YYV +T++ I  +GS+ C+++AY AD V    RA+AF  ++G+ SA+
Sbjct  94   ILAYSRSRNFFYLYYVFRTLTAIFCEGSVHCLALAYVADNVPAGRRASAFGILSGIGSAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGG-------VEQSLP--  185
             V GNL++RFL    +  Q A  + +    YM   L ++V            V + +P  
Sbjct  154  FVCGNLSTRFLSTP-STFQVATAVAVVALAYMRFFLPDSVVVGDDDPLTAPIVSKGMPDG  212

Query  184  -CP---SKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
             CP   S  K    ++   +  T+ ++ SS T   A +V+FF  L   G+ + + +YLKA
Sbjct  213  ACPDDDSANKAHAFKKTPSLGDTVALLRSSLTFLQAAIVAFFGNLADVGLHASMMYYLKA  272

Query  16   AFGFD  2
             F F+
Sbjct  273  QFHFN  277



>ref|XP_002313691.1| hypothetical protein POPTR_0009s14090g [Populus trichocarpa]
 gb|EEE87646.1| hypothetical protein POPTR_0009s14090g [Populus trichocarpa]
Length=442

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/242 (34%), Positives = 135/242 (56%), Gaps = 12/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            A+C GQ  CS + Y+ G Q   +G+  +V++P +G LSD YGRK LL L  + +IIP V+
Sbjct  35   AVCPGQDECSLAIYLTGFQQASIGMGTVVMLPLIGNLSDQYGRKALLTLPMTLSIIPLVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +++ GF YAYY ++T++ +I +GSI C+++AY AD V E  R + F  ++G+ +A+ 
Sbjct  95   LAYSRTTGFFYAYYALRTLTAMICEGSIDCLALAYVADNVLERQRTSVFGILSGITTAAL  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSK------  173
            V G LA+RFL       Q A  L +   +YM + L E++     + Q +    +      
Sbjct  155  VCGTLAARFLSTALT-FQVAALLSMLAAVYMRIFLEESLPQSENLTQPILKSGQDDHCQD  213

Query  172  -----VKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
                  K    ++   ++  + ++ SS T   A +V+FF+ L   G+ + + +YLKA F 
Sbjct  214  DGDLPRKPMVSKKIPSIQAIISLLKSSVTFSQAAIVAFFHSLSYGGLQASIMYYLKARFH  273

Query  7    FD  2
            F 
Sbjct  274  FS  275



>ref|XP_002510601.1| tetracycline transporter, putative [Ricinus communis]
 gb|EEF52788.1| tetracycline transporter, putative [Ricinus communis]
Length=442

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/243 (35%), Positives = 141/243 (58%), Gaps = 13/243 (5%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y+ G Q  ++G+  +V++P +G LSD YGRK LL +  S T+IP  
Sbjct  34   SALCPGRDECSLAIYLTGFQQAIIGLGTLVMMPLVGNLSDKYGRKALLTIPMSLTVIPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
             LA +++  F YAYYVM+T++ ++ +GS+ C+++AY AD V E  RA+AF  ++G+ S++
Sbjct  94   TLAYSRTTYFFYAYYVMKTLTAMVCEGSVHCLALAYVADNVPEARRASAFGILSGIGSSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V G L++RFL    +  Q +  + +   +YM + L +++  D  +   +    K K + 
Sbjct  154  FVCGTLSTRFL-STASTFQVSASMAVVAIVYMKVFLQDSIV-DKNLTTPIISNGKGKVYV  211

Query  157  R-------EQCYCVRTTLEVVV----SSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
            +       EQ +    +LE ++    SS T   A +V+FF  L   G+ + L +YLKA F
Sbjct  212  QIENSSENEQVFRTMPSLEDMICLLKSSVTFTQAAIVAFFINLSEVGLHASLMYYLKARF  271

Query  10   GFD  2
             F+
Sbjct  272  HFN  274



>ref|XP_003527649.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Glycine max]
Length=432

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/242 (36%), Positives = 131/242 (54%), Gaps = 12/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + YI G Q  ++G+  +V++P LG LSD YGRK +L +    TIIP  +
Sbjct  35   ALCPGQDECSLAIYITGFQQAMIGLGTLVMMPLLGNLSDKYGRKAILTVPMILTIIPVGI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++++ F Y YYV + +  +I +GS+ C+ +AY AD + E+ R+TAF  ++G+ SA+ 
Sbjct  95   LAYSRTKKFFYVYYVFKILISMICEGSVPCLGLAYVADNIPESGRSTAFGILSGIASAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGG-----VEQSLPCPSKV  170
            V G L++RFL       Q +  + +   LYM   L ++   D       + Q  P  SKV
Sbjct  155  VCGTLSARFLSTALT-FQVSTLIAVIGALYMQFFLRDSAIDDKHLYTPIISQENPIISKV  213

Query  169  ------KKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
                  KK   +    +      + SS T+  A +V+FF  L   G+   L ++LKA F 
Sbjct  214  NGKLESKKHLFKALRSIEDLTSFLNSSLTITQAAIVAFFNSLADVGLHGSLLYFLKAQFH  273

Query  7    FD  2
            FD
Sbjct  274  FD  275



>ref|XP_009624104.1| PREDICTED: solute carrier family 46 member 3-like [Nicotiana 
tomentosiformis]
Length=440

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 144/238 (61%), Gaps = 7/238 (3%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y+ G QH ++G+  ++++P LG LSD YGRK +L++  + +I P V
Sbjct  36   SAICPGKDECSLAIYLTGFQHAIIGLGSLIIMPVLGNLSDTYGRKVMLMVPLTLSIFPLV  95

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++++ F YAYYV++T+  ++ +G++ C+++AY ADVV ++ RA+ F  ++G+ S++
Sbjct  96   ILAYSRTKYFFYAYYVLRTLVAMVCEGNVHCLALAYVADVVPKSRRASVFGVLSGIASSA  155

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V GNL++RFL    +  Q A  + +   +Y  + L E +  D    +       ++K  
Sbjct  156  FVCGNLSTRFL-STASTFQVAATVAVIALVYTRMFLPEPLIKDHISAKGTDTICLLQKAP  214

Query  157  REQCYCVRT------TLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            ++    ++T       + ++ +S TL  A +VSFF  +   G++S L ++LKA F F+
Sbjct  215  KKNIQLLKTLPSFNDVICLLRNSSTLLHAAIVSFFVYVAQVGLESSLLYFLKAQFHFN  272



>gb|KHN20137.1| Hippocampus abundant transcript-like protein 1 [Glycine soja]
Length=432

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/242 (36%), Positives = 131/242 (54%), Gaps = 12/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + YI G Q  ++G+  +V++P LG LSD YGRK +L +    TIIP  +
Sbjct  35   ALCPGQDECSLAIYITGFQQAMIGLGTLVMMPLLGNLSDKYGRKAILTVPMILTIIPVGI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++++ F Y YYV + +  +I +GS+ C+ +AY AD + E+ R+TAF  ++G+ SA+ 
Sbjct  95   LAYSRTKKFFYVYYVFKILISMICEGSVPCLGLAYVADNIPESGRSTAFGILSGIASAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGG-----VEQSLPCPSKV  170
            V G L++RFL       Q +  + +   LYM   L ++   D       + Q  P  SKV
Sbjct  155  VCGTLSARFLSTALT-FQVSTLIAVIGALYMQFFLRDSAIDDKHLYTPIISQENPIISKV  213

Query  169  ------KKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
                  KK   +    +      + SS T+  A +V+FF  L   G+   L ++LKA F 
Sbjct  214  NGKLESKKHLFKALRSIEDLTSFLNSSLTITQAAIVAFFNSLADVGLHGSLLYFLKAQFH  273

Query  7    FD  2
            FD
Sbjct  274  FD  275



>emb|CDP07341.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 142/239 (59%), Gaps = 8/239 (3%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y++G Q  ++G+  +V++P +G LSD YGRK +L +  + +I P  
Sbjct  35   SAVCPGKDECSLAIYLSGFQQAIIGLGSLVMMPLVGNLSDRYGRKVMLTVPMTLSIFPLA  94

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++++GF YAY V++T+  ++++GS+ C+++AY AD V E+ R + F  ++G+ S +
Sbjct  95   VLAYSRTKGFFYAYCVLRTLISMLTEGSVQCLALAYVADNVPESKRVSIFGILSGIASCA  154

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGV-EQSLPCPSKVKKF  161
             V GNL++RFL     + Q A    +   +YM + L E+++    V EQ+    S ++K 
Sbjct  155  FVCGNLSTRFLSTS-AVFQVAAGGTVISLVYMRMFLPESMSRSSIVSEQATETDSLLEKS  213

Query  160  CREQCYCVRT------TLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             ++     +T      T+ ++ +S T   A ++SFF  +   G  S L +YLKA F FD
Sbjct  214  PKKTLKLFKTLPSLKDTISMLRTSKTFSQAAVISFFSTVAEVGAHSSLLYYLKAQFHFD  272



>ref|XP_002306959.1| hypothetical protein POPTR_0005s26720g [Populus trichocarpa]
 gb|EEE93955.1| hypothetical protein POPTR_0005s26720g [Populus trichocarpa]
Length=447

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 141/247 (57%), Gaps = 16/247 (6%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y+ G Q  ++G+  +V++P +G +SD YGRK LL +  S  I+P  
Sbjct  34   SALCPGRDECSLAIYLTGFQQAIIGLGTLVMMPLIGNMSDKYGRKALLTVPLSLVIVPSA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA +++R F YAYYV++T+  ++ +GS+ C+++AY AD V E  RA+AF  ++G+ S++
Sbjct  94   ILAYSRTRNFFYAYYVVKTLIAMVCEGSVPCLALAYVADNVPEGRRASAFGILSGIASSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V GNL++RFL    +  Q +  + I   +YM   L +++  +      L    K K   
Sbjct  154  FVCGNLSTRFLSTA-STFQVSASVAIASLVYMRFFLQDSIIDEQLTAPILTSNGKPKGKG  212

Query  157  RE-----------QCYCVRTTLE----VVVSSPTLKCACLVSFFYQLGISGIDSVLPHYL  23
            ++           Q +    +LE    ++ SS TL  A +V+FFY L   G+ + L +YL
Sbjct  213  KDYATNEIPSKNVQIFKSAPSLEDMLCLLKSSVTLSQAAVVAFFYSLAEVGLHASLLYYL  272

Query  22   KAAFGFD  2
            KA F F+
Sbjct  273  KARFHFN  279



>ref|XP_002968361.1| hypothetical protein SELMODRAFT_169638 [Selaginella moellendorffii]
 gb|EFJ30615.1| hypothetical protein SELMODRAFT_169638 [Selaginella moellendorffii]
Length=440

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 135/232 (58%), Gaps = 6/232 (3%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC GQ+ C+++ Y+ G+Q  V G+  M+V P LG+LSD+YGRKPLL++  S  ++P  
Sbjct  53   GALCPGQAECNEAIYLTGIQQIVAGIGTMLVTPILGELSDEYGRKPLLMIPFSAAVLPMA  112

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SR FVYAY V+ T+  I ++G I C+S AY +D ++   RA A   + G FS  
Sbjct  113  ILAYSQSRPFVYAYMVVGTVVRIFAEGGITCLSFAYVSDCIERRYRALAIGVLMGSFSVG  172

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKV-KKF  161
            +V+G L +R L +D  I + A  ++ F  +Y+ + L ET    G     LP  S   ++ 
Sbjct  173  YVIGILLARVLAQD-QIFKVAAVVIAFAAVYVKVFLPETNAERG--PPLLPNHSDTHQQH  229

Query  160  CREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
             R++C    T L +  +S       ++ FF  LG +G+   L +YLKA FGF
Sbjct  230  KRDECRS--TPLLMRSTSSITDTVAVIVFFSSLGEAGLQGSLLYYLKATFGF  279



>ref|XP_003523261.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Glycine max]
 gb|KHN45961.1| Hippocampus abundant transcript-like protein 1 [Glycine soja]
Length=432

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 86/242 (36%), Positives = 132/242 (55%), Gaps = 12/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + YI G Q  ++G+  +V++P LG LSD YGRK +L L    TIIP  +
Sbjct  35   ALCPGQDECSLAIYITGFQQAMIGLGTLVMMPLLGNLSDKYGRKAILTLPMILTIIPVGI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++++ F Y YYV + +  ++ +GS+ C+++AY AD V E+ R+T F  ++G+ SA+ 
Sbjct  95   LAYSRTKKFFYVYYVFKILISMVCEGSVPCLALAYVADNVPESGRSTVFGILSGIGSAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGG-----VEQSLPCPSKV  170
            V   L++RFL       Q +  + +   LYM   L ++V  D       + Q  P  SKV
Sbjct  155  VCATLSARFLSSALT-FQVSTLIAVIGALYMQFFLRDSVIDDKHLYTPIISQGNPIISKV  213

Query  169  ------KKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
                  KK   +    ++     + SS T+  A +V+FF  L   G+   L ++LKA F 
Sbjct  214  NGNLESKKHLLKALRSIKDLTSFLNSSLTINQAAIVAFFNSLADVGLHGSLLYFLKAQFH  273

Query  7    FD  2
            FD
Sbjct  274  FD  275



>ref|XP_002965935.1| hypothetical protein SELMODRAFT_167756 [Selaginella moellendorffii]
 gb|EFJ33355.1| hypothetical protein SELMODRAFT_167756 [Selaginella moellendorffii]
Length=459

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 87/232 (38%), Positives = 135/232 (58%), Gaps = 6/232 (3%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC GQ+ C+++ Y+ G+Q  + G+  M+V P LG+LSD+YGRKPLL++  S  ++P  
Sbjct  53   GALCPGQAECNEAIYLTGIQQIIAGIGTMLVTPILGELSDEYGRKPLLMIPFSAAVLPMA  112

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SR FVYAY V+ T+  I ++G I C+S AY +D ++   RA A   + G FS  
Sbjct  113  ILAYSQSRPFVYAYMVVGTVVRIFAEGGITCLSFAYVSDCIERRYRALAIGVLMGSFSVG  172

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKV-KKF  161
            +V+G L +R L +D  I + A  ++ F  +Y+ + L ET    G     LP  S   ++ 
Sbjct  173  YVIGILLARVLAQD-QIFKVAAVVIAFAAVYVKVFLPETNAERG--PPLLPNHSDTHQQH  229

Query  160  CREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
             R++C    T L +  +S       ++ FF  LG +G+   L +YLKA FGF
Sbjct  230  KRDECRS--TPLLMRSTSSITDTVAVIVFFSSLGEAGLQGSLLYYLKATFGF  279



>ref|XP_009400334.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Musa 
acuminata subsp. malaccensis]
Length=434

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 138/245 (56%), Gaps = 17/245 (7%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+  CS + Y++G+   + G+  +VV P +G LSD YGRK LL L  ++ I+P V
Sbjct  34   EALCPGRDQCSLAIYLSGINQAITGLGTLVVTPLVGNLSDKYGRKALLTLPMTSAIVPLV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA  +SR  +YAY+V++ +S + S GS+ C+S+AY AD V E  RA+AF  ++G+ +A 
Sbjct  94   VLACGRSRTHLYAYFVIKMVSGMFSDGSMQCLSLAYVADKVCERRRASAFGVLSGVSAAG  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGV-----EQSLP--CP  179
             V G +A+RFL   +   Q +  +     +YM + L ET   DGG      E + P   P
Sbjct  154  FVSGTVAARFLPTSHT-FQVSASVAAVAAVYMRVFLEET---DGGAALMDEESTRPLCSP  209

Query  178  SKVKKFC------REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
            +   + C      +++   +   + ++ +S TL  A +V FF  L  SG  S L +YLKA
Sbjct  210  ATDGESCPSLPTLKKKVPSLGDMISLLRNSLTLTRAAIVVFFNSLADSGFQSALLYYLKA  269

Query  16   AFGFD  2
             F F+
Sbjct  270  QFHFN  274



>gb|KDO68187.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=357

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 136/246 (55%), Gaps = 18/246 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  ++G+  +V++P +G LSD YGRK +L L  + +IIP  +
Sbjct  38   ALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKAMLTLPLTLSIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +S  F YAYY ++T++ ++ +GSI C+++AY AD + E  RA+AF  + G+ SAS 
Sbjct  98   LAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQRASAFGILLGVLSASF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHL---------------VETVTPDGGV  200
            V G LA+RFL    +  QAA  + +    YM + L               + T   +G  
Sbjct  158  VCGTLAARFLSTT-SAFQAATIVSMLAAAYMRVFLKDDVPNDDDDDLTRPIITEETEGVN  216

Query  199  EQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
            +     P K+   C+ +   +R  + ++ SS TL  A +V+FF  L   G+ +   ++LK
Sbjct  217  QNESNSPVKI-PVCK-KIPSIRDLICLLRSSVTLSQAAVVAFFSGLSEGGMQASFLYFLK  274

Query  19   AAFGFD  2
            A F F+
Sbjct  275  AQFHFN  280



>ref|XP_008382447.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Malus domestica]
 ref|XP_008382448.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X2 [Malus domestica]
Length=442

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/245 (36%), Positives = 135/245 (55%), Gaps = 16/245 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y++G Q  ++GV  +V+ P +G LSD YGRK LL +    +IIP V+
Sbjct  35   ALCPGRDECSLAIYLSGFQQAIIGVGTVVMTPVIGNLSDVYGRKSLLTIPMILSIIPLVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            +A ++   F YAYYV++T++ ++ + SI C+++AY AD V E  R +AF+ + G+ SA+ 
Sbjct  95   MAYSRETSFFYAYYVLRTVTAMVGEASITCLALAYVADNVAERERISAFAILAGITSAAI  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLP-CPSKVKKFC  158
            V G LA+RFL    +  Q A    I   +YM + L E++ P G      P     V +  
Sbjct  155  VCGTLAARFLSAA-STFQVAAFASILSTVYMGIFLKESL-PGGDSTLRQPILKGGVSEVA  212

Query  157  RE-QCYCVRTT------------LEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
             E   Y  +TT            + ++ SS  L  A +VSFF  L   G+ + L ++LKA
Sbjct  213  DEGDVYSPKTTQVFKKIPSPGELISLLRSSKILSQAAVVSFFQSLAEGGMQASLLYFLKA  272

Query  16   AFGFD  2
             F F+
Sbjct  273  RFHFN  277



>ref|XP_007017917.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY15142.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
Length=444

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 135/244 (55%), Gaps = 16/244 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y++G Q  ++G+  +V++P +G LSD YGRK LL +  + TIIP  +
Sbjct  35   ALCPGKEECSVAIYLSGFQQAIIGLGSLVMMPLVGNLSDKYGRKALLTVPMTLTIIPLAI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +++R F YAYYV++ ++ +  +G++ C+S+AY AD V E  R + F  ++G+ S + 
Sbjct  95   LAYSRTRSFFYAYYVLKILTAMFCEGTVHCLSLAYVADNVPEGRRVSTFGILSGIGSCAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTP-------------DGGVEQ  194
            V G L++RFL    +  Q A  + +   +YM + L +++               DG V  
Sbjct  155  VCGTLSTRFLSTA-STFQVATAMAMLSAVYMRIFLPDSIINDNLSAPILSQGKLDGIVNP  213

Query  193  SLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
                  K++ F  +    +   L ++ SS T   A +VSFF  L   G+ + L +YLKA 
Sbjct  214  DEESDKKMQMF--KTMPSIEDMLALLKSSLTFSQAAIVSFFSNLSDVGLHASLLYYLKAR  271

Query  13   FGFD  2
            F F+
Sbjct  272  FHFN  275



>ref|XP_007017916.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY15141.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=443

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 135/244 (55%), Gaps = 16/244 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y++G Q  ++G+  +V++P +G LSD YGRK LL +  + TIIP  +
Sbjct  35   ALCPGKEECSVAIYLSGFQQAIIGLGSLVMMPLVGNLSDKYGRKALLTVPMTLTIIPLAI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +++R F YAYYV++ ++ +  +G++ C+S+AY AD V E  R + F  ++G+ S + 
Sbjct  95   LAYSRTRSFFYAYYVLKILTAMFCEGTVHCLSLAYVADNVPEGRRVSTFGILSGIGSCAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTP-------------DGGVEQ  194
            V G L++RFL    +  Q A  + +   +YM + L +++               DG V  
Sbjct  155  VCGTLSTRFLSTA-STFQVATAMAMLSAVYMRIFLPDSIINDNLSAPILSQGKLDGIVNP  213

Query  193  SLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
                  K++ F  +    +   L ++ SS T   A +VSFF  L   G+ + L +YLKA 
Sbjct  214  DEESDKKMQMF--KTMPSIEDMLALLKSSLTFSQAAIVSFFSNLSDVGLHASLLYYLKAR  271

Query  13   FGFD  2
            F F+
Sbjct  272  FHFN  275



>ref|XP_009355593.1| PREDICTED: hippocampus abundant transcript 1 protein isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009355595.1| PREDICTED: hippocampus abundant transcript 1 protein isoform 
X2 [Pyrus x bretschneideri]
Length=442

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 138/246 (56%), Gaps = 18/246 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y++G Q  ++GV  +V+ P +G LSD YGRK LL +  + +IIP V+
Sbjct  35   ALCPGRDECSLAIYLSGFQQAIIGVGTVVMTPVIGNLSDVYGRKSLLTIPMTLSIIPLVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            +A ++   F YAYYV++T++ ++ + SI C+++AY AD V E  R +AF+ + G+ SA+ 
Sbjct  95   MACSRETSFFYAYYVLRTVTALVGETSINCLALAYVADNVSERERISAFAILAGITSAAI  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTP----------DGGV-----  200
            V G LA+RFL    +I Q A    I   +YM + L E++             GGV     
Sbjct  155  VCGTLAARFL-TTASIFQVAAFASILSTVYMRIFLKESLPGGDSSLRQPILKGGVSEVAD  213

Query  199  EQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
            E  +  P  ++ F  ++       + ++ SS  L  A +VSFF  L   G+ + L ++LK
Sbjct  214  EGDVHSPKTIQVF--KKIPSPGELISLLRSSKILSQATVVSFFQSLADGGMQASLLYFLK  271

Query  19   AAFGFD  2
            A F F+
Sbjct  272  ARFHFN  277



>ref|XP_006386158.1| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
 gb|ABK95031.1| unknown [Populus trichocarpa]
 gb|ERP63955.1| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
Length=450

