BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20345_g1_i3 len=1704 path=[1:0-475 477:476-499 5404:500-1703]

Length=1704
                                                                      Score     E

ref|XP_004228675.1|  PREDICTED: syntaxin-121-like                       442   1e-148   
ref|XP_009763025.1|  PREDICTED: syntaxin-121                            439   1e-147   
ref|XP_009593833.1|  PREDICTED: syntaxin-121-like                       439   2e-147   
ref|XP_006348450.1|  PREDICTED: syntaxin-121-like                       434   2e-145   
emb|CDP10588.1|  unnamed protein product                                432   1e-144   
ref|XP_009613977.1|  PREDICTED: syntaxin-121-like                       428   7e-143   
ref|XP_011094239.1|  PREDICTED: syntaxin-121                            424   1e-141   
ref|XP_004249403.1|  PREDICTED: syntaxin-121-like                       422   9e-141   
gb|EYU18107.1|  hypothetical protein MIMGU_mgv1a019805mg                421   5e-140   
ref|XP_006339172.1|  PREDICTED: syntaxin-121-like                       415   4e-138   
ref|XP_007028001.1|  Syntaxin of plants 121                             407   1e-134   
gb|KDP36101.1|  hypothetical protein JCGZ_08745                         407   1e-134   
ref|XP_010106987.1|  hypothetical protein L484_016916                   406   3e-134   
ref|XP_002524068.1|  syntaxin, putative                                 404   9e-134   Ricinus communis
gb|KHG08581.1|  Syntaxin-121 protein                                    400   9e-132   
ref|XP_002323377.2|  syntaxin 121 family protein                        399   1e-131   Populus trichocarpa [western balsam poplar]
ref|XP_011042574.1|  PREDICTED: syntaxin-121                            398   1e-131   
ref|XP_006481612.1|  PREDICTED: syntaxin-121-like                       399   3e-131   
ref|XP_006430049.1|  hypothetical protein CICLE_v10012164mg             398   4e-131   
ref|XP_002308326.1|  syntaxin 121 family protein                        395   3e-130   Populus trichocarpa [western balsam poplar]
ref|XP_008442928.1|  PREDICTED: syntaxin-121                            394   7e-130   
ref|XP_011046431.1|  PREDICTED: syntaxin-121-like                       393   2e-129   
gb|KHG08886.1|  Syntaxin-121 protein                                    394   2e-129   
ref|XP_004136519.1|  PREDICTED: syntaxin-121-like                       390   2e-128   
ref|XP_004170661.1|  PREDICTED: syntaxin-121-like                       389   4e-128   
ref|XP_008241070.1|  PREDICTED: syntaxin-121                            389   9e-128   
ref|XP_007202232.1|  hypothetical protein PRUPE_ppa008664mg             388   3e-127   
ref|XP_009343258.1|  PREDICTED: syntaxin-121-like                       388   3e-127   
ref|XP_008387116.1|  PREDICTED: syntaxin-121                            387   1e-126   
ref|XP_004303410.1|  PREDICTED: syntaxin-121-like                       386   1e-126   
gb|EPS62344.1|  hypothetical protein M569_12449                         385   2e-126   
ref|XP_009348873.1|  PREDICTED: syntaxin-121-like                       385   3e-126   
ref|XP_010543863.1|  PREDICTED: syntaxin-121-like                       385   9e-126   
ref|XP_010058995.1|  PREDICTED: syntaxin-121                            382   2e-125   
ref|XP_002263986.1|  PREDICTED: syntaxin-121                            383   2e-125   Vitis vinifera
ref|XP_008391982.1|  PREDICTED: syntaxin-121-like                       382   4e-125   
ref|XP_010036588.1|  PREDICTED: syntaxin-121                            383   4e-125   
ref|XP_007203038.1|  hypothetical protein PRUPE_ppa022754mg             380   2e-124   
ref|XP_002884867.1|  SYP121                                             379   2e-123   
ref|XP_009348866.1|  PREDICTED: syntaxin-121-like                       375   2e-122   
ref|XP_010247567.1|  PREDICTED: syntaxin-121                            376   2e-122   
gb|AAU04512.1|  PEN1                                                    372   4e-122   Solanum tuberosum [potatoes]
ref|XP_004303419.1|  PREDICTED: syntaxin-121-like                       374   5e-122   
ref|XP_003590328.1|  Syntaxin-121                                       374   5e-122   
ref|XP_004497646.1|  PREDICTED: syntaxin-121-like                       375   6e-122   
gb|EYU38684.1|  hypothetical protein MIMGU_mgv1a010962mg                373   7e-122   
ref|XP_008241071.1|  PREDICTED: syntaxin-121-like                       372   1e-121   
gb|KFK38547.1|  hypothetical protein AALP_AA3G128100                    374   1e-121   
ref|XP_003519111.1|  PREDICTED: syntaxin-121-like                       372   2e-121   
ref|XP_010464886.1|  PREDICTED: syntaxin-121-like isoform X1            373   5e-121   
ref|XP_010498135.1|  PREDICTED: syntaxin-121-like isoform X1            372   1e-120   
ref|XP_006407406.1|  hypothetical protein EUTSA_v10021072mg             372   1e-120   
ref|XP_003519112.1|  PREDICTED: syntaxin-121-like                       372   1e-120   
gb|AFK46658.1|  unknown                                                 370   1e-120   
ref|XP_010486844.1|  PREDICTED: syntaxin-121 isoform X1                 371   2e-120   
ref|XP_003535818.1|  PREDICTED: syntaxin-121-like isoform 1             369   4e-120   
ref|XP_008360602.1|  PREDICTED: syntaxin-121-like                       369   4e-120   
dbj|BAJ34618.1|  unnamed protein product                                370   5e-120   
ref|XP_010677545.1|  PREDICTED: syntaxin-121                            367   2e-119   
ref|XP_006298169.1|  hypothetical protein CARUB_v10014219mg             367   2e-119   
ref|XP_006403808.1|  hypothetical protein EUTSA_v10010514mg             368   4e-119   
ref|XP_006291445.1|  hypothetical protein CARUB_v10017581mg             366   2e-118   
ref|NP_974288.1|  syntaxin-121                                          364   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008350214.1|  PREDICTED: syntaxin-121-like                       363   3e-118   
ref|XP_009343257.1|  PREDICTED: syntaxin-121-like                       363   4e-118   
ref|XP_010464887.1|  PREDICTED: syntaxin-121-like isoform X2            364   6e-118   
emb|CDY01061.1|  BnaC05g41390D                                          364   7e-118   
ref|XP_010486845.1|  PREDICTED: syntaxin-121 isoform X2                 363   8e-118   
ref|XP_010498143.1|  PREDICTED: syntaxin-121-like isoform X2            363   1e-117   
ref|NP_187788.1|  syntaxin-121                                          364   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135186.1|  PREDICTED: syntaxin-121 isoform X2                 362   1e-117   
gb|KHN43702.1|  Syntaxin-121                                            361   3e-117   
emb|CDY70958.1|  BnaC03g73490D                                          362   5e-117   
ref|XP_009135185.1|  PREDICTED: syntaxin-121 isoform X1                 362   6e-117   
emb|CDX73851.1|  BnaA03g31960D                                          362   7e-117   
ref|XP_003590329.1|  Syntaxin-related protein Nt-syr1                   362   1e-116   
ref|XP_007145783.1|  hypothetical protein PHAVU_007G267300g             361   1e-116   
ref|XP_007145782.1|  hypothetical protein PHAVU_007G267200g             360   1e-116   
emb|CDY08492.1|  BnaA05g27280D                                          361   1e-116   
ref|XP_010503984.1|  PREDICTED: syntaxin-122-like                       361   1e-116   
emb|CDY29079.1|  BnaC07g32850D                                          360   3e-116   
ref|XP_003537119.1|  PREDICTED: syntaxin-121-like                       360   4e-116   
ref|XP_009139460.1|  PREDICTED: syntaxin-122                            359   8e-116   
ref|XP_010515701.1|  PREDICTED: syntaxin-122-like                       359   9e-116   
gb|KFK34487.1|  hypothetical protein AALP_AA5G152000                    358   1e-115   
ref|XP_010426857.1|  PREDICTED: syntaxin-122-like                       358   3e-115   
ref|XP_010263035.1|  PREDICTED: syntaxin-121-like                       354   3e-114   
emb|CDY23212.1|  BnaA04g05470D                                          355   6e-114   
gb|ACU19749.1|  unknown                                                 352   7e-114   Glycine max [soybeans]
emb|CDX90604.1|  BnaA03g41770D                                          353   1e-113   
ref|XP_009406699.1|  PREDICTED: syntaxin-121-like                       352   2e-113   
ref|XP_010476034.1|  PREDICTED: syntaxin-125                            344   2e-110   
ref|XP_003608218.1|  Syntaxin-124                                       343   7e-110   
ref|XP_010941596.1|  PREDICTED: syntaxin-121-like                       342   8e-110   
ref|XP_010458510.1|  PREDICTED: syntaxin-125-like                       342   9e-110   
ref|XP_010492556.1|  PREDICTED: syntaxin-125-like                       342   1e-109   
ref|XP_006837396.1|  hypothetical protein AMTR_s00111p00136390          342   1e-109   
ref|NP_172591.1|  syntaxin-125                                          342   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877861.1|  SYP122                                             343   2e-109   
emb|CAB52174.1|  syntaxin protein                                       342   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004143399.1|  PREDICTED: syntaxin-121-like                       341   3e-109   
gb|KFK43422.1|  hypothetical protein AALP_AA1G123800                    340   5e-109   
ref|XP_010278416.1|  PREDICTED: syntaxin-124-like                       340   5e-109   
ref|NP_190808.1|  syntaxin-122                                          342   5e-109   Arabidopsis thaliana [mouse-ear cress]
emb|CDY20986.1|  BnaA08g25390D                                          340   7e-109   
ref|XP_008787779.1|  PREDICTED: syntaxin-121-like                       340   9e-109   
ref|XP_006305987.1|  hypothetical protein CARUB_v10011255mg             340   9e-109   
emb|CDY34656.1|  BnaC08g42150D                                          339   1e-108   
ref|XP_006417375.1|  hypothetical protein EUTSA_v10008327mg             339   2e-108   
ref|XP_009118197.1|  PREDICTED: syntaxin-125-like                       338   2e-108   
gb|KGN48329.1|  hypothetical protein Csa_6G476690                       339   2e-108   
emb|CDY34843.1|  BnaA09g47690D                                          338   3e-108   
ref|XP_004505016.1|  PREDICTED: syntaxin-124-like                       338   3e-108   
ref|XP_008462624.1|  PREDICTED: syntaxin-121                            338   4e-108   
ref|XP_010515703.1|  PREDICTED: syntaxin-122-like isoform X2            338   5e-108   
emb|CDY19350.1|  BnaC05g08590D                                          337   6e-108   
ref|XP_009110738.1|  PREDICTED: syntaxin-125-like                       337   6e-108   
emb|CDY70107.1|  BnaAnng32640D                                          337   6e-108   
ref|XP_002889857.1|  SYP125                                             337   7e-108   
ref|XP_009148453.1|  PREDICTED: syntaxin-125                            337   7e-108   
ref|XP_002888093.1|  SYP124                                             337   8e-108   
ref|NP_176324.1|  syntaxin-124                                          337   8e-108   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28446.1|  unknown                                                 337   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392020.1|  hypothetical protein EUTSA_v10023607mg             337   1e-107   
gb|KEH24254.1|  syntaxin of plants 122 protein                          336   1e-107   
ref|XP_009602572.1|  PREDICTED: syntaxin-124-like                       337   2e-107   
ref|XP_003593444.1|  Syntaxin-124                                       337   2e-107   
ref|XP_004485712.1|  PREDICTED: syntaxin-124-like                       336   3e-107   
ref|XP_010473338.1|  PREDICTED: syntaxin-124-like isoform X2            335   4e-107   
ref|XP_002317241.1|  hypothetical protein POPTR_0011s04350g             335   4e-107   Populus trichocarpa [western balsam poplar]
ref|XP_010473337.1|  PREDICTED: syntaxin-124-like isoform X1            335   5e-107   
ref|XP_004248147.1|  PREDICTED: syntaxin-124-like                       335   5e-107   
ref|XP_010646969.1|  PREDICTED: syntaxin-124-like                       335   8e-107   
ref|XP_004494256.1|  PREDICTED: syntaxin-121-like                       334   8e-107   
emb|CBI23478.3|  unnamed protein product                                335   1e-106   
ref|XP_003543086.1|  PREDICTED: syntaxin-124-like                       334   1e-106   
ref|XP_010430146.1|  PREDICTED: syntaxin-124                            334   1e-106   
ref|XP_007025774.1|  Syntaxin of plants 124                             334   2e-106   
ref|XP_010533865.1|  PREDICTED: syntaxin-124                            333   2e-106   
ref|XP_007159259.1|  hypothetical protein PHAVU_002G222900g             333   4e-106   
gb|KHN00113.1|  Syntaxin-124                                            333   4e-106   
gb|KFK40720.1|  hypothetical protein AALP_AA2G032200                    333   5e-106   
ref|XP_010554816.1|  PREDICTED: syntaxin-122                            331   5e-106   
ref|XP_009146680.1|  PREDICTED: syntaxin-121-like                       333   6e-106   
ref|XP_002272992.1|  PREDICTED: syntaxin-124                            332   7e-106   Vitis vinifera
ref|XP_002305002.2|  syntaxin 125 family protein                        332   7e-106   Populus trichocarpa [western balsam poplar]
ref|XP_010052377.1|  PREDICTED: syntaxin-124-like                       332   8e-106   
ref|XP_004497645.1|  PREDICTED: syntaxin-121-like                       332   9e-106   
ref|XP_006366031.1|  PREDICTED: syntaxin-124-like                       332   9e-106   
ref|XP_002438619.1|  hypothetical protein SORBIDRAFT_10g022930          332   1e-105   Sorghum bicolor [broomcorn]
ref|XP_010925349.1|  PREDICTED: syntaxin-124                            332   1e-105   
ref|XP_006584927.1|  PREDICTED: syntaxin-124-like                       332   1e-105   
ref|XP_002466338.1|  hypothetical protein SORBIDRAFT_01g005900          332   1e-105   Sorghum bicolor [broomcorn]
ref|XP_004967209.1|  PREDICTED: syntaxin-124-like                       331   3e-105   
ref|XP_009782594.1|  PREDICTED: syntaxin-124-like                       331   3e-105   
ref|XP_009412504.1|  PREDICTED: syntaxin-121-like                       331   3e-105   
ref|XP_003545852.1|  PREDICTED: syntaxin-124-like                       330   5e-105   
ref|XP_011043281.1|  PREDICTED: syntaxin-124                            330   5e-105   
ref|XP_002521435.1|  syntaxin, putative                                 330   7e-105   Ricinus communis
ref|XP_006852126.1|  hypothetical protein AMTR_s00049p00050990          330   9e-105   
ref|XP_008649133.1|  PREDICTED: syntaxin-124-like                       330   1e-104   
ref|XP_010665520.1|  PREDICTED: syntaxin-125-like                       329   1e-104   
ref|XP_006351945.1|  PREDICTED: syntaxin-124-like                       329   1e-104   
ref|XP_007148239.1|  hypothetical protein PHAVU_006G191600g             329   1e-104   
ref|XP_008442020.1|  PREDICTED: syntaxin-124                            329   1e-104   
ref|XP_004146633.1|  PREDICTED: syntaxin-124-like                       329   2e-104   
ref|XP_011001123.1|  PREDICTED: syntaxin-124-like                       328   2e-104   
ref|XP_010557974.1|  PREDICTED: syntaxin-121-like                       330   2e-104   
ref|XP_011085365.1|  PREDICTED: syntaxin-125-like                       328   2e-104   
emb|CDP14712.1|  unnamed protein product                                328   2e-104   
gb|KDO75760.1|  hypothetical protein CISIN_1g036284mg                   327   3e-104   
ref|XP_004251500.1|  PREDICTED: syntaxin-124                            328   3e-104   
gb|KDP41779.1|  hypothetical protein JCGZ_26797                         327   3e-104   
ref|XP_009598377.1|  PREDICTED: syntaxin-124-like                       328   4e-104   
ref|XP_009381245.1|  PREDICTED: syntaxin-124-like                       327   7e-104   
ref|XP_010418104.1|  PREDICTED: syntaxin-124-like                       327   7e-104   
ref|XP_009801269.1|  PREDICTED: syntaxin-124-like                       327   1e-103   
ref|XP_008780342.1|  PREDICTED: syntaxin-124                            327   1e-103   
ref|XP_006449228.1|  hypothetical protein CICLE_v10016060mg             326   1e-103   
gb|KDO43783.1|  hypothetical protein CISIN_1g045802mg                   326   2e-103   
ref|XP_008659741.1|  PREDICTED: syntaxin-124-like                       326   3e-103   
ref|XP_010092626.1|  hypothetical protein L484_006388                   325   4e-103   
ref|XP_006467886.1|  PREDICTED: syntaxin-124-like                       325   7e-103   
ref|XP_006447372.1|  hypothetical protein CICLE_v10017913mg             324   7e-103   
ref|XP_004143398.1|  PREDICTED: syntaxin-121-like                       320   4e-102   
ref|XP_004981508.1|  PREDICTED: syntaxin-121-like                       322   6e-102   
gb|EYU26106.1|  hypothetical protein MIMGU_mgv1a027054mg                322   1e-101   
gb|KDP20894.1|  hypothetical protein JCGZ_21365                         321   2e-101   
ref|XP_010543067.1|  PREDICTED: syntaxin-123-like                       320   3e-101   
ref|NP_001051494.1|  Os03g0787000                                       321   3e-101   Oryza sativa Japonica Group [Japonica rice]
gb|ABB22782.1|  SNARE protein                                           321   4e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008383811.1|  PREDICTED: syntaxin-124                            320   5e-101   
ref|XP_008224938.1|  PREDICTED: syntaxin-124                            318   1e-100   
tpg|DAA51797.1|  TPA: syntaxin 121                                      318   1e-100   
gb|KFK30926.1|  hypothetical protein AALP_AA6G043900                    318   2e-100   
ref|XP_006396560.1|  hypothetical protein EUTSA_v10028836mg             318   2e-100   
ref|XP_007213408.1|  hypothetical protein PRUPE_ppa026160mg             318   3e-100   
ref|XP_010689643.1|  PREDICTED: syntaxin-124-like                       318   4e-100   
ref|XP_010422475.1|  PREDICTED: syntaxin-123                            317   5e-100   
ref|XP_010430946.1|  PREDICTED: syntaxin-123-like                       317   5e-100   
gb|KHN43701.1|  Syntaxin-121                                            317   6e-100   
ref|XP_010106999.1|  hypothetical protein L484_016928                   324   6e-100   
ref|NP_001057967.1|  Os06g0590500                                       317   1e-99    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001172852.1|  Os02g0209900                                       317   1e-99    
ref|XP_009403416.1|  PREDICTED: syntaxin-124-like                       316   1e-99    
gb|EAY84968.1|  hypothetical protein OsI_06334                          316   2e-99    Oryza sativa Indica Group [Indian rice]
ref|XP_006288308.1|  hypothetical protein CARUB_v10001553mg             316   2e-99    
ref|XP_007043496.1|  Syntaxin of plants 124                             316   2e-99    
gb|EYU38683.1|  hypothetical protein MIMGU_mgv1a011630mg                314   3e-99    
ref|XP_002874867.1|  SYP123                                             315   3e-99    
ref|XP_009376513.1|  PREDICTED: syntaxin-124                            315   4e-99    
emb|CDY48554.1|  BnaA09g01500D                                          314   9e-99    
ref|XP_008371295.1|  PREDICTED: syntaxin-124-like                       313   1e-98    
gb|AAP75621.1|  syntaxin                                                314   2e-98    Hordeum vulgare subsp. vulgare [barley]
gb|EPS62072.1|  hypothetical protein M569_12717                         313   2e-98    
ref|XP_009121917.1|  PREDICTED: syntaxin-123                            313   2e-98    
ref|XP_003563699.1|  PREDICTED: syntaxin-124-like                       313   3e-98    
ref|NP_001150776.1|  syntaxin 121                                       312   4e-98    Zea mays [maize]
ref|NP_192242.1|  syntaxin-123                                          312   5e-98    Arabidopsis thaliana [mouse-ear cress]
gb|ABK26928.1|  unknown                                                 311   9e-98    Picea sitchensis
emb|CDY21958.1|  BnaC09g00640D                                          311   1e-97    
ref|XP_010059359.1|  PREDICTED: syntaxin-124-like                       311   1e-97    
ref|XP_003553621.1|  PREDICTED: syntaxin-121-like                       311   2e-97    
ref|XP_006656195.1|  PREDICTED: syntaxin-124-like                       311   2e-97    
gb|AAP79426.1|  syntaxin-like protein 4                                 310   2e-97    Hordeum vulgare subsp. vulgare [barley]
ref|XP_008679858.1|  PREDICTED: syntaxin-124-like                       310   3e-97    
ref|XP_007162979.1|  hypothetical protein PHAVU_001G196400g             308   8e-97    
ref|XP_002987120.1|  hypothetical protein SELMODRAFT_125429             310   1e-96    
ref|XP_002976210.1|  hypothetical protein SELMODRAFT_151097             310   1e-96    
dbj|BAK07448.1|  predicted protein                                      308   1e-96    
gb|AFW66077.1|  hypothetical protein ZEAMMB73_372212                    310   8e-96    
ref|XP_010522637.1|  PREDICTED: syntaxin-123                            306   9e-96    
ref|XP_003520718.1|  PREDICTED: syntaxin-121-like isoform X1            305   3e-95    
gb|KHN22602.1|  Syntaxin-121                                            304   3e-95    
ref|XP_002453527.1|  hypothetical protein SORBIDRAFT_04g007360          305   6e-95    Sorghum bicolor [broomcorn]
ref|XP_001763191.1|  Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group        303   1e-94    
ref|XP_008230270.1|  PREDICTED: syntaxin-124                            303   2e-94    
gb|EMT15634.1|  Syntaxin-124                                            303   2e-94    
gb|AFN53706.1|  putative dead box ATP-dependent RNA helicase            323   6e-94    
ref|XP_007216766.1|  hypothetical protein PRUPE_ppa024730mg             296   9e-92    
ref|XP_007162978.1|  hypothetical protein PHAVU_001G196300g             295   2e-91    
gb|KHN43607.1|  Syntaxin-121                                            293   6e-91    
gb|EMT29769.1|  Syntaxin-124                                            293   1e-90    
ref|XP_001767977.1|  Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group        293   2e-90    