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/255 (34%), Positives = 141/255 (55%), Gaps = 29/255 (11%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y+ G Q  ++G+  +V +P +G +SD YGRK LL +  S  I+P  
Sbjct  34   SALCPGRDECSLAIYLTGFQQAIIGLGTLVTMPLIGNMSDKYGRKALLTVPMSLIIVPSA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA +++R F YAYYV++T+  ++ +GS+ C+++AY AD V E+ RA+ F  ++G+ S++
Sbjct  94   ILAYSRTRNFFYAYYVVRTLMAMVCEGSVQCLALAYVADNVPESRRASTFGILSGIASSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP-------  179
             V GNL++RFL    +  Q +  + I   +YM   L E++     +++ L  P       
Sbjct  154  FVCGNLSTRFLSTS-STFQVSALVAIAALVYMRFFLQESI-----IDEQLSTPILTYKGN  207

Query  178  ------SKVKKFCRE------QCYCVRTTLE----VVVSSPTLKCACLVSFFYQLGISGI  47
                  +    F  E      Q +    +LE    ++ SS TL  A +V+FFY L   G+
Sbjct  208  GKGKGKANAACFAHEIPSKNVQVFKSAPSLEDMLCLLKSSVTLSQAAVVAFFYSLAEVGL  267

Query  46   DSVLPHYLKAAFGFD  2
             + L +YLKA F F 
Sbjct  268  HASLMYYLKAQFHFS  282



>gb|EMT05362.1| Hippocampus abundant transcript 1 protein [Aegilops tauschii]
Length=424

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 133/244 (55%), Gaps = 22/244 (9%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y+ GLQ  + G+  +VV P +G LSD YGRK LL L ++ +I+P  +
Sbjct  36   ALCPGQDQCSLAIYLTGLQQAITGLGALVVTPVIGNLSDRYGRKALLALPATLSIVPLAI  95

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            +A N++R + YA+Y+ +T++ ++S+G++ C+S+AY AD V E  RA AF   +G+ +A  
Sbjct  96   MAFNQTRPYFYAFYIAKTLTAMVSEGAMMCLSLAYVADKVPEGRRAAAFGVFSGVCTAGF  155

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVET----------------VTPDGG  203
            V G +A+RFL    +  Q A    +   +Y+   + ET                  P   
Sbjct  156  VGGTIAARFLSVS-STFQVATLASVAAAVYLRAFVQETDRGASLLREEEASRLLFPPSSS  214

Query  202  VEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYL  23
             E++ P   ++    +        TL  + SS T   A +V+FF+ LG +G+ + L ++L
Sbjct  215  PEEASP---RLPPLRKAPSLLEMATL--LTSSSTFTRAAVVTFFHGLGETGLQTALLYFL  269

Query  22   KAAF  11
            KA F
Sbjct  270  KAQF  273



>ref|XP_006486682.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X2 [Citrus sinensis]
Length=397

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 136/246 (55%), Gaps = 18/246 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  ++G+  +V++P +G LSD YGRK +L L  + +IIP  +
Sbjct  38   ALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKAMLTLPLTLSIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +S  F YAYY ++T++ ++ +GSI C+++AY AD + E  RA+AF  + G+ SAS 
Sbjct  98   LAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQRASAFGILLGVLSASF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHL---------------VETVTPDGGV  200
            V G LA+RFL    +  QAA  + +    YM + L               + T   +G  
Sbjct  158  VCGTLAARFLSTT-SAFQAATIVSMLAAAYMRVFLKDDVPNDDDDDLTRPIITEETEGVN  216

Query  199  EQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
            +     P K+   C+ +   +R  + ++ SS TL  A +V+FF  L   G+ +   ++LK
Sbjct  217  QNESNSPVKI-PVCK-KIPSIRDLICLLRSSVTLSQAAVVAFFSGLSEGGMQASFLYFLK  274

Query  19   AAFGFD  2
            A F F+
Sbjct  275  AQFHFN  280



>ref|XP_011046630.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Populus 
euphratica]
Length=441

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 138/242 (57%), Gaps = 13/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            A+C G+  CS + Y++G Q  ++G+  +V++P +G LSD YGRK LL L  + +IIP V+
Sbjct  35   AVCPGKDECSLAIYLSGFQQAIIGLGTVVMMPLIGNLSDQYGRKALLTLPMTLSIIPLVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +++  F YAYYV++T++ +I +GSI C+++AY AD V E  R +AF  ++G+ +A+ 
Sbjct  95   LAYSRTTNFFYAYYVLRTLTAMICEGSINCLALAYVADNVLERQRTSAFGILSGIATAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G LA+RFL        AAL  ++   +YM + L E++ P+G         S     C+
Sbjct  155  VCGTLAARFLSTALTFQVAALVSML-AAVYMRIFLKESL-PNGENLTQPILKSGQDDHCQ  212

Query  154  E-----------QCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
            +           +   ++  + ++ S  T   A +V+FF  L   G+ + + +YLKA F 
Sbjct  213  DGDLSRQAPVLKKIPSIQDIIGLLKSRVTFSQAAVVAFFNSLAEGGMQASIMYYLKARFH  272

Query  7    FD  2
            F 
Sbjct  273  FS  274



>ref|XP_011034952.1| PREDICTED: uncharacterized protein LOC105132907 isoform X2 [Populus 
euphratica]
Length=450

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/255 (35%), Positives = 141/255 (55%), Gaps = 29/255 (11%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y+ G Q  ++G+  +V +P +G +SD YGRK LL +  S  I+P  
Sbjct  34   SALCPGRDECSLAIYLTGFQQAIIGLGTLVTMPLIGNMSDKYGRKALLTVPMSLIIVPSA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA +++R F YAYYV++T+  ++ +GS+ C+++AY AD V E  RA+ F  +TG+ S++
Sbjct  94   ILAYSRTRNFFYAYYVVRTLVSMVCEGSVQCLALAYVADNVPENRRASTFGILTGIASSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP-------  179
             V GNL++RFL    +  Q +  + I   +YM   L +++     +++ L  P       
Sbjct  154  FVCGNLSTRFLSTS-STFQVSALVAIAALVYMRFFLQDSI-----IDEQLSTPILTNKGD  207

Query  178  ----SKVKKFC--RE------QCYCVRTTLE----VVVSSPTLKCACLVSFFYQLGISGI  47
                 K    C  RE      Q +    +LE    ++ SS TL  A +V+FFY L   G+
Sbjct  208  GKGKGKANAACCAREIPSKNVQVFKSAPSLEDMLCLLKSSVTLSQAAVVAFFYSLAEVGL  267

Query  46   DSVLPHYLKAAFGFD  2
             + L +YLKA F F 
Sbjct  268  HASLMYYLKAQFHFS  282



>ref|XP_010028772.1| PREDICTED: uncharacterized protein LOC104418982 [Eucalyptus grandis]
Length=440

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 137/244 (56%), Gaps = 14/244 (6%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y++GLQ  +VG   +++ P +G LSD+YGRK LL +  +  IIP V
Sbjct  34   SALCPGKDECSLAIYLSGLQQAIVGFGTVILTPLIGNLSDEYGRKALLTIPMTAAIIPLV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++   F YAY+V++T++ I+ +G+I C+++AY AD V  T R +AF  ++G+ SA+
Sbjct  94   ILAYSRETKFFYAYFVLRTLAAIVGEGTIICLALAYVADNVPGTERVSAFGILSGVLSAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVT------------PDGGVEQ  194
             V G LA+RF+       Q A  + +   +YM + L E++              +  V+Q
Sbjct  154  FVFGTLAARFISTALT-FQVAAAVSMVAVVYMRIFLKESIPLADESAQPILKGSETDVDQ  212

Query  193  SLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
            +    S  K    ++   +   + ++ SS     A +V+FF  L   G+ + L ++LKA 
Sbjct  213  N-DSDSVEKTHVFKKIPSIGDLISLLRSSKIFAQAAVVAFFNNLAEGGLQTSLLYFLKAR  271

Query  13   FGFD  2
            F F+
Sbjct  272  FHFN  275



>gb|KDO68186.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=438

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 136/246 (55%), Gaps = 18/246 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  ++G+  +V++P +G LSD YGRK +L L  + +IIP  +
Sbjct  38   ALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKAMLTLPLTLSIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +S  F YAYY ++T++ ++ +GSI C+++AY AD + E  RA+AF  + G+ SAS 
Sbjct  98   LAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQRASAFGILLGVLSASF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHL---------------VETVTPDGGV  200
            V G LA+RFL    +  QAA  + +    YM + L               + T   +G  
Sbjct  158  VCGTLAARFLSTT-SAFQAATIVSMLAAAYMRVFLKDDVPNDDDDDLTRPIITEETEGVN  216

Query  199  EQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
            +     P K+   C+ +   +R  + ++ SS TL  A +V+FF  L   G+ +   ++LK
Sbjct  217  QNESNSPVKI-PVCK-KIPSIRDLICLLRSSVTLSQAAVVAFFSGLSEGGMQASFLYFLK  274

Query  19   AAFGFD  2
            A F F+
Sbjct  275  AQFHFN  280



>ref|XP_006486681.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Citrus sinensis]
 gb|KDO68184.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=445

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 136/246 (55%), Gaps = 18/246 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  ++G+  +V++P +G LSD YGRK +L L  + +IIP  +
Sbjct  38   ALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKAMLTLPLTLSIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +S  F YAYY ++T++ ++ +GSI C+++AY AD + E  RA+AF  + G+ SAS 
Sbjct  98   LAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQRASAFGILLGVLSASF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHL---------------VETVTPDGGV  200
            V G LA+RFL    +  QAA  + +    YM + L               + T   +G  
Sbjct  158  VCGTLAARFLSTT-SAFQAATIVSMLAAAYMRVFLKDDVPNDDDDDLTRPIITEETEGVN  216

Query  199  EQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
            +     P K+   C+ +   +R  + ++ SS TL  A +V+FF  L   G+ +   ++LK
Sbjct  217  QNESNSPVKI-PVCK-KIPSIRDLICLLRSSVTLSQAAVVAFFSGLSEGGMQASFLYFLK  274

Query  19   AAFGFD  2
            A F F+
Sbjct  275  AQFHFN  280



>ref|XP_010061115.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW68014.1| hypothetical protein EUGRSUZ_F01701 [Eucalyptus grandis]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 87/244 (36%), Positives = 136/244 (56%), Gaps = 14/244 (6%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            A+C G   CS + Y++G Q  +VG+  +V++P +G LSD YGRK LL +    TIIP  +
Sbjct  35   AICPGMDECSLAIYLSGFQQAIVGLGSLVMMPLIGNLSDKYGRKALLTIPLVFTIIPLAI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++SR F Y YYV +T++ I  +GS+ C+++AY AD V    RA+AF  ++G+ SA+ 
Sbjct  95   LAYSRSRNFFYLYYVFRTLTAIFCEGSVHCLALAYVADNVPAGRRASAFGILSGIGSAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGG-------VEQSLP---  185
            V GNL++RFL    +  Q A  + +    YM   L ++V            V + +P   
Sbjct  155  VCGNLSTRFLSTP-STFQVATAVAVVALAYMRFFLPDSVVVGDDDPLTAPIVSKGMPDGA  213

Query  184  CP---SKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
            CP   S  K    ++   +  T+ ++ SS T   A +V+FF  L   G+ + + +YLKA 
Sbjct  214  CPDDDSANKAHAFKKTPSLGDTVALLRSSLTFLQAAIVAFFGNLADVGLHASMMYYLKAQ  273

Query  13   FGFD  2
            F F+
Sbjct  274  FHFN  277



>ref|XP_004497200.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Cicer 
arietinum]
Length=445

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 133/246 (54%), Gaps = 22/246 (9%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y+ G QH ++GV  +V  P +G LSD YGRK L+ L  + ++IP  +
Sbjct  35   ALCPGQDECSLAIYLTGFQHAMIGVGSVVTTPLIGNLSDRYGRKALITLPLTVSLIPQAI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +++  F YAYYV++T++ I  +GS  C+++AY AD V    RA+AF  + G+ SAS 
Sbjct  95   LAYSRATKFFYAYYVVKTLAAIAGEGSFHCLALAYVADKVPVGKRASAFGILAGVGSASF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G LA+RFL       Q A    +   +YM + L E+      +    P   +V++ C 
Sbjct  155  VGGTLAARFLSPALT-FQVASVFSMIALVYMRIFLKES------LPMRQPLLKEVEEPCI  207

Query  154  EQC---YCVRTT------------LEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
            +QC      RTT            + ++  SPT   A +V  F  L   G+ +VL +YLK
Sbjct  208  QQCEDDMPQRTTGTFKKLPSMGDVICLLKCSPTFSQAGIVLLFNSLADGGLMAVLLYYLK  267

Query  19   AAFGFD  2
            A F ++
Sbjct  268  ARFQYN  273



>ref|XP_006655183.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Oryza 
brachyantha]
Length=439

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 134/249 (54%), Gaps = 25/249 (10%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ GLQ  + G+  +V  P +G LSD YGRK LLLL ++ +I+P V+
Sbjct  33   ALCPGRDECSLAIYLTGLQQAITGLGALVATPIVGNLSDRYGRKTLLLLPATASILPLVI  92

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA N+++ F YAYYV +T++  +++GS+ C+S+AY AD V  + RA AF   +G+  A  
Sbjct  93   LACNRTKAFFYAYYVTRTLTATVAEGSMSCLSLAYVADKVPPSRRAAAFGVFSGVCVAGF  152

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGV----------EQSLP  185
            V G +A+RFL    +  Q A    +   +YM   + ET   DGG           E S P
Sbjct  153  VAGTVAARFLTVP-STFQVAAVSAVAAAVYMRAFVQET---DGGASLLRAAGDEEENSHP  208

Query  184  -----CPSKVKKFCREQCYCVRTTLE------VVVSSPTLKCACLVSFFYQLGISGIDSV  38
                 C S  +         +R          ++ +S T   A LV+FF+ LG +G+ + 
Sbjct  209  LCVPSCSSSSEDVAPPTLPPLRKAASLSEMAALLTTSSTFSRAALVTFFHTLGETGLQTA  268

Query  37   LPHYLKAAF  11
            L +YLKA F
Sbjct  269  LLYYLKAQF  277



>ref|XP_011045660.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Populus euphratica]
Length=442

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/242 (33%), Positives = 135/242 (56%), Gaps = 12/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            A+C GQ  CS + Y+ G Q  ++G+  +V++P +G LSD +GRK LL L  + +IIP  +
Sbjct  35   AVCPGQDECSLAIYLTGFQQAIIGMGTVVMLPLIGNLSDQHGRKALLTLPLTLSIIPLAI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +++ GF YAYY ++T++ +I +GSI C+++AY AD V E  R + F  + G+ +A+ 
Sbjct  95   LAYSRTTGFFYAYYALRTLTAMICEGSIECLALAYVADNVLERQRTSVFGILAGMATAAL  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSK------  173
            V G LA+RFL        AAL  ++   +YM + + E++     + Q +    +      
Sbjct  155  VCGTLAARFLSTALTFQVAALVSML-AAVYMRIFVEESLPNSENLTQPILKSGQDDHCQD  213

Query  172  -----VKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
                  K    ++   ++  + ++ SS T   A +V+FF +L   G+ + + +YLKA F 
Sbjct  214  DGDLPRKPMVSKKMPSIQAIISLLKSSVTFSQAAIVAFFNRLSYGGLQASIMYYLKARFH  273

Query  7    FD  2
            F 
Sbjct  274  FS  275



>gb|KDO68183.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=484

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 136/246 (55%), Gaps = 18/246 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  ++G+  +V++P +G LSD YGRK +L L  + +IIP  +
Sbjct  38   ALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKAMLTLPLTLSIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +S  F YAYY ++T++ ++ +GSI C+++AY AD + E  RA+AF  + G+ SAS 
Sbjct  98   LAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQRASAFGILLGVLSASF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHL---------------VETVTPDGGV  200
            V G LA+RFL    +  QAA  + +    YM + L               + T   +G  
Sbjct  158  VCGTLAARFLSTT-SAFQAATIVSMLAAAYMRVFLKDDVPNDDDDDLTRPIITEETEGVN  216

Query  199  EQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
            +     P K+   C+ +   +R  + ++ SS TL  A +V+FF  L   G+ +   ++LK
Sbjct  217  QNESNSPVKI-PVCK-KIPSIRDLICLLRSSVTLSQAAVVAFFSGLSEGGMQASFLYFLK  274

Query  19   AAFGFD  2
            A F F+
Sbjct  275  AQFHFN  280



>ref|XP_006422528.1| hypothetical protein CICLE_v10028321mg [Citrus clementina]
 gb|ESR35768.1| hypothetical protein CICLE_v10028321mg [Citrus clementina]
Length=445

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 136/246 (55%), Gaps = 18/246 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  ++G+  +V++P +G LSD YGRK +L L  + +IIP  +
Sbjct  38   ALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKAMLTLPLTLSIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +S  F YAYY ++T++ ++ +GSI C+++AY AD + E  RA+AF  + G+ SAS 
Sbjct  98   LAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQRASAFGILLGVLSASF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHL---------------VETVTPDGGV  200
            V G LA+RFL    +  QAA  + +    YM + L               + T   +G  
Sbjct  158  VCGTLAARFLSTT-SAFQAATIVSMLAAAYMRVFLKDDVPNDDDDDLTRPIITEETEGVN  216

Query  199  EQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
            +     P K+   C+ +   +R  + ++ SS TL  A +V+FF  L   G+ +   ++LK
Sbjct  217  QNESNSPVKI-PVCK-KIPSIRDLICLLRSSVTLSQAAVVAFFSGLSEGGMQASFLYFLK  274

Query  19   AAFGFD  2
            A F F+
Sbjct  275  AQFHFN  280



>ref|XP_004238394.1| PREDICTED: uncharacterized protein LOC101248671 [Solanum lycopersicum]
Length=436

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 142/239 (59%), Gaps = 9/239 (4%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C GQ  CS + Y+ G+Q  +VG+  +V++P LG LSD YGRK +L L  + +I P  
Sbjct  34   SAICPGQDECSLAIYLTGVQQAIVGLGSLVMMPVLGNLSDTYGRKVMLTLPMTLSIFPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++++ + YAYYV++T+  +I +GS+ C++ AY AD V E+ RA+ F  ++G+ S++
Sbjct  94   ILAYSRTKYYFYAYYVLRTLIAMICEGSVQCLAFAYVADNVPESRRASVFGVLSGIASSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V GNL++RFL    +  Q A  + +   +YM + L E++T +G +   +   S + +  
Sbjct  154  FVCGNLSARFLSTA-STFQVAAAMAVIALVYMKMFLPESIT-NGNICSKISETSCLLEKA  211

Query  157  REQCYCVRTTLE-------VVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             ++ +    TL        ++ +S T   A +V+FF  +   G+++ L  +LKA F F+
Sbjct  212  PKKGFQFFKTLPSFSDMLCLLKTSSTFLHAAIVTFFANVAQVGLEASLLFFLKAQFHFN  270



>ref|XP_002280708.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Vitis 
vinifera]
 emb|CBI37822.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 136/242 (56%), Gaps = 12/242 (5%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y++G Q  ++G+  +V+ P +G LSD+YGRK LL +  + +IIP  
Sbjct  34   SALCPGKDECSLAIYLSGFQQAIIGLGTVVMTPVIGNLSDEYGRKALLTIPMALSIIPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA +++    YAY+V++T++ ++ +GSI C+++AY AD + E  RA+AF  ++G+ SA+
Sbjct  94   ILAYSRTTTSFYAYFVIRTLTAMVGEGSINCLALAYVADNISEGQRASAFGVLSGVASAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSL----PCPSKV  170
             V G LA+RFL    +  Q A  + +   +YM + L ET  P G   Q+L    P  S  
Sbjct  154  FVCGTLAARFLSTA-STFQVATLVSMIATVYMRVFLKETF-PKGDSSQALLKKEPGMSPD  211

Query  169  KKFCREQCYCVRTTLEVVVSSPTLKC------ACLVSFFYQLGISGIDSVLPHYLKAAFG  8
                 E+    +    V      LKC      A +V FF  L   G+ + L ++LKA F 
Sbjct  212  DGNSSEKIQTFKKIPSVGDLISLLKCRAAFSQAAVVVFFNGLAEGGLQASLLYFLKARFH  271

Query  7    FD  2
            F+
Sbjct  272  FN  273



>ref|XP_006422527.1| hypothetical protein CICLE_v10028321mg [Citrus clementina]
 gb|ESR35767.1| hypothetical protein CICLE_v10028321mg [Citrus clementina]
Length=484

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 136/246 (55%), Gaps = 18/246 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  ++G+  +V++P +G LSD YGRK +L L  + +IIP  +
Sbjct  38   ALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKAMLTLPLTLSIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +S  F YAYY ++T++ ++ +GSI C+++AY AD + E  RA+AF  + G+ SAS 
Sbjct  98   LAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQRASAFGILLGVLSASF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHL---------------VETVTPDGGV  200
            V G LA+RFL    +  QAA  + +    YM + L               + T   +G  
Sbjct  158  VCGTLAARFLSTT-SAFQAATIVSMLAAAYMRVFLKDDVPNDDDDDLTRPIITEETEGVN  216

Query  199  EQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
            +     P K+   C+ +   +R  + ++ SS TL  A +V+FF  L   G+ +   ++LK
Sbjct  217  QNESNSPVKI-PVCK-KIPSIRDLICLLRSSVTLSQAAVVAFFSGLSEGGMQASFLYFLK  274

Query  19   AAFGFD  2
            A F F+
Sbjct  275  AQFHFN  280



>ref|XP_011045668.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Populus euphratica]
Length=422

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/241 (33%), Positives = 135/241 (56%), Gaps = 12/241 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            A+C GQ  CS + Y+ G Q  ++G+  +V++P +G LSD +GRK LL L  + +IIP  +
Sbjct  35   AVCPGQDECSLAIYLTGFQQAIIGMGTVVMLPLIGNLSDQHGRKALLTLPLTLSIIPLAI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +++ GF YAYY ++T++ +I +GSI C+++AY AD V E  R + F  + G+ +A+ 
Sbjct  95   LAYSRTTGFFYAYYALRTLTAMICEGSIECLALAYVADNVLERQRTSVFGILAGMATAAL  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSK------  173
            V G LA+RFL        AAL  ++   +YM + + E++     + Q +    +      
Sbjct  155  VCGTLAARFLSTALTFQVAALVSML-AAVYMRIFVEESLPNSENLTQPILKSGQDDHCQD  213

Query  172  -----VKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
                  K    ++   ++  + ++ SS T   A +V+FF +L   G+ + + +YLKA F 
Sbjct  214  DGDLPRKPMVSKKMPSIQAIISLLKSSVTFSQAAIVAFFNRLSYGGLQASIMYYLKARFH  273

Query  7    F  5
            F
Sbjct  274  F  274



>ref|XP_004291324.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Fragaria 
vesca subsp. vesca]
Length=446

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 136/243 (56%), Gaps = 13/243 (5%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+  CS + Y+ G Q  +VG+  +V++P +G LSD +GRK LL L    TIIP  
Sbjct  37   TALCPGRDECSIAIYLTGFQQAIVGLGTLVMMPLVGNLSDKFGRKALLTLPMIFTIIPLG  96

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA +++R F YAY+V +T++ ++ +GS+ C+++AY AD V E  RA+ F  ++G+ SA+
Sbjct  97   ILAYSRTRNFFYAYFVAKTLTAMVCEGSVHCLALAYVADNVPEGRRASTFGILSGISSAA  156

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V G L +RF+    ++ Q A  + +   +YM + L E++  D  +   L    K K   
Sbjct  157  FVCGTLFTRFVSTP-SMFQVATSVAVVAVMYMRIFLPESII-DDDISAPLLSNGKPKVLN  214

Query  157  REQCYCVRTT-----------LEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
             ++   V              + ++ +SPT   A +V+FF  L   G+ + L +YLKA F
Sbjct  215  SDENSNVELQSSKALPSLPDLIALLKTSPTFSQAAIVAFFSNLADVGLHASLLYYLKARF  274

Query  10   GFD  2
             F+
Sbjct  275  HFN  277



>ref|XP_010266910.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Nelumbo 
nucifera]
Length=458

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 134/244 (55%), Gaps = 15/244 (6%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y++G Q  + GV  +V++P LG LSD+YGRK LL+L  +  ++P  
Sbjct  54   SAICPGKDECSIAIYLSGFQQAITGVGSLVMMPLLGNLSDEYGRKTLLILPMTLNVVPLA  113

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++++ F YAYYV++T++ +I +GS+ C+S+AY AD V    R +AF  + G  SA+
Sbjct  114  ILACSRTKSFFYAYYVLKTLTAMICEGSVQCLSLAYVADNVPHGKRISAFGILAGTGSAA  173

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPD-----GGVEQSLPC---  182
             V G L SRFL    +  Q +  + +   +YM   L E+   D       V Q  P    
Sbjct  174  FVCGTLTSRFLSTS-STFQVSASVAVLAAMYMKAFLKESTCEDLENMKQDVSQKTPLVTC  232

Query  181  ----PSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
                 S  K F  +    +   + ++ SS T   A +++FF  L   G+ + L +YLKA+
Sbjct  233  SNGEDSSSKIF--KTIPSIEDMICLLKSSLTFSQAAIIAFFTSLAEGGLYTSLLYYLKAS  290

Query  13   FGFD  2
            F F 
Sbjct  291  FHFS  294



>gb|KCW55587.1| hypothetical protein EUGRSUZ_I01458 [Eucalyptus grandis]
Length=517

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 137/244 (56%), Gaps = 14/244 (6%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y++GLQ  +VG   +++ P +G LSD+YGRK LL +  +  IIP V
Sbjct  111  SALCPGKDECSLAIYLSGLQQAIVGFGTVILTPLIGNLSDEYGRKALLTIPMTAAIIPLV  170

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++   F YAY+V++T++ I+ +G+I C+++AY AD V  T R +AF  ++G+ SA+
Sbjct  171  ILAYSRETKFFYAYFVLRTLAAIVGEGTIICLALAYVADNVPGTERVSAFGILSGVLSAA  230

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVT------------PDGGVEQ  194
             V G LA+RF+       Q A  + +   +YM + L E++              +  V+Q
Sbjct  231  FVFGTLAARFISTALT-FQVAAAVSMVAVVYMRIFLKESIPLADESAQPILKGSETDVDQ  289

Query  193  SLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
            +    S  K    ++   +   + ++ SS     A +V+FF  L   G+ + L ++LKA 
Sbjct  290  N-DSDSVEKTHVFKKIPSIGDLISLLRSSKIFAQAAVVAFFNNLAEGGLQTSLLYFLKAR  348

Query  13   FGFD  2
            F F+
Sbjct  349  FHFN  352



>gb|KDP36870.1| hypothetical protein JCGZ_08161 [Jatropha curcas]
Length=421

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/243 (34%), Positives = 138/243 (57%), Gaps = 13/243 (5%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y++G Q  ++G+  ++++P +G LSD YGRK LL +     IIP V
Sbjct  12   SAICPGRDECSLAIYLSGFQQAIIGLGTLLMMPLVGNLSDKYGRKALLTVPLVLGIIPLV  71

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
             LA +++R F YAYYV++T++ ++ +GS+ C+++AY AD V E  RA+AF  ++G+ S++
Sbjct  72   TLAYSRTRYFFYAYYVLRTLTAMVCEGSVHCLALAYVADNVPEGRRASAFGILSGIGSSA  131

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVK---  167
             V G L++RFL    +  Q A  + I   +YM + L +++  D  V   +    K K   
Sbjct  132  FVCGTLSTRFL-STASTFQVAASVAIVALVYMKVFLQDSII-DKNVSTPMLSNGKSKVDN  189

Query  166  --KFCREQCYCVRT------TLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
                  +  +  +T      TL ++ SS T   A +V+F   L   G+ +   +YLKA F
Sbjct  190  TIGSSSKNVHIFKTMPSLDDTLCLLKSSATFSQAAIVAFLSNLSEVGLHASAMYYLKARF  249

Query  10   GFD  2
             F+
Sbjct  250  HFN  252



>gb|EYU40457.1| hypothetical protein MIMGU_mgv1a021568mg [Erythranthe guttata]
Length=438

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/241 (34%), Positives = 129/241 (54%), Gaps = 17/241 (7%)
 Frame = -2

Query  691  LCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVLL  512
            +C G+  CS + Y+ G Q  V G+  +V++P +G LSD YGRK LL +  + +IIPF +L
Sbjct  36   VCPGKDECSLAIYLTGFQQAVGGLGAVVIMPLIGNLSDSYGRKVLLTIPLTLSIIPFAIL  95

Query  511  AINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASHV  332
            A+ ++    Y YYV++T++ ++S+G + C+S++Y AD V E  R +AF  + G+ S + V
Sbjct  96   ALKRTTQSFYVYYVLKTLTSMVSEGGVMCLSLSYLADNVSEGKRVSAFGLLAGVVSVATV  155

Query  331  LGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETV-----------TPDGGVEQSLP  185
             G +A+R L     I Q A    I   +YM   L +T+            PD G  + L 
Sbjct  156  CGTIAARLLPTP-QIFQVAAVASIVATVYMRAFLEDTIRHVDALEQPILKPDIGTTEQLD  214

Query  184  CPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
              + +KK         +  +  + SS T+  A  V+FF  L  +G+ S L +YLKA F +
Sbjct  215  KTNVIKKIPLP-----KDIIRFLKSSVTVSLASFVAFFNSLAEAGVQSFLMYYLKARFHY  269

Query  4    D  2
             
Sbjct  270  Q  270



>ref|XP_006342087.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Solanum tuberosum]
Length=438

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 141/240 (59%), Gaps = 11/240 (5%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C GQ  CS + Y+ G+Q  +VG+  +V++P LG LSD YGRK +L L  + +I P  
Sbjct  34   SAICPGQDECSLAIYLTGVQQAIVGLGSLVMMPVLGNLSDIYGRKVVLTLPMTLSIFPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++++ + YAYYV++T+  +I +GS+ C+++AY AD V E+ RA+ F  ++G+ S++
Sbjct  94   ILAYSRTKYYFYAYYVLRTLIAMICEGSVQCLALAYVADNVPESRRASVFGVLSGIASSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGV---EQSLPC-----  182
             V GNL++RFL    +  Q A  + +   +YM + L E++T  G +   +    C     
Sbjct  154  FVCGNLSARFLSTA-STFQVAAAMAVIALVYMKMFLPESIT-KGNICSKKSETSCLLEKA  211

Query  181  PSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            P K  +F +         L ++ +S T   A +VSFF  +   G+++ +  +LKA F F+
Sbjct  212  PKKGFQFFKA-LPSFSDMLCLLKTSSTFLQAAIVSFFVNVAQVGLEASILFFLKAQFHFN  270



>ref|XP_009620054.1| PREDICTED: uncharacterized protein LOC104111941 [Nicotiana tomentosiformis]
Length=438

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/240 (34%), Positives = 142/240 (59%), Gaps = 11/240 (5%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C G+  CS + Y+ G+Q  +VG+  +V++P LG LSD YGRK +L +  + +I P V
Sbjct  34   SAICPGKDECSLAIYLTGIQQAIVGMGSLVMMPVLGNLSDTYGRKIILTVPMTLSIFPLV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++++ + YAYYV++T+  +I +GS+ C+++AY AD V E+ RA+ F  ++G+ S++
Sbjct  94   ILAYSRTKYYFYAYYVLRTLIAMICEGSVQCLALAYVADNVPESRRASVFGVLSGIASSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGV---EQSLPC-----  182
             V GNL++RFL    +  Q A  + +   +YM + L +++   G +   E    C     
Sbjct  154  FVCGNLSARFLSTA-STFQVAAAMAVIALVYMKMFLPDSIM-KGNICSKETETICLLENA  211

Query  181  PSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            P K  +F +         L ++ +S T   A +VSFF  +   G+++ L ++LKA F F+
Sbjct  212  PKKGIQFFKT-LPSFSDMLCLLKTSSTFLHAAVVSFFVNVAQVGLEASLLYFLKAQFHFN  270



>gb|KHN37832.1| hypothetical protein glysoja_016956 [Glycine soja]
Length=430

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 124/217 (57%), Gaps = 24/217 (11%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGV--LKMVVV--------------PFLGQLSDDYGR  566
            +ALC G+S+CS+  YING+  T  G   ++M                 P +  L+ +  R
Sbjct  57   SALCPGESTCSKVIYINGIHQTDGGTSTIQMSTAVNPLSLLPCPRPYFPLVCSLTSNAFR  116

Query  565  K------PlllltsstTIIPFV-LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYA  407
                    + +   +T ++ F+ LLA N+S  FVYAYYV++TIS IISQGS+F IS+AY 
Sbjct  117  LVKIYHFNISVTKITTKLLNFIALLAWNQSEDFVYAYYVLRTISNIISQGSVFYISLAYV  176

Query  406  ADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLV  227
            ADVV+E+ RA  FSWITGL SASHVLG++ + FL E Y I   ++ LLIF  +YM   LV
Sbjct  177  ADVVNESKRAAVFSWITGLLSASHVLGDVLALFLPEKY-IFVVSIALLIFCLVYMKFFLV  235

Query  226  ETVTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVV  116
            ETV         L C +K+    +++   V+   E+V
Sbjct  236  ETVILAPRNNPKLGCGAKIVDVFQQRYKSVKRAAEIV  272



>ref|XP_010539088.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Tarenaya hassleriana]
Length=438

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 133/241 (55%), Gaps = 11/241 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y++G Q  V G+  ++++P +G LSD YGRK LL L  S  I+P   
Sbjct  38   ALCPGEDECSLAIYLSGFQQAVSGLGSLLMMPIVGTLSDTYGRKALLTLPMSLAILPLAS  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +++    Y YYV++T++  + +GS+ C+++AY AD V E  RA+AF  ++G+ S + 
Sbjct  98   LAYSRTTTTFYVYYVLKTLTSTVCEGSVHCLALAYVADNVSEQRRASAFGILSGIGSCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDG---------GVEQSLPC  182
            V G L++RFL       Q A  + +   +YM L L +++  +           V  +LP 
Sbjct  158  VCGTLSARFLSTSAT-FQVAATVAVLSTVYMRLFLPDSIADNSLTVPILSGEKVSATLPK  216

Query  181  PSKVKKF-CREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
                KKF        V+  + ++ SS  L  A +VSFF  LG +G+ +   +YLKA F F
Sbjct  217  DKSDKKFEVFRTLPSVQDMVGLLKSSVPLLQAAIVSFFSSLGDAGLQASTMYYLKAKFHF  276

Query  4    D  2
            +
Sbjct  277  N  277



>ref|XP_007136127.1| hypothetical protein PHAVU_009G020100g [Phaseolus vulgaris]
 gb|ESW08121.1| hypothetical protein PHAVU_009G020100g [Phaseolus vulgaris]
Length=433

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 137/246 (56%), Gaps = 19/246 (8%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y+ G Q  ++GV  +V++P LG  SD YGRK +L +    TIIP  +
Sbjct  35   ALCPGQDECSLAIYLTGFQQAMIGVGTLVMMPLLGNFSDKYGRKAILKVPMILTIIPTGI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA N+++ F Y YYV + +  ++ +GS+ C+++AY AD + E+ R+TAF  I+G+ SA+ 
Sbjct  95   LAYNRTKKFFYVYYVFKILISMVCEGSVPCLALAYVADNIPESGRSTAFGIISGIGSAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP--------  179
            V   L++RFL       Q +  + +   +YM L L ++V  D   +Q L  P        
Sbjct  155  VCATLSARFL-STAQTFQVSTLIAVIGAVYMQLFLRDSVIDD---DQHLHTPIISQQKLA  210

Query  178  -SKV-KKFCREQ--CYCVRTTLEVVV---SSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
             SKV +KF   +     +R+  ++     SS T+  A +V+FF  L   G+   + ++LK
Sbjct  211  ISKVDRKFESNKPLLKALRSFQDLASFFNSSFTITQAAIVAFFSNLADVGLHGSMLYFLK  270

Query  19   AAFGFD  2
            A F FD
Sbjct  271  AQFHFD  276



>ref|XP_007017915.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY15140.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=520

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/245 (33%), Positives = 134/245 (55%), Gaps = 16/245 (7%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  C  + Y+ G Q  ++G+  +V++P +G LSD YGRK LL +  + TIIP  
Sbjct  111  SALCPGKIECYLAIYLTGFQQAIIGLGSLVMMPLVGNLSDKYGRKALLTVPMTLTIIPLA  170

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA +++R F YAYYV++ ++ +  +G++ C+S+AY AD V E  R + F  ++G+ S +
Sbjct  171  ILAYSRTRSFFYAYYVLKILTAMFCEGTVHCLSLAYVADNVPEGRRVSTFGILSGIGSCA  230

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTP-------------DGGVE  197
             V G L++RFL    +  Q A  + +   +YM + L +++               DG V 
Sbjct  231  FVCGTLSTRFLSTA-STFQVATAMAMLSAVYMRIFLPDSIINDNLSAPILSQGKLDGIVN  289

Query  196  QSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
                   K++ F  +    +   L ++ SS T   A +VSFF  L   G+ + L +YLKA
Sbjct  290  PDEESDKKMQMF--KTMPSIEDMLALLKSSLTFSQAAIVSFFSNLSDVGLHASLLYYLKA  347

Query  16   AFGFD  2
             F F+
Sbjct  348  RFHFN  352



>ref|XP_004292638.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Fragaria 
vesca subsp. vesca]
Length=441

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/248 (33%), Positives = 130/248 (52%), Gaps = 18/248 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            A+C  + SCS + Y+ G Q  ++G+  +V+ P +G LSD YGRK LL    + +IIP  +
Sbjct  34   AVCPSRESCSLAIYLTGFQQAIIGLGTVVMNPVIGNLSDLYGRKALLTFPLTLSIIPLAI  93

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++   F YA++V++T++ +  +GS+ C+++AY AD + E  R + F  + G  SAS 
Sbjct  94   LAFSRETNFFYAFFVLRTLTAMTCEGSVNCLALAYIADNISEKERVSTFGILAGCTSASF  153

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGG--------VEQSLPCP  179
            V G L +R L        AAL  ++   +YM + L ET  PD G        ++ S P P
Sbjct  154  VCGTLVARILPTSSTFQVAALASMM-AAVYMRIFLKETRLPDHGDSTLSQPILKGSEPVP  212

Query  178  SKV---------KKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHY  26
             ++          K   ++         ++ SS TL  A ++SFF  L   G+   + ++
Sbjct  213  DRITEDDDYTPKTKIAFKKMPSAGDLFRLLRSSKTLSQAGIISFFQSLAEGGMQVTVMYF  272

Query  25   LKAAFGFD  2
            LKA F FD
Sbjct  273  LKARFQFD  280



>ref|XP_006280482.1| hypothetical protein CARUB_v10026419mg [Capsella rubella]
 gb|EOA13380.1| hypothetical protein CARUB_v10026419mg [Capsella rubella]
Length=438

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/242 (35%), Positives = 128/242 (53%), Gaps = 13/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS   Y++GLQ  + GV  ++++P +G LSD +GRK LL L  +  I+P   
Sbjct  38   ALCPGKDECSLVIYLSGLQQIITGVGSLMMMPLVGSLSDKHGRKCLLTLPMTLNILPLAT  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            +A ++     Y YYV++T + II +GS+ C+++AY AD V E  RA++F  +TG+ S + 
Sbjct  98   MAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVSEGQRASSFGILTGIASCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V   L +RFL       Q A  + I   +YM L L E++ PD  +  S+    K+     
Sbjct  158  VCATLCARFL-SIATTFQVAATMAILSTIYMRLFLPESI-PDNTLRASIVSNEKLNSPLL  215

Query  154  EQC-----------YCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
            E C             VR    ++  S  L    +VSFF  LG +G+ +   +YLKA F 
Sbjct  216  EDCPGYRNKISRSVRLVREMASLMRRSVPLFQVAMVSFFSSLGEAGLHASSVYYLKAKFH  275

Query  7    FD  2
            F+
Sbjct  276  FN  277



>ref|XP_010539087.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Tarenaya hassleriana]
Length=450

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 133/241 (55%), Gaps = 11/241 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y++G Q  V G+  ++++P +G LSD YGRK LL L  S  I+P   
Sbjct  38   ALCPGEDECSLAIYLSGFQQAVSGLGSLLMMPIVGTLSDTYGRKALLTLPMSLAILPLAS  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +++    Y YYV++T++  + +GS+ C+++AY AD V E  RA+AF  ++G+ S + 
Sbjct  98   LAYSRTTTTFYVYYVLKTLTSTVCEGSVHCLALAYVADNVSEQRRASAFGILSGIGSCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDG---------GVEQSLPC  182
            V G L++RFL       Q A  + +   +YM L L +++  +           V  +LP 
Sbjct  158  VCGTLSARFLSTSAT-FQVAATVAVLSTVYMRLFLPDSIADNSLTVPILSGEKVSATLPK  216

Query  181  PSKVKKF-CREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
                KKF        V+  + ++ SS  L  A +VSFF  LG +G+ +   +YLKA F F
Sbjct  217  DKSDKKFEVFRTLPSVQDMVGLLKSSVPLLQAAIVSFFSSLGDAGLQASTMYYLKAKFHF  276

Query  4    D  2
            +
Sbjct  277  N  277



>ref|XP_004248636.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
Length=444

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/244 (36%), Positives = 133/244 (55%), Gaps = 16/244 (7%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC  Q  CS + Y++G Q  ++G+  M+++P LG LSD YGRK LL +  + +IIP V
Sbjct  36   GALCPSQDECSLAIYLSGFQQAILGLGSMMMLPLLGHLSDIYGRKALLTVPVAASIIPSV  95

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LAI +S  + YAYY ++T + ++S   I C+SIAYAA  + E  R +A  ++ G+ SA+
Sbjct  96   ILAIGRSTNYFYAYYAVKTFTGMVSDNGIECLSIAYAAANISEEKRVSAIGFVAGIGSAA  155

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVET------------VTPDGGVEQ  194
             +LG +A+RFL      L AAL  +I   +YM + + ET            +  D G E 
Sbjct  156  SLLGTMAARFLSTAQIFLVAALSSMI-ATIYMRIFVKETTGRSDSETLNQPILIDNGAEC  214

Query  193  SLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
            S    SK      +Q   ++    ++ SS TL  A +V+F   LG  G  +   ++LKA 
Sbjct  215  S---KSKSVSQSFKQVLPLKDIFCLLRSSVTLSLATVVAFLNGLGEGGQQTPYLYFLKAR  271

Query  13   FGFD  2
              F+
Sbjct  272  LRFN  275



>ref|XP_004983780.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X2 [Setaria italica]
Length=364

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 131/247 (53%), Gaps = 19/247 (8%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+  CS + Y+ GLQ  V G+  +V+ P +G LSD YGRK LL L ++ +I+P  
Sbjct  34   GALCPGRDECSLAIYLTGLQQAVTGLGALVLTPVVGNLSDRYGRKALLALPATASIVPLG  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA  +++G+ YAYYV + ++ ++S GS+ C+S+AY AD V E  RA AF   TG+ SA 
Sbjct  94   ILAYGRTKGYFYAYYVTKMLTAMVSDGSMMCLSLAYVADRVPEARRAAAFGVFTGVCSAG  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQ-------SLP--  185
             V    A+RFL       Q +    +    YM   L ET   DGG          SLP  
Sbjct  154  FVASTFAARFLPVS-TTCQVSAVAAVVTAAYMKAFLQET---DGGASSCRSEEAASLPLC  209

Query  184  CPSKVKKFCREQCYCVRTT------LEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYL  23
             PS   +    +   +R          ++ SS T   A +V+FF+ LG +G+ + L ++L
Sbjct  210  LPSSSSEESSPRLPPLRKAPSLSEIATLLTSSSTFSRATVVTFFHGLGETGLLNTLLYFL  269

Query  22   KAAFGFD  2
            KA F + 
Sbjct  270  KAKFHYS  276



>ref|XP_004983779.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Setaria italica]
Length=435

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 131/247 (53%), Gaps = 19/247 (8%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+  CS + Y+ GLQ  V G+  +V+ P +G LSD YGRK LL L ++ +I+P  
Sbjct  34   GALCPGRDECSLAIYLTGLQQAVTGLGALVLTPVVGNLSDRYGRKALLALPATASIVPLG  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA  +++G+ YAYYV + ++ ++S GS+ C+S+AY AD V E  RA AF   TG+ SA 
Sbjct  94   ILAYGRTKGYFYAYYVTKMLTAMVSDGSMMCLSLAYVADRVPEARRAAAFGVFTGVCSAG  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQ-------SLP--  185
             V    A+RFL       Q +    +    YM   L ET   DGG          SLP  
Sbjct  154  FVASTFAARFLPVS-TTCQVSAVAAVVTAAYMKAFLQET---DGGASSCRSEEAASLPLC  209