ref|XP_001755039.1|  Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group        290   1e-89    
ref|XP_004306005.1|  PREDICTED: syntaxin-124-like                       290   2e-89    
ref|XP_001765144.1|  Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group        290   2e-89    
ref|XP_003558056.1|  PREDICTED: syntaxin-121-like                       290   3e-89    
ref|XP_001763192.1|  Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group        289   3e-89    
ref|XP_001785723.1|  Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group        288   9e-89    
ref|XP_008342086.1|  PREDICTED: syntaxin-124-like                       286   4e-88    
ref|XP_009794861.1|  PREDICTED: syntaxin-121-like                       281   1e-87    
ref|XP_003571109.1|  PREDICTED: syntaxin-124-like                       285   2e-87    
ref|XP_009351447.1|  PREDICTED: syntaxin-124-like                       282   2e-86    
ref|XP_007030234.1|  Syntaxin of plants 111                             282   3e-86    
ref|XP_006838301.1|  hypothetical protein AMTR_s00103p00119740          281   3e-86    
ref|XP_002978612.1|  hypothetical protein SELMODRAFT_109138             281   5e-86    
ref|XP_002970532.1|  hypothetical protein SELMODRAFT_93442              280   9e-86    
ref|XP_006840262.1|  hypothetical protein AMTR_s00045p00039700          280   2e-85    
ref|XP_010910206.1|  PREDICTED: syntaxin-related protein KNOLLE         278   5e-85    
gb|EEE60062.1|  hypothetical protein OsJ_12868                          277   1e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008808764.1|  PREDICTED: syntaxin-related protein KNOLLE         277   2e-84    
ref|XP_010038203.1|  PREDICTED: syntaxin-related protein KNOLLE         276   3e-84    
ref|XP_002967062.1|  hypothetical protein SELMODRAFT_86937              274   1e-83    
gb|KHG22090.1|  Syntaxin-related KNOLLE -like protein                   275   2e-83    
ref|XP_002960945.1|  hypothetical protein SELMODRAFT_74098              273   3e-83    
ref|XP_007151821.1|  hypothetical protein PHAVU_004G077900g             273   1e-82    
ref|XP_009772555.1|  PREDICTED: syntaxin-related protein KNOLLE         270   6e-82    
emb|CAD78064.1|  knolle                                                 270   1e-81    Antirrhinum majus [garden snapdragon]
ref|XP_010088477.1|  Syntaxin-related protein KNOLLE                    270   1e-81    
ref|XP_008240453.1|  PREDICTED: syntaxin-related protein KNOLLE         270   1e-81    
ref|XP_002991810.1|  hypothetical protein SELMODRAFT_25349              268   2e-81    
ref|XP_004241020.1|  PREDICTED: syntaxin-related protein KNOLLE         269   2e-81    
ref|XP_002319678.1|  Syntaxin-related protein KNOLLE                    269   2e-81    Populus trichocarpa [western balsam poplar]
ref|XP_002992970.1|  hypothetical protein SELMODRAFT_25347              267   3e-81    
ref|XP_007203085.1|  hypothetical protein PRUPE_ppa023624mg             269   3e-81    
ref|XP_002991735.1|  hypothetical protein SELMODRAFT_134103             268   3e-81    
ref|XP_006443346.1|  hypothetical protein CICLE_v10021255mg             268   4e-81    
gb|KHG09810.1|  Syntaxin-related KNOLLE -like protein                   268   6e-81    
ref|XP_002325822.2|  Syntaxin-related protein KNOLLE                    268   6e-81    
ref|XP_002989762.1|  hypothetical protein SELMODRAFT_130326             268   8e-81    
ref|XP_011034432.1|  PREDICTED: syntaxin-related protein KNOLLE-like    267   1e-80    
gb|EYU32988.1|  hypothetical protein MIMGU_mgv1a010481mg                267   1e-80    
ref|XP_009603955.1|  PREDICTED: syntaxin-related protein KNOLLE         267   2e-80    
ref|XP_003548051.1|  PREDICTED: syntaxin-related protein KNOLLE-like    267   2e-80    
ref|XP_004306480.1|  PREDICTED: syntaxin-related protein KNOLLE-like    266   3e-80    
ref|XP_011091152.1|  PREDICTED: syntaxin-related protein KNOLLE         265   5e-80    
ref|XP_002525472.1|  syntaxin, putative                                 265   5e-80    
ref|XP_008360623.1|  PREDICTED: syntaxin-121-like                       261   1e-79    
ref|XP_006350673.1|  PREDICTED: syntaxin-related protein KNOLLE-like    265   1e-79    
ref|XP_009759638.1|  PREDICTED: syntaxin-121-like                       261   1e-79    
emb|CDO99177.1|  unnamed protein product                                264   2e-79    
ref|XP_003611259.1|  Knolle                                             265   2e-79    
ref|XP_004511657.1|  PREDICTED: syntaxin-related protein KNOLLE-like    265   2e-79    
ref|XP_009416696.1|  PREDICTED: syntaxin-related protein KNOLLE         264   2e-79    
ref|XP_003518183.1|  PREDICTED: syntaxin-related protein KNOLLE-like    263   4e-79    
ref|XP_010999467.1|  PREDICTED: syntaxin-related protein KNOLLE-like    263   4e-79    
ref|XP_010272555.1|  PREDICTED: syntaxin-related protein KNOLLE         263   7e-79    
ref|XP_002525726.1|  syntaxin, putative                                 261   2e-78    
ref|XP_010528776.1|  PREDICTED: syntaxin-related protein KNOLLE         261   2e-78    
gb|KDP20286.1|  hypothetical protein JCGZ_06872                         261   2e-78    
ref|XP_006648447.1|  PREDICTED: syntaxin-124-like                       259   4e-78    
ref|XP_010909353.1|  PREDICTED: syntaxin-132-like                       260   6e-78    
gb|KDP39685.1|  hypothetical protein JCGZ_02705                         259   6e-78    
ref|XP_002283098.1|  PREDICTED: syntaxin-related protein KNOLLE         259   1e-77    
emb|CAB56195.1|  Knolle                                                 259   1e-77    
ref|XP_009388491.1|  PREDICTED: syntaxin-132-like                       258   2e-77    
gb|ADE76808.1|  unknown                                                 258   3e-77    
ref|XP_009366413.1|  PREDICTED: syntaxin-related protein KNOLLE         258   6e-77    
gb|ADE75779.1|  unknown                                                 257   6e-77    
gb|KHG29396.1|  syntaxin-131 protein                                    257   7e-77    
ref|XP_007030062.1|  Syntaxin of plants 131 isoform 1                   258   8e-77    
ref|XP_009380979.1|  PREDICTED: syntaxin-132-like                       257   8e-77    
gb|AAP03411.1|  putative cytokinesis-specific syntaxin-related pr...    257   9e-77    
ref|XP_008368500.1|  PREDICTED: syntaxin-related protein KNOLLE-like    256   1e-76    
gb|AFK47760.1|  unknown                                                 256   2e-76    
ref|XP_009409838.1|  PREDICTED: syntaxin-132-like                       256   2e-76    
ref|XP_008386788.1|  PREDICTED: syntaxin-related protein KNOLLE         256   3e-76    
gb|AIX10971.1|  syntaxin                                                254   1e-75    
ref|XP_008441971.1|  PREDICTED: syntaxin-related protein KNOLLE         254   2e-75    
ref|XP_007151857.1|  hypothetical protein PHAVU_004G081300g             253   2e-75    
ref|XP_004976613.1|  PREDICTED: syntaxin-related protein KNOLLE-like    253   2e-75    
ref|XP_006443451.1|  hypothetical protein CICLE_v10021315mg             253   3e-75    
ref|XP_005845633.1|  hypothetical protein CHLNCDRAFT_53691              253   3e-75    
ref|NP_001056925.1|  Os06g0168500                                       252   4e-75    
ref|XP_007030063.1|  Syntaxin of plants 131 isoform 2                   253   5e-75    
ref|XP_004981853.1|  PREDICTED: syntaxin-related protein KNOLLE-like    253   5e-75    
ref|XP_008807289.1|  PREDICTED: syntaxin-132-like isoform X1            252   6e-75    
ref|XP_010671346.1|  PREDICTED: syntaxin-121-like                       248   8e-75    
ref|XP_010666162.1|  PREDICTED: syntaxin-related protein KNOLLE         252   9e-75    
ref|XP_001781323.1|  Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group        251   2e-74    
ref|XP_004962863.1|  PREDICTED: syntaxin-132-like                       251   2e-74    
ref|XP_008808593.1|  PREDICTED: syntaxin-132-like                       251   2e-74    
ref|XP_006826370.1|  hypothetical protein AMTR_s00004p00131810          250   5e-74    
gb|KHG30112.1|  Syntaxin-132 protein                                    249   5e-74    
ref|XP_004249381.1|  PREDICTED: syntaxin-132                            249   7e-74    
gb|EAY91785.1|  hypothetical protein OsI_13428                          256   8e-74    
ref|XP_006339193.1|  PREDICTED: syntaxin-132-like                       249   9e-74    
ref|NP_001058959.2|  Os07g0164300                                       249   1e-73    
ref|XP_002529743.1|  syntaxin, putative                                 248   1e-73    
ref|XP_002466500.1|  hypothetical protein SORBIDRAFT_01g008840          248   2e-73    
dbj|BAC79742.1|  putative syntaxin-related protein                      248   2e-73    
emb|CBB36501.1|  Oryza sativa protein similar to cytokinesis-spec...    248   2e-73    
gb|EEC84099.1|  hypothetical protein OsI_30412                          248   3e-73    
ref|XP_010319568.1|  PREDICTED: syntaxin-132-like isoform X2            247   3e-73    
ref|XP_003063916.1|  predicted protein                                  249   3e-73    
ref|XP_002325846.1|  syntaxin 131 family protein                        247   3e-73    
ref|XP_004229052.1|  PREDICTED: syntaxin-132-like isoform X1            248   3e-73    
ref|XP_006657473.1|  PREDICTED: syntaxin-132-like                       247   3e-73    
ref|XP_005643626.1|  s-syntaxin-like protein                            246   4e-73    
emb|CDI66526.1|  Syntaxin-related protein KNOLLE                        248   4e-73    
ref|XP_002987155.1|  hypothetical protein SELMODRAFT_426042             247   5e-73    
ref|XP_002461505.1|  hypothetical protein SORBIDRAFT_02g003700          247   5e-73    
emb|CDI66564.1|  Syntaxin-related protein KNOLLE                        247   6e-73    
ref|XP_002976260.1|  hypothetical protein SELMODRAFT_443146             247   6e-73    
ref|XP_006655835.1|  PREDICTED: syntaxin-132-like                       246   7e-73    
ref|XP_009615894.1|  PREDICTED: syntaxin-132-like isoform X2            246   8e-73    
emb|CDI66539.1|  Syntaxin-related protein KNOLLE                        246   1e-72    
ref|NP_001152009.1|  syntaxin 132                                       246   1e-72    
ref|XP_011021463.1|  PREDICTED: syntaxin-132-like                       246   1e-72    
ref|XP_008651576.1|  PREDICTED: syntaxin 132 isoform X1                 248   1e-72    
emb|CDI66552.1|  Syntaxin-related protein KNOLLE                        246   1e-72    
ref|XP_009767198.1|  PREDICTED: syntaxin-132-like                       246   1e-72    
ref|XP_009615893.1|  PREDICTED: syntaxin-132-like isoform X1            247   1e-72    
ref|XP_008644522.1|  PREDICTED: syntaxin-related protein KNOLLE-like    246   2e-72    
ref|XP_010914389.1|  PREDICTED: syntaxin-132                            245   2e-72    
emb|CDX93553.1|  BnaA06g04950D                                          245   3e-72    
gb|KHN32770.1|  Putative syntaxin-131                                   245   3e-72    
ref|XP_004171305.1|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-rel...    245   3e-72    
ref|XP_008464975.1|  PREDICTED: syntaxin-132                            244   4e-72    
ref|XP_004489690.1|  PREDICTED: syntaxin-132-like                       244   4e-72    
ref|NP_001149376.1|  syntaxin 132                                       244   4e-72    
emb|CDX97497.1|  BnaC08g13620D                                          244   4e-72    
ref|XP_004147530.1|  PREDICTED: syntaxin-related protein KNOLLE-like    244   5e-72    
ref|XP_011094179.1|  PREDICTED: syntaxin-132                            244   5e-72    
ref|NP_172332.1|  syntaxin-related protein KNOLLE                       244   6e-72    
gb|ABG75752.1|  putative syntaxin-related protein                       244   6e-72    
ref|XP_011077753.1|  PREDICTED: syntaxin-132-like                       244   7e-72    
ref|XP_003557555.1|  PREDICTED: syntaxin-132-like                       244   7e-72    
gb|KFM27425.1|  Putative syntaxin-131                                   244   8e-72    
ref|XP_009148111.1|  PREDICTED: syntaxin-related protein KNOLLE         244   1e-71    
ref|XP_004487393.1|  PREDICTED: syntaxin-132-like                       243   1e-71    
ref|XP_009125717.1|  PREDICTED: syntaxin-132-like                       243   1e-71    
emb|CDX95050.1|  BnaC05g06210D                                          243   1e-71    
ref|XP_010423138.1|  PREDICTED: syntaxin-132-like                       243   2e-71    
emb|CDY31137.1|  BnaA08g26870D                                          243   2e-71    
ref|XP_004955539.1|  PREDICTED: syntaxin-132-like isoform X2            243   2e-71    
ref|XP_006417676.1|  hypothetical protein EUTSA_v10008289mg             243   2e-71    
ref|XP_009110885.1|  PREDICTED: syntaxin-related protein KNOLLE-like    242   3e-71    
gb|EMT33763.1|  Syntaxin-132                                            244   4e-71    
ref|XP_010677633.1|  PREDICTED: syntaxin-132-like                       242   4e-71    
ref|NP_187030.1|  syntaxin of plants 131                                242   4e-71    
ref|XP_010109520.1|  Putative syntaxin-131                              242   5e-71    
ref|XP_010528744.1|  PREDICTED: syntaxin-132                            242   5e-71    
ref|XP_010054704.1|  PREDICTED: syntaxin-132-like                       241   6e-71    
ref|XP_006447531.1|  hypothetical protein CICLE_v10016039mg             241   6e-71    
ref|NP_001170292.1|  hypothetical protein                               241   6e-71    
ref|XP_002892462.1|  SYP111                                             241   6e-71    
ref|XP_002990760.1|  hypothetical protein SELMODRAFT_132199             239   9e-71    
gb|AAP79424.1|  syntaxin-like protein 2                                 241   1e-70    
ref|XP_010463844.1|  PREDICTED: putative syntaxin-131                   241   1e-70    
ref|XP_002986653.1|  hypothetical protein SELMODRAFT_124666             238   1e-70    
gb|KHG00119.1|  syntaxin-131 protein                                    240   1e-70    
ref|XP_011079016.1|  PREDICTED: syntaxin-132-like isoform X2            240   2e-70    
ref|XP_010475656.1|  PREDICTED: syntaxin-related protein KNOLLE i...    240   2e-70    
gb|KDO54993.1|  hypothetical protein CISIN_1g023623mg                   238   2e-70    
ref|XP_009610653.1|  PREDICTED: syntaxin-132-like                       240   2e-70    
ref|XP_004141130.1|  PREDICTED: putative syntaxin-131-like              240   3e-70    
gb|KDO54992.1|  hypothetical protein CISIN_1g023623mg                   239   3e-70    
ref|XP_010458095.1|  PREDICTED: syntaxin-related protein KNOLLE-l...    240   3e-70    
ref|XP_002882311.1|  SYP131                                             239   3e-70    
ref|XP_002266162.1|  PREDICTED: syntaxin-132                            239   5e-70    
ref|XP_006299021.1|  hypothetical protein CARUB_v10015158mg             239   7e-70    
emb|CDY29963.1|  BnaC01g40450D                                          239   7e-70    
ref|XP_006306373.1|  hypothetical protein CARUB_v10012277mg             239   8e-70    
ref|XP_009342248.1|  PREDICTED: syntaxin-132-like isoform X1            238   8e-70    
ref|XP_004288405.1|  PREDICTED: putative syntaxin-131-like              239   8e-70    
ref|XP_009797379.1|  PREDICTED: syntaxin-132-like                       239   9e-70    
ref|NP_001241535.1|  uncharacterized protein LOC100807404               238   9e-70    
ref|XP_008230082.1|  PREDICTED: syntaxin-132-like                       238   9e-70    
ref|XP_010941764.1|  PREDICTED: syntaxin-132-like isoform X1            238   1e-69    
ref|XP_006443450.1|  hypothetical protein CICLE_v10021315mg             237   1e-69    
ref|XP_010514675.1|  PREDICTED: putative syntaxin-131                   238   1e-69    
ref|XP_009130391.1|  PREDICTED: putative syntaxin-131                   238   1e-69    
dbj|BAK04444.1|  predicted protein                                      238   1e-69    
emb|CAN79713.1|  hypothetical protein VITISV_027502                     238   2e-69    
ref|XP_003540313.1|  PREDICTED: syntaxin-132-like                       238   2e-69    
gb|KHN25781.1|  Putative syntaxin-131                                   238   2e-69    
ref|XP_010485740.1|  PREDICTED: putative syntaxin-131                   238   2e-69    
gb|KDD76209.1|  hypothetical protein H632_c314p2                        237   3e-69    
ref|XP_002442246.1|  hypothetical protein SORBIDRAFT_08g016910          237   4e-69    
ref|XP_010549686.1|  PREDICTED: putative syntaxin-131                   237   4e-69    
ref|XP_010941765.1|  PREDICTED: syntaxin-132-like isoform X2            236   6e-69    
ref|XP_007149964.1|  hypothetical protein PHAVU_005G114200g             236   6e-69    
ref|XP_003560038.1|  PREDICTED: syntaxin-related protein KNOLLE         236   6e-69    
ref|XP_011079015.1|  PREDICTED: syntaxin-132-like isoform X1            236   8e-69    
ref|XP_010489017.1|  PREDICTED: syntaxin-related protein KNOLLE-like    236   9e-69    
ref|XP_007045603.1|  Syntaxin of plants 131 isoform 1                   237   1e-68    
ref|XP_010941768.1|  PREDICTED: syntaxin-132-like isoform X4            234   1e-68    
gb|AFK41418.1|  unknown                                                 236   1e-68    
ref|NP_001149999.1|  syntaxin-related protein KNOLLE                    236   1e-68    
ref|XP_006367276.1|  PREDICTED: syntaxin-132-like isoform X2            235   2e-68    
ref|XP_008379622.1|  PREDICTED: syntaxin-132-like                       235   2e-68    
ref|XP_008391983.1|  PREDICTED: syntaxin-121-like                       231   2e-68    
ref|XP_006346549.1|  PREDICTED: syntaxin-132-like                       235   2e-68    
ref|XP_010941767.1|  PREDICTED: syntaxin-132-like isoform X3            234   3e-68    
ref|XP_006288315.1|  hypothetical protein CARUB_v10001560mg             234   3e-68    
ref|XP_009102083.1|  PREDICTED: putative syntaxin-131                   234   3e-68    
ref|XP_009790445.1|  PREDICTED: syntaxin-132-like isoform X2            234   3e-68    
ref|XP_009790444.1|  PREDICTED: syntaxin-132-like isoform X1            234   4e-68    
ref|XP_009131032.1|  PREDICTED: syntaxin-132                            234   4e-68    
ref|XP_010452781.1|  PREDICTED: syntaxin-132                            234   4e-68    
gb|EYU43114.1|  hypothetical protein MIMGU_mgv1a022364mg                234   6e-68    
ref|XP_009122417.1|  PREDICTED: syntaxin-132                            233   6e-68    
ref|XP_006399295.1|  hypothetical protein EUTSA_v10014211mg             233   6e-68    
ref|XP_004955538.1|  PREDICTED: syntaxin-132-like isoform X1            233   7e-68    
ref|XP_003597016.1|  Syntaxin-132                                       233   8e-68    
ref|XP_009615981.1|  PREDICTED: syntaxin-132-like isoform X2            233   1e-67    
ref|XP_010263627.1|  PREDICTED: syntaxin-112                            233   1e-67    
emb|CDP11795.1|  unnamed protein product                                232   1e-67    
gb|ACJ84829.1|  unknown                                                 233   2e-67    
ref|XP_001785655.1|  Qa-SNARE, Sso1/Syntaxin1-type, SYP13 group         233   2e-67    
gb|EYU38725.1|  hypothetical protein MIMGU_mgv1a010631mg                232   2e-67    
ref|XP_008351506.1|  PREDICTED: syntaxin-121-like                       228   3e-67    
gb|AHY82613.1|  putative syntaxin-related protein                       231   3e-67    
ref|XP_008350131.1|  PREDICTED: syntaxin-132-like                       232   3e-67    
ref|XP_003575826.1|  PREDICTED: syntaxin-132-like                       232   3e-67    
ref|NP_568187.1|  syntaxin of plants 132                                231   3e-67    
ref|XP_001693638.1|  Qa-SNARE Sso1/Syntaxin1, PM-type                   232   3e-67    
ref|XP_009353260.1|  PREDICTED: syntaxin-132-like isoform X1            231   4e-67    
ref|XP_007217749.1|  hypothetical protein PRUPE_ppa009977mg             230   4e-67    
ref|XP_001752092.1|  Qa-SNARE, Sso1/Syntaxin1-type, SYP12B-group        232   4e-67    
gb|EMT27931.1|  Putative syntaxin-131                                   233   5e-67    
ref|XP_009615980.1|  PREDICTED: syntaxin-132-like isoform X1            231   6e-67    
ref|XP_006408259.1|  hypothetical protein EUTSA_v10021203mg             231   6e-67    
ref|XP_003563000.1|  PREDICTED: syntaxin-132-like                       231   6e-67    
ref|XP_008807290.1|  PREDICTED: syntaxin-132-like isoform X2            228   9e-67    
ref|XP_002273906.3|  PREDICTED: syntaxin-132-like isoform X1            232   1e-66    
ref|XP_004287931.1|  PREDICTED: putative syntaxin-131-like              230   1e-66    
ref|XP_007045604.1|  Syntaxin of plants 131 isoform 2                   230   1e-66    
ref|XP_006447528.1|  hypothetical protein CICLE_v10016039mg             227   2e-66    
gb|KHG27264.1|  Syntaxin-132 protein                                    229   2e-66    
ref|XP_006367275.1|  PREDICTED: syntaxin-132-like isoform X1            230   2e-66    
ref|XP_002871307.1|  SYP132                                             229   2e-66    
ref|XP_001773354.1|  Qa-SNARE, Sso1/Syntaxin1-type, SYP13 group         229   3e-66    
ref|XP_010035568.1|  PREDICTED: syntaxin-132-like                       229   3e-66    
ref|XP_010323814.1|  PREDICTED: syntaxin-132 isoform X2                 229   4e-66    
ref|NP_001190256.1|  syntaxin of plants 132                             228   9e-66    
gb|ABI93942.1|  syntaxin                                                226   1e-65    
emb|CBI28948.3|  unnamed protein product                                230   2e-65    
ref|XP_002508626.1|  predicted protein                                  228   2e-65    
gb|AFK43025.1|  unknown                                                 221   3e-65    
gb|EYU40192.1|  hypothetical protein MIMGU_mgv1a011014mg                226   4e-65    
ref|XP_007149963.1|  hypothetical protein PHAVU_005G114200g             226   4e-65    
ref|XP_008391704.1|  PREDICTED: syntaxin-132-like                       226   5e-65    
ref|XP_006447527.1|  hypothetical protein CICLE_v10016039mg             226   5e-65    
ref|XP_010550705.1|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-132...    226   5e-65    
ref|XP_010323813.1|  PREDICTED: syntaxin-132 isoform X1                 226   6e-65    
ref|XP_009353111.1|  PREDICTED: syntaxin-132-like isoform X1            225   9e-65    
ref|XP_002948820.1|  Qa-SNARE, Sso1/Syntaxin1-type                      226   1e-64    