Query  184  CPSKVKKFCREQCYCVRTT------LEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYL  23
             PS   +    +   +R          ++ SS T   A +V+FF+ LG +G+ + L ++L
Sbjct  210  LPSSSSEESSPRLPPLRKAPSLSEIATLLTSSSTFSRATVVTFFHGLGETGLLNTLLYFL  269

Query  22   KAAFGFD  2
            KA F + 
Sbjct  270  KAKFHYS  276



>ref|XP_002465000.1| hypothetical protein SORBIDRAFT_01g030220 [Sorghum bicolor]
 gb|EER91998.1| hypothetical protein SORBIDRAFT_01g030220 [Sorghum bicolor]
Length=447

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 88/255 (35%), Positives = 134/255 (53%), Gaps = 28/255 (11%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ GLQ  V G+  +V+ P +G LSD YGRK LL L ++ +I+P  +
Sbjct  38   ALCPGRDECSLAIYLTGLQQAVTGLGALVLTPVVGNLSDRYGRKALLALPATASIVPLGI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +++G+ YAYYV +T++ ++++G++ C+S+AY AD V ET RA AF   +G+ SA  
Sbjct  98   LAYGRTKGYFYAYYVTKTLTAMVAEGTMMCLSLAYVADRVPETRRAAAFGVFSGVCSAGF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGV---------------  200
            V   +A+RFL    +  Q +    +   +YM   L ET   DGG                
Sbjct  158  VASTVAARFLPAS-STFQVSAVAAVVTAVYMKAFLQET---DGGASISSSCSSSSSNSDE  213

Query  199  EQSLP--CPSKVKKFCR-------EQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGI  47
            E S P   PS               +   +      + SS T   A +V+FF+ LG +G+
Sbjct  214  EASRPLCLPSSSSSEEASPRLPPLRKAPSLSELAATLTSSSTFSRAAVVTFFHGLGETGL  273

Query  46   DSVLPHYLKAAFGFD  2
             S L ++LKA F + 
Sbjct  274  LSTLLYFLKAKFHYS  288



>ref|XP_004500910.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X5 [Cicer arietinum]
Length=395

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 85/244 (35%), Positives = 133/244 (55%), Gaps = 15/244 (6%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y+ G Q  ++GV  +V++P LG LSD YGRK +L +  S  IIP  +
Sbjct  37   ALCPGQDECSIAIYLTGFQQAIIGVGTLVMMPLLGNLSDKYGRKAILTVPMSLMIIPLGI  96

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++++ F Y YYV + +  +I  G + C+++AY AD V E  R++AF  ++G+ S++ 
Sbjct  97   LAYSRTKTFFYIYYVFKILINMICDGCVPCLALAYVADNVPEGRRSSAFGILSGIGSSAF  156

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGG-------VEQSLPCPS  176
            V G LA+RFL       Q +  + +   +YM + L ++V  DG        + +  P  S
Sbjct  157  VCGTLAARFL-STAQTFQVSTFVAVIGAVYMQIFLRDSVI-DGNHRLCTPIISEGEPSTS  214

Query  175  KV--KKFCREQCYCVRTTLEVVV----SSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
            K+  K     Q      +L+ +     SS T+  A +V+FF  L   G+   + +YLKA 
Sbjct  215  KIIAKSKSNMQLLNALRSLQDLTSFLNSSLTITQAAIVAFFSNLADVGLHGSMMYYLKAR  274

Query  13   FGFD  2
            F FD
Sbjct  275  FHFD  278



>gb|KDO68185.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=444

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 136/246 (55%), Gaps = 19/246 (8%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  ++G+  +V++P +G LSD YGRK +L L  + +IIP  +
Sbjct  38   ALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKAMLTLPLTLSIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +S  F YAYY ++T++ ++ +GSI C+++AY AD + E  RA+AF  + G+ SAS 
Sbjct  98   LAYRRSISFFYAYYALRTLTAMVCEGSINCLALAY-ADNISERQRASAFGILLGVLSASF  156

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHL---------------VETVTPDGGV  200
            V G LA+RFL    +  QAA  + +    YM + L               + T   +G  
Sbjct  157  VCGTLAARFLSTT-SAFQAATIVSMLAAAYMRVFLKDDVPNDDDDDLTRPIITEETEGVN  215

Query  199  EQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
            +     P K+   C+ +   +R  + ++ SS TL  A +V+FF  L   G+ +   ++LK
Sbjct  216  QNESNSPVKI-PVCK-KIPSIRDLICLLRSSVTLSQAAVVAFFSGLSEGGMQASFLYFLK  273

Query  19   AAFGFD  2
            A F F+
Sbjct  274  AQFHFN  279



>ref|XP_010943478.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Elaeis 
guineensis]
Length=443

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 128/247 (52%), Gaps = 20/247 (8%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+  CS + Y++G Q  + G+  ++V P +G LSD YGRK LL L  +T IIP  
Sbjct  34   EALCPGRDECSLAIYLSGFQQVITGLGTLMVTPLIGNLSDRYGRKALLTLPMTTAIIPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SR + Y YY+++  + I  +GS+ C+S+AY AD V E  RA+AF  ++G+ +A 
Sbjct  94   ILAYDRSRVYFYIYYIVKMFTGIFCEGSMQCLSLAYVADKVGEQRRASAFGVLSGVSAAG  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V G   +RFL    +  Q +  + +    YM L L ET   D G   +    +  +  C
Sbjct  154  FVSGTFVARFLSTS-STFQVSATVAVIAAAYMRLFLAET---DRGAAAAAAEEAS-RPLC  208

Query  157  R---------------EQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYL  23
                             +   +   + ++ SS TL  A +V FF  L  SG+ S L +YL
Sbjct  209  SPSSSDGESSPRLPALRKLPSLENMIVILQSSTTLSRAAIVVFFNSLAESGLQSALLYYL  268

Query  22   KAAFGFD  2
            KA F F 
Sbjct  269  KAQFQFS  275



>ref|XP_004500906.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Cicer arietinum]
Length=466

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/244 (35%), Positives = 133/244 (55%), Gaps = 15/244 (6%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y+ G Q  ++GV  +V++P LG LSD YGRK +L +  S  IIP  +
Sbjct  37   ALCPGQDECSIAIYLTGFQQAIIGVGTLVMMPLLGNLSDKYGRKAILTVPMSLMIIPLGI  96

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++++ F Y YYV + +  +I  G + C+++AY AD V E  R++AF  ++G+ S++ 
Sbjct  97   LAYSRTKTFFYIYYVFKILINMICDGCVPCLALAYVADNVPEGRRSSAFGILSGIGSSAF  156

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGG-------VEQSLPCPS  176
            V G LA+RFL       Q +  + +   +YM + L ++V  DG        + +  P  S
Sbjct  157  VCGTLAARFL-STAQTFQVSTFVAVIGAVYMQIFLRDSVI-DGNHRLCTPIISEGEPSTS  214

Query  175  KV--KKFCREQCYCVRTTLEVVV----SSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
            K+  K     Q      +L+ +     SS T+  A +V+FF  L   G+   + +YLKA 
Sbjct  215  KIIAKSKSNMQLLNALRSLQDLTSFLNSSLTITQAAIVAFFSNLADVGLHGSMMYYLKAR  274

Query  13   FGFD  2
            F FD
Sbjct  275  FHFD  278



>ref|XP_004500908.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X3 [Cicer arietinum]
Length=439

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/244 (35%), Positives = 133/244 (55%), Gaps = 15/244 (6%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y+ G Q  ++GV  +V++P LG LSD YGRK +L +  S  IIP  +
Sbjct  37   ALCPGQDECSIAIYLTGFQQAIIGVGTLVMMPLLGNLSDKYGRKAILTVPMSLMIIPLGI  96

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++++ F Y YYV + +  +I  G + C+++AY AD V E  R++AF  ++G+ S++ 
Sbjct  97   LAYSRTKTFFYIYYVFKILINMICDGCVPCLALAYVADNVPEGRRSSAFGILSGIGSSAF  156

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGG-------VEQSLPCPS  176
            V G LA+RFL       Q +  + +   +YM + L ++V  DG        + +  P  S
Sbjct  157  VCGTLAARFL-STAQTFQVSTFVAVIGAVYMQIFLRDSVI-DGNHRLCTPIISEGEPSTS  214

Query  175  KV--KKFCREQCYCVRTTLEVVV----SSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
            K+  K     Q      +L+ +     SS T+  A +V+FF  L   G+   + +YLKA 
Sbjct  215  KIIAKSKSNMQLLNALRSLQDLTSFLNSSLTITQAAIVAFFSNLADVGLHGSMMYYLKAR  274

Query  13   FGFD  2
            F FD
Sbjct  275  FHFD  278



>ref|XP_011003093.1| PREDICTED: uncharacterized protein LOC105109921 [Populus euphratica]
Length=447

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 84/249 (34%), Positives = 140/249 (56%), Gaps = 20/249 (8%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y+ G Q  ++G+  +V++P +G +SD YGRK LL +  S  I+P  
Sbjct  34   SALCPGRDECSLAIYLTGFQQAIIGLGTLVMMPLIGNMSDKYGRKALLTVPLSLVIVPSA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA +++R   YAYYV++T+  ++ +GS+ C+++AY AD V E  RA+AF  ++G+ S++
Sbjct  94   ILAYSRTRYSFYAYYVVKTLIAMVCEGSVPCLALAYVADNVPEGRRASAFGILSGIASSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSL----------  188
             V GNL++RFL    +  Q +  + +   +YM   L +++  +      L          
Sbjct  154  FVCGNLSTRFLSTA-STFQVSASVAVASLVYMRFFLQDSIIDEQLTAPILTSKGKQKGKG  212

Query  187  ------PCPSK-VKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPH  29
                    PSK V+ F  +    +   L ++ SS TL  A +V+FFY L   G+ + L +
Sbjct  213  KDYATNEIPSKNVQIF--KSAPSLEDMLCLLKSSMTLSQAAVVAFFYSLAEVGLHASLLY  270

Query  28   YLKAAFGFD  2
            YLKA F F+
Sbjct  271  YLKARFHFN  279



>gb|KDO68188.1| hypothetical protein CISIN_1g011514mg [Citrus sinensis]
Length=273

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 128/233 (55%), Gaps = 18/233 (8%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  ++G+  +V++P +G LSD YGRK +L L  + +IIP  +
Sbjct  38   ALCPGLDECSLAIYLSGFQQAIIGLGTLVMMPVIGNLSDQYGRKAMLTLPLTLSIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +S  F YAYY ++T++ ++ +GSI C+++AY AD + E  RA+AF  + G+ SAS 
Sbjct  98   LAYRRSISFFYAYYALRTLTAMVCEGSINCLALAYVADNISERQRASAFGILLGVLSASF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHL---------------VETVTPDGGV  200
            V G LA+RFL    +  QAA  + +    YM + L               + T   +G  
Sbjct  158  VCGTLAARFLSTT-SAFQAATIVSMLAAAYMRVFLKDDVPNDDDDDLTRPIITEETEGVN  216

Query  199  EQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDS  41
            +     P K+   C+ +   +R  + ++ SS TL  A +V+FF  L   G+ +
Sbjct  217  QNESNSPVKI-PVCK-KIPSIRDLICLLRSSVTLSQAAVVAFFSGLSEGGMQA  267



>gb|KEH44396.1| MFS transporter [Medicago truncatula]
Length=361

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 131/243 (54%), Gaps = 19/243 (8%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  ++  P +G LSD YGRK L+ L  + ++IP  +
Sbjct  35   ALCPGQDECSLAIYLSGFQQVMIGIGSVMTTPLIGNLSDRYGRKALITLPLTVSLIPQAI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++   F YAYYV++T++ +  +GS  C+++AY AD+V    RA+AF  + G+ SAS 
Sbjct  95   LAYSRDTKFFYAYYVVKTLAALAGEGSFHCLALAYVADIVPVGKRASAFGILAGVGSASF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G LA+RFL        A++  +I + +YM + L E+           P   + ++ C 
Sbjct  155  VGGTLAARFLSAALTFQVASVSSMIGL-VYMRIFLKES------APMRQPLLKEAEEPCI  207

Query  154  EQCY--CVRTTLEVVVS----------SPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
            EQC     + T + + S          SPT   A +V  F  L   G  +V  +YLKA F
Sbjct  208  EQCEDDLPQRTFKKLPSMGDLICLLKCSPTFSQAAIVLLFNSLADGGSMAVTMYYLKARF  267

Query  10   GFD  2
             ++
Sbjct  268  QYN  270



>ref|XP_011088647.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Sesamum indicum]
Length=443

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 135/248 (54%), Gaps = 22/248 (9%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             A+C G+  CS + Y++G Q  + G+  +VV+P +G LSD YGRK LL +  + +I P V
Sbjct  34   EAVCPGKDECSLAIYLSGFQQAIAGIGSVVVMPLIGFLSDTYGRKVLLTIPMTLSIFPLV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA+ ++  F Y YYV++T++ ++++G + C++++Y AD V E  R +AF  ++G+ +A+
Sbjct  94   ILAVRRTTEFFYVYYVLKTLTAMVTEGGVICLALSYLADNVSEGKRVSAFGLLSGVTAAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDG-GVEQSLPCPSK----  173
             V G L +R L     I Q A  + +   +YM + L +T T     +EQ +  P+     
Sbjct  154  TVCGTLVARLLPTT-RIFQLAAVVAVVAAVYMKIFLKDTSTCQADALEQPILKPATETSE  212

Query  172  -----------VKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHY  26
                       +KKF        +  + ++ SS T+  A  + FF  L  +GI + L +Y
Sbjct  213  TGNESLKKTDLIKKFPLP-----KDIIRLLKSSGTVSLASFIVFFNSLAEAGIQAFLMYY  267

Query  25   LKAAFGFD  2
            LKA F F 
Sbjct  268  LKARFHFQ  275



>emb|CDY02382.1| BnaA02g22910D [Brassica napus]
Length=438

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/242 (34%), Positives = 128/242 (53%), Gaps = 13/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  + GV  ++++P +G LSD +GRK LL L  +  I+P  +
Sbjct  38   ALCPGTDECSLAIYLSGFQQAITGVGSLMMMPLVGSLSDKHGRKSLLTLPMALNILPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV++T + I  +GS+FC+++AY AD V E +RA+AF  +TG+ S + 
Sbjct  98   LAYSRETSVFYIYYVLKTFTSIFCEGSVFCLALAYVADNVSENHRASAFGILTGIGSCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V  N  +RFL       Q A  + IF  +YM + L +++  D  +  S+    K+     
Sbjct  158  VCANCCARFLSTTAT-FQVATTVAIFSTVYMRIFLPDSIR-DNSLVTSIVSTEKLSYVLL  215

Query  154  EQ-----------CYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
            E               VR    ++ SS  L    +VSFF  L  +G+ +   +YLKA F 
Sbjct  216  EDYPAHRNQISRTLRSVREMASLMRSSVPLFQVAMVSFFSSLSEAGLHASSMYYLKAKFH  275

Query  7    FD  2
            F+
Sbjct  276  FN  277



>ref|XP_004290751.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
[Fragaria vesca subsp. vesca]
Length=462

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/249 (33%), Positives = 134/249 (54%), Gaps = 20/249 (8%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            A+C G+ SCS + Y+ G Q  ++G+  +V+ P +G LSD YGRK LL    + +IIP  +
Sbjct  55   AVCPGRESCSLAIYLTGFQQAMIGMGTVVMNPVIGNLSDLYGRKALLTFPLTLSIIPLAI  114

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++   F YA+Y+++T++ +  +GS+ C+++AY AD + E  R + F  + G  SAS 
Sbjct  115  LAYSQETNFFYAFYLLRTLTAMTCEGSVNCLALAYLADNIPEKERVSTFGILAGFTSASF  174

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP------SK  173
            V G L +RFL        AAL  ++   +YM + L E+   D G + SL  P        
Sbjct  175  VCGTLVARFLPTSLTFQVAALGSMM-AAVYMRIFLKESRLSDHG-DSSLSQPILKGSEPV  232

Query  172  VKKFCREQCYCVRTTLE------------VVVSSPTLKCACLVSFFYQLGISGIDSVLPH  29
            +++   +  Y  +T +             ++ SS TL  A +++FF  L   G+ + + +
Sbjct  233  LERITDDDDYTPKTKVAFKKMPSAADLFGLLRSSKTLSQAGIITFFQSLAEGGMQATVLY  292

Query  28   YLKAAFGFD  2
            +LKA F FD
Sbjct  293  FLKARFQFD  301



>gb|KEH44398.1| MFS transporter [Medicago truncatula]
Length=440

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 131/243 (54%), Gaps = 19/243 (8%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  ++  P +G LSD YGRK L+ L  + ++IP  +
Sbjct  35   ALCPGQDECSLAIYLSGFQQVMIGIGSVMTTPLIGNLSDRYGRKALITLPLTVSLIPQAI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++   F YAYYV++T++ +  +GS  C+++AY AD+V    RA+AF  + G+ SAS 
Sbjct  95   LAYSRDTKFFYAYYVVKTLAALAGEGSFHCLALAYVADIVPVGKRASAFGILAGVGSASF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G LA+RFL        A++  +I + +YM + L E+           P   + ++ C 
Sbjct  155  VGGTLAARFLSAALTFQVASVSSMIGL-VYMRIFLKES------APMRQPLLKEAEEPCI  207

Query  154  EQCY--CVRTTLEVVVS----------SPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
            EQC     + T + + S          SPT   A +V  F  L   G  +V  +YLKA F
Sbjct  208  EQCEDDLPQRTFKKLPSMGDLICLLKCSPTFSQAAIVLLFNSLADGGSMAVTMYYLKARF  267

Query  10   GFD  2
             ++
Sbjct  268  QYN  270



>gb|KFK32943.1| hypothetical protein AALP_AA6G309500 [Arabis alpina]
Length=436

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 126/240 (53%), Gaps = 11/240 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y++GLQ  + GV  ++++P +G LSD +GRK LL L  +  I+P   
Sbjct  38   ALCPGKDECSLAIYLSGLQQAITGVGSLMMMPLVGSLSDKHGRKSLLTLPMTLNILPLAT  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV +T + I+ +GS+FC+++AY AD + E  RA+AF  +TG+ S + 
Sbjct  98   LAYSRGTTTFYVYYVFKTFTSIVCEGSVFCLALAYVADNIPEGRRASAFGILTGISSCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGV---EQSLPC------  182
            V   L +RFL       Q A  + +   +YM + L  ++     +      L C      
Sbjct  158  VCATLCARFLSTAAT-FQVATTMAVLSTVYMRVFLPVSIRDHSLIVVPSDKLSCDLLEDF  216

Query  181  PSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            P    +  R     VR    ++ SS  L    LVSFF  LG +G+ +   +YLKA F F+
Sbjct  217  PGHKNRVLRS-IRSVREMASLMRSSVPLSQVALVSFFTSLGEAGLHASSMYYLKAKFHFN  275



>ref|XP_007222153.1| hypothetical protein PRUPE_ppa005755mg [Prunus persica]
 gb|EMJ23352.1| hypothetical protein PRUPE_ppa005755mg [Prunus persica]
Length=445

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 133/248 (54%), Gaps = 22/248 (9%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y+ G Q  +VG+  +V++P +G LSD  GRK LL +    TIIP  
Sbjct  36   SALCPGRDECSIAIYLTGFQQAIVGLGTLVMMPLVGNLSDKCGRKALLTVPMILTIIPLG  95

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L  +++R F Y Y+V +T++ +I +GS+ C+++AY AD V E  RA+ F  ++G+ S++
Sbjct  96   ILGYSRNRTFFYIYFVAKTLTAMICEGSVHCLALAYVADNVAEERRASTFGVLSGIGSSA  155

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP-------  179
             V G L +RFL    +  Q A  + +   +Y+ + L     PD  +++ L  P       
Sbjct  156  FVCGTLFTRFLSTS-STFQVATSVAVVSAMYLRIFL-----PDSNIDKKLSAPLLSDEKP  209

Query  178  --SKVKKFCREQCYCVRTTL-------EVVVSSPTLKCACLVSFFYQLGISGIDSVLPHY  26
              +   +  R Q      TL        ++ +S T   A +V+FF  L   G+ + + +Y
Sbjct  210  KIADSDESSRAQILQPAKTLPSLHDLISLLKTSATFSQAAIVAFFSNLADVGLHASMMYY  269

Query  25   LKAAFGFD  2
            LKA F F+
Sbjct  270  LKARFHFN  277



>gb|AES74091.2| MFS transporter [Medicago truncatula]
Length=434

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/242 (33%), Positives = 130/242 (54%), Gaps = 12/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y+ G Q  ++G+  +V++P LG LSD YGRK +L L  +  IIP  +
Sbjct  37   ALCPGQDECSIAIYLTGFQQAMIGMGTLVMMPILGDLSDKYGRKAILTLPMTLMIIPLGI  96

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++++ F Y YYV + I  +I  G + C+++AY AD V E  R++AF  ++G+ S++ 
Sbjct  97   LAYSRTKTFFYVYYVFKIIINMICDGCVPCLALAYVADNVPEGRRSSAFGVLSGIGSSAF  156

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGG-----VEQSLPCPSKV  170
            V G +A+RFL       Q +  + +   +YM + L ++V  +       + Q  P  +K+
Sbjct  157  VCGTVAARFLSAA-QTFQVSTFVAVLGAVYMQIFLRDSVADENQLYTPIISQGKPPIAKI  215

Query  169  KKFCR------EQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
                +      +    +R     + SS  +  A +V+FF  L   G+   + +YLKA F 
Sbjct  216  NGKSKANMPLLKALSSLRDITSFLNSSKIITQASIVAFFSNLADVGLHGSMMYYLKARFH  275

Query  7    FD  2
            FD
Sbjct  276  FD  277



>gb|KEH44397.1| MFS transporter [Medicago truncatula]
Length=394

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 131/243 (54%), Gaps = 19/243 (8%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  ++  P +G LSD YGRK L+ L  + ++IP  +
Sbjct  35   ALCPGQDECSLAIYLSGFQQVMIGIGSVMTTPLIGNLSDRYGRKALITLPLTVSLIPQAI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++   F YAYYV++T++ +  +GS  C+++AY AD+V    RA+AF  + G+ SAS 
Sbjct  95   LAYSRDTKFFYAYYVVKTLAALAGEGSFHCLALAYVADIVPVGKRASAFGILAGVGSASF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G LA+RFL        A++  +I + +YM + L E+           P   + ++ C 
Sbjct  155  VGGTLAARFLSAALTFQVASVSSMIGL-VYMRIFLKES------APMRQPLLKEAEEPCI  207

Query  154  EQCY--CVRTTLEVVVS----------SPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
            EQC     + T + + S          SPT   A +V  F  L   G  +V  +YLKA F
Sbjct  208  EQCEDDLPQRTFKKLPSMGDLICLLKCSPTFSQAAIVLLFNSLADGGSMAVTMYYLKARF  267

Query  10   GFD  2
             ++
Sbjct  268  QYN  270



>gb|EYU37987.1| hypothetical protein MIMGU_mgv1a019548mg, partial [Erythranthe 
guttata]
Length=432

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 124/246 (50%), Gaps = 20/246 (8%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             A+C GQ  CS + Y+ G Q  + G+  + V+P +G LSD YGRK LL +     I P  
Sbjct  34   EAVCPGQDECSLAIYLTGFQQAIAGIGSVFVMPLIGNLSDSYGRKVLLTIPLIVAIFPPA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA+ ++  F Y YYVM+ ++ ++++G + C+S+ Y AD V E  R +AF  ++G+ +A+
Sbjct  94   ILAVRRTTEFFYVYYVMKILTAVVTEGGVICLSLGYLADNVSEGKRVSAFGLLSGVVAAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVE--------------TVTPDGGV  200
             V G L +R L  +  I + A  +     +YM + L E              ++  D   
Sbjct  154  TVCGTLTARLLPTN-QIFKVAAVIAALAAVYMKIFLKERNRKVDTLNEPILKSIGEDEND  212

Query  199  EQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
            E  L     V K            + +  +SPT+  A +V+FF  +  +G+ S L +YLK
Sbjct  213  EHPLKPKHPVNKIPSAH-----DIIRLFKTSPTVSLASVVAFFNSIAEAGVQSFLMYYLK  267

Query  19   AAFGFD  2
            A F F 
Sbjct  268  ARFHFQ  273



>ref|XP_008445313.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Cucumis 
melo]
Length=437

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/243 (33%), Positives = 129/243 (53%), Gaps = 13/243 (5%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC  Q  CS + Y  GLQ  V G+  ++++P LG LSD +GRK +L +     ++P  
Sbjct  34   SALCPDQDECSLAIYFTGLQQVVTGLGSLLMMPLLGNLSDKFGRKTVLTIPMILVVLPLG  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L   +SR F Y Y+V++ ++ II +GS+ C+++AYAAD V E  RA+AF  ++ + SA+
Sbjct  94   ILGYGRSRKFYYVYFVLKCVTSIICEGSVQCLAVAYAADNVPEHQRASAFGILSAIISAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V G L +RFL    +  Q A    +   +YM + L ++V  D  +   L    KV+   
Sbjct  154  FVCGTLCTRFLSIP-STFQFAASTAVVAAVYMRIFLTDSVA-DCNLSAPLLSGEKVESVS  211

Query  157  REQCY-----------CVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
             E               V+    ++++S T   A +V+F   L   G+ + + +YLKA F
Sbjct  212  SEPVSPKKEHIITTLPSVKDLFSLLMTSSTFSQAAIVAFLTNLADVGLHASVLYYLKARF  271

Query  10   GFD  2
             FD
Sbjct  272  QFD  274



>ref|XP_010494157.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Camelina sativa]
Length=432

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/242 (35%), Positives = 125/242 (52%), Gaps = 13/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS   Y++G Q  + GV  ++++P +G LSD +GRK LL L  +  I+P   
Sbjct  38   ALCPGKDECSLVIYLSGFQQIITGVGSLMMMPLVGSLSDKHGRKSLLTLPMTLNILPLAT  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV++T + II +GS+ C+++AY AD V E  RA+AF  +TG+ S + 
Sbjct  98   LAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVSEGQRASAFGILTGIASCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V   L +RFL       Q A  L I   +YM L L +++  D  V   +     +     
Sbjct  158  VCATLCARFL-SIATTFQVAATLAILSTVYMRLLLPDSIQ-DNSVGAPIVSSENLSSPLL  215

Query  154  EQC-----------YCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
            E C             VR    ++ SS  L    +VSFF  LG +G+ +   +YLKA F 
Sbjct  216  EDCPGHRNRIFRSFRSVREMASLMRSSVPLFQVAVVSFFSSLGEAGLHASSMYYLKAKFH  275

Query  7    FD  2
            F+
Sbjct  276  FN  277



>ref|XP_010494158.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Camelina sativa]
Length=423

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/242 (35%), Positives = 125/242 (52%), Gaps = 13/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS   Y++G Q  + GV  ++++P +G LSD +GRK LL L  +  I+P   
Sbjct  38   ALCPGKDECSLVIYLSGFQQIITGVGSLMMMPLVGSLSDKHGRKSLLTLPMTLNILPLAT  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV++T + II +GS+ C+++AY AD V E  RA+AF  +TG+ S + 
Sbjct  98   LAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVSEGQRASAFGILTGIASCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V   L +RFL       Q A  L I   +YM L L +++  D  V   +     +     
Sbjct  158  VCATLCARFL-SIATTFQVAATLAILSTVYMRLLLPDSIQ-DNSVGAPIVSSENLSSPLL  215

Query  154  EQC-----------YCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
            E C             VR    ++ SS  L    +VSFF  LG +G+ +   +YLKA F 
Sbjct  216  EDCPGHRNRIFRSFRSVREMASLMRSSVPLFQVAVVSFFSSLGEAGLHASSMYYLKAKFH  275

Query  7    FD  2
            F+
Sbjct  276  FN  277



>gb|KDP33281.1| hypothetical protein JCGZ_13068 [Jatropha curcas]
Length=447

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 126/250 (50%), Gaps = 20/250 (8%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y+ G Q  + G+  +V+ P +G LSD YGRK +L +  + +I P  +
Sbjct  36   ALCPGQDQCSLAIYLTGFQQAMTGIGSVVITPIIGNLSDQYGRKAMLTIPLTVSIFPLAI  95

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +    F Y+YYV++T++ ++S+ SI C++ AY AD + E  RA+AF   +G+FS+S 
Sbjct  96   LAYSSETNFFYSYYVLRTLTAMVSESSIQCLAFAYVADNISERQRASAFGIQSGIFSSSF  155

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGV-EQSLPCPSKVKKFC  158
            V G LA+R L        AAL  ++   +YM + L + V+ +  + E  L      +   
Sbjct  156  VAGTLAARLLSISLTFQVAALVSMV-ATVYMRIFLKDRVSDNENLSEPILKSSGPEENIH  214

Query  157  REQCYCVRTTLEV------------------VVSSPTLKCACLVSFFYQLGISGIDSVLP  32
            ++  +    T  V                  +  S T     +VSFF  L   G+ +   
Sbjct  215  QDNAHTNNLTTRVSPVSSSKKILTVGDLICLLKRSSTFSQVSVVSFFNSLAEGGLLASFM  274

Query  31   HYLKAAFGFD  2
            +YLKA F F 
Sbjct  275  YYLKARFHFS  284



>ref|XP_010494154.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Camelina sativa]
 ref|XP_010494155.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Camelina sativa]
Length=438

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/242 (35%), Positives = 125/242 (52%), Gaps = 13/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS   Y++G Q  + GV  ++++P +G LSD +GRK LL L  +  I+P   
Sbjct  38   ALCPGKDECSLVIYLSGFQQIITGVGSLMMMPLVGSLSDKHGRKSLLTLPMTLNILPLAT  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV++T + II +GS+ C+++AY AD V E  RA+AF  +TG+ S + 
Sbjct  98   LAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVSEGQRASAFGILTGIASCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V   L +RFL       Q A  L I   +YM L L +++  D  V   +     +     
Sbjct  158  VCATLCARFL-SIATTFQVAATLAILSTVYMRLLLPDSIQ-DNSVGAPIVSSENLSSPLL  215

Query  154  EQC-----------YCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
            E C             VR    ++ SS  L    +VSFF  LG +G+ +   +YLKA F 
Sbjct  216  EDCPGHRNRIFRSFRSVREMASLMRSSVPLFQVAVVSFFSSLGEAGLHASSMYYLKAKFH  275

Query  7    FD  2
            F+
Sbjct  276  FN  277



>ref|XP_010494156.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Camelina sativa]
Length=435

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/242 (35%), Positives = 125/242 (52%), Gaps = 13/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS   Y++G Q  + GV  ++++P +G LSD +GRK LL L  +  I+P   
Sbjct  38   ALCPGKDECSLVIYLSGFQQIITGVGSLMMMPLVGSLSDKHGRKSLLTLPMTLNILPLAT  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV++T + II +GS+ C+++AY AD V E  RA+AF  +TG+ S + 
Sbjct  98   LAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVSEGQRASAFGILTGIASCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V   L +RFL       Q A  L I   +YM L L +++  D  V   +     +     
Sbjct  158  VCATLCARFL-SIATTFQVAATLAILSTVYMRLLLPDSIQ-DNSVGAPIVSSENLSSPLL  215

Query  154  EQC-----------YCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
            E C             VR    ++ SS  L    +VSFF  LG +G+ +   +YLKA F 
Sbjct  216  EDCPGHRNRIFRSFRSVREMASLMRSSVPLFQVAVVSFFSSLGEAGLHASSMYYLKAKFH  275

Query  7    FD  2
            F+
Sbjct  276  FN  277



>gb|EYU37986.1| hypothetical protein MIMGU_mgv1a006358mg [Erythranthe guttata]
Length=447

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 131/250 (52%), Gaps = 23/250 (9%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             A+C GQ  CS + Y+ G Q  + G+  +V++P +G LSD YGRK LL +  + +I P V
Sbjct  34   EAVCPGQDECSLAIYLTGFQQAIAGIGAVVMMPVIGTLSDVYGRKVLLTIPLTLSIFPLV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA+ ++  F YAYY ++T++ ++++G I C+S++Y AD V E  R +AF  ++G+ +A+
Sbjct  94   ILAVKRTTEFFYAYYALKTLTSMVTEGGIICLSLSYLADNVSEGKRVSAFGLLSGVVAAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V G   +R L     I Q A  +     +YM + L ET+  +  VE   P    + K  
Sbjct  154  TVCGTFVARLLPTT-QIFQVAAVVAFIAAIYMKIFLKETIR-NAAVE---PLEEPILKSV  208

Query  157  RE------------------QCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLP  32
             E                  +    +  + ++ ++ T+  A  V+FF  L  +G+ + L 
Sbjct  209  TETSTTNQDKIILKPADLFKKMPLPKDIINLLKTNKTVSLASFVAFFNSLAEAGVQAFLM  268

Query  31   HYLKAAFGFD  2
            +YLKA F F 
Sbjct  269  YYLKARFHFQ  278



>tpg|DAA46149.1| TPA: hypothetical protein ZEAMMB73_581598 [Zea mays]
Length=360

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 133/260 (51%), Gaps = 33/260 (13%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ GLQ  V G+  +V+ P +G LSD YGRK LL L ++ +I+P  +
Sbjct  44   ALCPGRDECSLAIYLTGLQQAVSGLGALVLTPVVGNLSDRYGRKALLALPATASIVPLGI  103

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +++G+ YAYYV +T++ ++ +G++  +S+AY AD V ET RA AF   +G+ SA  
Sbjct  104  LAYGRTKGYFYAYYVTKTLTAMVCEGTMMTLSLAYVADRVPETRRAAAFGVFSGVCSAGF  163

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G +A+RFL    +  Q +    +   +YM   L ET   DGG   S    S       
Sbjct  164  VGGTVAARFLPVS-STFQVSAVAAVATAVYMKAFLQET---DGGASVSSSSSSSSGSGSD  219

Query  154  EQCYCVR-----------------------------TTLEVVVSSPTLKCACLVSFFYQL  62
            E+  C R                                  + SS T  CA +V+FF+ L
Sbjct  220  EEAACRRPLCLPSSSSSEEAASLPRLPPLRKAPSLSEIAAALTSSSTFCCAAVVTFFHGL  279

Query  61   GISGIDSVLPHYLKAAFGFD  2
            G +G+ S L ++LKA F + 
Sbjct  280  GETGLLSALLYFLKAKFHYS  299



>ref|XP_010690317.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Beta 
vulgaris subsp. vulgaris]
Length=434

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 130/244 (53%), Gaps = 16/244 (7%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+  CS + Y++G Q  V G+  +V+ P LG LSD YGRK LL L  +  I+P V
Sbjct  34   EALCPGKDECSLAIYLSGFQQAVSGIGSVVMTPLLGNLSDMYGRKALLTLPLTLYILPHV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++ R F YAYYV++T++ +I +G+I C+S+AY AD + +  RA+AF  + G+ SA+
Sbjct  94   VLAYSRERSFFYAYYVLKTVASMICEGTINCLSLAYVADKIPQGKRASAFGVLAGVTSAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSL----PCPS--  176
             V G L +RFL       QAA    +    YM + L ET        Q L    P  S  
Sbjct  154  FVCGTLTARFL-PTAQTFQAAAVSSMAAAAYMRIFLKETTPETDASTQPLLKSEPSSSSD  212

Query  175  -----KVKKFCR-EQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
                 KV+ F +    + V++ L    SS       ++  F+ L   G+ + L ++LKA 
Sbjct  213  ENLSKKVQIFKKIPNFHDVKSLLG---SSKIFSQVAVMVLFHSLAEGGLHASLMYFLKAE  269

Query  13   FGFD  2
            F F 
Sbjct  270  FHFS  273



>gb|EMT20897.1| Hippocampus abundant transcript 1 protein [Aegilops tauschii]
Length=441

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/257 (33%), Positives = 128/257 (50%), Gaps = 31/257 (12%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             A+C G+  CS + Y++G Q+ + G+  +VV P +G LSD YGRK L+ L  +  I+P  
Sbjct  34   EAVCPGRDECSVAIYLSGFQNAITGLGALVVTPIVGNLSDKYGRKALMTLPVTVAILPLF  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N+S  + YAYYVM+ ++ I  +GSI C+S+AY AD V    RA AF  ++G+ +A 
Sbjct  94   ILACNRSEVYFYAYYVMKILAGIFCEGSIHCLSLAYVADHVGTKRRAAAFGLLSGVSAAG  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSL---PCPSKVK  167
             + G L +RFL    +  Q A  +     +Y+         PD G   S     C   ++
Sbjct  154  FLSGTLTARFLATS-STFQVAAAVGAAGAIYL-----RAFVPDSGAAVSFHDDACDPLLQ  207

Query  166  K-----------FCREQCYCVRTTLEVVVSSP-----------TLKCACLVSFFYQLGIS  53
                           E+        + V+ SP           TL  A +++FFY LG  
Sbjct  208  DSSCSSAASSSASSDEELSPRLPPYKGVLPSPSDMVALLTGSLTLSTAAMITFFYSLGEH  267

Query  52   GIDSVLPHYLKAAFGFD  2
            G+ + L +YLKA FG+ 
Sbjct  268  GLQTALLYYLKAQFGYS  284



>ref|XP_009775454.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Nicotiana 
sylvestris]
Length=449

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 133/247 (54%), Gaps = 17/247 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC  Q  CS + Y++G Q  ++G+  M+++P LG LSD YGRK LL +  +  I+P V+
Sbjct  35   ALCPAQDECSLAIYLSGFQQAILGLGSMLMLPLLGHLSDIYGRKALLTVPVAAAIVPSVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LAI +S  + YAYY ++T + ++S   I C+SIAYAA  + E  R +A   + G+ SA++
Sbjct  95   LAIGRSTNYFYAYYAIKTFTGMVSDNGIECLSIAYAAASISEEKRVSAIGAVAGIGSAAY  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVT---PDGGVEQ------SLPC  182
            + G +A+RFL   +  L AA+  ++   +YM + L ET      D  + Q      S  C
Sbjct  155  LFGTMAARFLSTAHIFLVAAISSMV-AAIYMRIFLEETSNHFRSDDALNQPILGESSAEC  213

Query  181  -------PSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYL  23
                    SK+     ++   ++    ++ SS TL  A +++F   LG  G  +   ++L
Sbjct  214  SQSGSNDSSKIVPQSFKKVLPLKDIFCLLRSSVTLSLATVIAFLNGLGEGGQQTPFLYFL  273

Query  22   KAAFGFD  2
            KA   ++
Sbjct  274  KARLQYN  280



>ref|XP_008221200.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Prunus 
mume]
Length=446

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/248 (33%), Positives = 134/248 (54%), Gaps = 22/248 (9%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y+ G Q  +VG+  +V++P +G LSD  GRK LL +    TIIP  
Sbjct  36   SALCPGRDECSIAIYLTGFQQAIVGMGTLVMMPLVGNLSDKCGRKALLTVPMILTIIPLG  95

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L  +++R F Y Y+V +T++ +I +GS+ C+++AY AD V E  RA+AF  ++G+ S++
Sbjct  96   ILGYSRNRTFFYVYFVAKTLTAMICEGSVHCLALAYVADNVAEERRASAFGVLSGIGSSA  155

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP-------  179
             V G L +RFL    +  Q A  + +   +Y+ + L     PD  +++ L  P       
Sbjct  156  FVCGTLFTRFLSTS-STFQVATSVAVVAAMYLRIFL-----PDSNIDKKLSAPLLSDEKQ  209

Query  178  --SKVKKFCREQCYCVRTTL-------EVVVSSPTLKCACLVSFFYQLGISGIDSVLPHY  26
              +   +  R Q      TL        ++ +S T   A +V+FF  L   G+ + + +Y
Sbjct  210  KIADSDESSRAQILQPAKTLPSLHDLISLLKTSATFSQAAIVAFFSNLADVGLHASMMYY  269

Query  25   LKAAFGFD  2
            LKA F F+
Sbjct  270  LKARFHFN  277



>ref|XP_007041737.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOX97568.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=443

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 142/245 (58%), Gaps = 18/245 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++GLQ  ++G+   +++P +G LSD YGRK LL L  + +IIP  +
Sbjct  36   ALCPGTDECSLAIYLSGLQQAMIGLGTALMMPLIGNLSDQYGRKALLTLPMTLSIIPLAI  95

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +++  + YAYY ++T++ +I +GSI C+++AY AD + ++ RA+AF  ++G+ S + 
Sbjct  96   LACSRTTNYYYAYYALRTLTAMICEGSINCLALAYLADNISDSQRASAFGILSGVSSGAF  155

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPD--GGVEQSL---------  188
            V G LA+RFL    +  Q A  + +   +YM + L E++ PD   G+ Q +         
Sbjct  156  VCGTLAARFLSTG-STFQVATFVSMLAVVYMRIFLEESI-PDQVDGMTQPILKEGEDVIQ  213

Query  187  ---PCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
                 P K+  +  ++   V   + ++ SSP+   A +V+FF  L   G+ S L +YLKA
Sbjct  214  KDGNAPRKMPVY--KKIPSVGDIISLLKSSPSFSQAAVVAFFNSLAEGGMISSLMYYLKA  271

Query  16   AFGFD  2
             F F+
Sbjct  272  RFHFN  276



>ref|XP_008445315.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Cucumis 
melo]
Length=434

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 125/238 (53%), Gaps = 8/238 (3%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y  G Q  V GV  +++VP LG LSD +GRK +L +     +IP  
Sbjct  34   SALCPGRDECSLAIYFTGFQQVVTGVGALLMVPLLGNLSDKFGRKTVLTIPLILNVIPLG  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L   +SR   Y Y+V + ++ I+ +GS+ C+++AYAAD V E  RA+AF  ++ + S++
Sbjct  94   ILGYGRSRDLFYIYFVFKCVTSIVCEGSVQCLAVAYAADNVPEHRRASAFGILSAIISSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVT------PDGGVEQSLPCPS  176
             V GNL +RFL    +  QAA        LYM + L ++ +      P    E      S
Sbjct  154  SVCGNLCARFLSIS-STFQAAASTAAMAALYMRVFLTDSASNCNLSAPLLSGENVESVSS  212

Query  175  KVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            K +K+       +      + +S T   A +V+FF  L   G  + + +YLKA F FD
Sbjct  213  KKEKYA-SALPSLTDLFSFLKTSSTFSQAAVVAFFSNLADVGHHASIMYYLKAKFHFD  269



>ref|NP_001130498.1| tetracycline transporter protein [Zea mays]
 gb|ACF78738.1| unknown [Zea mays]
 gb|ACN25405.1| unknown [Zea mays]
 tpg|DAA46151.1| TPA: tetracycline transporter protein [Zea mays]
Length=458

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 133/260 (51%), Gaps = 33/260 (13%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ GLQ  V G+  +V+ P +G LSD YGRK LL L ++ +I+P  +
Sbjct  44   ALCPGRDECSLAIYLTGLQQAVSGLGALVLTPVVGNLSDRYGRKALLALPATASIVPLGI  103

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +++G+ YAYYV +T++ ++ +G++  +S+AY AD V ET RA AF   +G+ SA  
Sbjct  104  LAYGRTKGYFYAYYVTKTLTAMVCEGTMMTLSLAYVADRVPETRRAAAFGVFSGVCSAGF  163

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G +A+RFL    +  Q +    +   +YM   L ET   DGG   S    S       
Sbjct  164  VGGTVAARFLPVS-STFQVSAVAAVATAVYMKAFLQET---DGGASVSSSSSSSSGSGSD  219

Query  154  EQCYCVR-----------------------------TTLEVVVSSPTLKCACLVSFFYQL  62
            E+  C R                                  + SS T  CA +V+FF+ L
Sbjct  220  EEAACRRPLCLPSSSSSEEAASLPRLPPLRKAPSLSEIAAALTSSSTFCCAAVVTFFHGL  279

Query  61   GISGIDSVLPHYLKAAFGFD  2
            G +G+ S L ++LKA F + 
Sbjct  280  GETGLLSALLYFLKAKFHYS  299



>ref|XP_007041738.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOX97569.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=444

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 142/245 (58%), Gaps = 18/245 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++GLQ  ++G+   +++P +G LSD YGRK LL L  + +IIP  +
Sbjct  36   ALCPGTDECSLAIYLSGLQQAMIGLGTALMMPLIGNLSDQYGRKALLTLPMTLSIIPLAI  95

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +++  + YAYY ++T++ +I +GSI C+++AY AD + ++ RA+AF  ++G+ S + 
Sbjct  96   LACSRTTNYYYAYYALRTLTAMICEGSINCLALAYLADNISDSQRASAFGILSGVSSGAF  155