>ref|XP_004228675.1| PREDICTED: syntaxin-121-like [Solanum lycopersicum]
Length=300

 Score =   442 bits (1137),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 234/306 (76%), Positives = 262/306 (86%), Gaps = 7/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  REN        +SH IEM            KFFEDVEA+KD+LK++EK
Sbjct  1     MNDLFSGSFSRYREN----DHDQDSHGIEMGDTGGVNLD---KFFEDVEAIKDELKNLEK  53

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             IY  L++++E+SKT+HNAK VK+LR++MD DVSLALK+AK IK RLE LD+SNA+NR + 
Sbjct  54    IYAQLQSSNEKSKTLHNAKAVKDLRSKMDDDVSLALKKAKFIKVRLEALDRSNASNRSLP  113

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KL+E MNQFN+LRQK+ SEYRETVQRRYYTVTGENPDE 
Sbjct  114   GCGPGSSSDRTRTSVVNGLRKKLQESMNQFNELRQKMASEYRETVQRRYYTVTGENPDEA  173

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
             VLD LISTGQSETF+QKAIQEQGRG+VM+T+MEIQERHEAVKE+ERNLKELHQVFLDMAV
Sbjct  174   VLDTLISTGQSETFLQKAIQEQGRGQVMDTIMEIQERHEAVKEIERNLKELHQVFLDMAV  233

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LVE+QGEQLDDIESQVNRANS VR GA QL  ARKHQKNTRKWTCFAIILLLIIILIVVL
Sbjct  234   LVESQGEQLDDIESQVNRANSFVRGGAQQLQVARKHQKNTRKWTCFAIILLLIIILIVVL  293

Query  599   SIRPWK  582
             SI+PWK
Sbjct  294   SIQPWK  299



>ref|XP_009763025.1| PREDICTED: syntaxin-121 [Nicotiana sylvestris]
 gb|AAD11808.1| syntaxin-related protein Nt-syr1 [Nicotiana tabacum]
Length=300

 Score =   439 bits (1130),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 234/306 (76%), Positives = 261/306 (85%), Gaps = 7/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  R +  S     +SH IEM     G   +  KFFEDVEA+KD+LK +EK
Sbjct  1     MNDLFSGSFSRFRADDQS-----DSHAIEMGDITGGVNLD--KFFEDVEAIKDELKGLEK  53

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             IY  L+++HE+SKT+HNAK VK+LR+ MD DVS+ALK+AK IK RLE LD+SNAANR + 
Sbjct  54    IYSQLQSSHEKSKTLHNAKAVKDLRSNMDNDVSMALKKAKFIKVRLEALDRSNAANRSLP  113

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KL+E MNQFN+LRQK+ SEYRETVQRRYYTVTGENPDE 
Sbjct  114   GCGPGSSSDRTRTSVVNGLRKKLQESMNQFNELRQKMASEYRETVQRRYYTVTGENPDEA  173

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
             VLD LISTGQSETF+QKAIQEQGRG+VM+TVMEIQERHEAVKE+ERNLKELHQVFLDMAV
Sbjct  174   VLDTLISTGQSETFLQKAIQEQGRGQVMDTVMEIQERHEAVKELERNLKELHQVFLDMAV  233

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LVE+QG QLDDIESQVNRANS VR GA QL  ARKHQKNTRKWTCFAIILLLIIIL+VVL
Sbjct  234   LVESQGAQLDDIESQVNRANSFVRGGAQQLQVARKHQKNTRKWTCFAIILLLIIILVVVL  293

Query  599   SIRPWK  582
             SI+PWK
Sbjct  294   SIQPWK  299



>ref|XP_009593833.1| PREDICTED: syntaxin-121-like [Nicotiana tomentosiformis]
Length=300

 Score =   439 bits (1128),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/306 (76%), Positives = 262/306 (86%), Gaps = 7/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  R +  S     +SHTIEM     G   +  KFFEDVEA+KD+LK +EK
Sbjct  1     MNDLFSGSFSRFRADDQS-----DSHTIEMGDITGGVNLD--KFFEDVEAIKDELKGLEK  53

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+T+HE+SKT+HNAK VK+LR+ MD DVS+ALK+AK IK RLE LD+SNAANR + 
Sbjct  54    LYSQLQTSHEKSKTLHNAKTVKDLRSNMDNDVSMALKKAKFIKVRLEALDRSNAANRSLP  113

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KL+E MNQFN+LRQK+ SEYRETVQRRYYTVTGENPDE 
Sbjct  114   GCGPGSSSDRTRTSVVNGLRKKLQESMNQFNELRQKMASEYRETVQRRYYTVTGENPDEA  173

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
             VLD LISTGQSETF+QKAIQEQGRG+VM+TVMEIQER+EAVKE+ERNLKELHQVFLDMAV
Sbjct  174   VLDTLISTGQSETFLQKAIQEQGRGQVMDTVMEIQERNEAVKELERNLKELHQVFLDMAV  233

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LVE+QG QLDDIESQVNRANS VR GA QL  ARKHQKNTRKWTCFAIILLLIIIL+VVL
Sbjct  234   LVESQGAQLDDIESQVNRANSFVRGGAQQLQVARKHQKNTRKWTCFAIILLLIIILVVVL  293

Query  599   SIRPWK  582
             SI+PWK
Sbjct  294   SIQPWK  299



>ref|XP_006348450.1| PREDICTED: syntaxin-121-like [Solanum tuberosum]
Length=300

 Score =   434 bits (1115),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 232/306 (76%), Positives = 259/306 (85%), Gaps = 7/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS   EN        +SH IEM            KFFEDVEA+KD+LK++EK
Sbjct  1     MNDLFSGSFSRHGEN----DHDQDSHGIEMGDTGGVNLD---KFFEDVEAIKDELKNLEK  53

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             IY  L++++E+SKT+HNAK VK+LR++MD DVSLALK+AK IK RLE LD+SNA+NR + 
Sbjct  54    IYAQLQSSNEKSKTLHNAKAVKDLRSKMDDDVSLALKKAKFIKVRLEALDRSNASNRSLP  113

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
              CGPGSSSDRTRTSVVNGLR KL E MNQFN+LRQK+ SEYRETVQRRYYTVTGENPDE 
Sbjct  114   ECGPGSSSDRTRTSVVNGLRKKLHESMNQFNELRQKMASEYRETVQRRYYTVTGENPDET  173

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
             VLD LISTGQSETF+QKAIQEQGRG+VM+T+MEIQERHEAVKE+ERNLKELHQVFLDMAV
Sbjct  174   VLDTLISTGQSETFLQKAIQEQGRGQVMDTIMEIQERHEAVKEIERNLKELHQVFLDMAV  233

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LVE+QGEQLDDIESQVNRANS VR GA QL  ARKHQKNTRKWTCFAIILLLIIILIVVL
Sbjct  234   LVESQGEQLDDIESQVNRANSYVRGGAQQLQVARKHQKNTRKWTCFAIILLLIIILIVVL  293

Query  599   SIRPWK  582
             SI+PWK
Sbjct  294   SIQPWK  299



>emb|CDP10588.1| unnamed protein product [Coffea canephora]
Length=300

 Score =   432 bits (1110),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 226/306 (74%), Positives = 258/306 (84%), Gaps = 6/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  R    S    P+SH+IEM+    G   +  KFFEDVEA+KD+L+D+E 
Sbjct  1     MNDLFSGSFSRFR----SQDQSPDSHSIEMTNNTGGVNLD--KFFEDVEAIKDELRDLET  54

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L +++EQSKT+HNAK VKELR +MD DVSL+LK+AK IK RLE LD+SNAANR + 
Sbjct  55    LYSQLHSSNEQSKTLHNAKAVKELRTKMDSDVSLSLKKAKFIKVRLEALDRSNAANRSIP  114

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KL++ MNQF+DLRQK+  EYRETVQRRYYTVTGENPDE 
Sbjct  115   GCGPGSSSDRTRTSVVNGLRKKLQDQMNQFSDLRQKMAGEYRETVQRRYYTVTGENPDEA  174

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
             VLD LISTGQSETF+QKAIQ+QGRG+VM+T+MEIQERH+AVKE+E+NLKELHQVFLDMAV
Sbjct  175   VLDSLISTGQSETFLQKAIQQQGRGQVMDTIMEIQERHDAVKEIEKNLKELHQVFLDMAV  234

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LVETQGEQLDDIESQV RA+S VR G  QL  ARKHQKNTRKWTC  I+LLLIIILIVVL
Sbjct  235   LVETQGEQLDDIESQVQRASSFVRGGTQQLQVARKHQKNTRKWTCIGIVLLLIIILIVVL  294

Query  599   SIRPWK  582
             SIRPWK
Sbjct  295   SIRPWK  300



>ref|XP_009613977.1| PREDICTED: syntaxin-121-like [Nicotiana tomentosiformis]
Length=327

 Score =   428 bits (1101),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 230/306 (75%), Positives = 260/306 (85%), Gaps = 5/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  R     SP   +SH I+M      GG +L KFFEDVEA+KD+LK++EK
Sbjct  1     MNDLFSGSFSRFRSED-QSP-NQDSHGIQM---RQTGGIHLDKFFEDVEAIKDELKELEK  55

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++  L  +HEQSKT+HNAK VK+LR +MD DVS+ALK+AK IK RLE LD+SNAANR + 
Sbjct  56    LHSQLHNSHEQSKTLHNAKTVKDLRTKMDNDVSIALKKAKFIKVRLEALDRSNAANRSID  115

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KL+E MNQFN+LRQ++ SEYRETVQRRYYTVTGENPDE 
Sbjct  116   GCGPGSSSDRTRTSVVNGLRKKLQESMNQFNELRQRMASEYRETVQRRYYTVTGENPDEG  175

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              LD LISTGQSETF+QKAIQEQGRG+VM+TVMEIQERHEAVKE+ERNLKELHQVFLDMAV
Sbjct  176   TLDNLISTGQSETFLQKAIQEQGRGQVMDTVMEIQERHEAVKELERNLKELHQVFLDMAV  235

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LVE+QG QLDDIESQVNRANS VR GA QL  ARKHQKNTRKWTC AI++LLIIIL+VVL
Sbjct  236   LVESQGAQLDDIESQVNRANSFVRGGAQQLEVARKHQKNTRKWTCIAIVILLIIILVVVL  295

Query  599   SIRPWK  582
             SI+PWK
Sbjct  296   SIQPWK  301



>ref|XP_011094239.1| PREDICTED: syntaxin-121 [Sesamum indicum]
Length=305

 Score =   424 bits (1090),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 223/307 (73%), Positives = 264/307 (86%), Gaps = 4/307 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPE-SHTIEMSaaanggganlAKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS  R   G   +P + SHTIEM+ + + GG NL +FFEDVEA+KD+L D+E
Sbjct  1     MNDLFSGSFSRFR---GQDQSPAQDSHTIEMTNSGSTGGVNLDRFFEDVEAIKDELGDLE  57

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
              +Y  L+ AHEQSKT+H+AK +K+LR+RMD D+S ALK+AK+IK RLE LD+SNAANR +
Sbjct  58    SLYTQLQAAHEQSKTLHSAKAIKDLRSRMDADISAALKKAKVIKVRLEALDRSNAANRSL  117

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTRTSVVNGLR KL + M +FNDLRQK+ SEYRETVQRRYYTVTGENPDE
Sbjct  118   PGCGPGSSSDRTRTSVVNGLRKKLHDTMTRFNDLRQKMGSEYRETVQRRYYTVTGENPDE  177

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             ++LD+LI TG+SETF+QKAIQEQGRG+VM T+MEIQERH+AVKE+E+NL+ELHQVFLDMA
Sbjct  178   KILDRLIETGESETFLQKAIQEQGRGQVMETIMEIQERHDAVKEMEKNLRELHQVFLDMA  237

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivv  603
             VLV++QGEQLDDIESQVNRANS VR G  QL  ARKHQKNTRKWTCF I+LLLIIILI+V
Sbjct  238   VLVQSQGEQLDDIESQVNRANSFVRGGTHQLEVARKHQKNTRKWTCFGIVLLLIIILIIV  297

Query  602   LSIRPWK  582
             LS++PWK
Sbjct  298   LSLQPWK  304



>ref|XP_004249403.1| PREDICTED: syntaxin-121-like [Solanum lycopersicum]
Length=303

 Score =   422 bits (1084),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 230/306 (75%), Positives = 259/306 (85%), Gaps = 4/306 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  R N   SP   ES  I+M      GG NL KFFEDVE +KD+LK++EK
Sbjct  1     MNDLFSGSFSRFR-NEEQSP-NQESAGIQM--RQQTGGVNLDKFFEDVETIKDELKELEK  56

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             I+  L  +HEQSKT+HNAK VK+LR +MD DVSLALK+AK IK RLE LD+SNAANR V 
Sbjct  57    IHTQLHNSHEQSKTLHNAKNVKDLRKKMDNDVSLALKKAKFIKVRLEALDRSNAANRSVP  116

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KL+E MNQFN+LRQ++ SEYRETVQRRY+TVTGENPDE 
Sbjct  117   GCGPGSSSDRTRTSVVNGLRKKLQESMNQFNELRQRMASEYRETVQRRYFTVTGENPDEG  176

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              LD LISTGQSETF+QKAIQEQGRG+VM+TVMEIQERHEAVKE+ERNLKELHQVF+DMAV
Sbjct  177   TLDTLISTGQSETFLQKAIQEQGRGQVMDTVMEIQERHEAVKELERNLKELHQVFMDMAV  236

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LVE+QG QLDDIESQVNRANS VR GA QL  ARKHQK++RKWTC AII+LLII+L+VVL
Sbjct  237   LVESQGAQLDDIESQVNRANSFVRGGAQQLEVARKHQKSSRKWTCIAIIILLIIVLVVVL  296

Query  599   SIRPWK  582
             SI+PWK
Sbjct  297   SIQPWK  302



>gb|EYU18107.1| hypothetical protein MIMGU_mgv1a019805mg [Erythranthe guttata]
Length=329

 Score =   421 bits (1082),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 219/310 (71%), Positives = 261/310 (84%), Gaps = 4/310 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM----SaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL S SFS  R+   S P   +SHT+EM    S    GG  NL +FFEDVE+VKD+L+
Sbjct  1     MNDLFSGSFSRFRDQDQSPPRRDDSHTVEMINSASTGGGGGAVNLNRFFEDVESVKDELQ  60

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             ++E +Y +L +AHEQSKT+HN+K VKELR+RMD DVS +LK+AKLIK RLE LD+SNAAN
Sbjct  61    ELETLYNNLHSAHEQSKTLHNSKAVKELRSRMDADVSASLKKAKLIKVRLEALDRSNAAN  120

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R   GCGPGSSSDRTRTSVVNGLR KL+E M +FNDLRQ++ SEYRETVQRRYYTVTGEN
Sbjct  121   RSNPGCGPGSSSDRTRTSVVNGLRKKLQESMTRFNDLRQRMGSEYRETVQRRYYTVTGEN  180

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
             PDE+ LD+LI TG+SETF+QKAIQEQGRG+VM+T+MEI+ERH+AVKE+E+NL ELHQVF+
Sbjct  181   PDEKTLDRLIETGESETFLQKAIQEQGRGQVMDTIMEIRERHDAVKEMEKNLIELHQVFM  240

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiil  612
             DMAVLV++QGEQLDDIESQVNRANS VR G  QL  ARKHQKNTRKW CF I+L+ +IIL
Sbjct  241   DMAVLVQSQGEQLDDIESQVNRANSFVRGGTQQLEVARKHQKNTRKWACFGIVLVSVIIL  300

Query  611   ivvLSIRPWK  582
             I+VLS++PWK
Sbjct  301   IIVLSLQPWK  310



>ref|XP_006339172.1| PREDICTED: syntaxin-121-like [Solanum tuberosum]
Length=302

 Score =   415 bits (1067),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 231/306 (75%), Positives = 259/306 (85%), Gaps = 5/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  R N   SP   ES  I+M      GG NL KFFEDVE +KD+LK++EK
Sbjct  1     MNDLFSGSFSRFR-NEEQSPNQ-ESPGIQM---RQTGGVNLDKFFEDVETIKDELKELEK  55

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             I+  L  +HEQSKT+HNAK VK+LR +MD DVS+ALK+AK IK RLE LD+SNAANR V 
Sbjct  56    IHTQLHNSHEQSKTLHNAKNVKDLRTKMDNDVSIALKKAKFIKVRLEALDRSNAANRSVP  115

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KL+E MNQFN+LRQ++ SEYRETVQRRYYTVTGENPDE 
Sbjct  116   GCGPGSSSDRTRTSVVNGLRKKLQESMNQFNELRQRMASEYRETVQRRYYTVTGENPDEG  175

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              LD LISTGQSETF+QKAIQEQGRG+VM+TVMEIQERHEAVKE+ERNLKELHQVF+DMAV
Sbjct  176   TLDTLISTGQSETFLQKAIQEQGRGQVMDTVMEIQERHEAVKELERNLKELHQVFMDMAV  235

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LVE+QG QLDDIESQVNRANS VR GA QL  ARKHQK++RKWTC AII+LLIIIL+VVL
Sbjct  236   LVESQGAQLDDIESQVNRANSFVRGGAQQLEVARKHQKSSRKWTCIAIIILLIIILVVVL  295

Query  599   SIRPWK  582
             SI+PWK
Sbjct  296   SIQPWK  301



>ref|XP_007028001.1| Syntaxin of plants 121 [Theobroma cacao]
 gb|EOY08503.1| Syntaxin of plants 121 [Theobroma cacao]
Length=330

 Score =   407 bits (1047),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 208/307 (68%), Positives = 257/307 (84%), Gaps = 6/307 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS  R    S  A P+ H I+M+ +++  G     KFFEDVE++KD+LK++E
Sbjct  1     MNDLFSGSFSRFR----SEEASPDHHVIQMTQSSSTSGGVNLDKFFEDVESIKDELKELE  56

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++  +L ++HEQSKT+HNAK VKELRA+MD DV++ALK+AKLIK RLE LD+SNAANR +
Sbjct  57    RLNDNLSSSHEQSKTLHNAKTVKELRAKMDADVAMALKKAKLIKVRLEALDRSNAANRSL  116

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTRTSVVNGLR KLK+ M  FN LR+KI SEYRETVQRRY+TVTGENPDE
Sbjct  117   PGCGPGSSSDRTRTSVVNGLRKKLKDSMESFNGLREKISSEYRETVQRRYFTVTGENPDE  176

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
               +D LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E+NLKELHQVFLDMA
Sbjct  177   RTIDLLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDMEKNLKELHQVFLDMA  236

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA-iillliiiliv  606
             VLV+ QGEQLDDIESQVNRANS VR G ++L TAR +QKNTRKWTC+A I+LL+II+ +V
Sbjct  237   VLVQAQGEQLDDIESQVNRANSFVRGGTERLQTARNYQKNTRKWTCYAIILLLVIILFVV  296

Query  605   vLSIRPW  585
             + ++RPW
Sbjct  297   LFTVRPW  303



>gb|KDP36101.1| hypothetical protein JCGZ_08745 [Jatropha curcas]
Length=333

 Score =   407 bits (1047),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 215/306 (70%), Positives = 254/306 (83%), Gaps = 5/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  R    S  A P+ H I+MS   + GG NL KFFEDVE+VKD+LK++E+
Sbjct  1     MNDLFSGSFSRFR----SEDASPDHHVIQMSETPSAGGVNLNKFFEDVESVKDELKELER  56

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +  SL++AHEQSKT+HNAK VK+LR+RMD DV+ ALK+AK IK RLE LD+SNAANR + 
Sbjct  57    LNQSLQSAHEQSKTIHNAKAVKDLRSRMDADVAQALKKAKFIKVRLEALDRSNAANRSLP  116

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KLK+ M  FN LR+KI SEYRETVQRRY+TV GENPDE 
Sbjct  117   GCGPGSSSDRTRTSVVNGLRKKLKDSMESFNSLREKISSEYRETVQRRYFTVNGENPDER  176

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              LD+LISTG+SETF+QKAIQEQGRG V++T+ EIQERH+AVKE+E+NLKELHQVFLDM+V
Sbjct  177   TLDRLISTGESETFLQKAIQEQGRGRVLDTINEIQERHDAVKEMEKNLKELHQVFLDMSV  236

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA-iillliiilivv  603
             LVE QGEQLDDIES + RANS VR GA QL TAR  QKNTRKWTC+A IILL+II+ +V+
Sbjct  237   LVEAQGEQLDDIESNMQRANSYVRTGAQQLNTARVLQKNTRKWTCYAIIILLVIILFVVL  296

Query  602   LSIRPW  585
              ++RPW
Sbjct  297   FTVRPW  302



>ref|XP_010106987.1| hypothetical protein L484_016916 [Morus notabilis]
 gb|EXC12985.1| hypothetical protein L484_016916 [Morus notabilis]
Length=331

 Score =   406 bits (1044),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 217/309 (70%), Positives = 259/309 (84%), Gaps = 8/309 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaangggan----lAKFFEDVEAVKDDLK  1332
             MNDL SRSFS  R    S    P+ H IEMS+A++   A     L KFFEDVE+VKD+LK
Sbjct  1     MNDLFSRSFSRFRNEDAS----PDHHVIEMSSASSAAVATGGVNLDKFFEDVESVKDELK  56

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             ++E+++ +L  +H+QSKT+HNAK +K+LR+RMD DVSLALK+AKLIK RLE LD+SNAAN
Sbjct  57    ELERLHENLNASHQQSKTLHNAKAIKDLRSRMDADVSLALKKAKLIKVRLEALDRSNAAN  116

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R + GCGPGSSSDRTRTSVVNGLR KLK+ M  FN LRQ+I SEYR+TVQRRY+TVTGEN
Sbjct  117   RSLPGCGPGSSSDRTRTSVVNGLRKKLKDSMESFNSLRQQISSEYRDTVQRRYFTVTGEN  176

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
             PDE+ +D LISTG+SETF+QKAIQEQGRG V++T+ EIQERH+AVKE+E+NLKELHQVFL
Sbjct  177   PDEKTIDLLISTGESETFLQKAIQEQGRGRVLDTIKEIQERHDAVKEMEKNLKELHQVFL  236

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiil  612
             DMAVLVE QGEQLDDIES V RANS VR GAD+L  AR +QKNTRKWTC+AIILLLII L
Sbjct  237   DMAVLVEAQGEQLDDIESHVARANSFVRSGADRLQGARAYQKNTRKWTCYAIILLLIIAL  296

Query  611   ivvLSIRPW  585
             +V+LS++PW
Sbjct  297   VVILSLKPW  305



>ref|XP_002524068.1| syntaxin, putative [Ricinus communis]
 gb|EEF38278.1| syntaxin, putative [Ricinus communis]
Length=316

 Score =   404 bits (1039),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 212/306 (69%), Positives = 256/306 (84%), Gaps = 5/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  R   GS    P+ H I+M+   + GG NL KFFEDVE+VKD+LK++E+
Sbjct  1     MNDLFSGSFSRFRNEQGS----PDHHVIQMTETPSTGGVNLDKFFEDVESVKDELKELER  56

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +  SL++AHEQSKT+HNAK VK+LR+RMD DV+ ALK+AKLIK RLE LD+SNAANR + 
Sbjct  57    LNESLQSAHEQSKTLHNAKTVKDLRSRMDADVAQALKKAKLIKVRLEALDRSNAANRSLP  116

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KLK+ M  F+ LR+KI +EYRETVQRRYYTVTGENPDE+
Sbjct  117   GCGPGSSSDRTRTSVVNGLRKKLKDSMESFSSLREKISTEYRETVQRRYYTVTGENPDEK  176

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              LD+LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVKE+E+NLKELHQVFLDMAV
Sbjct  177   TLDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKEMEKNLKELHQVFLDMAV  236