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPD--GGVEQSL---------  188
            V G LA+RFL    +  Q A  + +   +YM + L E++ PD   G+ Q +         
Sbjct  156  VCGTLAARFLSTG-STFQVATFVSMLAVVYMRIFLEESI-PDQVDGMTQPILKEGEDVIQ  213

Query  187  ---PCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
                 P K+  +  ++   V   + ++ SSP+   A +V+FF  L   G+ S L +YLKA
Sbjct  214  KDGNAPRKMPVY--KKIPSVGDIISLLKSSPSFSQAAVVAFFNSLAEGGMISSLMYYLKA  271

Query  16   AFGFD  2
             F F+
Sbjct  272  RFHFN  276



>ref|XP_008447923.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Cucumis melo]
Length=383

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 132/245 (54%), Gaps = 15/245 (6%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ G Q  + G   +V+ P +G LSD YGRK LL L ++ +IIP  +
Sbjct  38   ALCPGRDECSLAIYLTGFQQALSGFGAVVITPIVGNLSDKYGRKALLTLPTAISIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++ R F YAYYV +T++ ++S+G+  C+++AY AD    TNR +AF   TG+ SA+ 
Sbjct  98   LAYSRERRFFYAYYVTRTLTAMVSEGTAACLALAYLADNTSLTNRGSAFGLFTGVCSAAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G +ASRFL  DY I   A    +   +YM + L + +     + Q +      +   R
Sbjct  158  VCGTIASRFLATDY-IFPIAAIFSMVATVYMRIFLKDRLPGRSDLVQPMLKEEVPELTNR  216

Query  154  E----------QCYCVRTTLEVVV----SSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
            E          Q +    TL+ V+    SS  L  A +V FF  LG  G+ + + +Y KA
Sbjct  217  EDDGGKLTRPTQPFRKMPTLDDVITLFKSSTLLSQAAVVVFFTGLGEGGMQASILYYFKA  276

Query  16   AFGFD  2
             F FD
Sbjct  277  RFHFD  281



>tpg|DAA46150.1| TPA: hypothetical protein ZEAMMB73_581598 [Zea mays]
Length=448

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 133/260 (51%), Gaps = 33/260 (13%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ GLQ  V G+  +V+ P +G LSD YGRK LL L ++ +I+P  +
Sbjct  44   ALCPGRDECSLAIYLTGLQQAVSGLGALVLTPVVGNLSDRYGRKALLALPATASIVPLGI  103

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +++G+ YAYYV +T++ ++ +G++  +S+AY AD V ET RA AF   +G+ SA  
Sbjct  104  LAYGRTKGYFYAYYVTKTLTAMVCEGTMMTLSLAYVADRVPETRRAAAFGVFSGVCSAGF  163

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G +A+RFL    +  Q +    +   +YM   L ET   DGG   S    S       
Sbjct  164  VGGTVAARFLPVS-STFQVSAVAAVATAVYMKAFLQET---DGGASVSSSSSSSSGSGSD  219

Query  154  EQCYCVR-----------------------------TTLEVVVSSPTLKCACLVSFFYQL  62
            E+  C R                                  + SS T  CA +V+FF+ L
Sbjct  220  EEAACRRPLCLPSSSSSEEAASLPRLPPLRKAPSLSEIAAALTSSSTFCCAAVVTFFHGL  279

Query  61   GISGIDSVLPHYLKAAFGFD  2
            G +G+ S L ++LKA F + 
Sbjct  280  GETGLLSALLYFLKAKFHYS  299



>ref|XP_008447922.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Cucumis melo]
Length=395

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 132/245 (54%), Gaps = 15/245 (6%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ G Q  + G   +V+ P +G LSD YGRK LL L ++ +IIP  +
Sbjct  38   ALCPGRDECSLAIYLTGFQQALSGFGAVVITPIVGNLSDKYGRKALLTLPTAISIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++ R F YAYYV +T++ ++S+G+  C+++AY AD    TNR +AF   TG+ SA+ 
Sbjct  98   LAYSRERRFFYAYYVTRTLTAMVSEGTAACLALAYLADNTSLTNRGSAFGLFTGVCSAAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G +ASRFL  DY I   A    +   +YM + L + +     + Q +      +   R
Sbjct  158  VCGTIASRFLATDY-IFPIAAIFSMVATVYMRIFLKDRLPGRSDLVQPMLKEEVPELTNR  216

Query  154  E----------QCYCVRTTLEVVV----SSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
            E          Q +    TL+ V+    SS  L  A +V FF  LG  G+ + + +Y KA
Sbjct  217  EDDGGKLTRPTQPFRKMPTLDDVITLFKSSTLLSQAAVVVFFTGLGEGGMQASILYYFKA  276

Query  16   AFGFD  2
             F FD
Sbjct  277  RFHFD  281



>gb|EYU37988.1| hypothetical protein MIMGU_mgv1a006415mg [Erythranthe guttata]
Length=444

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/240 (34%), Positives = 127/240 (53%), Gaps = 10/240 (4%)
 Frame = -2

Query  694  ALCDG-QSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            A+C G +  CS + Y+ G    + G+  +V++P +G LSD YGRK L+ +  +  IIP V
Sbjct  35   AVCGGGKEECSLAIYLTGFTQAITGLGAVVMMPMIGNLSDVYGRKNLMTIPMTLAIIPLV  94

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            ++A N++  F YAYYV +T++ I++ G I C+++ Y AD V E  R   FS ++G+   +
Sbjct  95   IMAWNRTTNFYYAYYVFKTLTDIVADGGILCLALGYLADCVAEGKRVAVFSVLSGVICGA  154

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTP--DGGVEQSLPCPSKVKK  164
            +V G+LA+R L   + I Q A  + I   +YM + L + V    D  +EQ +  P K   
Sbjct  155  NVCGSLAARLLSTPH-IFQVAAVISIVAAIYMRVFLKDPVREKNDMLLEQPILNPGKGSS  213

Query  163  FCRE------QCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
               E      Q    +    +  SS     A  VSFF  L  +G  + L ++LKA F F+
Sbjct  214  KSSENISFIHQIPSPKDVFILFRSSNKFALAASVSFFTSLAEAGGAAFLMYFLKARFHFN  273



>ref|XP_009783818.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Nicotiana sylvestris]
Length=313

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 127/240 (53%), Gaps = 11/240 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  ++++P +G LSD YGRK LL +  + +IIP V+
Sbjct  35   ALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLSDVYGRKALLTIPVTLSIIPPVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +++ F Y YYV++T++ +I  G I C+++AY AD +    RA+A   + G+ SA+ 
Sbjct  95   LAYRRTKNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGVGSAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQ----------SLP  185
            V G LA  FL      L AA+   +   +YM + L +T   +  +EQ           L 
Sbjct  155  VCGTLADHFLSTSQIFLVAAIASTV-AAVYMQIFLEDTACFEDSIEQPILKSELENDELD  213

Query  184  CPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
            C ++      ++   ++  +  +  S T   A  V+F   L   G  +   ++LKA F F
Sbjct  214  CETEKNIKVFKKVPSLKDIICFLKKSATFSLAASVAFLNSLAEGGEQAPFQYFLKAQFHF  273



>ref|XP_008447920.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Cucumis melo]
 ref|XP_008447921.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Cucumis melo]
Length=449

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 132/245 (54%), Gaps = 15/245 (6%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ G Q  + G   +V+ P +G LSD YGRK LL L ++ +IIP  +
Sbjct  38   ALCPGRDECSLAIYLTGFQQALSGFGAVVITPIVGNLSDKYGRKALLTLPTAISIIPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++ R F YAYYV +T++ ++S+G+  C+++AY AD    TNR +AF   TG+ SA+ 
Sbjct  98   LAYSRERRFFYAYYVTRTLTAMVSEGTAACLALAYLADNTSLTNRGSAFGLFTGVCSAAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G +ASRFL  DY I   A    +   +YM + L + +     + Q +      +   R
Sbjct  158  VCGTIASRFLATDY-IFPIAAIFSMVATVYMRIFLKDRLPGRSDLVQPMLKEEVPELTNR  216

Query  154  E----------QCYCVRTTLEVVV----SSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
            E          Q +    TL+ V+    SS  L  A +V FF  LG  G+ + + +Y KA
Sbjct  217  EDDGGKLTRPTQPFRKMPTLDDVITLFKSSTLLSQAAVVVFFTGLGEGGMQASILYYFKA  276

Query  16   AFGFD  2
             F FD
Sbjct  277  RFHFD  281



>ref|XP_006360887.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X1 [Solanum tuberosum]
Length=444

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 132/244 (54%), Gaps = 16/244 (7%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC  Q  CS + Y++G Q  ++G+  M+++P LG LSD YGRK LL +  + +IIP V
Sbjct  36   GALCPSQDECSLAIYLSGFQQAILGLGSMMMLPLLGHLSDIYGRKALLTVPVAASIIPSV  95

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LAI +S  + Y YY ++T + ++S   I C+SIAYAA  + E  R +A  ++ G+ SA+
Sbjct  96   ILAIGRSTNYFYVYYAVKTFTGMVSDSGIECLSIAYAAANISEEKRVSAIGFVAGIGSAA  155

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVET------------VTPDGGVEQ  194
             +LG +A+RFL      L AA+  ++   +YM + + ET            +  D G E 
Sbjct  156  SLLGTMAARFLSTAQIFLIAAISSMV-ATIYMRIFVKETSGRIDSEPLNQPILVDNGEEC  214

Query  193  SLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
            S    SK      ++   ++    ++ SS TL  A +++F   LG  G  +   ++LKA 
Sbjct  215  S---QSKSVSQSFKEVLPLKDIFCLLKSSVTLSLATVIAFLNGLGEGGQQTPYLYFLKAR  271

Query  13   FGFD  2
              ++
Sbjct  272  LQYN  275



>ref|XP_004167746.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Cucumis 
sativus]
Length=434

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 131/252 (52%), Gaps = 29/252 (12%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ G Q  + G   +V+ P LG LSD YGRK LL L ++ +IIP  +
Sbjct  37   ALCPGRDECSLAIYLTGSQQALSGFGAVVITPLLGNLSDKYGRKALLTLPTAISIIPLAI  96

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++ R F YAYY  +T++ ++S+G+   +++AY AD     NRA+AF   TG+ SA+ 
Sbjct  97   LAYSRERRFFYAYYATRTLTAMVSEGTAASLALAYLADNTSLANRASAFGLFTGVCSAAF  156

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVET-------VTP------------  212
            V G LASRFL  DY I   A    +   +YM + L +        V P            
Sbjct  157  VCGTLASRFLATDY-IFPIAAVFSMVATVYMRIFLKDRLPGRSDLVQPMLKEEVPELTDR  215

Query  211  --DGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSV  38
              DGG    LP P++  +    +   +   + +  SS  L  A +V FF  LG  GI + 
Sbjct  216  EDDGG---ELPRPTQPFR----KMPTLHDVITLFKSSTLLSKAAVVVFFTGLGEGGIQAS  268

Query  37   LPHYLKAAFGFD  2
            + +Y KA F FD
Sbjct  269  ILYYFKARFHFD  280



>ref|XP_010442182.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Camelina 
sativa]
 ref|XP_010442183.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Camelina 
sativa]
 ref|XP_010442184.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Camelina 
sativa]
Length=438

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 124/245 (51%), Gaps = 21/245 (9%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS   Y+ G Q  + GV  ++++P +G LSD +GRK LL L  +  I+P   
Sbjct  38   ALCPGKDECSLVIYLFGFQQIITGVGSLMMMPLVGSLSDKHGRKSLLTLPMTLNILPLAT  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV++T + II +GS+ C+++AY AD V E  RA+AF  +TG+ S + 
Sbjct  98   LAYSRGTTIFYVYYVLKTFTSIICEGSVLCLALAYVADNVTEGQRASAFGILTGIASCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP----SKVK  167
            V   L +RFL       Q A  + I   +YM L L     PD   + SL  P     K+ 
Sbjct  158  VCATLCARFLAIS-TTFQVAATMAILSTVYMRLFL-----PDFIRDNSLGAPIVSSEKLS  211

Query  166  KFCREQC-----------YCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
                E C             VR    ++ SS  L    ++SFF  LG +G+ +   +YLK
Sbjct  212  SPLLEDCPGHRNRIFRSFRSVREMTSLMRSSVPLFQVVVISFFSSLGEAGLHASSMYYLK  271

Query  19   AAFGF  5
            A F F
Sbjct  272  AKFHF  276



>ref|XP_004142991.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Cucumis 
sativus]
 ref|XP_004161071.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Cucumis 
sativus]
Length=437

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 125/242 (52%), Gaps = 13/242 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC  Q  CS + Y  GLQ  V G   ++++P LG LSD +GRK +L +     +IP  +
Sbjct  35   ALCPDQDQCSVAIYFTGLQQVVTGFGSLLMMPLLGNLSDKFGRKTVLTIPMILVVIPLGI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +SR F Y Y+V + ++ II +GS+ C+++AYAAD V E  RA+AF  ++   SA+ 
Sbjct  95   LAYGRSRKFYYVYFVFKCVTSIICEGSVQCMAVAYAADNVPEHQRASAFGILSATISAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVT-----------PDGGVEQSL  188
            V G L +RFL    +  Q A    +   +YM + L ++V             +     S 
Sbjct  155  VCGTLCTRFLSIP-STFQVAASTAVVAAVYMRIFLTDSVANCNLSAPLLSGENADSVSSD  213

Query  187  PCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFG  8
            P   K K+        V+    ++++S T   A +V+F   L   G+ + + +YLKA F 
Sbjct  214  PISPK-KEHIITTLPSVKDLFSLLMTSSTFSQAAIVAFLTNLADVGLHASVLYYLKARFQ  272

Query  7    FD  2
            FD
Sbjct  273  FD  274



>ref|XP_004144923.1| PREDICTED: tetracycline resistance protein, class D-like [Cucumis 
sativus]
 gb|KGN43275.1| hypothetical protein Csa_7G016600 [Cucumis sativus]
Length=448

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 131/252 (52%), Gaps = 29/252 (12%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ G Q  + G   +V+ P LG LSD YGRK LL L ++ +IIP  +
Sbjct  37   ALCPGRDECSLAIYLTGSQQALSGFGAVVITPLLGNLSDKYGRKALLTLPTAISIIPLAI  96

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++ R F YAYY  +T++ ++S+G+   +++AY AD     NRA+AF   TG+ SA+ 
Sbjct  97   LAYSRERRFFYAYYATRTLTAMVSEGTAASLALAYLADNTSLANRASAFGLFTGVCSAAF  156

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVET-------VTP------------  212
            V G LASRFL  DY I   A    +   +YM + L +        V P            
Sbjct  157  VCGTLASRFLATDY-IFPIAAVFSMVATVYMRIFLKDRLPGRSDLVQPMLKEEVPELTDR  215

Query  211  --DGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSV  38
              DGG    LP P++  +    +   +   + +  SS  L  A +V FF  LG  GI + 
Sbjct  216  EDDGG---ELPRPTQPFR----KMPTLHDVITLFKSSTLLSKAAVVVFFTGLGEGGIQAS  268

Query  37   LPHYLKAAFGFD  2
            + +Y KA F FD
Sbjct  269  ILYYFKARFHFD  280



>ref|XP_008445314.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Cucumis 
melo]
Length=438

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 128/245 (52%), Gaps = 17/245 (7%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC GQ  CS + Y  G Q  V G+  ++++P LG LSD  GRK LL +    T++P  
Sbjct  35   SALCPGQDECSLAIYFTGFQQVVTGIGALLIMPLLGNLSDKLGRKTLLTIPMILTVVPLG  94

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L   +SR   Y Y+V++ ++ I+ +GS+ C+++AYAAD V E  RA+AF  ++ + S++
Sbjct  95   ILGYGRSRTLFYVYFVLKCVTSIVCEGSVQCLAVAYAADNVPEHRRASAFGLLSAVGSSA  154

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTP---------DGGVEQSLP  185
             V G L +RFL    +  Q A        +YM + L ++V              VE    
Sbjct  155  FVCGTLCARFLSIP-STFQVAALTAAVAAVYMRIFLTDSVAECNLSAPLLSGENVESVSS  213

Query  184  CPSKVKKFCREQCYC----VRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
             P  +KK   EQ       V+    ++ +S T   A +V+FF  L   G+ + L +YLKA
Sbjct  214  DPVSLKK---EQIITTLPSVKDLFALLKTSLTFSLAAIVAFFGNLADVGLYASLLYYLKA  270

Query  16   AFGFD  2
             F FD
Sbjct  271  RFHFD  275



>ref|XP_009783817.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X3 [Nicotiana sylvestris]
Length=355

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 127/240 (53%), Gaps = 11/240 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  ++++P +G LSD YGRK LL +  + +IIP V+
Sbjct  35   ALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLSDVYGRKALLTIPVTLSIIPPVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +++ F Y YYV++T++ +I  G I C+++AY AD +    RA+A   + G+ SA+ 
Sbjct  95   LAYRRTKNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGVGSAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQ----------SLP  185
            V G LA  FL      L AA+   +   +YM + L +T   +  +EQ           L 
Sbjct  155  VCGTLADHFLSTSQIFLVAAIASTV-AAVYMQIFLEDTACFEDSIEQPILKSELENDELD  213

Query  184  CPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
            C ++      ++   ++  +  +  S T   A  V+F   L   G  +   ++LKA F F
Sbjct  214  CETEKNIKVFKKVPSLKDIICFLKKSATFSLAASVAFLNSLAEGGEQAPFQYFLKAQFHF  273



>ref|XP_009588093.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=442

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/244 (32%), Positives = 131/244 (54%), Gaps = 13/244 (5%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC  Q  CS + Y++GLQ  ++G+  M+++P +G LSD YGRK LL++  + +I+P V
Sbjct  35   DALCPSQDKCSLAIYLSGLQQAIMGLGSMLMMPLIGNLSDVYGRKALLIVPVTASILPSV  94

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            ++A  ++  + YAYYV++T++ ++S   I C+ IAYAAD + E  RA+A   + G+ SA+
Sbjct  95   IMAYKRTTNYFYAYYVVRTLTGMLSDTGIQCLPIAYAADCISEEKRASAIGVVAGVGSAA  154

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP-------  179
            +  G  A RFL      L +++       +YM + L ET       E +L  P       
Sbjct  155  YFCGTFAVRFLSTAQIFLVSSISSTA-AAVYMTIFLKETTRHINIDEDALNQPILANGAD  213

Query  178  -----SKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
                 S  K+   +        + ++ SS TL  A L++F   L   GI +   ++L+A 
Sbjct  214  DSESDSSEKRLSPKNIPSFYHIISLLKSSTTLSLATLIAFLNGLAEGGIQTPFMYFLRAR  273

Query  13   FGFD  2
            F ++
Sbjct  274  FQYN  277



>ref|XP_004143076.1| PREDICTED: uncharacterized protein LOC101213676 [Cucumis sativus]
Length=836

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 130/245 (53%), Gaps = 17/245 (7%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC GQ  CS + Y+ G QH V+G+  ++++P LG LSD  GRK LL +    T++P  
Sbjct  34   SALCPGQDECSLAIYLTGFQHAVMGIGALLMMPLLGNLSDKLGRKTLLTIPMILTVVPLG  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L   +SR   Y Y+V++ ++ I+ +GS+ C+++AYAAD V E  RA+AF  ++ + S++
Sbjct  94   ILGYGRSRNLFYVYFVLKCVTSIVCEGSVQCLAVAYAADNVPEHRRASAFGLLSAVGSSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTP---------DGGVEQSLP  185
             V G L +RFL    +  Q A        +YM + L ++V              VE    
Sbjct  154  FVCGTLCARFLSIS-STFQVAAFTAAVAVVYMKIFLADSVAECIISAPLLSGENVESVSS  212

Query  184  CPSKVKKFCREQCYC----VRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
             P  +KK   EQ       ++    ++  S T   A +V+FF  L   G+ + L +YLKA
Sbjct  213  DPVSLKK---EQIITTLPSIKDLFALLNISLTFSLAAIVAFFGNLADVGLYASLLYYLKA  269

Query  16   AFGFD  2
             F FD
Sbjct  270  RFHFD  274


 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/238 (32%), Positives = 123/238 (52%), Gaps = 8/238 (3%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC  Q  CS   Y  G Q  V G+  ++++P LG LSD +GRK +L +     IIP  
Sbjct  436  SALCPDQDECSLVIYFTGFQQVVTGIGALLMMPLLGNLSDRFGRKTVLTIPLVLNIIPLG  495

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L   +SR   Y Y+V + ++ I+ +GS+ C+++AYAAD V E  RA+AF  ++   +++
Sbjct  496  ILGYGRSRELFYIYFVFKCVTSIVCEGSVQCLAVAYAADNVPEHRRASAFGILSATIASA  555

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKF-  161
             V GNL +RFL    +  QAA        +YM + L ++  P+  +   L     V+   
Sbjct  556  SVCGNLCARFLSIS-STFQAAASTAAMAAVYMRVFLTDS-APNCNLSAPLLSGENVESVS  613

Query  160  CREQCYC-----VRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             +++ Y      +      + +S T     +V+FF  L   G  + + +YLKA F FD
Sbjct  614  SKKEKYATALPSLTDLFSFLKTSSTFSQVAVVAFFSNLADVGHHASIMYYLKAKFHFD  671



>ref|XP_010482014.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X2 [Camelina sativa]
Length=397

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 124/246 (50%), Gaps = 21/246 (9%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS   Y++G Q  + G+  ++++P +G LSD +GRK LL L  +  I+P   
Sbjct  38   ALCPGKDDCSLVIYLSGFQQIITGMGSLMMMPLVGSLSDKHGRKSLLTLPMTLNILPLAT  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV +T + II +GS+ C+++AY AD V E  RA+AF  + G+ S + 
Sbjct  98   LAYSRGTTIFYVYYVPKTFTSIICEGSVLCLALAYVADNVTEGQRASAFGILIGIASCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP----SKVK  167
            V   L +RFL       Q A  + I   +YM L L     PD   + SL  P     K+ 
Sbjct  158  VCATLCARFLAIS-TTFQVAATMAILSTVYMRLFL-----PDSIRDNSLGAPIVSSEKLS  211

Query  166  KFCREQC-----------YCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
                E C             VR    ++ SS  L    +VSFF  LG +G+ +   +YLK
Sbjct  212  SPLLEDCPGHRNRIFRSFRSVREMTSLMRSSVPLFQVAVVSFFSSLGEAGLHASSMYYLK  271

Query  19   AAFGFD  2
            A F F+
Sbjct  272  AKFHFN  277



>ref|XP_010482015.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X3 [Camelina sativa]
Length=437

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 124/246 (50%), Gaps = 21/246 (9%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS   Y++G Q  + G+  ++++P +G LSD +GRK LL L  +  I+P   
Sbjct  38   ALCPGKDDCSLVIYLSGFQQIITGMGSLMMMPLVGSLSDKHGRKSLLTLPMTLNILPLAT  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV +T + II +GS+ C+++AY AD V E  RA+AF  + G+ S + 
Sbjct  98   LAYSRGTTIFYVYYVPKTFTSIICEGSVLCLALAYVADNVTEGQRASAFGILIGIASCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP----SKVK  167
            V   L +RFL       Q A  + I   +YM L L     PD   + SL  P     K+ 
Sbjct  158  VCATLCARFLAIS-TTFQVAATMAILSTVYMRLFL-----PDSIRDNSLGAPIVSSEKLS  211

Query  166  KFCREQC-----------YCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
                E C             VR    ++ SS  L    +VSFF  LG +G+ +   +YLK
Sbjct  212  SPLLEDCPGHRNRIFRSFRSVREMTSLMRSSVPLFQVAVVSFFSSLGEAGLHASSMYYLK  271

Query  19   AAFGFD  2
            A F F+
Sbjct  272  AKFHFN  277



>ref|XP_010482011.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Camelina sativa]
 ref|XP_010482012.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Camelina sativa]
 ref|XP_010482013.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Camelina sativa]
Length=420

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 124/246 (50%), Gaps = 21/246 (9%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS   Y++G Q  + G+  ++++P +G LSD +GRK LL L  +  I+P   
Sbjct  38   ALCPGKDDCSLVIYLSGFQQIITGMGSLMMMPLVGSLSDKHGRKSLLTLPMTLNILPLAT  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV +T + II +GS+ C+++AY AD V E  RA+AF  + G+ S + 
Sbjct  98   LAYSRGTTIFYVYYVPKTFTSIICEGSVLCLALAYVADNVTEGQRASAFGILIGIASCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP----SKVK  167
            V   L +RFL       Q A  + I   +YM L L     PD   + SL  P     K+ 
Sbjct  158  VCATLCARFLAIS-TTFQVAATMAILSTVYMRLFL-----PDSIRDNSLGAPIVSSEKLS  211

Query  166  KFCREQC-----------YCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLK  20
                E C             VR    ++ SS  L    +VSFF  LG +G+ +   +YLK
Sbjct  212  SPLLEDCPGHRNRIFRSFRSVREMTSLMRSSVPLFQVAVVSFFSSLGEAGLHASSMYYLK  271

Query  19   AAFGFD  2
            A F F+
Sbjct  272  AKFHFN  277



>ref|XP_009802649.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Nicotiana sylvestris]
Length=442

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/244 (31%), Positives = 132/244 (54%), Gaps = 13/244 (5%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC  Q  CS + Y++GLQ  ++G+  M+++P +G LSD YGRK LL++  + +I+P V
Sbjct  35   DALCPSQDKCSLAIYLSGLQQAIMGLGSMLMMPLIGNLSDVYGRKALLIVPVTASILPSV  94

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            ++A  ++  + YAYYV++T++ ++S   I C+ IAYAAD + E  RA+A   + G+ SA+
Sbjct  95   IMAYRRTTNYFYAYYVVRTLTGMLSDTGIQCLPIAYAADCISEEKRASAIGIVAGVGSAA  154

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPD------------GGVEQ  194
            ++ G  A+RFL      L +++       +YM + L ET   +               ++
Sbjct  155  YLCGTFAARFLSTAQIFLVSSISSTA-AAVYMTIFLKETTRINKNDDALNQPILTNNADE  213

Query  193  SLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
            S    S  K    +        + ++ SS T   A  ++F Y +G  GI +   ++L+A 
Sbjct  214  SGGDDSSEKTLSPKSIPSFYHIIRLLKSSTTFSLATSIAFLYGIGEGGIRTPFMYFLRAR  273

Query  13   FGFD  2
            F ++
Sbjct  274  FQYN  277



>gb|KDP33282.1| hypothetical protein JCGZ_13069 [Jatropha curcas]
Length=451

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/250 (31%), Positives = 129/250 (52%), Gaps = 20/250 (8%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  + G+  +V+ P +G LSD YGRK +L +  + +I P  +
Sbjct  36   ALCPGQDHCSIAIYLSGFQQAMTGIGSVVITPIIGNLSDQYGRKAMLTIPLTVSIFPLAI  95

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA +    F Y+YYV++ ++ ++S  SI+C+++AY AD + E  RA+AF  ++G+  AS 
Sbjct  96   LAYSSETNFFYSYYVLRILTAMVSGSSIYCLALAYVADNISERQRASAFGILSGIALASS  155

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G LA+R L        AA   ++   +YM + L + V+ +G + + +   S  ++   
Sbjct  156  VAGILAARLLSTSLTFKVAAFVSMV-AAVYMRIFLKDRVSDNGNLSEPILKSSGPEENIH  214

Query  154  E-------------------QCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLP  32
            +                   +   V   + ++  S T     +VSFF  L  +G  + L 
Sbjct  215  QNDADTNNLSTRVSPVSSSNKILTVGDLICLLKRSETFSQVSVVSFFDSLAEAGFLASLM  274

Query  31   HYLKAAFGFD  2
            +YLKA F F 
Sbjct  275  YYLKARFHFS  284



>ref|XP_009783815.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Nicotiana sylvestris]
Length=433

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 127/240 (53%), Gaps = 11/240 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  ++++P +G LSD YGRK LL +  + +IIP V+
Sbjct  35   ALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLSDVYGRKALLTIPVTLSIIPPVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +++ F Y YYV++T++ +I  G I C+++AY AD +    RA+A   + G+ SA+ 
Sbjct  95   LAYRRTKNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGVGSAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQ----------SLP  185
            V G LA  FL      L AA+   +   +YM + L +T   +  +EQ           L 
Sbjct  155  VCGTLADHFLSTSQIFLVAAIASTV-AAVYMQIFLEDTACFEDSIEQPILKSELENDELD  213

Query  184  CPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
            C ++      ++   ++  +  +  S T   A  V+F   L   G  +   ++LKA F F
Sbjct  214  CETEKNIKVFKKVPSLKDIICFLKKSATFSLAASVAFLNSLAEGGEQAPFQYFLKAQFHF  273



>ref|XP_011083420.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Sesamum 
indicum]
Length=444

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 83/240 (35%), Positives = 135/240 (56%), Gaps = 11/240 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y+ G Q  ++G+  +VV+P +G  SD YGRK +L +  + +I P V+
Sbjct  35   ALCPGKDECSLAIYLTGAQQAIIGLGSVVVMPLVGNFSDTYGRKVMLTVPMTLSIFPLVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++++ + YAYYV++T+  ++S+GS+  +++AY AD V E+ RA  F  ++G  S+S 
Sbjct  95   LACSRTKYYFYAYYVLKTLIAMVSEGSVQFLALAYVADNVPESRRAAVFGIMSGFSSSSF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPD----GGVEQSLPC-----  182
            V GNL++RFL       Q A  + +   LYM + L E+            +   C     
Sbjct  155  VFGNLSTRFLSTSAT-FQVAAAMSVVALLYMRVFLPESAMSSSMCAAAESRETDCLLQKA  213

Query  181  PSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            PSK  K  +     V  T+ ++ +SPT   A +V+FF  +   G+ + L +YLKA F F+
Sbjct  214  PSKKWKLFKT-LPSVDDTIFLLRTSPTFSKAAVVAFFINVSDVGLYASLMYYLKAQFHFN  272



>ref|XP_009124113.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X4 [Brassica rapa]
Length=445

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 82/249 (33%), Positives = 128/249 (51%), Gaps = 20/249 (8%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  + GV  ++++P +G LSD +GRK LL L  +  I+P  +
Sbjct  38   ALCPGTDECSLAIYLSGFQQAITGVGSLMMMPLVGSLSDKHGRKSLLTLPMALNILPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV++T + I  +GS+FC+++AY AD V E +RA+AF  +TG+ S + 
Sbjct  98   LAYSRETSVFYIYYVLKTFTSIFCEGSVFCLALAYVADNVSENHRASAFGILTGIGSCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V  N  +RFL       Q A  + IF  +YM + L +++  D  +  S+    K+     
Sbjct  158  VCANCCARFLSTTAT-FQVATTVAIFSTVYMRIFLPDSIR-DNSLVTSIVSTEKLSYVLL  215

Query  154  EQ-----------CYCVRTTLEVVVSSPTLKCACLVSFFYQLGISG-------IDSVLPH  29
            E               VR    ++ SS  L    +VSFF  L  +G       ++    +
Sbjct  216  EDYPAHRNQISRTLRSVREMASLMRSSVPLFQVAMVSFFSSLSEAGLHASSMFVNCFTHY  275

Query  28   YLKAAFGFD  2
            YLKA F F+
Sbjct  276  YLKAKFHFN  284



>ref|XP_009783816.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Nicotiana sylvestris]
Length=429

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/241 (32%), Positives = 127/241 (53%), Gaps = 11/241 (5%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  ++++P +G LSD YGRK LL +  + +IIP V+
Sbjct  35   ALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLSDVYGRKALLTIPVTLSIIPPVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  +++ F Y YYV++T++ +I  G I C+++AY AD +    RA+A   + G+ SA+ 
Sbjct  95   LAYRRTKNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGVGSAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQ----------SLP  185
            V G LA  FL      L AA+   +   +YM + L +T   +  +EQ           L 
Sbjct  155  VCGTLADHFLSTSQIFLVAAIASTV-AAVYMQIFLEDTACFEDSIEQPILKSELENDELD  213

Query  184  CPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGF  5
            C ++      ++   ++  +  +  S T   A  V+F   L   G  +   ++LKA F F
Sbjct  214  CETEKNIKVFKKVPSLKDIICFLKKSATFSLAASVAFLNSLAEGGEQAPFQYFLKAQFHF  273

Query  4    D  2
             
Sbjct  274  K  274



>ref|XP_002301947.2| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
 gb|EEE81220.2| hypothetical protein POPTR_0002s01760g [Populus trichocarpa]
Length=474

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/279 (31%), Positives = 141/279 (51%), Gaps = 53/279 (19%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPF-  521
            +ALC G+  CS + Y+ G Q  ++G+  +V +P +G +SD YGRK LL +  S  I+P  
Sbjct  34   SALCPGRDECSLAIYLTGFQQAIIGLGTLVTMPLIGNMSDKYGRKALLTVPMSLIIVPSG  93

Query  520  -----------------------VLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAY  410
                                    +LA +++R F YAYYV++T+  ++ +GS+ C+++AY
Sbjct  94   WGFSTLWLVSRYLIVNIYKLLQSTILAYSRTRNFFYAYYVVRTLMAMVCEGSVQCLALAY  153

Query  409  AADVVDETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHL  230
             AD V E+ RA+ F  ++G+ S++ V GNL++RFL    +  Q +  + I   +YM   L
Sbjct  154  VADNVPESRRASTFGILSGIASSAFVCGNLSTRFLSTS-STFQVSALVAIAALVYMRFFL  212

Query  229  VETVTPDGGVEQSLPCP-------------SKVKKFCRE------QCYCVRTTLE----V  119
             E++     +++ L  P             +    F  E      Q +    +LE    +
Sbjct  213  QESI-----IDEQLSTPILTYKGNGKGKGKANAACFAHEIPSKNVQVFKSAPSLEDMLCL  267

Query  118  VVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            + SS TL  A +V+FFY L   G+ + L +YLKA F F 
Sbjct  268  LKSSVTLSQAAVVAFFYSLAEVGLHASLMYYLKAQFHFS  306



>ref|XP_009334544.1| PREDICTED: uncharacterized protein LOC103927348 [Pyrus x bretschneideri]
Length=445

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 135/248 (54%), Gaps = 22/248 (9%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y+ G Q  +VG+  +V++P +G LSD  GRK LL L     IIP  
Sbjct  35   SALCPGRDECSIAIYLTGFQQAIVGLGTLVMMPLVGNLSDKCGRKALLTLPMILRIIPLG  94

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L  ++S+ F Y Y+V++T++ ++ +GS+ C+++AY AD V E  RA+ F  ++G+ S++
Sbjct  95   ILGYSRSKSFFYVYFVVKTLTEMVCEGSVQCLALAYVADNVAEGRRASTFGVLSGISSSA  154

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP----SKV  170
             V G L +RF+    +  Q A  + +   +YM + L     PD  ++++L  P     K+
Sbjct  155  FVCGTLFTRFVSTS-STFQVATVVAVVAVMYMRVFL-----PDSNIDKNLSAPLLSDEKI  208

Query  169  K-----KFCREQCYCVRTTL-------EVVVSSPTLKCACLVSFFYQLGISGIDSVLPHY  26
            K     +    Q      TL        ++ +S T   A +V+FF  L   G+ + + +Y
Sbjct  209  KIKDSAENSSAQILQPAKTLPSLSDFISLLKTSTTFSQAAIVAFFSNLADVGLHASMMYY  268

Query  25   LKAAFGFD  2
            LKA F F+
Sbjct  269  LKAQFHFN  276



>ref|XP_004953398.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Setaria 
italica]
Length=451

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/259 (32%), Positives = 126/259 (49%), Gaps = 34/259 (13%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             A+C G+  CS + Y++G Q+ V GV  +VV P +G LSD YGRK L+ L  +  I+P  
Sbjct  33   EAVCPGRDECSVAIYLSGFQNAVTGVGALVVTPIVGNLSDRYGRKALMTLPVTMAIVPLF  92

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N+S  + Y YYV + +S I  +G++ C+  AY AD V  + RA AF  ++G+ +A 
Sbjct  93   VLACNRSEVYFYVYYVAKIVSGIFCEGTMHCLCFAYVADHVGPSRRAAAFGLLSGVSAAG  152

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVET---------------------  221
             + G L +RFL    +  Q A  +     LY+ + L ++                     
Sbjct  153  FLSGTLTARFLTTS-STFQVAAAVATAAALYLRVFLPDSGGTSCVDEACDPLLQPSSCTS  211

Query  220  ------VTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLG  59
                   + D  +   LP P K           V   + ++  S TL  A  ++FFY LG
Sbjct  212  STSSSASSSDEELSPRLPPPQK------GGLPSVSDMVALLTGSLTLSGAATITFFYSLG  265

Query  58   ISGIDSVLPHYLKAAFGFD  2
              G+ + L +YLKA FG+ 
Sbjct  266  EHGLQTALLYYLKAQFGYS  284



>ref|XP_004161094.1| PREDICTED: uncharacterized protein LOC101225919 [Cucumis sativus]
Length=810

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 130/245 (53%), Gaps = 17/245 (7%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC GQ  CS + Y+ G QH V+G+  ++++P LG LSD  GRK LL +    T++P  
Sbjct  34   SALCPGQDECSLAIYLTGFQHAVMGIGALLMMPLLGNLSDKLGRKTLLTIPMILTVVPLG  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L   +SR   Y Y+V++ ++ I+ +GS+ C+++AYAAD V E  RA+AF  ++ + S++
Sbjct  94   ILGYGRSRNLFYVYFVLKCVTSIVCEGSVQCLAVAYAADNVPEHRRASAFGLLSAVGSSA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTP---------DGGVEQSLP  185
             V G L +RFL    +  Q A        +YM + L ++V              VE    
Sbjct  154  FVCGTLCARFLSIS-STFQVAAFTAAVAVVYMKIFLADSVAECIISAPLLSGENVESVSS  212

Query  184  CPSKVKKFCREQCYC----VRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKA  17
             P  +K+   EQ       ++    ++  S T   A +V+FF  L   G+ + L +YLKA
Sbjct  213  DPVSLKE---EQIITTLPSIKDLFALLNISLTFSLAAIVAFFGNLADVGLYASLLYYLKA  269

Query  16   AFGFD  2
             F FD
Sbjct  270  RFHFD  274


 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 113/232 (49%), Gaps = 22/232 (9%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC  Q  CS   Y  G Q  V G+  ++++P LG LSD +GRK +L +     IIP  
Sbjct  436  SALCPDQDECSLVIYFTGFQQVVTGIGALLMMPLLGNLSDRFGRKTVLTIPLVLNIIPLG  495

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L   +SR   Y Y+V + ++ I+ +GS+ C+++AYAAD V E  RA+AF  ++   +++
Sbjct  496  ILGYGRSRELFYIYFVFKCVTSIVCEGSVQCLAVAYAADNVPEHRRASAFGILSATIASA  555

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V GNL +RFL    +  QAA        +YM + L ++                     
Sbjct  556  SVCGNLCARFLSIS-STFQAAASTAAMAAVYMRVFLTDSA--------------------  594

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
               C      L    +S T     +V+FF  L   G  + + +YLKA F FD
Sbjct  595  -PNCNLSAPLLSGENTSSTFSQVAVVAFFSNLADVGHHASIMYYLKAKFHFD  645



>ref|XP_010315397.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X3 [Solanum lycopersicum]
Length=355

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 127/232 (55%), Gaps = 4/232 (2%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C  Q  CS + Y++G Q  ++G+  M+++P +G LSD YGRK LL +  +  I P V
Sbjct  34   DAICPSQDKCSLAIYLSGFQQAIIGLGSMLMMPLIGNLSDVYGRKTLLTIPVTLLIFPSV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            ++A  ++  + YAYYVM+T++ ++S   I CISIAYAAD + E NRA+A + + G+ SA+
Sbjct  94   IMAYRRTTNYFYAYYVMRTLTGMLSDTGIQCISIAYAADCMSEENRASAIATLAGVGSAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             +  N   RFL     I   +        LYM + L + +     + QS+    +     
Sbjct  154  FLCSNFVVRFLSTA-QIFLVSSISSSAALLYMTIFLKDNINNYDALNQSILANHQSD---  209

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   V   + ++ +S TL  A L+S  Y LG  GI S   ++L+A F ++
Sbjct  210  HSEGTTVHQIINLLNTSTTLLLATLISILYGLGEGGIQSPFLYFLRARFQYN  261



>ref|XP_003570066.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Brachypodium 
distachyon]
Length=458

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/271 (30%), Positives = 125/271 (46%), Gaps = 53/271 (20%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             A+C G+  CS + Y++G Q+ + G+  +VV P +G LSD YGRK L+ L  +  I+P  
Sbjct  34   EAVCPGRDECSVAIYLSGFQNAITGLGALVVTPVVGNLSDRYGRKALMTLPVTVAILPLF  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N+S  + Y YYV + ++ I  +GS+ C+S+AY AD V    RA AF  ++G+ +A 
Sbjct  94   ILACNRSEAYFYVYYVAKIVAGIFCEGSMHCLSLAYVADQVGTRRRAAAFGLLSGVSAAG  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             V G L +RFL    +  Q A  +     +Y+         PD G        S V  F 
Sbjct  154  FVSGTLTARFLPTS-STFQVAAAVATAGAIYL-----RAFVPDSG--------SAVSSFG  199

Query  157  REQCYC---------------------------------------VRTTLEVVVSSPTLK  95
             ++  C                                       +   + ++  S TL 
Sbjct  200  DDEASCDPLLQDSSSCSCSSATSSSTSSDGELSPRLPPYKGLLPSLPDMVALLTGSLTLS  259

Query  94   CACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
             A  ++FFY LG  G+ + L +YLKA FG+ 
Sbjct  260  AAATITFFYSLGEHGLQTALLYYLKAQFGYS  290



>ref|XP_004231065.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Solanum lycopersicum]
Length=375

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 127/232 (55%), Gaps = 4/232 (2%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C  Q  CS + Y++G Q  ++G+  M+++P +G LSD YGRK LL +  +  I P V
Sbjct  34   DAICPSQDKCSLAIYLSGFQQAIIGLGSMLMMPLIGNLSDVYGRKTLLTIPVTLLIFPSV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            ++A  ++  + YAYYVM+T++ ++S   I CISIAYAAD + E NRA+A + + G+ SA+
Sbjct  94   IMAYRRTTNYFYAYYVMRTLTGMLSDTGIQCISIAYAADCMSEENRASAIATLAGVGSAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             +  N   RFL     I   +        LYM + L + +     + QS+    +     
Sbjct  154  FLCSNFVVRFLSTA-QIFLVSSISSSAALLYMTIFLKDNINNYDALNQSILANHQSD---  209

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   V   + ++ +S TL  A L+S  Y LG  GI S   ++L+A F ++
Sbjct  210  HSEGTTVHQIINLLNTSTTLLLATLISILYGLGEGGIQSPFLYFLRARFQYN  261



>ref|XP_010315396.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Solanum lycopersicum]
Length=364

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 127/232 (55%), Gaps = 4/232 (2%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +A+C  Q  CS + Y++G Q  ++G+  M+++P +G LSD YGRK LL +  +  I P V
Sbjct  34   DAICPSQDKCSLAIYLSGFQQAIIGLGSMLMMPLIGNLSDVYGRKTLLTIPVTLLIFPSV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            ++A  ++  + YAYYVM+T++ ++S   I CISIAYAAD + E NRA+A + + G+ SA+
Sbjct  94   IMAYRRTTNYFYAYYVMRTLTGMLSDTGIQCISIAYAADCMSEENRASAIATLAGVGSAA  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFC  158
             +  N   RFL     I   +        LYM + L + +     + QS+    +     
Sbjct  154  FLCSNFVVRFLSTA-QIFLVSSISSSAALLYMTIFLKDNINNYDALNQSILANHQSD---  209

Query  157  REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
              +   V   + ++ +S TL  A L+S  Y LG  GI S   ++L+A F ++
Sbjct  210  HSEGTTVHQIINLLNTSTTLLLATLISILYGLGEGGIQSPFLYFLRARFQYN  261



>ref|XP_004500907.1| PREDICTED: hippocampus abundant transcript-like protein 1-like 
isoform X2 [Cicer arietinum]
Length=453

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/262 (33%), Positives = 133/262 (51%), Gaps = 33/262 (13%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTV------------------VGVLKMVVVPFLGQLSDDYG  569
            ALC GQ  CS + Y+ G Q  V                  +GV  +V++P LG LSD YG
Sbjct  37   ALCPGQDECSIAIYLTGFQQAVIITFINISIIQIFTKLHIIGVGTLVMMPLLGNLSDKYG  96

Query  568  RKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDE  389
            RK +L +  S  IIP  +LA ++++ F Y YYV + +  +I  G + C+++AY AD V E
Sbjct  97   RKAILTVPMSLMIIPLGILAYSRTKTFFYIYYVFKILINMICDGCVPCLALAYVADNVPE  156