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA-iillliiilivv  603
             LV+ QGEQLDDIES + RA+S VR G  QL TAR  QKNTRKWTC+A IILL+II+ +V+
Sbjct  237   LVQAQGEQLDDIESNMQRASSFVRGGTQQLQTARTLQKNTRKWTCYAIIILLVIILFVVL  296

Query  602   LSIRPW  585
              ++RPW
Sbjct  297   FTVRPW  302



>gb|KHG08581.1| Syntaxin-121 protein [Gossypium arboreum]
Length=331

 Score =   400 bits (1027),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 204/307 (66%), Positives = 257/307 (84%), Gaps = 6/307 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggg-anlAKFFEDVEAVKDDLKDIE  1323
             MN+L S SFS  R    S  A P+ H IEM+ +++  G  NL KFFEDVE++KD+LK++E
Sbjct  1     MNNLFSGSFSRFR----SEEASPDHHVIEMTQSSSTSGGVNLDKFFEDVESIKDELKELE  56

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++   L ++HE+SKT+HNAK VKELRA+MD DV++ALK+AKLIK RLE LD+SNA+NR +
Sbjct  57    RLNHDLSSSHERSKTLHNAKAVKELRAKMDADVAMALKKAKLIKVRLEALDRSNASNRSL  116

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTRTSVVNGLR KLK+ M  FN LR+KI SEYRETVQRRY+TVTGENPDE
Sbjct  117   LGCGPGSSSDRTRTSVVNGLRKKLKDSMESFNGLREKISSEYRETVQRRYFTVTGENPDE  176

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + LD LISTG+SE+F+QKAIQEQGRG +++T+ EIQERH+A K++E+NLKELHQVFLDMA
Sbjct  177   KTLDLLISTGESESFLQKAIQEQGRGRILDTIYEIQERHDAAKDLEKNLKELHQVFLDMA  236

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA-iillliiiliv  606
             VLV+ QGEQLDDIES VNRANS VR G ++L TAR +QKNTRKWTC+A I+LL+I++ +V
Sbjct  237   VLVQAQGEQLDDIESHVNRANSFVRGGTERLQTARNYQKNTRKWTCYAIILLLVIVLFVV  296

Query  605   vLSIRPW  585
             + +++PW
Sbjct  297   LFTVKPW  303



>ref|XP_002323377.2| syntaxin 121 family protein [Populus trichocarpa]
 gb|EEF05138.2| syntaxin 121 family protein [Populus trichocarpa]
Length=302

 Score =   399 bits (1024),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 206/286 (72%), Positives = 250/286 (87%), Gaps = 0/286 (0%)
 Frame = -2

Query  1439  APPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQ  1260
             APP  H I+MS A + GG NL KFFEDVE++KD+LK++E++ G+L++AHEQSKT+HN++ 
Sbjct  17    APPAHHVIQMSEAPSTGGVNLDKFFEDVESIKDELKELERLNGNLQSAHEQSKTLHNSRA  76

Query  1259  VKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLR  1080
             VK+LR++MD DV+LALK+AKLIK RLE LD+SNAANR + GCG GSSSDRTRTSVVNGLR
Sbjct  77    VKDLRSKMDADVALALKKAKLIKVRLEALDRSNAANRTLPGCGAGSSSDRTRTSVVNGLR  136

Query  1079  NKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQ  900
              KLK+ M+ FN LRQKI +EYRETVQRRY+TVTGENPDE+ +D LISTG+SETF+QKAIQ
Sbjct  137   KKLKDLMDGFNGLRQKISTEYRETVQRRYFTVTGENPDEKTIDLLISTGESETFLQKAIQ  196

Query  899   EQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRAN  720
             +QGRG +++T+ EIQERH+AVK++E NLKELHQVFLDMAVLVE QGEQLDDIES + RAN
Sbjct  197   QQGRGRILDTINEIQERHDAVKDLENNLKELHQVFLDMAVLVEHQGEQLDDIESNMQRAN  256

Query  719   SIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvLSIRPWK  582
             S VR G  QL TARK QKNTRKWTC+AII+LLIIIL+V+L +RPWK
Sbjct  257   SFVRGGTQQLQTARKLQKNTRKWTCYAIIILLIIILVVLLILRPWK  302



>ref|XP_011042574.1| PREDICTED: syntaxin-121 [Populus euphratica]
Length=302

 Score =   398 bits (1023),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 216/306 (71%), Positives = 259/306 (85%), Gaps = 4/306 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS SFS       S  APP  H I+MS A + GG NL KFFEDVE++KD+LK++EK
Sbjct  1     MNDLLSSSFSRFS----SEEAPPAHHVIQMSEAPSTGGVNLEKFFEDVESIKDELKELEK  56

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             + G+L++AHEQSKT+HN++ VK+LR++MD DV+LALK+AKLIK RLE LD+SNAANR + 
Sbjct  57    LNGNLQSAHEQSKTLHNSRAVKDLRSKMDADVALALKKAKLIKVRLEALDRSNAANRTLP  116

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCG GSSSDRTRTSVVNGLR KLK+ M+ FN LRQKI +EYRETVQRRY+TVTGENPDE+
Sbjct  117   GCGLGSSSDRTRTSVVNGLRKKLKDLMDGFNGLRQKISTEYRETVQRRYFTVTGENPDEK  176

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQ+QGRG +++T+ EIQERH+AVK++E NLKELHQVFLDMAV
Sbjct  177   TIDLLISTGESETFLQKAIQQQGRGRILDTINEIQERHDAVKDLENNLKELHQVFLDMAV  236

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LVE QGEQLDDIES + RANS VR G  QL  ARK QKNTRKWTC+AII+LLIIIL+V+L
Sbjct  237   LVENQGEQLDDIESNMQRANSFVRGGTQQLQAARKLQKNTRKWTCYAIIILLIIILVVLL  296

Query  599   SIRPWK  582
              +RPWK
Sbjct  297   ILRPWK  302



>ref|XP_006481612.1| PREDICTED: syntaxin-121-like [Citrus sinensis]
 gb|KDO70640.1| hypothetical protein CISIN_1g019985mg [Citrus sinensis]
Length=332

 Score =   399 bits (1024),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 208/307 (68%), Positives = 254/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggg-anlAKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS  R    S   P    TI+M+   N  G  NL KFF+DVE+VKD+LK++E
Sbjct  1     MNDLFSGSFSRFRSEQASPDRPHHHTTIQMTENPNSTGGVNLDKFFDDVESVKDELKELE  60

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +++ SL+T+HE+SKT+HNAK VK+LR+RMD DVS ALK AKLIK RLE LD+SNAANR +
Sbjct  61    RLHNSLQTSHEKSKTLHNAKAVKDLRSRMDADVSAALKNAKLIKIRLEALDRSNAANRSL  120

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTRTSVVNGLR KLK+ M  FN+LRQ+I SEYR+TVQRRYYTVTGENPDE
Sbjct  121   PGCGPGSSSDRTRTSVVNGLRKKLKDSMESFNELRQRISSEYRDTVQRRYYTVTGENPDE  180

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + LD+LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK +E+NL+ELHQVFLDMA
Sbjct  181   KTLDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKVLEKNLQELHQVFLDMA  240

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA-iillliiiliv  606
             VLV+ QGEQLDDIESQV RANS VR G ++L TARK+Q +TRKWTC A  ILL+II+ +V
Sbjct  241   VLVQAQGEQLDDIESQVQRANSYVRGGTERLQTARKYQLSTRKWTCIAITILLIIILFVV  300

Query  605   vLSIRPW  585
             + +++PW
Sbjct  301   LFTVKPW  307



>ref|XP_006430049.1| hypothetical protein CICLE_v10012164mg [Citrus clementina]
 gb|ESR43289.1| hypothetical protein CICLE_v10012164mg [Citrus clementina]
Length=332

 Score =   398 bits (1023),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 208/307 (68%), Positives = 254/307 (83%), Gaps = 2/307 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggg-anlAKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS  R    S   P    TI+M+   N  G  NL KFF+DVE+VKD+LK++E
Sbjct  1     MNDLFSGSFSRFRSEQASPDHPHHHTTIQMTENPNSTGGVNLDKFFDDVESVKDELKELE  60

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +++ SL+T+HE+SKT+HNAK VK+LR+RMD DVS ALK AKLIK RLE LD+SNAANR +
Sbjct  61    RLHNSLQTSHEKSKTLHNAKAVKDLRSRMDADVSAALKNAKLIKIRLEALDRSNAANRSL  120

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTRTSVVNGLR KLK+ M  FN+LRQ+I SEYR+TVQRRYYTVTGENPDE
Sbjct  121   PGCGPGSSSDRTRTSVVNGLRKKLKDSMESFNELRQRISSEYRDTVQRRYYTVTGENPDE  180

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + LD+LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK +E+NL+ELHQVFLDMA
Sbjct  181   KTLDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKVLEKNLQELHQVFLDMA  240

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA-iillliiiliv  606
             VLV+ QGEQLDDIESQV RANS VR G ++L TARK+Q +TRKWTC A  ILL+II+ +V
Sbjct  241   VLVQAQGEQLDDIESQVQRANSYVRGGTERLQTARKYQLSTRKWTCIAITILLIIILFVV  300

Query  605   vLSIRPW  585
             + +++PW
Sbjct  301   LFTVKPW  307



>ref|XP_002308326.1| syntaxin 121 family protein [Populus trichocarpa]
 gb|EEE91849.1| syntaxin 121 family protein [Populus trichocarpa]
Length=306

 Score =   395 bits (1015),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 207/306 (68%), Positives = 256/306 (84%), Gaps = 5/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS       S  A P+ H I+MS A + GG     KFFEDVE++KD+LK++E
Sbjct  1     MNDLFSGSFS----RFHSEEASPDHHVIQMSEAQSTGGGVNLDKFFEDVESIKDELKELE  56

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++  +++++HEQSKT+HNA+ VK++R++MD DV+LALK+AKLIK RLE LD+SNAANR +
Sbjct  57    RLNENMRSSHEQSKTLHNARAVKDMRSKMDADVALALKRAKLIKVRLEALDRSNAANRSL  116

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTRTSVV+GLR KLK+ M  FN LRQKI +EYRETV+RRY+TVTGENPDE
Sbjct  117   PGCGPGSSSDRTRTSVVSGLRKKLKDLMESFNGLRQKITTEYRETVERRYFTVTGENPDE  176

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + LD LISTG+SETF+QKAIQ+QGRG +++T+ EIQERH+AVK++E NLKELHQVF+DMA
Sbjct  177   KTLDLLISTGESETFLQKAIQQQGRGRILDTINEIQERHDAVKDLENNLKELHQVFMDMA  236

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivv  603
             VLVE QGEQLDDIES V RANS VR G  QL TARK Q+N+RKWTC+AII+LLIIIL+V+
Sbjct  237   VLVEHQGEQLDDIESHVQRANSYVRGGTQQLQTARKLQRNSRKWTCYAIIILLIIILVVL  296

Query  602   LSIRPW  585
             LS+RPW
Sbjct  297   LSVRPW  302



>ref|XP_008442928.1| PREDICTED: syntaxin-121 [Cucumis melo]
Length=307

 Score =   394 bits (1012),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 254/309 (82%), Gaps = 15/309 (5%)
 Frame = -2

Query  1499  MNDLLS-RSFSLPRENGGSSPAPPESHTIEMSaaanggganlA--KFFEDVEAVKDDLKD  1329
             MNDL S RSFS             ++H +EM   A+     +   KFFEDVE+VKD+LK+
Sbjct  1     MNDLFSSRSFS------------RDTHVVEMGNNASSSPTAVNLDKFFEDVESVKDELKE  48

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             +E++Y +L  +HEQSKT+HNAK VK+LR+RMD DVSLALK+AKLIK RLE LD+SNAANR
Sbjct  49    LERLYSNLHDSHEQSKTLHNAKTVKDLRSRMDSDVSLALKKAKLIKVRLEALDRSNAANR  108

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              + GCGPGSSSDRTRTSVVNGLR KL++ M  FN+LRQ+I SEYRETVQRRYYTVTGENP
Sbjct  109   SLPGCGPGSSSDRTRTSVVNGLRKKLQDSMESFNNLRQQISSEYRETVQRRYYTVTGENP  168

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             DE+ +D LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++ERNLKELHQVF+D
Sbjct  169   DEKTIDVLISTGESETFLQKAIQEQGRGRILDTISEIQERHDAVKDLERNLKELHQVFMD  228

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiili  609
             MAVLV  QGE+LDDIESQVNRA+S VR G  +L TAR +QKNTRKWT  AII+LL+I+L+
Sbjct  229   MAVLVHEQGEKLDDIESQVNRAHSFVRGGTQELTTARVYQKNTRKWTIIAIIILLLIVLV  288

Query  608   vvLSIRPWK  582
             +VLS++PWK
Sbjct  289   IVLSLQPWK  297



>ref|XP_011046431.1| PREDICTED: syntaxin-121-like [Populus euphratica]
Length=306

 Score =   393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 209/306 (68%), Positives = 257/306 (84%), Gaps = 5/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggg-anlAKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS       S  A P+ H I+MS A + GG  NL KFFEDVE++KD+LK++E
Sbjct  1     MNDLFSGSFSRFH----SEEASPDHHVIQMSEAHSAGGGVNLDKFFEDVESIKDELKELE  56

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++  +++++HEQSKT+HNA+ VK++R++MD DV+LALK+AKLIK RLE LD+SNAANR +
Sbjct  57    RLNENMRSSHEQSKTLHNARAVKDMRSKMDADVALALKRAKLIKVRLEALDRSNAANRTL  116

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCG GSSSDRTRTSVVNGLR KLK+ M  FN LRQKI +EYRETV+RRY+TVTGENPDE
Sbjct  117   PGCGLGSSSDRTRTSVVNGLRKKLKDLMESFNGLRQKISTEYRETVERRYFTVTGENPDE  176

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + LD LISTG+SETF+QKAIQ+QGRG +++T+ EIQERH+AVK++E NLKELHQVF+DMA
Sbjct  177   KTLDLLISTGESETFLQKAIQQQGRGRILDTINEIQERHDAVKDLENNLKELHQVFMDMA  236

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivv  603
             VLVE QGEQLDDIES V RANS VR G  QL TARK Q+N+RKWTC+AII+LLIIIL+V+
Sbjct  237   VLVEHQGEQLDDIESHVQRANSFVRGGTQQLQTARKLQRNSRKWTCYAIIILLIIILVVL  296

Query  602   LSIRPW  585
             LS+RPW
Sbjct  297   LSVRPW  302



>gb|KHG08886.1| Syntaxin-121 protein [Gossypium arboreum]
Length=334

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 260/308 (84%), Gaps = 6/308 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaa-nggganlAKFFEDVEAVKDDLKDIE  1323
             MN+L S SF+  R   GS    P+ H ++M+ ++ +  G NL KFF+DVE++KD+LK++E
Sbjct  1     MNNLFSGSFTRFRSEEGS----PDHHAVQMTESSPSSRGVNLDKFFDDVESIKDELKELE  56

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++   L ++HEQSKT+H+AK V++LRA+MD DV++ALK+AKLIK RLE LD+SNAANR +
Sbjct  57    RLNDDLSSSHEQSKTLHSAKAVRDLRAKMDGDVAMALKKAKLIKVRLEALDRSNAANRSL  116

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTRTSVVNGLR KLK+ M  FN+LR++I SEYRETVQRRY+TVTGENPD+
Sbjct  117   PGCGPGSSSDRTRTSVVNGLRKKLKDSMESFNELRERISSEYRETVQRRYFTVTGENPDD  176

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + LD LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++ER+LK+LHQVFLDMA
Sbjct  177   KTLDLLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDLERHLKDLHQVFLDMA  236

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliii-liv  606
             VLVE QGEQLDDIESQVNRANS VR G ++L TAR +QKNTRKWTC+AIILLL II  +V
Sbjct  237   VLVEAQGEQLDDIESQVNRANSFVRGGTERLQTARTYQKNTRKWTCYAIILLLSIIFFVV  296

Query  605   vLSIRPWK  582
             + ++RPW+
Sbjct  297   IFTVRPWE  304



>ref|XP_004136519.1| PREDICTED: syntaxin-121-like [Cucumis sativus]
 gb|KGN59221.1| hypothetical protein Csa_3G782680 [Cucumis sativus]
Length=307

 Score =   390 bits (1003),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 207/309 (67%), Positives = 254/309 (82%), Gaps = 15/309 (5%)
 Frame = -2

Query  1499  MNDLLS-RSFSLPRENGGSSPAPPESHTIEMSaaanggganlA--KFFEDVEAVKDDLKD  1329
             MNDL S RSFS             ++H +EM   A+     +   KFFEDVE+VKD+LK+
Sbjct  1     MNDLFSSRSFS------------RDAHVVEMGNNASSSPTAVNLDKFFEDVESVKDELKE  48

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             +E++Y +L  +HEQSKT+HNAK VK+LR+RMD DVSLALK+AKLIK RLE LD+SNAANR
Sbjct  49    LERLYSNLHDSHEQSKTLHNAKAVKDLRSRMDTDVSLALKKAKLIKVRLEALDRSNAANR  108

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              + GCGPGSSSDRTRTSVVNGLR KL++ M  FN+LRQ+I SEYRETVQRRYYTVTGENP
Sbjct  109   SLPGCGPGSSSDRTRTSVVNGLRKKLQDSMESFNNLRQQISSEYRETVQRRYYTVTGENP  168

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             DE+ +D LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++ERNLKELHQVF+D
Sbjct  169   DEKTIDVLISTGESETFLQKAIQEQGRGRILDTISEIQERHDAVKDLERNLKELHQVFMD  228

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiili  609
             MAVLV  QGE+LDDIESQVNRA+S VR G  +L TAR +QKNTRKWT  AII+LL+++L+
Sbjct  229   MAVLVHEQGEKLDDIESQVNRAHSFVRGGTQELTTARVYQKNTRKWTIIAIIILLLVVLV  288

Query  608   vvLSIRPWK  582
             +VLS++PWK
Sbjct  289   IVLSLQPWK  297



>ref|XP_004170661.1| PREDICTED: syntaxin-121-like [Cucumis sativus]
Length=307

 Score =   389 bits (1000),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 206/310 (66%), Positives = 254/310 (82%), Gaps = 17/310 (5%)
 Frame = -2

Query  1499  MNDLLS-RSFSLPR---ENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL S RSFS      E G ++ + P +  ++             KFFEDVE+VKD+LK
Sbjct  1     MNDLFSSRSFSRDARVVEMGNNASSSPTAVNLD-------------KFFEDVESVKDELK  47

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             ++E++Y +L  +HEQSKT+HNAK VK+LR+RMD DVSLALK+AKLIK RLE LD+SNAAN
Sbjct  48    ELERLYSNLHDSHEQSKTLHNAKAVKDLRSRMDTDVSLALKKAKLIKVRLEALDRSNAAN  107

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R + GCGPGSSSDRTRTSVVNGLR KL++ M  FN+LRQ+I SEYRETVQRRYYTVTGEN
Sbjct  108   RSLPGCGPGSSSDRTRTSVVNGLRKKLQDSMESFNNLRQQISSEYRETVQRRYYTVTGEN  167

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
             PDE+ +D LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++ERNLKELHQVF+
Sbjct  168   PDEKTIDVLISTGESETFLQKAIQEQGRGRILDTISEIQERHDAVKDLERNLKELHQVFM  227

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiil  612
             DMAVLV  QGE+LDDIESQVNRA+S VR G  +L TAR +QKNTRKWT  AII+LL+++L
Sbjct  228   DMAVLVHEQGEKLDDIESQVNRAHSFVRGGTQELTTARVYQKNTRKWTIIAIIILLLVVL  287

Query  611   ivvLSIRPWK  582
             ++VLS++PWK
Sbjct  288   VIVLSLQPWK  297



>ref|XP_008241070.1| PREDICTED: syntaxin-121 [Prunus mume]
Length=329

 Score =   389 bits (1000),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 195/287 (68%), Positives = 237/287 (83%), Gaps = 5/287 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS  R    S     + H IEMS+A +  G     KFF DVE+VKD+LK++E
Sbjct  1     MNDLFSGSFSRFR----SEQNTNDDHVIEMSSAGSSTGGVNLDKFFGDVESVKDELKELE  56

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +++ +L+++HE SKT+HNAK VK+LR+RMD DV+LALK+AK++K RLE LD+SNAANR +
Sbjct  57    RLHQNLQSSHEHSKTLHNAKAVKDLRSRMDADVTLALKKAKVLKVRLEALDRSNAANRSL  116

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTR SVVNGLR KLK+ M+ FN LRQKI SEYRETVQRRY+TV+GENPDE
Sbjct  117   PGCGPGSSSDRTRISVVNGLRKKLKDSMDSFNSLRQKISSEYRETVQRRYFTVSGENPDE  176

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + LD+LISTG+SETF+QKAIQEQGRG+V++T+ EIQERH+AVK++E+NL+ELHQVFLDMA
Sbjct  177   KTLDRLISTGESETFLQKAIQEQGRGQVLDTIHEIQERHDAVKDMEKNLQELHQVFLDMA  236

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCF  642
             VLV+ QGEQLDDIES V RANS VR G  QL  AR +QKNTRKWTCF
Sbjct  237   VLVQAQGEQLDDIESHVARANSFVRGGTQQLNKARFYQKNTRKWTCF  283



>ref|XP_007202232.1| hypothetical protein PRUPE_ppa008664mg [Prunus persica]
 gb|EMJ03431.1| hypothetical protein PRUPE_ppa008664mg [Prunus persica]
Length=323

 Score =   388 bits (997),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 194/287 (68%), Positives = 236/287 (82%), Gaps = 5/287 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS  R    S     + H IEMS+A +  G     KFF D E+VKD+LK++E
Sbjct  1     MNDLFSGSFSRFR----SETNTNDDHVIEMSSAGSSTGGVNLDKFFGDAESVKDELKELE  56

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +++ +L+++HE SKT+HNAK VK+LR+RMD DV+LALK+AK++K RLE LD+SNAANR +
Sbjct  57    RLHQNLQSSHEHSKTLHNAKAVKDLRSRMDADVTLALKKAKVLKVRLEALDRSNAANRSL  116

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTR SVVNGLR KLK+ M+ FN LRQKI SEYRETVQRRY+TV+GENPDE
Sbjct  117   PGCGPGSSSDRTRISVVNGLRKKLKDSMDSFNSLRQKISSEYRETVQRRYFTVSGENPDE  176

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + LD+LISTG+SETF+QKAIQEQGRG+V++T+ EIQERH+AVK++E+NL+ELHQVFLDMA
Sbjct  177   KTLDRLISTGESETFLQKAIQEQGRGQVLDTIHEIQERHDAVKDMEKNLQELHQVFLDMA  236

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCF  642
             VLV+ QGEQLDDIES V RANS VR G  QL  AR +QKNTRKWTCF
Sbjct  237   VLVQAQGEQLDDIESHVARANSFVRGGTQQLNKARFYQKNTRKWTCF  283



>ref|XP_009343258.1| PREDICTED: syntaxin-121-like [Pyrus x bretschneideri]
 ref|XP_009343261.1| PREDICTED: syntaxin-121-like [Pyrus x bretschneideri]
Length=328

 Score =   388 bits (996),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 213/321 (66%), Positives = 255/321 (79%), Gaps = 10/321 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPP--ESHTIEMSaaanggganlA----KFFEDVEAVKDD  1338
             MNDL S SFS  R    S    P  + H IEM + A  G         KFF DVE+VKD+
Sbjct  1     MNDLFSGSFSRFR----SEEQSPRRDDHVIEMGSTAAAGAGAAGVNLDKFFADVESVKDE  56

Query  1337  LKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNA  1158
             LK++E++Y SL+++HEQSKT+HNA  VK+LR+RMD DV+LALK+AK++K RLE LD+SNA
Sbjct  57    LKELERVYFSLQSSHEQSKTLHNASAVKDLRSRMDADVTLALKKAKVLKVRLEALDRSNA  116

Query  1157  ANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTG  978
             ANR +  CGPGSSSDRTR SVVNGLR KLK+ M+ FN LRQKI SEYRETVQRRYYTV+G
Sbjct  117   ANRSLPNCGPGSSSDRTRISVVNGLRKKLKDSMDSFNALRQKISSEYRETVQRRYYTVSG  176

Query  977   ENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQV  798
             ENPDE+ LD LISTG+SETF+QKAIQEQGRG+V++T+ EIQERH+AVK++ERNL+ELHQV
Sbjct  177   ENPDEKTLDLLISTGESETFLQKAIQEQGRGQVLDTIQEIQERHDAVKDMERNLQELHQV  236

Query  797   FLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiilllii  618
             FLDMAVLV+ QGEQ+DDIE+ V RANS V  G  QL  AR  QKNTRKWTCFAIILLL+I
Sbjct  237   FLDMAVLVQAQGEQIDDIENHVMRANSFVNSGTQQLTKARASQKNTRKWTCFAIILLLVI  296

Query  617   ilivvLSIRPWK*DYYHSNSN  555
             ILIV+LS++PW      +NSN
Sbjct  297   ILIVILSLKPWNWGGGSNNSN  317



>ref|XP_008387116.1| PREDICTED: syntaxin-121 [Malus domestica]
 ref|XP_008350213.1| PREDICTED: syntaxin-121-like [Malus domestica]
Length=334

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/311 (67%), Positives = 250/311 (80%), Gaps = 10/311 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPP--ESHTIEMSaaanggganl----AKFFEDVEAVKDD  1338
             MNDL S SFS  R    S    P  + H IEM + A            KFF DVE+VKD+
Sbjct  1     MNDLFSGSFSRFR----SEEQSPRRDDHVIEMGSTAAARSGTAGVNLDKFFADVESVKDE  56

Query  1337  LKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNA  1158
             LK++E++Y SL+++HEQSKT+HNA  VK+LR+RMD DV+LALK+AK++K RLE LD+SNA
Sbjct  57    LKELERVYFSLQSSHEQSKTLHNASAVKDLRSRMDADVTLALKKAKVLKVRLEALDRSNA  116

Query  1157  ANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTG  978
             ANR +  CGPGSSSDRTR SVVNGLR KLK+ M+ FN LRQKI SEYRETVQRRYYTV+G
Sbjct  117   ANRSLPNCGPGSSSDRTRISVVNGLRKKLKDSMDSFNALRQKISSEYRETVQRRYYTVSG  176

Query  977   ENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQV  798
             +NPDE+ LD LISTG+SETF+QKAIQEQGRG+V++T+ EIQERH+AVK++ERNL+ELHQV
Sbjct  177   QNPDEKTLDLLISTGESETFLQKAIQEQGRGQVLDTIQEIQERHDAVKDMERNLQELHQV  236

Query  797   FLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiilllii  618
             FLDMAVLV+ QGEQ+DDIE+ V RANS V  G  QL  AR  QKNTRKW+CFAIILLL+I
Sbjct  237   FLDMAVLVQAQGEQIDDIENHVMRANSFVNSGTQQLTKARASQKNTRKWSCFAIILLLVI  296

Query  617   ilivvLSIRPW  585
             ILIV+LS++PW
Sbjct  297   ILIVILSLKPW  307



>ref|XP_004303410.1| PREDICTED: syntaxin-121-like [Fragaria vesca subsp. vesca]
Length=303

 Score =   386 bits (991),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/306 (68%), Positives = 248/306 (81%), Gaps = 5/306 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS  R    S P   + H IEMS+A   G      KFF DVE+VKD+LK++E
Sbjct  1     MNDLFSGSFSRFR----SEPDNNDEHVIEMSSATGTGTGVNLDKFFGDVESVKDELKELE  56

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +I+ +L+ AHEQSKT+HNA  VK+LR+RMD DV+LALK+AK+IK RLE LD+SNAANR  
Sbjct  57    RIHQNLQAAHEQSKTLHNANTVKDLRSRMDGDVTLALKKAKVIKVRLEALDRSNAANRSQ  116

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTR SVVNGLR KLK+ M  FN LRQKI  EYRETVQRRYYTV+GENPDE
Sbjct  117   PGCGPGSSSDRTRISVVNGLRKKLKDSMESFNSLRQKISLEYRETVQRRYYTVSGENPDE  176

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + LD LISTGQSETF+QKAIQEQGRG+V++T+ EIQERH+AVK++E+NL ELHQVFLDMA
Sbjct  177   KTLDLLISTGQSETFLQKAIQEQGRGQVLDTINEIQERHDAVKDMEKNLHELHQVFLDMA  236

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivv  603
             VLV+ QGEQLDDIES V RA+S VR G  +L  A+ +Q+NTRKWTC+ IILLL+I LI++
Sbjct  237   VLVQAQGEQLDDIESHVQRASSFVRGGTQELGKAKVYQRNTRKWTCYLIILLLVIALIII  296

Query  602   LSIRPW  585
             LS++PW
Sbjct  297   LSLKPW  302



>gb|EPS62344.1| hypothetical protein M569_12449 [Genlisea aurea]
Length=307

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 211/306 (69%), Positives = 252/306 (82%), Gaps = 1/306 (0%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MN+L SRSFS  R  G  SP PP    I  +    GGG NL +FF+DVEAVK++L D+E 
Sbjct  1     MNNLFSRSFSRFRSEGNQSP-PPRDVEITGAGGGGGGGVNLNRFFDDVEAVKEELADLES  59

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
              Y  L+T HEQS+T+HNA  VKELR RMD D+S ALK+AK+IK RLE LD+SNA+ R + 
Sbjct  60    FYARLQTDHEQSRTLHNAAAVKELRTRMDGDISSALKKAKVIKVRLEALDRSNASQRSLP  119

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KL + MN+FNDLRQ+I SEYRET+QRRYY VTGENPDE+
Sbjct  120   GCGPGSSSDRTRTSVVNGLRKKLYDSMNRFNDLRQRIGSEYRETIQRRYYAVTGENPDEK  179

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              LD LI TG+SE F+Q AIQ+QGR ++++T+MEIQERH+AVKE+ERNL ELHQ+FLDMAV
Sbjct  180   TLDHLIDTGESEKFLQTAIQQQGRAQILDTIMEIQERHDAVKEIERNLTELHQIFLDMAV  239

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LVE+QGEQ+DDIE+QVNRA+SIVR GA QL  AR+HQKNTRKWTC  II+LLII+LIV+L
Sbjct  240   LVESQGEQIDDIENQVNRASSIVRVGARQLEVARRHQKNTRKWTCIGIIILLIIVLIVLL  299

Query  599   SIRPWK  582
             SIRPW+
Sbjct  300   SIRPWQ  305



>ref|XP_009348873.1| PREDICTED: syntaxin-121-like [Pyrus x bretschneideri]
Length=326

 Score =   385 bits (990),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 235/291 (81%), Gaps = 8/291 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPP--ESHTIEMSaaanggganlA--KFFEDVEAVKDDLK  1332
             MNDL S SFS  R    S    P  + H IEM + A  G A +   KFF DVE+VKD+LK
Sbjct  1     MNDLFSGSFSRFR----SEEQSPRRDDHVIEMGSTAGSGAAGVNLDKFFADVESVKDELK  56

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             ++E++Y SL+++HEQSKT+HNA  VK+LR+RMD DV+LALK+AK++K RLE LD+SNAAN
Sbjct  57    ELERVYFSLQSSHEQSKTLHNATAVKDLRSRMDADVTLALKKAKVLKVRLEALDRSNAAN  116

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R +  CGPGSSSDRTR SVVNGLR KLK+ M+ FN LRQKI SEYRETVQRRYYTV+GEN
Sbjct  117   RSLPNCGPGSSSDRTRISVVNGLRKKLKDSMDSFNALRQKISSEYRETVQRRYYTVSGEN  176

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
             PDE+ LD LISTG+SETF+QKAIQEQGRG+V++T+ EIQERH+AVK++ERNL+ELHQVFL
Sbjct  177   PDEKTLDLLISTGESETFLQKAIQEQGRGQVLDTIQEIQERHDAVKDMERNLQELHQVFL  236

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DMAVLV+ QGEQ+DDIE+ V RANS V  G  QL  AR  QKNTRKWTC+A
Sbjct  237   DMAVLVQAQGEQIDDIENHVMRANSFVSRGTQQLTKARASQKNTRKWTCYA  287



>ref|XP_010543863.1| PREDICTED: syntaxin-121-like [Tarenaya hassleriana]
Length=340

 Score =   385 bits (988),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 233/287 (81%), Gaps = 4/287 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS  R      P+P     ++M+ A    G     KFFEDVE+VKD+LK+++
Sbjct  1     MNDLFSGSFSRFRSG---EPSPRRGGGVQMTEAVGSTGGVNLDKFFEDVESVKDELKELD  57

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++  +L++ HEQSKT+HNAK VK+LR++MD DV+ ALK+AK+IK +LE LD+SNAANR +
Sbjct  58    RLNDTLQSCHEQSKTLHNAKAVKDLRSKMDGDVAAALKKAKMIKVKLEALDRSNAANRSL  117

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTRTSVVNGLR KLK+ M  FN LR+KI SEYRETVQRRY+TVTGENP+E
Sbjct  118   PGCGPGSSSDRTRTSVVNGLRKKLKDSMESFNRLREKISSEYRETVQRRYFTVTGENPNE  177

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             E LD+LISTG+SE F+QKAIQEQGRG +++T+ EIQERH+AVKE+E+NLKELHQVFLDMA
Sbjct  178   ETLDRLISTGESERFLQKAIQEQGRGRILDTINEIQERHDAVKEIEKNLKELHQVFLDMA  237

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCF  642
             VLVE QG QLDDIES V RA+S VR G +QL TAR +QKNTRKWTC+
Sbjct  238   VLVEHQGAQLDDIESHVARASSFVRGGTEQLHTARVYQKNTRKWTCY  284



>ref|XP_010058995.1| PREDICTED: syntaxin-121 [Eucalyptus grandis]
 gb|KCW90443.1| hypothetical protein EUGRSUZ_A02574 [Eucalyptus grandis]
Length=301

 Score =   382 bits (982),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/287 (66%), Positives = 236/287 (82%), Gaps = 7/287 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLSRSFS  R+NG       + H IE++    G GANL KFFED E++KD+LK++E 
Sbjct  1     MNDLLSRSFSPSRDNG-------DFHDIELTGGGGGAGANLDKFFEDAESIKDELKELET  53

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +   L+++HEQSKT+HNA+ VK+LRARMD DV+ ALK+AK++K RLE LD++N  NR + 
Sbjct  54    LQRRLQSSHEQSKTLHNARAVKDLRARMDSDVATALKKAKVVKVRLEALDRANTTNRNLP  113

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVV+G+R KLK+ M  FN LR+KI SEY+ETV+RRY+TVTGE+PDE 
Sbjct  114   GCGPGSSSDRTRTSVVHGMRKKLKDNMEAFNRLREKISSEYKETVKRRYFTVTGEDPDER  173

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQEQGRG V++T+ EIQERH+AVK++ERNLKELHQVFLDMAV
Sbjct  174   TVDLLISTGESETFLQKAIQEQGRGRVLDTIQEIQERHDAVKDMERNLKELHQVFLDMAV  233

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LV++QGEQLDDIESQV RANS+V+ G   L  AR +QKN+RKWTCF 
Sbjct  234   LVQSQGEQLDDIESQVARANSLVQQGTGHLQEARWYQKNSRKWTCFG  280



>ref|XP_002263986.1| PREDICTED: syntaxin-121 [Vitis vinifera]
Length=324

 Score =   383 bits (984),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 204/307 (66%), Positives = 250/307 (81%), Gaps = 10/307 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  R     S  PP S  +EM+++  G   +  KFFEDVE++K++L+++E 
Sbjct  1     MNDLFSGSFSRFR-----SEEPPPS--VEMTSSTAGVNLD--KFFEDVESIKEELREMES  51

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +   L  AHEQSKT+HNA  VKELR+RMD  VSLALK+AKLIK RLE LD+SNAANR + 
Sbjct  52    LQQKLHDAHEQSKTLHNANSVKELRSRMDSHVSLALKKAKLIKLRLEALDRSNAANRSLP  111

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KL++ M+ F  +R +I SEYRETVQRRY+TVTGENPDE+
Sbjct  112   GCGPGSSSDRTRTSVVNGLRKKLRDSMDAFTSIRNQISSEYRETVQRRYFTVTGENPDEK  171

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQEQGRG V++T+ EI+ERHE+VKE+ERNLKELHQVFLDMAV
Sbjct  172   TVDLLISTGESETFLQKAIQEQGRGRVLDTISEIRERHESVKELERNLKELHQVFLDMAV  231

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LV+ QGEQLDDIESQV RANS V  G  QL TARKHQ ++RKWTC+ II+L++IIL++VL
Sbjct  232   LVQAQGEQLDDIESQVARANSFVTGGTQQLQTARKHQISSRKWTCYGIIILIVIILLIVL  291

Query  599   -SIRPWK  582
              ++RPW+
Sbjct  292   FTVRPWE  298



>ref|XP_008391982.1| PREDICTED: syntaxin-121-like [Malus domestica]
 ref|XP_008351507.1| PREDICTED: syntaxin-121-like [Malus domestica]
Length=326

 Score =   382 bits (982),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 234/291 (80%), Gaps = 8/291 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPP--ESHTIEMSaaanggganlA--KFFEDVEAVKDDLK  1332
             MNDL S SFS  R    S    P  + H IEM + A  G A +   KFF DVE+VKD+LK
Sbjct  1     MNDLFSGSFSRFR----SEEQSPRRDDHVIEMGSTAGSGAAGVNLDKFFADVESVKDELK  56

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             ++E++Y SL+++HE+SKT+HNA  VK+LR+RMD DV+LALK+AK++K RLE LD+SNAAN
Sbjct  57    ELERVYFSLQSSHEKSKTLHNATAVKDLRSRMDADVTLALKKAKVLKVRLEALDRSNAAN  116

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R +  CGPGSSSDRTR SVVNGLR KLK+ M+ FN LRQKI SEYRETVQRRYYTV+GEN
Sbjct  117   RSLPNCGPGSSSDRTRISVVNGLRKKLKDSMDSFNALRQKISSEYRETVQRRYYTVSGEN  176

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
             PDE+ LD LISTG+SETF+QKAIQEQGRG+V++T+ EIQERH+AVK++ERNL+ELHQVFL
Sbjct  177   PDEKTLDLLISTGESETFLQKAIQEQGRGQVLDTIQEIQERHDAVKDMERNLQELHQVFL  236

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DMAVLV+ QG Q+DDIE+ V RANS V  G  QL  AR  QKNTRKWTC+A
Sbjct  237   DMAVLVQAQGXQIDDIENHVMRANSFVSRGTQQLTKARASQKNTRKWTCYA  287



>ref|XP_010036588.1| PREDICTED: syntaxin-121 [Eucalyptus grandis]
 gb|KCW48199.1| hypothetical protein EUGRSUZ_K01922 [Eucalyptus grandis]
Length=333

 Score =   383 bits (983),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 261/321 (81%), Gaps = 10/321 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSP---APPESHTIEM----SaaanggganlAKFFEDVEAVKD  1341
             MNDL SRSFS  R +   SP   A    + +EM    + A + GGANL KFFEDVE +K+
Sbjct  1     MNDLFSRSFS--RFHSDRSPSRGASDRGYDVEMGAPPAPAPSSGGANLDKFFEDVECIKE  58

Query  1340  DLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSN  1161
             +LK++E ++  L+++HEQSKT+HNA+ VK+LR+RM+ DV+ ALK+AK++K RLE LD+SN
Sbjct  59    ELKELESLHQRLRSSHEQSKTLHNARAVKDLRSRMEGDVTAALKKAKVVKVRLEALDRSN  118

Query  1160  AANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVT  981
             AANR + GCGPGSSSDRTRTSVV+GLR KL++ M  FN LRQ I SEYRETVQRRY+TVT
Sbjct  119   AANRSLPGCGPGSSSDRTRTSVVSGLRKKLQDSMESFNALRQLISSEYRETVQRRYFTVT  178

Query  980   GENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQ  801
             GENPDE  LD LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E+NLKELHQ
Sbjct  179   GENPDERTLDLLISTGESETFLQKAIQEQGRGRILDTIQEIQERHDAVKDMEKNLKELHQ  238

Query  800   VFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA-iilll  624
             VFLDMAVLV++QGEQLDDIES V RANS VR G ++L TARK QKNTRKWTC+A IILL+
Sbjct  239   VFLDMAVLVQSQGEQLDDIESHVARANSFVRGGTERLQTARKLQKNTRKWTCYAIIILLV  298

Query  623   iiilivvLSIRPWK*DYYHSN  561
             I++ +V+ ++RPW+ +   SN
Sbjct  299   IVLFVVLFTVRPWEKNNSSSN  319



>ref|XP_007203038.1| hypothetical protein PRUPE_ppa022754mg [Prunus persica]
 gb|EMJ04237.1| hypothetical protein PRUPE_ppa022754mg [Prunus persica]
Length=293

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/286 (66%), Positives = 227/286 (79%), Gaps = 12/286 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS SFS          A PE H IEM+ +         KFF+DV+AV+ +L +++K
Sbjct  1     MNDLLSSSFS---------GASPEHHVIEMTPSKGDDLG---KFFQDVDAVQSELDELQK  48

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +  SL+++HEQSKT+HNAK VKELR RMD DV LALK+AK++K RL+ LD+SNAANR + 
Sbjct  49    LNKSLRSSHEQSKTLHNAKAVKELRTRMDADVHLALKKAKILKVRLDALDRSNAANRSLP  108

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KLK+ M+ FNDLRQKI SE+RETVQRRY+TVTG+NPDE+
Sbjct  109   GCGPGSSSDRTRTSVVNGLRKKLKDSMDSFNDLRQKISSEHRETVQRRYFTVTGDNPDEK  168

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQEQGRG V++T+ EIQERH+ VK +ERNL ELHQVF+DMAV
Sbjct  169   TVDLLISTGESETFLQKAIQEQGRGRVLDTISEIQERHDGVKAMERNLNELHQVFMDMAV  228

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCF  642
             LV+ QGEQLDDI+S V RANS V  G  QL  AR  QKNTRKWTC+
Sbjct  229   LVQAQGEQLDDIQSHVERANSYVHAGNQQLQKARFLQKNTRKWTCY  274



>ref|XP_002884867.1| SYP121 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61126.1| SYP121 [Arabidopsis lyrata subsp. lyrata]
Length=342

 Score =   379 bits (972),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 234/291 (80%), Gaps = 6/291 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSP---APPESHTIEMSaaanggganl-AKFFEDVEAVKDDLK  1332
             MNDL S SFS  R  G  SP   AP     ++M+  A   G     KFFEDVE+VK++LK
Sbjct  1     MNDLFSSSFS--RFRGEPSPRRDAPGGGDGLQMANPAGSTGGVNLDKFFEDVESVKEELK  58

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             +++++  +L + HEQSKT+HNAK VK+LR++MD DV +ALK+AK+IK +LE LD++NAAN
Sbjct  59    ELDRLNETLSSCHEQSKTLHNAKAVKDLRSKMDGDVGVALKKAKMIKVKLEALDRANAAN  118

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R + GCGPGSSSDRTRTSV+NGLR KLK+ M+ FN LR+ I SEYRETVQRRY+TVTGEN
Sbjct  119   RSLPGCGPGSSSDRTRTSVLNGLRKKLKDSMDSFNRLRELISSEYRETVQRRYFTVTGEN  178

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
             PDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK++E+NL+ELHQVFL
Sbjct  179   PDEGTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVKDIEKNLRELHQVFL  238

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DMAVLVE QG QLDDIES V RA+S +R G DQL TAR +QKNTRKWTC+A
Sbjct  239   DMAVLVEHQGAQLDDIESHVGRASSFIRGGTDQLHTARVYQKNTRKWTCYA  289



>ref|XP_009348866.1| PREDICTED: syntaxin-121-like [Pyrus x bretschneideri]
Length=295

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 197/304 (65%), Positives = 240/304 (79%), Gaps = 13/304 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS SFS          A P+ H IEM+A +N       KFF+DVE+V+++L +++K
Sbjct  1     MNDLLSSSFS---------EASPDHHVIEMTATSNELN----KFFQDVESVQNELNELQK  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             I  SL++AHEQSK++HN+K VK+LR RMD DV  ALK AK++K +L+ LD+SNAANR + 
Sbjct  48    INKSLQSAHEQSKSLHNSKAVKDLRTRMDADVHTALKNAKVLKVQLDALDKSNAANRSLP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KLK+ M+ FNDLR KI SE+RETVQRRY+TVTGENPD++
Sbjct  108   GCGPGSSSDRTRTSVVNGLRKKLKDSMDSFNDLRNKISSEHRETVQRRYFTVTGENPDDK  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              LD LISTG+SETF+QKAIQEQGRG V++T+ EIQERH+ VK +ERNL ELHQVF+DMAV
Sbjct  168   TLDLLISTGESETFLQKAIQEQGRGRVLDTIQEIQERHDGVKAMERNLNELHQVFMDMAV  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LV+ QGEQLDDI+  V RANS V  G  QL  AR  QKNTRKWTC+ II+LLIII I++ 
Sbjct  228   LVQAQGEQLDDIQGHVERANSFVHSGTQQLQKARFLQKNTRKWTCYGIIILLIIIGIILA  287

Query  599   SIRP  588
             SI P
Sbjct  288   SILP  291



>ref|XP_010247567.1| PREDICTED: syntaxin-121 [Nelumbo nucifera]
Length=336

 Score =   376 bits (965),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 244/307 (79%), Gaps = 3/307 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM--SaaanggganlAKFFEDVEAVKDDLKDI  1326
             MNDL S SFS  R N      PP S       +      G NL KFFEDVE +KD+LK+ 
Sbjct  1     MNDLFSGSFSRFRSND-VDHEPPYSGGGGGGGAVQMGTVGVNLDKFFEDVEGIKDELKEE  59

Query  1325  EKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRK  1146
             E+++  L+ +HE+SKT+HNA+ +K+LRARMD DV+LALK+AK+IK RLE L+++NAANR 
Sbjct  60    ERLHQRLQDSHEESKTLHNARSIKDLRARMDADVALALKKAKMIKVRLEALERANAANRS  119

Query  1145  VYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPD  966
             + GCGPGSSSDRTRTSVV+GLR KLK+ M  FN LR++I +EY+ETV+RRY+TVTGE PD
Sbjct  120   IPGCGPGSSSDRTRTSVVSGLRKKLKDQMESFNTLRERISTEYKETVERRYFTVTGEKPD  179

Query  965   EEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDM  786
             +  +D LISTGQSE   QK IQEQGRG VM+ V EIQERH+AVKE+E+NL+ELHQVFLDM
Sbjct  180   DRTVDALISTGQSENLFQKVIQEQGRGTVMDIVSEIQERHDAVKEIEKNLRELHQVFLDM  239