Query  388  TNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPD  209
              R++AF  ++G+ S++ V G LA+RFL       Q +  + +   +YM + L ++V  D
Sbjct  157  GRRSSAFGILSGIGSSAFVCGTLAARFL-STAQTFQVSTFVAVIGAVYMQIFLRDSVI-D  214

Query  208  GG-------VEQSLPCPSKV--KKFCREQCYCVRTTLEVVV----SSPTLKCACLVSFFY  68
            G        + +  P  SK+  K     Q      +L+ +     SS T+  A +V+FF 
Sbjct  215  GNHRLCTPIISEGEPSTSKIIAKSKSNMQLLNALRSLQDLTSFLNSSLTITQAAIVAFFS  274

Query  67   QLGISGIDSVLPHYLKAAFGFD  2
             L   G+   + +YLKA F FD
Sbjct  275  NLADVGLHGSMMYYLKARFHFD  296



>gb|EYU17555.1| hypothetical protein MIMGU_mgv1a006533mg [Erythranthe guttata]
Length=440

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 133/240 (55%), Gaps = 10/240 (4%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+  CS + Y+ G Q  ++G+  +VV+P +G LSD YGRK +L +  + +I P V
Sbjct  34   TALCPGKDECSLAIYLTGAQQAIIGLGSLVVMPLVGNLSDTYGRKVMLTVPMTLSIFPLV  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA  +++ + YAYYV +T+  + S+GS+  +++AY AD V E  RA  F  ++G  S+S
Sbjct  94   ILAYRRTKYYFYAYYVFKTLISMASEGSVQFLALAYVADNVPEGKRAAVFGIMSGFSSSS  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSL--------PC  182
             V GN ++RFL       Q A  + +    YM + L E++  +    +S           
Sbjct  154  FVFGNFSTRFLSTSAT-FQVAAAMSVIALFYMRVFLPESMMSNTNCTKSTEETVCLLEKA  212

Query  181  PSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            PSK K    +    +  T+ ++ +SPT   A +V+FF  +G  G+ + L +YLKA F F+
Sbjct  213  PSK-KWNLFDTLPSMDDTICLLKTSPTFSKAAVVAFFINVGDVGLHASLMYYLKAQFHFN  271



>ref|XP_009124111.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X2 [Brassica rapa]
Length=434

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 120/229 (52%), Gaps = 13/229 (6%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G   CS + Y++G Q  + GV  ++++P +G LSD +GRK LL L  +  I+P  +
Sbjct  38   ALCPGTDECSLAIYLSGFQQAITGVGSLMMMPLVGSLSDKHGRKSLLTLPMALNILPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV++T + I  +GS+FC+++AY AD V E +RA+AF  +TG+ S + 
Sbjct  98   LAYSRETSVFYIYYVLKTFTSIFCEGSVFCLALAYVADNVSENHRASAFGILTGIGSCAF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V  N  +RFL       Q A  + IF  +YM + L +++  D  +  S+    K+     
Sbjct  158  VCANCCARFLSTTAT-FQVATTVAIFSTVYMRIFLPDSIR-DNSLVTSIVSTEKLSYVLL  215

Query  154  EQ-----------CYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDS  41
            E               VR    ++ SS  L    +VSFF  L  +G+ +
Sbjct  216  EDYPAHRNQISRTLRSVREMASLMRSSVPLFQVAMVSFFSSLSEAGLHA  264



>ref|XP_002865555.1| hypothetical protein ARALYDRAFT_331182 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41814.1| hypothetical protein ARALYDRAFT_331182 [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 131/244 (54%), Gaps = 16/244 (7%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y++G Q  + GV  ++++P +G LSD +GRK LL L  +  I+P   
Sbjct  38   ALCPGKDECSLAIYLSGFQQVITGVGSLMMMPLMGSLSDKHGRKCLLTLPMTLHILPLAT  97

Query  514  LAINKSRG--FVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSA  341
            LA + +RG    Y YYV++T + I+ +G++FC+++AY AD V E  R +AF+ +TG+ S 
Sbjct  98   LAYS-TRGTTIFYMYYVLKTSTSIVCEGTVFCLALAYVADNVSERRRGSAFAILTGITSC  156

Query  340  SHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDG-----GVEQSLP---  185
            + V  NL +RFL       Q A  + I   LYM L L +++  +       + ++L    
Sbjct  157  AFVCANLCARFL-SIAATYQVATGMGILSLLYMRLFLPDSIRDNSLGAPIVISETLSSSL  215

Query  184  ---CPSKVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAA  14
               CP    +  R   + VR    ++ SS       +VSF   L  +G+ +   +YLKA 
Sbjct  216  LEDCPGHRNRIFRA-IHSVREMASLLRSSVPFFQVAMVSFCSSLAEAGLHASSMYYLKAK  274

Query  13   FGFD  2
            F F+
Sbjct  275  FHFN  278



>ref|XP_002454504.1| hypothetical protein SORBIDRAFT_04g032320 [Sorghum bicolor]
 gb|EES07480.1| hypothetical protein SORBIDRAFT_04g032320 [Sorghum bicolor]
Length=447

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 126/253 (50%), Gaps = 27/253 (11%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             A+C G+  CS + Y+ G Q+ V G+  +VV P +G LSD YGRK L+ L  +  + P  
Sbjct  34   EAVCPGRDECSVAIYLTGFQNAVTGLGALVVTPIVGNLSDRYGRKALMTLPVTVAVAPLF  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA N+S  + Y YYV + I+ I  +G++ C+ +AY AD V    RA AF  ++G+ +A 
Sbjct  94   ILACNRSEVYFYVYYVAKIIAGIFCEGTMHCLCLAYVADHVGPRRRAAAFGLLSGVSAAG  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPD-GGVE-QSLPCPSKVKK  164
             V G L +RFL    +  Q A  + +   LY+   L     PD GGV      C   ++ 
Sbjct  154  FVSGTLTARFL-PTASTFQVAAAVAVASALYLRAFL-----PDAGGVSCADEACDPLLQD  207

Query  163  FC-------------------REQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDS  41
                                 +     +   + ++ SS  L  A +V+FFY LG  G+++
Sbjct  208  SSCTSSASSSDEELSPRLPPHKSGLPSLSDMVALLTSSLALSGAAVVTFFYSLGEHGLNT  267

Query  40   VLPHYLKAAFGFD  2
             L +YLKA FG+ 
Sbjct  268  ALLYYLKAQFGYS  280



>ref|XP_003603840.1| Hippocampus abundant transcript-like protein [Medicago truncatula]
Length=454

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/262 (31%), Positives = 131/262 (50%), Gaps = 32/262 (12%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQH--------------------TVVGVLKMVVVPFLGQLSDD  575
            ALC GQ  CS + Y+ G Q                     T++G+  +V++P LG LSD 
Sbjct  37   ALCPGQDECSIAIYLTGFQQAVRYIVSPIYLNILHSFSKLTMIGMGTLVMMPILGDLSDK  96

Query  574  YGRKPlllltsstTIIPFVLLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVV  395
            YGRK +L L  +  IIP  +LA ++++ F Y YYV + I  +I  G + C+++AY AD V
Sbjct  97   YGRKAILTLPMTLMIIPLGILAYSRTKTFFYVYYVFKIIINMICDGCVPCLALAYVADNV  156

Query  394  DETNRATAFSWITGLFSASHVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVT  215
             E  R++AF  ++G+ S++ V G +A+RFL       Q +  + +   +YM + L ++V 
Sbjct  157  PEGRRSSAFGVLSGIGSSAFVCGTVAARFLSAA-QTFQVSTFVAVLGAVYMQIFLRDSVA  215

Query  214  PDGG-----VEQSLPCPSKVKKFCR------EQCYCVRTTLEVVVSSPTLKCACLVSFFY  68
             +       + Q  P  +K+    +      +    +R     + SS  +  A +V+FF 
Sbjct  216  DENQLYTPIISQGKPPIAKINGKSKANMPLLKALSSLRDITSFLNSSKIITQASIVAFFS  275

Query  67   QLGISGIDSVLPHYLKAAFGFD  2
             L   G+   + +YLKA F FD
Sbjct  276  NLADVGLHGSMMYYLKARFHFD  297



>dbj|BAF00568.1| hypothetical protein [Arabidopsis thaliana]
Length=184

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC G+  CS + Y++G Q  + GV  ++++P +G LSD +GRK LL L  +  I+P V 
Sbjct  38   ALCPGKDECSLAIYLSGFQQVITGVGSLIMMPLVGSLSDKHGRKCLLTLPMTLNILPLVT  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++     Y YYV++T++ I+ +GS+ C+++AY AD V E  RA+AF  +TG+ S + 
Sbjct  98   LAYSRGATIFYMYYVLKTLTSIVCEGSVLCLALAYVADNVPEGRRASAFGILTGITSCAF  157

Query  334  VLGNLASRFL  305
            V  NL++RFL
Sbjct  158  VCANLSARFL  167



>ref|XP_008387898.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Malus 
domestica]
Length=445

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 134/248 (54%), Gaps = 22/248 (9%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y+ G Q  +VG+  +V++P +G LSD  GRK LL L   +TIIP  
Sbjct  35   SALCPGRDECSIAIYLTGFQQAIVGLGTLVMMPLVGNLSDKCGRKALLTLPMISTIIPLG  94

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +L  ++S+ F Y Y+ ++T++ ++ +GS+ C+++AY AD V E  RA+ F  ++G+ S++
Sbjct  95   ILGYSRSKSFFYVYFAVKTLTAMLCEGSVQCLALAYVADNVAEGRRASTFGVLSGISSSA  154

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP----SKV  170
             V G L +RF+    +  Q A  + +   +YM + L     PD   + +L  P     K+
Sbjct  155  FVCGTLFTRFVSTS-SAFQVATVVAVVAVMYMRVFL-----PDSNRDNNLSAPLLSDEKI  208

Query  169  K-----KFCREQCYCVRTTL-------EVVVSSPTLKCACLVSFFYQLGISGIDSVLPHY  26
            K     +    Q      TL        ++ +S T   A +V+FF  L   G+ + + ++
Sbjct  209  KIKDSAESSSAQILQPAKTLPSLSDFISLLKTSTTFSQAAIVAFFSNLADVGLHASMMYF  268

Query  25   LKAAFGFD  2
            LKA F F+
Sbjct  269  LKARFHFN  276



>ref|XP_009617454.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X3 [Nicotiana tomentosiformis]
Length=355

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 127/242 (52%), Gaps = 15/242 (6%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  ++++P +G L D YGRK LL +  + +IIP V+
Sbjct  35   ALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLCDVYGRKALLTIPVTLSIIPPVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  ++  F Y YYV++T++ +I  G I C+++AY AD +    RA+A   + G+ SA+ 
Sbjct  95   LAYRRTNNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGVGSAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQ----------SLP  185
            V G LA  FL      L AA+   +   +YM + L +T   +  +EQ           L 
Sbjct  155  VCGTLADHFLSTSQIFLVAAIASTV-ASVYMQIFLEDTACFEDSIEQPILKSEMENDELD  213

Query  184  CPSK--VKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
            C +   +K F  ++   ++  +  +  S T   A  V+F   +   G  +   ++LKA F
Sbjct  214  CETAKIIKVF--KKVPSLKDIICFLKKSATFSLAASVAFLNSVAEGGEQAPFQYFLKARF  271

Query  10   GF  5
             F
Sbjct  272  HF  273



>gb|EPS73404.1| hypothetical protein M569_01349 [Genlisea aurea]
Length=427

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 134/231 (58%), Gaps = 2/231 (1%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            A+C G+  CS + Y+ G    ++G+  +VV+P +G LSD +GRK +L +  + +++P  +
Sbjct  38   AICPGKDECSLAIYLTGAHQVIIGLGSIVVMPLVGILSDSHGRKSMLTIPMALSVLPLAI  97

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA N+++ + YAY+ ++T+  + ++GS+  +++AY AD V E+ RA  F  ++G+ S+S 
Sbjct  98   LAYNRTKYYYYAYFALRTLIAMATEGSVQFLALAYVADNVSESKRAGVFGMMSGIASSSF  157

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            VLGN +SRFL    +  Q A  + +   +YM L L ++  P+   E +    SK      
Sbjct  158  VLGNFSSRFL-STASTFQVAAVMSVVALVYMRLFLPDS-NPNPRDESNTRLLSKNATRNF  215

Query  154  EQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            +  + ++ ++ ++ +S T   A  V+FF  +  +G  S   ++LKA F F+
Sbjct  216  KVLHLLQDSISLLRTSRTFAKAAAVAFFINVSENGFSSSAFYFLKAEFHFN  266



>ref|XP_010327393.1| PREDICTED: uncharacterized protein LOC101267067 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327394.1| PREDICTED: uncharacterized protein LOC101267067 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327395.1| PREDICTED: uncharacterized protein LOC101267067 isoform X1 [Solanum 
lycopersicum]
Length=473

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 87/273 (32%), Positives = 135/273 (49%), Gaps = 45/273 (16%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC  Q  CS + Y++G Q  ++G+  M+++P LG LSD YGRK LL +  + +IIP V
Sbjct  36   GALCPSQDECSLAIYLSGFQQAILGLGSMMMLPLLGHLSDIYGRKALLTVPVAASIIPSV  95

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LAI +S  + YAYY ++T + ++S   I C+SIAYAA  + E  R +A  ++ G+ SA+
Sbjct  96   ILAIGRSTNYFYAYYAVKTFTGMVSDNGIECLSIAYAAANISEEKRVSAIGFVAGIGSAA  155

Query  337  HVLGNLASRFLHED-------------------YNILQ----------AALCLLIFVPLY  245
             +LG +A+RFL                      + +L           AAL  +I   +Y
Sbjct  156  SLLGTMAARFLSTAQIFLVPFFSLNNFHFYLLLFGLLSCVRFHCVSKVAALSSMI-ATIY  214

Query  244  MALHLVET------------VTPDGGVEQSLPCPSKVKKFCREQCYCVRTTLEVVVSSPT  101
            M + + ET            +  D G E S    SK      +Q   ++    ++ SS T
Sbjct  215  MRIFVKETTGRSDSETLNQPILIDNGAECS---KSKSVSQSFKQVLPLKDIFCLLRSSVT  271

Query  100  LKCACLVSFFYQLGISGIDSVLPHYLKAAFGFD  2
            L  A +V+F   LG  G  +   ++LKA   F+
Sbjct  272  LSLATVVAFLNGLGEGGQQTPYLYFLKARLRFN  304



>emb|CAN70291.1| hypothetical protein VITISV_019346 [Vitis vinifera]
Length=494

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC G+  CS + Y++G Q  ++G+  +V+ P +G LSD+YGRK LL +  + +IIP  
Sbjct  34   SALCPGKDECSLAIYLSGFQQAIIGLGTVVMTPVIGNLSDEYGRKALLTIPMALSIIPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA +++    YAY+V++T++ ++ +GSI C+++AY AD + E  RA+AF  ++G+ SA+
Sbjct  94   ILAYSRTTTSFYAYFVIRTLTAMVGEGSINCLALAYVADNISEGQRASAFGVLSGVASAA  153

Query  337  HVLGNLASRFL  305
             V G LA+RFL
Sbjct  154  FVCGTLAARFL  164



>gb|KHN37382.1| Hippocampus abundant transcript 1 protein [Glycine soja]
Length=424

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 124/243 (51%), Gaps = 35/243 (14%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  + GV  +V+ P +G LSD YGRK LL L  + ++IP V+
Sbjct  35   ALCPGQDQCSLAIYLSGFQQAMAGVGSVVMTPLIGNLSDRYGRKALLTLPLTVSVIPQVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA ++   F YAYYV++                   AD V +  R +AF  + G+ SAS 
Sbjct  95   LAYSRDTQFFYAYYVVK-------------------ADKVPDGKRTSAFGILAGVGSASF  135

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCPSKVKKFCR  155
            V G LA+RFL       Q A  L +   +YM + L ++V P G + Q  P    V++ C 
Sbjct  136  VGGTLAARFLSTALT-FQVASVLSMVALVYMRIFLKDSV-PGGAIRQ--PLLKVVEESCA  191

Query  154  EQCYCVRT--TLEVVVS----------SPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
            E     ++  T + + S          SPT   A +VSFF  L   G+ +VL +YLKA F
Sbjct  192  EDDSTPKSAGTFKKLPSLGDFICLLKCSPTFSQAAIVSFFNSLADGGLMAVLLYYLKARF  251

Query  10   GFD  2
             F+
Sbjct  252  QFN  254



>ref|XP_010918152.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Elaeis guineensis]
Length=445

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 129/250 (52%), Gaps = 24/250 (10%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
             ALC G+  CS + Y++GLQ  + G+  ++V P +G LSD YGRK LL L     IIP  
Sbjct  34   EALCPGRVQCSLAVYLSGLQQVITGLGTLIVTPLIGNLSDRYGRKALLTLPMIIAIIPLA  93

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            +LA ++SR + YAYYV++  + +  +GS+ C+S+AY AD V E  RA AF   +G+  A 
Sbjct  94   ILAYDRSRAYFYAYYVIKMFTGMFCEGSMQCLSLAYVADKVGERRRAAAFGVFSGVSCAG  153

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVET-----VTPDGGVEQSLPC---  182
             V G +A+RFL    +  Q +  + +    YM L LVET        +   E SLP    
Sbjct  154  FVSGTVAARFLSTS-STFQVSATVAVIAAAYMRLFLVETDRGAAGGGEEEEEASLPLCSS  212

Query  181  --------PS--KVKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLP  32
                    P    ++KF       +   + ++ SS TL  A +V FF     SG+   L 
Sbjct  213  SSSDSGSSPKLPALRKFPS-----LEDMIGLLRSSLTLSRAAVVVFFNSFAESGVQCALL  267

Query  31   HYLKAAFGFD  2
            ++LKA F F 
Sbjct  268  YFLKAQFQFS  277



>ref|XP_009617452.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X1 [Nicotiana tomentosiformis]
Length=436

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/243 (32%), Positives = 127/243 (52%), Gaps = 15/243 (6%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  ++++P +G L D YGRK LL +  + +IIP V+
Sbjct  35   ALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLCDVYGRKALLTIPVTLSIIPPVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  ++  F Y YYV++T++ +I  G I C+++AY AD +    RA+A   + G+ SA+ 
Sbjct  95   LAYRRTNNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGVGSAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQ----------SLP  185
            V G LA  FL      L AA+   +   +YM + L +T   +  +EQ           L 
Sbjct  155  VCGTLADHFLSTSQIFLVAAIASTV-ASVYMQIFLEDTACFEDSIEQPILKSEMENDELD  213

Query  184  CPSK--VKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
            C +   +K F  ++   ++  +  +  S T   A  V+F   +   G  +   ++LKA F
Sbjct  214  CETAKIIKVF--KKVPSLKDIICFLKKSATFSLAASVAFLNSVAEGGEQAPFQYFLKARF  271

Query  10   GFD  2
             F 
Sbjct  272  HFK  274



>ref|XP_009617453.1| PREDICTED: hippocampus abundant transcript 1 protein-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/243 (32%), Positives = 127/243 (52%), Gaps = 15/243 (6%)
 Frame = -2

Query  694  ALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFVL  515
            ALC GQ  CS + Y++G Q  ++G+  ++++P +G L D YGRK LL +  + +IIP V+
Sbjct  35   ALCPGQDQCSLAIYLSGFQQAIIGIGLVLMMPIIGNLCDVYGRKALLTIPVTLSIIPPVI  94

Query  514  LAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSASH  335
            LA  ++  F Y YYV++T++ +I  G I C+++AY AD +    RA+A   + G+ SA+ 
Sbjct  95   LAYRRTNNFYYVYYVLRTLTGMICDGGIQCVALAYVADNMSRAKRASAIGILAGVGSAAF  154

Query  334  VLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQ----------SLP  185
            V G LA  FL      L AA+   +   +YM + L +T   +  +EQ           L 
Sbjct  155  VCGTLADHFLSTSQIFLVAAIASTV-ASVYMQIFLEDTACFEDSIEQPILKSEMENDELD  213

Query  184  CPSK--VKKFCREQCYCVRTTLEVVVSSPTLKCACLVSFFYQLGISGIDSVLPHYLKAAF  11
            C +   +K F  ++   ++  +  +  S T   A  V+F   +   G  +   ++LKA F
Sbjct  214  CETAKIIKVF--KKVPSLKDIICFLKKSATFSLAASVAFLNSVAEGGEQAPFQYFLKARF  271

Query  10   GFD  2
             F 
Sbjct  272  HFK  274



>ref|XP_009588092.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform 
X1 [Nicotiana tomentosiformis]
Length=457

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 134/263 (51%), Gaps = 36/263 (14%)
 Frame = -2

Query  697  NALCDGQSSCSQSTYINGLQHTVVGVLKMVVVPFLGQLSDDYGRKPlllltsstTIIPFV  518
            +ALC  Q  CS + Y++GLQ  ++G+  M+++P +G LSD YGRK LL++  + +I+P V
Sbjct  35   DALCPSQDKCSLAIYLSGLQQAIMGLGSMLMMPLIGNLSDVYGRKALLIVPVTASILPSV  94

Query  517  LLAINKSRGFVYAYYVMQTISYIISQGSIFCISIAYAADVVDETNRATAFSWITGLFSAS  338
            ++A  ++  + YAYYV++T++ ++S   I C+ IAYAAD + E  RA+A   + G+ SA+
Sbjct  95   IMAYKRTTNYFYAYYVVRTLTGMLSDTGIQCLPIAYAADCISEEKRASAIGVVAGVGSAA  154

Query  337  HVLGNLASRFLHEDYNILQAALCLLIFVPLYMALHLVETVTPDGGVEQSLPCP-------  179
            +  G  A RFL      L +++       +YM + L ET       E +L  P       
Sbjct  155  YFCGTFAVRFLSTAQIFLVSSISSTA-AAVYMTIFLKETTRHINIDEDALNQPILANGAD  213

Query  178  -----SKVKKFC-------------------REQCYCVRTTLEVVVSSPTLKCACLVSFF  71
                 S  K+                     R+Q  C    + V VS+ TL  A L++F 
Sbjct  214  DSESDSSEKRLSPKNIPSFYHIISLLKSRVYRKQSLC---PIGVEVST-TLSLATLIAFL  269

Query  70   YQLGISGIDSVLPHYLKAAFGFD  2
              L   GI +   ++L+A F ++
Sbjct  270  NGLAEGGIQTPFMYFLRARFQYN  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1092032152992