Query  785   AVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiiliv  606
             AVLV+TQGEQLDDIESQV RANS +R G ++L+TARK QKNTRKW CF I LLLI++LI+
Sbjct  240   AVLVQTQGEQLDDIESQVARANSFIRGGTEKLVTARKLQKNTRKWACFGITLLLIVVLII  299

Query  605   vLSIRPW  585
             +LS++PW
Sbjct  300   ILSLKPW  306



>gb|AAU04512.1| PEN1 [Solanum tuberosum]
Length=239

 Score =   372 bits (954),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVEA+KD+LK++EKIY  L++++E+SKT+HNAK VK+LR++MD DVS+ALK+AK I
Sbjct  11    KFFEDVEAIKDELKNLEKIYAQLQSSNEKSKTLHNAKAVKDLRSKMDDDVSMALKKAKFI  70

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K RLE LD+SNA+NR +  CGPGSSSDRTRTSVVNGLR KL E +NQFN+LRQK+ +EYR
Sbjct  71    KVRLEALDRSNASNRSLPECGPGSSSDRTRTSVVNGLRKKLLESLNQFNELRQKMATEYR  130

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRYYTVTGENPDE VLD LISTGQSETF+QKA ++QGRG+VM+T+MEIQERHEAVK
Sbjct  131   ETVQRRYYTVTGENPDETVLDTLISTGQSETFLQKAYKKQGRGQVMDTIMEIQERHEAVK  190

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQL  690
             E+ERNLKELHQVFLDMAVLVE+QGEQLDDIESQVNRANS VR GA QL
Sbjct  191   EIERNLKELHQVFLDMAVLVESQGEQLDDIESQVNRANSYVRGGAQQL  238



>ref|XP_004303419.1| PREDICTED: syntaxin-121-like [Fragaria vesca subsp. vesca]
Length=293

 Score =   374 bits (959),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 182/286 (64%), Positives = 225/286 (79%), Gaps = 11/286 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS SFS          A P+ H IEM++          KFFEDV+ ++ +L D++K
Sbjct  1     MNDLLSNSFS---------QASPDHHVIEMTSFDASSDLK--KFFEDVDLIQTELNDLQK  49

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +  SLK+AHEQSK++H AK+VK+LR RMD DV+LALK  KL+K RLE LD+SN + R + 
Sbjct  50    LNTSLKSAHEQSKSLHKAKEVKDLRTRMDADVNLALKAVKLLKVRLETLDRSNTSARSLP  109

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVV+GLR KLK+ M  FNDLRQKI SEY+ET+QRRY+TVTGENPD++
Sbjct  110   GCGPGSSSDRTRTSVVSGLRKKLKDSMESFNDLRQKISSEYKETIQRRYFTVTGENPDDK  169

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQ+QGRG+V++T+ EIQERH  VK +ERNL ELHQVFLDMAV
Sbjct  170   TIDLLISTGESETFLQKAIQQQGRGQVLDTIYEIQERHNGVKAMERNLNELHQVFLDMAV  229

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCF  642
             LV+ QGEQ+D+IES V+RA+S V+HG  QL  AR  QKNTRKWTC+
Sbjct  230   LVQAQGEQIDNIESHVDRASSFVQHGNQQLQKARFLQKNTRKWTCY  275



>ref|XP_003590328.1| Syntaxin-121 [Medicago truncatula]
 gb|ACJ84399.1| unknown [Medicago truncatula]
 gb|AES60579.1| syntaxin of plants 122 protein [Medicago truncatula]
Length=306

 Score =   374 bits (960),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 186/286 (65%), Positives = 233/286 (81%), Gaps = 2/286 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSa-aanggganlAKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS  R +   SP     H IEMS+      G +L KFFE+VE VK++LK+++
Sbjct  1     MNDLFSGSFSRFRNSDQVSP-DNHHHVIEMSSPNTAQTGVHLDKFFEEVEGVKEELKELD  59

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++Y SL+ +HE+SKT+H+AK VK++R++MD DV+LALK+AKL+K RLE LD+SN A+R +
Sbjct  60    RLYESLRVSHERSKTLHSAKAVKDIRSKMDADVALALKKAKLVKLRLEALDRSNEASRSL  119

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              G GPGSSSDRTRTSVV+GLR KLK+ M+ FN+LRQ+I SEYRETVQRRYYTVTGENPD+
Sbjct  120   PGAGPGSSSDRTRTSVVSGLRKKLKDSMDSFNNLRQQISSEYRETVQRRYYTVTGENPDD  179

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + +D LISTG+SETF+QKAIQ+QGR  +M+T+ EIQERH+ VKE+ERNL ELHQVF+DM+
Sbjct  180   KTVDLLISTGESETFLQKAIQQQGRANIMDTIQEIQERHDTVKEIERNLMELHQVFMDMS  239

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             VLV++QGEQLD+IES V RANS VR G  QL  ARKHQ NTRKWTC
Sbjct  240   VLVQSQGEQLDNIESHVARANSYVRGGVQQLHVARKHQMNTRKWTC  285



>ref|XP_004497646.1| PREDICTED: syntaxin-121-like [Cicer arietinum]
Length=332

 Score =   375 bits (962),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 251/310 (81%), Gaps = 7/310 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggg---anlAKFFEDVEAVKDDLKD  1329
             MN+L S SFS  R    S   P   H IEMS           NL KFF+DVE VKDDLK+
Sbjct  1     MNNLFSGSFSRFRSEETS---PDRHHVIEMSDTGANSTGGRVNLDKFFDDVEGVKDDLKE  57

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             +E I   L+ +HE+SKT+H+AK VKELR+RMD DVS+ALK+AK++K +LE L++SNAANR
Sbjct  58    LEGISNRLEKSHEKSKTIHDAKSVKELRSRMDDDVSVALKKAKMVKLKLEALERSNAANR  117

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              + GCGPGSSSDRTR+SVVNGL+ KLK+ M+ FN LR+ I SEYRETVQRRY+TVTGENP
Sbjct  118   NLPGCGPGSSSDRTRSSVVNGLKKKLKDSMDTFNRLRELISSEYRETVQRRYFTVTGENP  177

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             D++ LD LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQVFLD
Sbjct  178   DDKTLDLLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDLEKSLLELHQVFLD  237

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiili  609
             M V+V+ QGEQLD+IE+ V RA+S V +GA+QL TARKHQKNTRKWTC+ IIL+LII+L+
Sbjct  238   MTVMVQFQGEQLDNIENHVARASSFVHNGAEQLQTARKHQKNTRKWTCYCIILILIIVLL  297

Query  608   vvL-SIRPWK  582
             VVL +++PWK
Sbjct  298   VVLFTVKPWK  307



>gb|EYU38684.1| hypothetical protein MIMGU_mgv1a010962mg [Erythranthe guttata]
Length=296

 Score =   373 bits (958),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 202/307 (66%), Positives = 250/307 (81%), Gaps = 13/307 (4%)
 Frame = -2

Query  1499  MNDLLSR-SFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIE  1323
             MNDL S  SFS  R+         +SH+IEM+           +FFEDVE++K++L ++E
Sbjct  1     MNDLFSAGSFSRYRDQ--------DSHSIEMTTGGVNLD----RFFEDVESIKEELTNLE  48

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
              +Y +L  AHEQSKT+HNA  VK LR++MD DV+ +LK+AKL+K +LE LD+SNAANR V
Sbjct  49    TLYTNLNAAHEQSKTLHNAAAVKSLRSKMDADVAASLKKAKLVKVKLEALDRSNAANRSV  108

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSSSDRTRTSVVNGLR KL + MN+FNDLRQK+ SEYRETVQRRYYTVTGENPDE
Sbjct  109   PGCGPGSSSDRTRTSVVNGLRKKLHDAMNRFNDLRQKMGSEYRETVQRRYYTVTGENPDE  168

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             ++LD LI TG+SE F+QKAIQEQGRG+VM+TVMEIQERH+AVKE+E+NL ELHQVFLDMA
Sbjct  169   KLLDSLIETGESENFLQKAIQEQGRGQVMDTVMEIQERHDAVKEMEKNLMELHQVFLDMA  228

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivv  603
             VLV++QGEQL+DIE QV RA S VR G +QL++AR  QKN+RKW CF I+L+L++ILI+V
Sbjct  229   VLVQSQGEQLNDIEGQVMRAKSFVRGGTEQLVSARTLQKNSRKWACFGIVLVLVVILIIV  288

Query  602   LSIRPWK  582
             LS++PWK
Sbjct  289   LSLQPWK  295



>ref|XP_008241071.1| PREDICTED: syntaxin-121-like [Prunus mume]
Length=293

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/266 (68%), Positives = 217/266 (82%), Gaps = 3/266 (1%)
 Frame = -2

Query  1439  APPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQ  1260
             A P+ H IEM+ +         KFF+DVEAV+ +L +++K+  SL++AHEQSKT+HNAK 
Sbjct  12    ASPDHHVIEMTPSKGDDLG---KFFQDVEAVQSELDELQKLNKSLRSAHEQSKTLHNAKA  68

Query  1259  VKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLR  1080
             VKELR RMD DV LALK+AK++K RL+ LD+SN ANR + GCGPGSSSDRTRTSVVNGLR
Sbjct  69    VKELRTRMDADVHLALKKAKILKVRLDALDRSNVANRSLPGCGPGSSSDRTRTSVVNGLR  128

Query  1079  NKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQ  900
              KLK+ M+ FNDLRQKI SEYRETVQRRY+TVTG+NPDE+ +D LISTG+SETF+QKAIQ
Sbjct  129   KKLKDSMDSFNDLRQKISSEYRETVQRRYFTVTGDNPDEKTVDLLISTGESETFLQKAIQ  188

Query  899   EQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRAN  720
             EQGRG V++T+ EIQERH+ VK +ERNL ELHQVF+DMAVLV+ QGEQLDDI+S V RAN
Sbjct  189   EQGRGRVLDTISEIQERHDGVKAMERNLNELHQVFMDMAVLVQAQGEQLDDIQSHVQRAN  248

Query  719   SIVRHGADQLLTARKHQKNTRKWTCF  642
             S V  G  QL  AR  QKNTRKWTC+
Sbjct  249   SYVHAGNQQLQKARFFQKNTRKWTCY  274



>gb|KFK38547.1| hypothetical protein AALP_AA3G128100 [Arabis alpina]
Length=346

 Score =   374 bits (961),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/245 (72%), Positives = 215/245 (88%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK++++I  +LK+ HEQSKT+HNAK VK+LR++MD DV +ALK+AK+I
Sbjct  46    KFFEDVESVKEELKELDRINETLKSCHEQSKTLHNAKAVKDLRSKMDGDVGVALKKAKMI  105

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD++NAANR + GCGPGSSSDRTR+SV+NGLR KLK+ M+ FN LR+ I SEYR
Sbjct  106   KVKLEALDRANAANRSLPGCGPGSSSDRTRSSVLNGLRKKLKDSMDSFNRLRELISSEYR  165

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRY+TVTGENPDE  LD+LISTG+SE FMQKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  166   ETVQRRYFTVTGENPDEGTLDRLISTGESERFMQKAIQEQGRGRVLDTINEIQERHDAVK  225

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G DQL TAR +QKNTRK
Sbjct  226   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTDQLQTARVYQKNTRK  285

Query  653   WTCFA  639
             WTCFA
Sbjct  286   WTCFA  290



>ref|XP_003519111.1| PREDICTED: syntaxin-121-like [Glycine max]
Length=305

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/288 (66%), Positives = 228/288 (79%), Gaps = 7/288 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl---AKFFEDVEAVKDDLKD  1329
             MNDL S SFS  R N   SP     H IEM+A A+          KFF++VE VK++LK+
Sbjct  1     MNDLFSGSFS--RTNDQVSP--DHHHVIEMAATASPTAEGSVNLEKFFQEVEQVKEELKE  56

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             +E+++ +L+ +HE+SK +H+AK VKELR RMD DV+LALK AKL+K RLE LD+SN  ++
Sbjct  57    LERLHENLRGSHEKSKILHSAKAVKELRLRMDSDVTLALKNAKLVKVRLEALDRSNQTSQ  116

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              + G GPGSSSDRTRTSVV+GLR KLK+ M+ FN LRQKI SEYRETVQRRYYTVTGENP
Sbjct  117   SLPGSGPGSSSDRTRTSVVSGLRKKLKDSMDSFNSLRQKISSEYRETVQRRYYTVTGENP  176

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             D++ +D LISTG+SETF+QKAIQ+QGR  VM+T+ EIQERH+ VKE+ERNL ELHQVFLD
Sbjct  177   DDKTIDLLISTGESETFLQKAIQQQGRASVMDTIQEIQERHDTVKEIERNLNELHQVFLD  236

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             MAVLV++QGEQLDDIES V RANS VR G  QL  ARKHQKNTRKWTC
Sbjct  237   MAVLVQSQGEQLDDIESHVARANSYVRGGVQQLHVARKHQKNTRKWTC  284



>ref|XP_010464886.1| PREDICTED: syntaxin-121-like isoform X1 [Camelina sativa]
Length=342

 Score =   373 bits (957),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 188/291 (65%), Positives = 234/291 (80%), Gaps = 7/291 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAP----PESHTIEMSaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL S SFS  R   G  P+P    P    +   A  + GG NL KFFEDVE++K++LK
Sbjct  1     MNDLFSSSFSRFR---GGEPSPRRDAPGGVQMTNPAVGSTGGVNLDKFFEDVESIKEELK  57

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             +++++  SL ++HEQSKT+HNAK VK+LR++MD DV +ALK+AK+IK +LE LD++NAAN
Sbjct  58    ELDRLNESLSSSHEQSKTLHNAKAVKDLRSQMDGDVGVALKKAKMIKVKLEALDRANAAN  117

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R + GCGPGSSSDRTRTSV+NGLR KL + M+ FN LR+ I SEYRETVQRRY+TVTGEN
Sbjct  118   RSLPGCGPGSSSDRTRTSVLNGLRKKLMDSMDSFNRLRELISSEYRETVQRRYFTVTGEN  177

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
             PDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK++E+NL+ELHQVFL
Sbjct  178   PDEGTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVKDIEKNLRELHQVFL  237

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DMAVLVE QG QLDDIES V RA+S +R G + L TAR +QKNTRKWTC+A
Sbjct  238   DMAVLVEHQGAQLDDIESHVGRASSFIRGGTEHLQTARVYQKNTRKWTCYA  288



>ref|XP_010498135.1| PREDICTED: syntaxin-121-like isoform X1 [Camelina sativa]
Length=341

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 185/290 (64%), Positives = 235/290 (81%), Gaps = 6/290 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPP-ESHTIEMSaaanggganlA--KFFEDVEAVKDDLKD  1329
             MNDL S SFS  R   G  P+P  +   ++M+  A G    +   KFFEDVE+VK++LK+
Sbjct  1     MNDLFSSSFSRFR---GGEPSPRRDDGGVQMANPAVGSTGGVNLDKFFEDVESVKEELKE  57

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             ++++  +L ++HEQSKT+HNAK VK+LR++MD DV +ALK+AK+IK +LE LD++NAANR
Sbjct  58    LDRLNETLSSSHEQSKTLHNAKAVKDLRSQMDGDVGVALKKAKMIKVKLEALDRANAANR  117

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              + GCGPGSSSDRTRTSV+NGLR KLK+ M+ FN LR+ I SEY+ETVQRRY+TVTGENP
Sbjct  118   SLPGCGPGSSSDRTRTSVLNGLRKKLKDSMDSFNRLRELISSEYKETVQRRYFTVTGENP  177

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             DE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK++E+NL+ELHQVFLD
Sbjct  178   DEGTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVKDIEKNLRELHQVFLD  237

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             MAVLVE QG QLDDIES V RA+S +R G + L TAR +QKNTRKWTC+A
Sbjct  238   MAVLVEHQGAQLDDIESHVGRASSFIRGGTEHLQTARVYQKNTRKWTCYA  287



>ref|XP_006407406.1| hypothetical protein EUTSA_v10021072mg [Eutrema salsugineum]
 gb|ESQ48859.1| hypothetical protein EUTSA_v10021072mg [Eutrema salsugineum]
Length=342

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/245 (71%), Positives = 215/245 (88%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L++ HEQSKT+HNAK VK+LR++MD DV +ALK+AK+I
Sbjct  45    KFFEDVESVKEELKELDRLNETLQSCHEQSKTLHNAKAVKDLRSKMDADVGVALKKAKMI  104

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SNAANR + GCGPGSSSDRTRTSV+NGLR KLK+ M+ FN LR+ I SEYR
Sbjct  105   KVKLEALDRSNAANRSLPGCGPGSSSDRTRTSVLNGLRKKLKDSMDSFNRLRELISSEYR  164

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRY+TVTGENPDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  165   ETVQRRYFTVTGENPDEGTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  224

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NLKELHQVFLDMAVLVE QG QLDDIES V RA+S +R G DQL TAR +QKNTRK
Sbjct  225   DIEKNLKELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTDQLQTARVYQKNTRK  284

Query  653   WTCFA  639
             WTC+A
Sbjct  285   WTCYA  289



>ref|XP_003519112.1| PREDICTED: syntaxin-121-like [Glycine max]
Length=335

 Score =   372 bits (954),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 207/311 (67%), Positives = 255/311 (82%), Gaps = 8/311 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM----SaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL S SFS  R +  S   P   H IEM    S+   GG  NL KFFEDVE VK++LK
Sbjct  1     MNDLFSGSFSRFRSDQSS---PDRHHDIEMGATASSGGRGGEVNLDKFFEDVEGVKEELK  57

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             ++E +  SL+++HEQSKT+HNAK V++LRARMD DVS ALK+AKLIK +LE L++SNAAN
Sbjct  58    ELEGLAQSLRSSHEQSKTLHNAKAVRDLRARMDGDVSAALKKAKLIKLKLEALERSNAAN  117

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R + GCGPGSSSDRTRTSVVNGL+ KLK+ M  FN++RQ + SEYRETVQRRY+TVTGEN
Sbjct  118   RNMPGCGPGSSSDRTRTSVVNGLKKKLKDAMESFNEIRQLVSSEYRETVQRRYFTVTGEN  177

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
             PD++ LD LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVKE+E+NLKELHQVFL
Sbjct  178   PDDKTLDLLISTGESETFLQKAIQEQGRGRILDTITEIQERHDAVKEIEKNLKELHQVFL  237

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA-iillliii  615
             DM VLV+ QGEQLDDIES V RA+S VR GA+QL TARKHQKNTRKWTC+  I+LL+II+
Sbjct  238   DMTVLVQHQGEQLDDIESHVARAHSFVRTGAEQLQTARKHQKNTRKWTCYCIILLLVIIL  297

Query  614   livvLSIRPWK  582
              +V+ +++PW+
Sbjct  298   FVVLFTVKPWE  308



>gb|AFK46658.1| unknown [Medicago truncatula]
Length=306

 Score =   370 bits (950),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/286 (64%), Positives = 230/286 (80%), Gaps = 2/286 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggg-anlAKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS  R +   SP     H IEMS+        +L KFFE+VE VK++LK+++
Sbjct  1     MNDLFSGSFSRFRNSDQVSP-DNHHHVIEMSSPNTAQTGVHLDKFFEEVEGVKEELKELD  59

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++Y SL+ +HE SKT+H+AK VK++R++MD DV+LALK+AKL+K RLE LD+SN A+R +
Sbjct  60    RLYESLRVSHEGSKTLHSAKAVKDIRSKMDADVALALKKAKLVKLRLEALDRSNEASRSL  119

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              G GPGSSSDRTRTSVV+GLR KLK+ M+ FN+LRQ+I SEYRETVQRRYYTVTGENPD+
Sbjct  120   PGAGPGSSSDRTRTSVVSGLRKKLKDSMDSFNNLRQQISSEYRETVQRRYYTVTGENPDD  179

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + +D LISTG+SETF+QKAIQ+QGR  +M+T+ EIQERH+ VKE+ERNL ELHQVF+DM+
Sbjct  180   KTVDLLISTGESETFLQKAIQQQGRANIMDTIQEIQERHDTVKEIERNLMELHQVFMDMS  239

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             VLV++QGEQLD+IES V RANS VR G  QL  ARKH  NTRKWTC
Sbjct  240   VLVQSQGEQLDNIESHVARANSYVRGGVQQLHVARKHPMNTRKWTC  285



>ref|XP_010486844.1| PREDICTED: syntaxin-121 isoform X1 [Camelina sativa]
Length=340

 Score =   371 bits (953),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 233/289 (81%), Gaps = 5/289 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPP-ESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDI  1326
             MNDL S SFS  R   G  P+P  +   ++M+  A   G     KFFEDVE+VK++LK++
Sbjct  1     MNDLFSSSFSRFR---GGEPSPRRDDGGVQMANPAGSTGGVNLDKFFEDVESVKEELKEL  57

Query  1325  EKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRK  1146
             +++  +L ++HEQSKT+HNAK VK+LR++MD DV +ALK+AK+IK +LE LD++NAANR 
Sbjct  58    DRLNETLSSSHEQSKTLHNAKAVKDLRSQMDGDVGVALKKAKMIKVKLEALDRANAANRS  117

Query  1145  VYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPD  966
             + GCGPGSSSDRTRTSV+NGLR KL + M+ FN LR+ I SEYRETVQRRY+TVTGENPD
Sbjct  118   LPGCGPGSSSDRTRTSVLNGLRKKLMDSMDSFNRLRELISSEYRETVQRRYFTVTGENPD  177

Query  965   EEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDM  786
             E  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK++E+NL+ELHQVFLDM
Sbjct  178   EGTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVKDIEKNLRELHQVFLDM  237

Query  785   AVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             AVLVE QG QLDDIES V RA+S +R G + L TAR +QKNTRKWTC+A
Sbjct  238   AVLVEHQGAQLDDIESHVGRASSFIRGGTEHLQTARVYQKNTRKWTCYA  286



>ref|XP_003535818.1| PREDICTED: syntaxin-121-like isoform 1 [Glycine max]
Length=306

 Score =   369 bits (948),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 192/288 (67%), Positives = 230/288 (80%), Gaps = 6/288 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM---SaaanggganlAKFFEDVEAVKDDLKD  1329
             MNDL S SFS  R N    P     H IEM   S+    G ANL KFF++VE VK+DLK+
Sbjct  1     MNDLFSGSFS--RNNDQVLP-DHHHHVIEMAAASSPTAEGSANLEKFFQEVEQVKEDLKE  57

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             +E+++ +L+  HE+SKT+H+AK VKELR+RMD DV+LALK+AKL+K RLE LD+SN  +R
Sbjct  58    LERLHENLRGNHEKSKTLHSAKAVKELRSRMDADVALALKKAKLVKVRLETLDRSNQVSR  117

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              + G  PGSSSDRTRTSVV+GLR KLK+ M+ FN LRQ+I SEYRETVQRRYYTVTGENP
Sbjct  118   NLPGLEPGSSSDRTRTSVVSGLRKKLKDSMDSFNSLRQQISSEYRETVQRRYYTVTGENP  177

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             D++ +D LISTG+SETF+QKAI++QGR  VM+T+ EIQERH+ VKE+ERNL ELHQVFLD
Sbjct  178   DDKTIDLLISTGESETFLQKAIEQQGRASVMDTIQEIQERHDTVKEIERNLNELHQVFLD  237

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             MAVLV++QGEQLDDIES V RANS VR G  QL  ARKHQKNTRKWTC
Sbjct  238   MAVLVQSQGEQLDDIESHVARANSYVRGGVQQLHVARKHQKNTRKWTC  285



>ref|XP_008360602.1| PREDICTED: syntaxin-121-like [Malus domestica]
Length=295

 Score =   369 bits (946),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 194/304 (64%), Positives = 238/304 (78%), Gaps = 13/304 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS SFS          A P+ H IEM+A +N       KFF+DVE+V+++L +++K
Sbjct  1     MNDLLSSSFS---------EASPDHHVIEMAATSNELN----KFFQDVESVQNELNELQK  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             I  SL++AHEQSK++HN+K VK+L  RMD DV  ALK AK++K +L+ LD+SNAANR + 
Sbjct  48    INKSLQSAHEQSKSLHNSKAVKDLXTRMDADVHTALKNAKVLKVQLDALDKSNAANRSLP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KLK+ M+ FNDLR KI SE+RETVQRRY+TVTGENPD++
Sbjct  108   GCGPGSSSDRTRTSVVNGLRKKLKDSMDSFNDLRNKISSEHRETVQRRYFTVTGENPDDK  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              LD LISTG+SETF+QKAIQEQGRG  ++T+ EIQERH+ VK +ERNL ELHQVF+DMAV
Sbjct  168   TLDLLISTGESETFLQKAIQEQGRGGXLDTIQEIQERHDGVKXMERNLNELHQVFMDMAV  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LV+ QGEQLDDI+  V RANS V  G  QL  AR  QKNTRKWTC+ II+LL+II I++ 
Sbjct  228   LVQAQGEQLDDIQGHVERANSYVHSGTQQLQKARFLQKNTRKWTCYGIIILLVIIGIILA  287

Query  599   SIRP  588
             SI P
Sbjct  288   SILP  291



>dbj|BAJ34618.1| unnamed protein product [Thellungiella halophila]
Length=342

 Score =   370 bits (950),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 174/245 (71%), Positives = 214/245 (87%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L++ HEQSKT+HNAK VK+LR++MD DV +ALK+AK+I
Sbjct  45    KFFEDVESVKEELKELDRLNETLQSCHEQSKTLHNAKAVKDLRSKMDADVGVALKKAKMI  104

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SNAANR + GCGPGSSSDRTRTSV+NGLR KLK+ M+ FN LR+ I SEYR
Sbjct  105   KVKLEALDRSNAANRSLPGCGPGSSSDRTRTSVLNGLRKKLKDSMDSFNRLRELISSEYR  164

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRY+TVTGENPDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  165   ETVQRRYFTVTGENPDEGTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  224

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NLKELHQVFLDMAVLVE QG QLDDIES V RA+S +R G DQL T R +QKNTRK
Sbjct  225   DIEKNLKELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTDQLQTVRVYQKNTRK  284

Query  653   WTCFA  639
             WTC+A
Sbjct  285   WTCYA  289



>ref|XP_010677545.1| PREDICTED: syntaxin-121 [Beta vulgaris subsp. vulgaris]
Length=298

 Score =   367 bits (942),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 198/305 (65%), Positives = 245/305 (80%), Gaps = 9/305 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MN+LLS SFS   +N         S  IEM  AA+ G     KFFEDVE + +DLK+IE+
Sbjct  1     MNNLLSTSFSQHGKNN--------SGDIEMGLAADAGANLE-KFFEDVEKINEDLKEIEE  51

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +   L+  HE+SKT HNA  VK LR+RMD+DVS  LK+AKLIK RL+ LD+SNAA+R + 
Sbjct  52    LQRKLRAGHEESKTAHNAGVVKALRSRMDQDVSQTLKKAKLIKDRLQALDKSNAASRSLP  111

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
              CGPGSS+DRTRTSVV GL   LK+ M +F +LR+KI  EYRET++RRYYTVTGENPDE+
Sbjct  112   ECGPGSSTDRTRTSVVGGLGKNLKDKMEEFQELREKINGEYRETIERRYYTVTGENPDEK  171

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQ+QGRG++++T+ EIQERH+AV+++ERNLKELHQ+FLD+AV
Sbjct  172   TVDLLISTGESETFLQKAIQQQGRGQILDTIAEIQERHDAVRDIERNLKELHQIFLDIAV  231

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LV+ QGEQLDDIE+ V+RANS V+ G +QL  ARKHQKNTRKWTCFAIILLLIIILI+VL
Sbjct  232   LVQHQGEQLDDIEANVDRANSYVQRGTNQLHEARKHQKNTRKWTCFAIILLLIIILIIVL  291

Query  599   SIRPW  585
             S+RPW
Sbjct  292   SLRPW  296



>ref|XP_006298169.1| hypothetical protein CARUB_v10014219mg [Capsella rubella]
 gb|EOA31067.1| hypothetical protein CARUB_v10014219mg [Capsella rubella]
Length=314

 Score =   367 bits (943),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/245 (70%), Positives = 215/245 (88%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L ++HEQSKT+ NAK VK+LR++MD DV +ALK+AK+I
Sbjct  15    KFFEDVESVKEELKELDRLNEALSSSHEQSKTLPNAKAVKDLRSKMDGDVGVALKKAKMI  74

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD++NAANR + GCGPGSSSDRTRTSV+NGLR KLK+ M+ FN LR++I SEYR
Sbjct  75    KVKLEALDRANAANRSLPGCGPGSSSDRTRTSVLNGLRKKLKDSMDSFNHLRERISSEYR  134

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRY+TVTGENPDE  LD+LISTG+SE FMQKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  135   ETVQRRYFTVTGENPDEGTLDRLISTGESERFMQKAIQEQGRGRVLDTINEIQERHDAVK  194

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G +QL TAR +QKNTRK
Sbjct  195   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTEQLQTARVYQKNTRK  254

Query  653   WTCFA  639
             WTC+A
Sbjct  255   WTCYA  259



>ref|XP_006403808.1| hypothetical protein EUTSA_v10010514mg [Eutrema salsugineum]
 dbj|BAJ33859.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45261.1| hypothetical protein EUTSA_v10010514mg [Eutrema salsugineum]
Length=343

 Score =   368 bits (944),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 195/311 (63%), Positives = 250/311 (80%), Gaps = 9/311 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM-----SaaanggganlAKFFEDVEAVKDDL  1335
             MNDLLSRSF+    +     +PP SH+IEM     S  +  GG NL KF+ DVE V  +L
Sbjct  1     MNDLLSRSFN---RSVADDSSPPHSHSIEMPKAKCSGGSCRGGNNLDKFYLDVEEVNGEL  57

Query  1334  KDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAA  1155
             K+++++  SL+++HE+SKT+HNAK VKEL+A MD DVS ALK AK +K  LE LD+SN  
Sbjct  58    KELDRLCHSLRSSHEKSKTLHNAKAVKELKANMDADVSTALKTAKRVKGNLEALDRSNEV  117

Query  1154  NRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGE  975
             NR +   GPGSSSDR RTSVVNGLR KLK+ M+ FN +R+ I +EYRET+QRRY+TVTGE
Sbjct  118   NRSLPESGPGSSSDRQRTSVVNGLRKKLKDAMDSFNRVRETISTEYRETIQRRYFTVTGE  177

Query  974   NPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVF  795
             NPDE+ +D+LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQVF
Sbjct  178   NPDEDTVDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDIEKSLNELHQVF  237

Query  794   LDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliii  615
             LDMAVLVE QGEQLDDIE  V RANS+VR GAD+L+ AR +QKNTRKWTCFAI+LL+II+
Sbjct  238   LDMAVLVEHQGEQLDDIEGNVKRANSLVRSGADRLVKARFYQKNTRKWTCFAILLLIIIV  297

Query  614   livvL-SIRPW  585
             ++VV+ +++PW
Sbjct  298   VLVVVFTVKPW  308



>ref|XP_006291445.1| hypothetical protein CARUB_v10017581mg [Capsella rubella]
 gb|EOA24343.1| hypothetical protein CARUB_v10017581mg [Capsella rubella]
Length=340

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 247/307 (80%), Gaps = 5/307 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaangg-ganlAKFFEDVEAVKDDLKDIE  1323
             MNDLLSRSF+    +     +PP SH IEM  A + G   NL KF+ DVE V DDLK+++
Sbjct  1     MNDLLSRSFN---RSVADDSSPPHSHGIEMPKAKHSGGSKNLDKFYHDVEEVNDDLKELD  57

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++  +L+++HEQSKT+HNAK VKEL+ +MD DVS +LK AK +K  LE LD++N  NR +
Sbjct  58    RLCRNLRSSHEQSKTLHNAKAVKELKEKMDADVSSSLKTAKRVKGNLEALDRANEVNRGL  117

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
                GPGSSSDR RTSVVNGLR KLK+ M+ FN +R+ I  EYRET+QRRY+TVTGENPDE
Sbjct  118   PDSGPGSSSDRQRTSVVNGLRKKLKDAMDNFNRVRETISIEYRETIQRRYFTVTGENPDE  177

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + +D+LISTG+SETF+QKAIQEQGRG V++T+ EIQERH+AVK++E++L ELHQVFLDMA
Sbjct  178   DTVDRLISTGESETFLQKAIQEQGRGRVLDTINEIQERHDAVKDIEKSLNELHQVFLDMA  237

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivv  603
             VLV  QGEQLDDIE  V RANS+VR GAD+L+ AR +QKNTRKWTCFAI+LL+II+++VV
Sbjct  238   VLVVHQGEQLDDIEGNVKRANSLVRSGADRLVKARFYQKNTRKWTCFAILLLIIIVVLVV  297

Query  602   L-SIRPW  585
             + +++PW
Sbjct  298   VFTVKPW  304



>ref|NP_974288.1| syntaxin-121 [Arabidopsis thaliana]
 gb|AEE75102.1| syntaxin-121 [Arabidopsis thaliana]
Length=315

 Score =   364 bits (935),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 211/243 (87%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L + HEQSKT+HNAK VK+LR++MD DV +ALK+AK+I
Sbjct  15    KFFEDVESVKEELKELDRLNETLSSCHEQSKTLHNAKAVKDLRSKMDGDVGVALKKAKMI  74

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD++NAANR + GCGPGSSSDRTRTSV+NGLR KL + M+ FN LR+ I SEYR
Sbjct  75    KVKLEALDRANAANRSLPGCGPGSSSDRTRTSVLNGLRKKLMDSMDSFNRLRELISSEYR  134

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRY+TVTGENPDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  135   ETVQRRYFTVTGENPDERTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  194

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G DQL TAR +QKNTRK
Sbjct  195   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTDQLQTARVYQKNTRK  254

Query  653   WTC  645
             WTC
Sbjct  255   WTC  257



>ref|XP_008350214.1| PREDICTED: syntaxin-121-like [Malus domestica]
Length=292

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/286 (63%), Positives = 223/286 (78%), Gaps = 13/286 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS SFS            P+ H IEM+A +        KFF+DVE+V+++L +++K
Sbjct  1     MNDLLSSSFS---------EDSPDHHVIEMAATSTELN----KFFQDVESVQNELNELQK  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             I  SL++AHEQSK++HN+K VK+LR+RMD DV  ALK AK++K +L+ LD+SNAANR + 
Sbjct  48    INKSLQSAHEQSKSLHNSKAVKDLRSRMDADVHTALKTAKVLKVQLDALDKSNAANRSLP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KLK+ M+ FNDLR KI SE+RETVQRRY+TVTG+NPD++
Sbjct  108   GCGPGSSSDRTRTSVVNGLRKKLKDSMDSFNDLRNKISSEHRETVQRRYFTVTGDNPDDK  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              LD LISTG+SETF+QKAIQEQGR  V++T+ EIQERH+ VK  ERNL ELHQVF+DMAV
Sbjct  168   TLDLLISTGESETFLQKAIQEQGRXRVLDTIQEIQERHDGVKAXERNLNELHQVFMDMAV  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCF  642
             LV+ QG+QLDDI+  V RANS V  G  QL  AR  QKN+RKWTC+
Sbjct  228   LVQAQGDQLDDIQGHVERANSYVHXGTQQLQKARFFQKNSRKWTCY  273



>ref|XP_009343257.1| PREDICTED: syntaxin-121-like [Pyrus x bretschneideri]
 ref|XP_009343262.1| PREDICTED: syntaxin-121-like [Pyrus x bretschneideri]
Length=292

 Score =   363 bits (932),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 225/286 (79%), Gaps = 13/286 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS SFS             + H IEM+A +N       KFF+DVE+++++L +++K
Sbjct  1     MNDLLSSSFS---------EDSLDHHVIEMAATSNELN----KFFQDVESIQNELNELQK  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             I  SL++AHEQSKT+HN+K +K+LR+RMD DV  ALK AK++K +L+ LD+SNAANR + 
Sbjct  48    INKSLQSAHEQSKTLHNSKALKDLRSRMDADVHTALKTAKVLKVQLDALDKSNAANRILP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTSVVNGLR KLK+ M+ FNDLR KI SE+RETVQRRY+TVTG+NPD++
Sbjct  108   GCGPGSSSDRTRTSVVNGLRKKLKDSMDSFNDLRNKISSEHRETVQRRYFTVTGDNPDDK  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              LD LISTG+SETF+QKAIQEQGRG V++T+ EIQERH+ VK +ERNL ELHQVF+DMAV
Sbjct  168   TLDLLISTGESETFLQKAIQEQGRGRVLDTIQEIQERHDGVKAMERNLNELHQVFMDMAV  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCF  642
             LV+ QG+QLDDI+  V RANS V  G  QL  AR  QKNTRKWTC+
Sbjct  228   LVQAQGDQLDDIQGHVERANSYVHSGTQQLQKARFFQKNTRKWTCY  273



>ref|XP_010464887.1| PREDICTED: syntaxin-121-like isoform X2 [Camelina sativa]
Length=314

 Score =   364 bits (934),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 170/245 (69%), Positives = 213/245 (87%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE++K++LK+++++  SL ++HEQSKT+HNAK VK+LR++MD DV +ALK+AK+I
Sbjct  16    KFFEDVESIKEELKELDRLNESLSSSHEQSKTLHNAKAVKDLRSQMDGDVGVALKKAKMI  75

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD++NAANR + GCGPGSSSDRTRTSV+NGLR KL + M+ FN LR+ I SEYR
Sbjct  76    KVKLEALDRANAANRSLPGCGPGSSSDRTRTSVLNGLRKKLMDSMDSFNRLRELISSEYR  135

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRY+TVTGENPDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  136   ETVQRRYFTVTGENPDEGTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  195

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G + L TAR +QKNTRK
Sbjct  196   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTEHLQTARVYQKNTRK  255

Query  653   WTCFA  639
             WTC+A
Sbjct  256   WTCYA  260



>emb|CDY01061.1| BnaC05g41390D [Brassica napus]
Length=335

 Score =   364 bits (935),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 183/286 (64%), Positives = 234/286 (82%), Gaps = 6/286 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF+  R +G  SP   +   ++M+  A        KFFEDVE+VK++LK++++
Sbjct  1     MNDLFSSSFTRFRSSGAPSP---QGTGVQMAHPAGVNLD---KFFEDVESVKEELKELDR  54

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +  +L+++HEQSKT+ NA+ VK+LR++MD DV +ALK+AK+IK +LE LD+SNAANR + 
Sbjct  55    VNDTLQSSHEQSKTLPNAQAVKDLRSKMDGDVGVALKKAKMIKVKLEALDRSNAANRSLP  114

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTRTS++NGLR KLK+ M+ FN LR+ I SEYRETVQRRY+TVTGENPDE+
Sbjct  115   GCGPGSSSDRTRTSLLNGLRKKLKDSMDSFNRLRELISSEYRETVQRRYFTVTGENPDEK  174

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK++E+NLKELHQVFLDMAV
Sbjct  175   TLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVKDIEKNLKELHQVFLDMAV  234

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCF  642
             LVE QG QLDDIES V RA+S +R G +QL TAR +QKNTRKWTC+
Sbjct  235   LVEHQGAQLDDIESHVGRASSFIRGGTEQLHTARVYQKNTRKWTCY  280



>ref|XP_010486845.1| PREDICTED: syntaxin-121 isoform X2 [Camelina sativa]
Length=313

 Score =   363 bits (932),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 170/245 (69%), Positives = 213/245 (87%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L ++HEQSKT+HNAK VK+LR++MD DV +ALK+AK+I
Sbjct  15    KFFEDVESVKEELKELDRLNETLSSSHEQSKTLHNAKAVKDLRSQMDGDVGVALKKAKMI  74

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD++NAANR + GCGPGSSSDRTRTSV+NGLR KL + M+ FN LR+ I SEYR
Sbjct  75    KVKLEALDRANAANRSLPGCGPGSSSDRTRTSVLNGLRKKLMDSMDSFNRLRELISSEYR  134

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRY+TVTGENPDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  135   ETVQRRYFTVTGENPDEGTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  194

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G + L TAR +QKNTRK
Sbjct  195   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTEHLQTARVYQKNTRK  254

Query  653   WTCFA  639
             WTC+A
Sbjct  255   WTCYA  259



>ref|XP_010498143.1| PREDICTED: syntaxin-121-like isoform X2 [Camelina sativa]
Length=314

 Score =   363 bits (932),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/245 (69%), Positives = 214/245 (87%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L ++HEQSKT+HNAK VK+LR++MD DV +ALK+AK+I
Sbjct  16    KFFEDVESVKEELKELDRLNETLSSSHEQSKTLHNAKAVKDLRSQMDGDVGVALKKAKMI  75

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD++NAANR + GCGPGSSSDRTRTSV+NGLR KLK+ M+ FN LR+ I SEY+
Sbjct  76    KVKLEALDRANAANRSLPGCGPGSSSDRTRTSVLNGLRKKLKDSMDSFNRLRELISSEYK  135

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRY+TVTGENPDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  136   ETVQRRYFTVTGENPDEGTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  195

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G + L TAR +QKNTRK
Sbjct  196   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTEHLQTARVYQKNTRK  255

Query  653   WTCFA  639
             WTC+A
Sbjct  256   WTCYA  260



>ref|NP_187788.1| syntaxin-121 [Arabidopsis thaliana]
 sp|Q9ZSD4.1|SY121_ARATH RecName: Full=Syntaxin-121; Short=AtSYP121; AltName: Full=Syntaxin-related 
protein At-Syr1 [Arabidopsis thaliana]
 gb|AAF23198.1|AC016795_11 putative syntaxin [Arabidopsis thaliana]
 gb|AAD11809.1| syntaxin-related protein At-SYR1 [Arabidopsis thaliana]
 gb|AAM13150.1| putative syntaxin [Arabidopsis thaliana]
 gb|AAM65395.1| putative syntaxin [Arabidopsis thaliana]
 gb|AAO30056.1| putative syntaxin [Arabidopsis thaliana]
 gb|AEE75103.1| syntaxin-121 [Arabidopsis thaliana]
Length=346

 Score =   364 bits (934),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 211/243 (87%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L + HEQSKT+HNAK VK+LR++MD DV +ALK+AK+I
Sbjct  46    KFFEDVESVKEELKELDRLNETLSSCHEQSKTLHNAKAVKDLRSKMDGDVGVALKKAKMI  105

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD++NAANR + GCGPGSSSDRTRTSV+NGLR KL + M+ FN LR+ I SEYR
Sbjct  106   KVKLEALDRANAANRSLPGCGPGSSSDRTRTSVLNGLRKKLMDSMDSFNRLRELISSEYR  165

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRY+TVTGENPDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  166   ETVQRRYFTVTGENPDERTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  225

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G DQL TAR +QKNTRK
Sbjct  226   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTDQLQTARVYQKNTRK  285

Query  653   WTC  645
             WTC
Sbjct  286   WTC  288



>ref|XP_009135186.1| PREDICTED: syntaxin-121 isoform X2 [Brassica rapa]
Length=306

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 213/243 (88%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L+++HE SKT+HNA+ VK+LR++MD DV +ALK+AK+I
Sbjct  11    KFFEDVESVKEELKELDRLNDTLRSSHEHSKTLHNAEAVKDLRSKMDADVGVALKKAKMI  70

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SNAANR + GCGPGSSSDRTRTSV+NGLR KLK+ M+ FN LR+ I SEYR
Sbjct  71    KVKLEALDRSNAANRSLPGCGPGSSSDRTRTSVLNGLRKKLKDSMDSFNRLRELISSEYR  130

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             +TVQRRY+TVTGENPDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  131   DTVQRRYFTVTGENPDERTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  190

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G +QL TAR +QKNTRK
Sbjct  191   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTEQLQTARVYQKNTRK  250

Query  653   WTC  645
             WTC
Sbjct  251   WTC  253



>gb|KHN43702.1| Syntaxin-121 [Glycine soja]
Length=286

 Score =   361 bits (926),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 185/285 (65%), Positives = 220/285 (77%), Gaps = 20/285 (7%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  R N   SP     H IEM+A                 AVK++LK++E+
Sbjct  1     MNDLFSGSFS--RTNDQVSP--DHHHVIEMAAT----------------AVKEELKELER  40

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++ +L+ +HE+SK +H+AK VKELR RMD DV+LALK AKL+K RLE LD+SN  ++ + 
Sbjct  41    LHENLRGSHEKSKILHSAKAVKELRLRMDSDVTLALKNAKLVKVRLEALDRSNQTSQSLP  100

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             G GPGSSSDRTRTSVV+GLR KLK+ M+ FN LRQKI SEYRETVQRRYYTVTGENPD++
Sbjct  101   GSGPGSSSDRTRTSVVSGLRKKLKDSMDSFNSLRQKISSEYRETVQRRYYTVTGENPDDK  160

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQ+QGR  VM+T+ EIQERH+ VKE+ERNL ELHQVFLDMAV
Sbjct  161   TIDLLISTGESETFLQKAIQQQGRASVMDTIQEIQERHDTVKEIERNLNELHQVFLDMAV  220

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             LV++QGEQLDDIES V RANS VR G  QL  ARKHQKNTRKWTC
Sbjct  221   LVQSQGEQLDDIESHVARANSYVRGGVQQLHVARKHQKNTRKWTC  265



>emb|CDY70958.1| BnaC03g73490D [Brassica napus]
Length=333

 Score =   362 bits (929),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 213/243 (88%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L+++HE SKT+HNA+ VK+LR++MD DV +ALK+AK+I
Sbjct  37    KFFEDVESVKEELKELDRLNDTLRSSHEHSKTLHNAEAVKDLRSKMDADVGVALKKAKMI  96

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SNAANR + GCGPGSSSDRTRTSV+NGLR KLK+ M+ FN LR+ I SEYR
Sbjct  97    KVKLEALDRSNAANRSLPGCGPGSSSDRTRTSVLNGLRKKLKDSMDSFNRLRELISSEYR  156

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             +TVQRRY+TVTGENPDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  157   DTVQRRYFTVTGENPDERTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  216

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G +QL TAR +QKNTRK
Sbjct  217   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTEQLQTARVYQKNTRK  276

Query  653   WTC  645
             WTC
Sbjct  277   WTC  279



>ref|XP_009135185.1| PREDICTED: syntaxin-121 isoform X1 [Brassica rapa]
Length=333

 Score =   362 bits (928),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 213/243 (88%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L+++HE SKT+HNA+ VK+LR++MD DV +ALK+AK+I
Sbjct  38    KFFEDVESVKEELKELDRLNDTLRSSHEHSKTLHNAEAVKDLRSKMDADVGVALKKAKMI  97

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SNAANR + GCGPGSSSDRTRTSV+NGLR KLK+ M+ FN LR+ I SEYR
Sbjct  98    KVKLEALDRSNAANRSLPGCGPGSSSDRTRTSVLNGLRKKLKDSMDSFNRLRELISSEYR  157

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             +TVQRRY+TVTGENPDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  158   DTVQRRYFTVTGENPDERTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  217

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G +QL TAR +QKNTRK
Sbjct  218   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTEQLQTARVYQKNTRK  277

Query  653   WTC  645
             WTC
Sbjct  278   WTC  280



>emb|CDX73851.1| BnaA03g31960D [Brassica napus]
Length=334

 Score =   362 bits (928),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 213/243 (88%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L+++HE SKT+HNA+ VK+LR++MD DV +ALK+AK+I
Sbjct  38    KFFEDVESVKEELKELDRLNDTLRSSHEHSKTLHNAEAVKDLRSKMDADVGVALKKAKMI  97

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SNAANR + GCGPGSSSDRTRTSV+NGLR KLK+ M+ FN LR+ I SEYR
Sbjct  98    KVKLEALDRSNAANRSLPGCGPGSSSDRTRTSVLNGLRKKLKDSMDSFNRLRELISSEYR  157

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             +TVQRRY+TVTGENPDE  LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  158   DTVQRRYFTVTGENPDERTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  217

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G +QL TAR +QKNTRK
Sbjct  218   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTEQLQTARVYQKNTRK  277

Query  653   WTC  645
             WTC
Sbjct  278   WTC  280



>ref|XP_003590329.1| Syntaxin-related protein Nt-syr1 [Medicago truncatula]
 gb|AES60580.1| syntaxin of plants 122 protein [Medicago truncatula]
Length=339

 Score =   362 bits (928),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 245/314 (78%), Gaps = 11/314 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlA-------KFFEDVEAVKD  1341
             MN+L + SFS  R       +P   H IEM+  A       A       KFF+DVE VKD
Sbjct  1     MNNLFTGSFSRFR---SEEVSPDRHHVIEMTDGAGTRTGAGAGGRINLDKFFDDVEGVKD  57

Query  1340  DLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSN  1161
             DLK++E I+  L   +EQ+KTVH+AK VKELR+RMD++VS ALK+AK++K +LE+L++SN
Sbjct  58    DLKELESIHQRLSKTNEQTKTVHDAKGVKELRSRMDEEVSAALKKAKMVKLKLEKLERSN  117

Query  1160  AANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVT  981
             AANR + GCGPGSSSDRTR+SVVNGL+ KLK+ M  FN LR+ I +EYRETVQRR++TVT
Sbjct  118   AANRNLEGCGPGSSSDRTRSSVVNGLKKKLKDSMESFNRLREVITTEYRETVQRRFFTVT  177

Query  980   GENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQ  801
             GENPD++ LD LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L  LHQ
Sbjct  178   GENPDDKTLDLLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDLEKSLLALHQ  237

Query  800   VFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA-iilll  624
             VFLDM V+V+ QGEQLDDIES V RA+S V  G DQL TARKHQKNTRKW C+  I+LL+
Sbjct  238   VFLDMTVMVQFQGEQLDDIESHVARASSFVHTGTDQLQTARKHQKNTRKWACYCIILLLI  297

Query  623   iiilivvLSIRPWK  582
             I++++V+ +++PW+
Sbjct  298   IVLIVVLATVKPWQ  311



>ref|XP_007145783.1| hypothetical protein PHAVU_007G267300g [Phaseolus vulgaris]
 gb|ESW17777.1| hypothetical protein PHAVU_007G267300g [Phaseolus vulgaris]
Length=335

 Score =   361 bits (927),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 231/291 (79%), Gaps = 7/291 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlA----KFFEDVEAVKDDLK  1332
             MNDL+S SFS  R    S   P   H IEM+     G   +     KFFEDVE+VK++LK
Sbjct  1     MNDLISGSFSRFRSERAS---PDRHHVIEMTGVGGDGAGGVKVNLDKFFEDVESVKEELK  57

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             ++E +  SL+ +HEQSKT+HNA  VK+LR+RMD DVS+ALK+AKLIK +LE LD+SNAAN
Sbjct  58    ELEGLAQSLRRSHEQSKTLHNANAVKDLRSRMDGDVSVALKKAKLIKLKLEALDRSNAAN  117

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R + GCGPGSSSDRTRTSVVNGL+ KLK+ M  FN++RQ + SEYRETVQRRY+TVTGEN
Sbjct  118   RNLPGCGPGSSSDRTRTSVVNGLKKKLKDSMESFNEIRQLVSSEYRETVQRRYFTVTGEN  177

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
             PD+  LD LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVKE+E++LKELHQVFL
Sbjct  178   PDDNTLDLLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKELEKSLKELHQVFL  237

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DM VLV+ QGEQLDDIES V RA S V  G +QL TARKHQKNTRKWTC+ 
Sbjct  238   DMTVLVQHQGEQLDDIESHVARAQSFVHTGTEQLQTARKHQKNTRKWTCYC  288



>ref|XP_007145782.1| hypothetical protein PHAVU_007G267200g [Phaseolus vulgaris]
 gb|ESW17776.1| hypothetical protein PHAVU_007G267200g [Phaseolus vulgaris]
Length=301

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 229/287 (80%), Gaps = 5/287 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SFS  R     SP     H +EM+A   G   +  KFFE+VE VK++LK++E 
Sbjct  1     MNDLFSGSFS--RNTDQVSP-DNHHHVVEMAAVEGGVNLD--KFFEEVEQVKEELKELEL  55

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++ +L+ +HE+SKT+H+A  VKELR+RMD DV+LALK+AKLIK RLE LD+SN A+R + 
Sbjct  56    LHENLRGSHEKSKTLHSANAVKELRSRMDADVTLALKKAKLIKIRLEALDRSNQASRNLP  115

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             G GPGSSSDRTRTSVVNGLR KLK+ M+ FN LRQ+I SEYRETVQRRYYTVTGENPD++
Sbjct  116   GSGPGSSSDRTRTSVVNGLRKKLKDSMDNFNSLRQQISSEYRETVQRRYYTVTGENPDDK  175

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQ+QGR  VM T+ EIQERH+ VKE+ERNL ELHQVFLDMAV
Sbjct  176   TIDLLISTGESETFLQKAIQQQGRASVMETIQEIQERHDTVKEIERNLNELHQVFLDMAV  235

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LV++QGEQLDDIES V RANS VR G  QL  ARKHQKNTRKWT FA
Sbjct  236   LVQSQGEQLDDIESHVARANSYVRGGVQQLQVARKHQKNTRKWTFFA  282



>emb|CDY08492.1| BnaA05g27280D [Brassica napus]
Length=339

 Score =   361 bits (927),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L+++HEQSKT+ NA+ VK+LR++MD DV +ALK+AK+I
Sbjct  37    KFFEDVESVKEELKELDRVNDTLQSSHEQSKTLPNAQAVKDLRSKMDGDVGVALKKAKMI  96

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SNAANR + GCGPGSSSDRTRTS++NGLR KLK+ M+ FN LR+ I SEYR
Sbjct  97    KVKLEALDRSNAANRSLPGCGPGSSSDRTRTSLLNGLRKKLKDSMDSFNRLRELISSEYR  156

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRY+TVTGENPDE+ LD+LISTG+SE F+QKAIQEQGRG V++T+ EIQERH+AVK
Sbjct  157   ETVQRRYFTVTGENPDEKTLDRLISTGESERFLQKAIQEQGRGRVLDTINEIQERHDAVK  216

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G ++L TAR +QKNTRK
Sbjct  217   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTEELHTARVYQKNTRK  276

Query  653   WTCF  642
             WTC+
Sbjct  277   WTCY  280



>ref|XP_010503984.1| PREDICTED: syntaxin-122-like [Camelina sativa]
Length=342

 Score =   361 bits (927),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/293 (61%), Positives = 225/293 (77%), Gaps = 9/293 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl------AKFFEDVEAVKDD  1338
             MNDLLSRSF   + +     +PP SH+IEM    N  G          KF+ DVE V +D
Sbjct  1     MNDLLSRSF---KSSVADDSSPPHSHSIEMPKTKNSAGGTGHGGYNLDKFYHDVEEVNED  57

Query  1337  LKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNA  1158
             LK+++++  +L+++HEQSKT+HNAK VKEL+ +MD DVS ALK A  +K  LE LD++N 
Sbjct  58    LKELDRLCHNLRSSHEQSKTLHNAKAVKELKEKMDADVSAALKTATRVKGNLEALDRANE  117

Query  1157  ANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTG  978
              NR +  CGPGSSSDR RTSVVNGLR KLK+ M  FN +R+KI +EYRET+ R Y+TVTG
Sbjct  118   VNRGLPECGPGSSSDRQRTSVVNGLRKKLKDAMENFNRMREKISTEYRETIMRMYFTVTG  177

Query  977   ENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQV  798
             ENPDE+ +D+LISTG+SETF+QK IQEQGRG +++T+ EIQERH+AVK++E++L ELHQV
Sbjct  178   ENPDEDTVDRLISTGESETFLQKTIQEQGRGRILDTINEIQERHDAVKDIEKSLNELHQV  237

Query  797   FLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             FLDMAVLV  QGEQLDDIE  V RANS+VR GAD+L+ AR +QKNTRKWTCFA
Sbjct  238   FLDMAVLVVHQGEQLDDIEGNVKRANSLVRSGADRLVKARFYQKNTRKWTCFA  290



>emb|CDY29079.1| BnaC07g32850D [Brassica napus]
Length=336

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 242/306 (79%), Gaps = 4/306 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLSRSF   + +     +PP SHTIEM  A      NL KFF DVE V +DLK++++
Sbjct  1     MNDLLSRSF---KRSVADDSSPPHSHTIEMPKAKYSDENNLDKFFLDVEEVNNDLKELDR  57

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +  SL+ +H++SKT+HN+K VKEL+ +MD DVS ALK AK +K  L+ LD+SN  NR + 
Sbjct  58    LCHSLQVSHDKSKTLHNSKAVKELKDKMDSDVSKALKTAKRVKGNLQALDRSNEVNRSLP  117

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
              CGPGSSSDR R +VVNGLR KLK+ MN F  +R+ I +EYR+T+ R Y+TVTGENPDE+
Sbjct  118   ECGPGSSSDRQRMAVVNGLRKKLKDAMNHFMRVRETISTEYRDTIHRLYFTVTGENPDED  177

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQVFLDMAV
Sbjct  178   TVDHLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDIEKSLNELHQVFLDMAV  237

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LV++QGEQLD IE  + R N+I+R GADQL+ AR +QKNTRKWTC+A+++L+II+++VVL
Sbjct  238   LVQSQGEQLDTIEDSLKRTNTIIRSGADQLVKARFYQKNTRKWTCYAVLILIIIVVLVVL  297

Query  599   -SIRPW  585
              +++PW
Sbjct  298   FTVKPW  303



>ref|XP_003537119.1| PREDICTED: syntaxin-121-like [Glycine max]
Length=332

 Score =   360 bits (923),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 205/310 (66%), Positives = 250/310 (81%), Gaps = 7/310 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlA---KFFEDVEAVKDDLKD  1329
             MNDL S SFS  R +  S   P   H IEM AAA G         KFFEDVE V ++LK+
Sbjct  1     MNDLFSGSFSRFRSDQSS---PDRHHDIEMGAAAGGPRGGEVNLDKFFEDVEGVNEELKE  57

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             +E +  SL+++HEQSKT+HNAK V++LR+ MD DVS ALK+AKLIK +LE L++SNAANR
Sbjct  58    LEGLAQSLRSSHEQSKTLHNAKAVRDLRSGMDGDVSAALKKAKLIKLKLEALERSNAANR  117

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              + GCGPGSSSDRTRTSVVNGL+ KLK+ M  FN++R  + SEYRETVQRRY+TVTGENP
Sbjct  118   NLPGCGPGSSSDRTRTSVVNGLKKKLKDSMESFNEIRGLVSSEYRETVQRRYFTVTGENP  177

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             D++ LD LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVKE+E+NLKELHQVFLD
Sbjct  178   DDKTLDLLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKEIEKNLKELHQVFLD  237

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliii-l  612
             M VLV+ QGEQLDDIES V RA+S VR GA+QL TARK+QKNTRKWTC+ IILLL+II  
Sbjct  238   MTVLVQHQGEQLDDIESHVARAHSFVRTGAEQLQTARKYQKNTRKWTCYCIILLLVIIFF  297

Query  611   ivvLSIRPWK  582
             +V+ ++RPWK
Sbjct  298   VVLFTVRPWK  307



>ref|XP_009139460.1| PREDICTED: syntaxin-122 [Brassica rapa]
Length=342

 Score =   359 bits (922),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 193/312 (62%), Positives = 246/312 (79%), Gaps = 10/312 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggg------anlAKFFEDVEAVKDD  1338
             MNDLLSRSF+    +  S   PP SH IEMS A    G       NL KFF DVE V  D
Sbjct  1     MNDLLSRSFNRSVSDDSS---PPHSHNIEMSKAKYSSGGSCRGGNNLDKFFLDVEEVNSD  57

Query  1337  LKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNA  1158
             LK+++++  SL+ +HE+SKT+HNAK VKEL+ +MD DVS ALK AK +K  L+ELD++N 
Sbjct  58    LKELDRLCHSLQLSHEKSKTLHNAKAVKELKDKMDSDVSTALKTAKRVKVNLKELDRANE  117

Query  1157  ANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTG  978
              NR +   GPGSSSDR RTSVVNGLR KLK+ MN F  +R+ I +EYR+T+ R Y+TVTG
Sbjct  118   VNRSLPESGPGSSSDRQRTSVVNGLRKKLKDAMNNFMRVRETISTEYRDTINRLYFTVTG  177

Query  977   ENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQV  798
             ENPDE+ +D+LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQV
Sbjct  178   ENPDEDTVDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDIEKSLNELHQV  237

Query  797   FLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiilllii  618
             FLDMAVLVE QGEQL+DIES V RANS+VR GAD+L+ AR +QKNTRKWTC+AI+LL+II
Sbjct  238   FLDMAVLVEHQGEQLEDIESHVKRANSLVRSGADKLVKARFYQKNTRKWTCYAILLLIII  297

Query  617   ilivvL-SIRPW  585
             +++VVL +++PW
Sbjct  298   VVLVVLFTVKPW  309



>ref|XP_010515701.1| PREDICTED: syntaxin-122-like [Camelina sativa]
 ref|XP_010515702.1| PREDICTED: syntaxin-122-like isoform X1 [Camelina sativa]
 ref|XP_010515706.1| PREDICTED: syntaxin-122-like [Camelina sativa]
Length=343

 Score =   359 bits (922),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 183/294 (62%), Positives = 228/294 (78%), Gaps = 10/294 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaan-------ggganlAKFFEDVEAVKD  1341
             MNDLLSRSF     +G S   PP SH+IEM    N       G G NLAKF+ DVE V +
Sbjct  1     MNDLLSRSFKSSVADGSS---PPHSHSIEMPKTKNPGGTGHGGSGTNLAKFYHDVEEVNE  57

Query  1340  DLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSN  1161
             DLK+++++  +L++ HEQSKT+HNA  VK+L+ +MD DVS ALK A  +K  LE LD++N
Sbjct  58    DLKELDRLCHNLRSGHEQSKTLHNAMAVKKLKEKMDADVSAALKTATRVKGNLEALDRAN  117

Query  1160  AANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVT  981
               NR +  CGPGSSSDR RTSVVNGLR KLK+ M++FN +R+ I +EYRET+ R Y+TVT
Sbjct  118   EVNRGLPECGPGSSSDRQRTSVVNGLRKKLKDAMDKFNRMRETISTEYRETIMRMYFTVT  177

Query  980   GENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQ  801
             GENPDE  +D+LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQ
Sbjct  178   GENPDEHTVDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDIEKSLNELHQ  237

Query  800   VFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             VFLDMAVLV  QGEQLDDIE  V RANS+VR GAD+L+ AR +QKNTRKWTCFA
Sbjct  238   VFLDMAVLVVHQGEQLDDIEGNVKRANSLVRSGADRLVKARFYQKNTRKWTCFA  291



>gb|KFK34487.1| hypothetical protein AALP_AA5G152000 [Arabis alpina]
Length=336

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/307 (62%), Positives = 247/307 (80%), Gaps = 8/307 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggg-anlAKFFEDVEAVKDDLKDIE  1323
             MNDLLS+SF   R +  S   PP+SH I+M       G  NL KFF DVE V +DLK+++
Sbjct  1     MNDLLSQSF---RRDDSS---PPQSHKIDMPKPKLTSGGNNLDKFFLDVEVVNNDLKELD  54

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++  SL+++HE+SKT+HNAK VK+L+ +MD DVS +LK AK +K  LE LD++N ANR +
Sbjct  55    RLCQSLRSSHEKSKTLHNAKAVKDLKQKMDSDVSASLKTAKRVKGNLEALDRANEANRSL  114

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
                GPGSSSDR RTSVVNGLR KLK+ M+ FN +R+ I +EYRET+QRRY+TVTGENPDE
Sbjct  115   PESGPGSSSDRQRTSVVNGLRKKLKDAMDNFNRVRETISTEYRETIQRRYFTVTGENPDE  174

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             + +D+LISTG+SETF+QKAIQEQGRG++++T+ EIQERH+AVK++E++L ELHQVFLDMA
Sbjct  175   DTVDRLISTGESETFLQKAIQEQGRGQILDTINEIQERHDAVKDIEKSLNELHQVFLDMA  234

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivv  603
             VLVE QG QLD IE  V R NS+VR GAD+L+ AR +QKNTRKWTC+AI+LL+II+++VV
Sbjct  235   VLVEHQGVQLDGIEDNVKRTNSLVRSGADKLVKARFYQKNTRKWTCYAILLLIIIVVLVV  294

Query  602   L-SIRPW  585
             L +++PW
Sbjct  295   LFTVKPW  301



>ref|XP_010426857.1| PREDICTED: syntaxin-122-like [Camelina sativa]
Length=342

 Score =   358 bits (918),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 241/315 (77%), Gaps = 10/315 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl------AKFFEDVEAVKDD  1338
             MNDLLSRSF     N  S   PP SH+IEM    N  G          KF+ DVE V +D
Sbjct  1     MNDLLSRSFKSSVANDSS---PPHSHSIEMPKTKNSAGGTGHGGNNLDKFYHDVEEVNED  57

Query  1337  LKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNA  1158
             LK+++++  +L+++HEQSKT+HNAK VKEL+ +MD DVS ALK A  +K  LE LD++N 
Sbjct  58    LKELDRLCHNLRSSHEQSKTLHNAKAVKELKGKMDADVSAALKTATRVKGNLEALDRANE  117

Query  1157  ANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTG  978
              NR +  CGPGSSSDR RTSVVNGLR KLK+ M  FN +R+ I +EYRET+ R Y+TVTG
Sbjct  118   VNRGLPECGPGSSSDRQRTSVVNGLRKKLKDAMENFNRVRETISTEYRETIMRMYFTVTG  177

Query  977   ENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQV  798
             ENPDE  +D+LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQV
Sbjct  178   ENPDEATVDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDIEKSLNELHQV  237

Query  797   FLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA-iillli  621
             FLDMAVLV  QGEQLDDIE  V RANS+VR GAD+L+ AR +QKNTRKWTC A ++L++I
Sbjct  238   FLDMAVLVVHQGEQLDDIEGNVKRANSLVRSGADKLVKARFYQKNTRKWTCCAILLLIMI  297

Query  620   iilivvLSIRPWK*D  576
             ++L+VV ++RPW+ D
Sbjct  298   VVLVVVFTVRPWESD  312



>ref|XP_010263035.1| PREDICTED: syntaxin-121-like [Nelumbo nucifera]
Length=313

 Score =   354 bits (909),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 177/297 (60%), Positives = 219/297 (74%), Gaps = 19/297 (6%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENG----------GSSPAPPESHTIEMSaaanggganlAKFFEDVEA  1350
             MNDL S SFS  R N           G+S    +  T+ ++           KFFEDVE 
Sbjct  1     MNDLFSGSFSGLRSNNVDLEPPYSRRGASGGDVQMRTVGVNLD---------KFFEDVEG  51

Query  1349  VKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELD  1170
             +KD+LK++E ++  L+ +HE+S T+HNA+ +K+LRARMD DV+L LK+AK++K RLE LD
Sbjct  52    IKDELKEVEALHRRLQDSHEESMTLHNARSIKDLRARMDADVALVLKKAKMVKIRLEALD  111

Query  1169  QSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYY  990
             ++NAA+R   GCGPGSSSDRTRTSVV+GLR KLK+ M  FN LR+KI +EY+ETV+ RY+
Sbjct  112   RANAAHRSTPGCGPGSSSDRTRTSVVSGLRKKLKDQMENFNTLREKIATEYKETVEHRYF  171

Query  989   TVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKE  810
             TVTGE PD+  +D LISTGQSE   QK IQEQGRG VM+ V EIQER +AVKE+E+NLKE
Sbjct  172   TVTGEKPDKRTVDALISTGQSENLFQKMIQEQGRGTVMDIVSEIQERQDAVKEIEKNLKE  231

Query  809   LHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LHQVFLDMAVLV++QGEQLDDIESQV RA S +R G +QL  AR  QKNTRKW CF 
Sbjct  232   LHQVFLDMAVLVQSQGEQLDDIESQVARATSFIRGGTEQLQVARTLQKNTRKWACFG  288



>emb|CDY23212.1| BnaA04g05470D [Brassica napus]
Length=343

 Score =   355 bits (910),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 246/313 (79%), Gaps = 11/313 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggg------anlAKFFEDVEAVKDD  1338
             MNDLLSRSF+    +  S   PP SH IEMS A    G       NL KFF DVE V  D
Sbjct  1     MNDLLSRSFNRSVSDDSS---PPHSHNIEMSKAKYSSGGSCRGGNNLDKFFLDVEEVNSD  57

Query  1337  LKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNA  1158
             LK+++++  SL+ +HE+SKT+HNAK VKEL+ +MD DVS ALK AK +K  L+ELD++N 
Sbjct  58    LKELDRLCHSLQLSHEKSKTLHNAKAVKELKDKMDSDVSTALKTAKRVKVNLKELDRANE  117

Query  1157  ANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTG  978
              NR +   GPGSSSDR RTSVVNGLR KLK+ MN F  +R+ I +EYR+T+ R Y+TVTG
Sbjct  118   VNRSLPESGPGSSSDRQRTSVVNGLRKKLKDAMNNFMRVRETISTEYRDTINRLYFTVTG  177

Query  977   ENPDEEVLDKLISTG-QSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQ  801
             ENPDE+ +D+LISTG +SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQ
Sbjct  178   ENPDEDTVDRLISTGRESETFLQKAIQEQGRGRILDTINEIQERHDAVKDIEKSLNELHQ  237

Query  800   VFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillli  621
             VFLDMAVLVE QGEQL+DIES V RANS+VR GAD+L+ AR +QKNTRKWTC+AI+LL+I
Sbjct  238   VFLDMAVLVEHQGEQLEDIESHVKRANSLVRSGADKLVKARFYQKNTRKWTCYAILLLII  297

Query  620   iilivvL-SIRPW  585
             I+++VVL +++PW
Sbjct  298   IVVLVVLFTVKPW  310



>gb|ACU19749.1| unknown [Glycine max]
Length=279

 Score =   352 bits (903),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 183/283 (65%), Positives = 221/283 (78%), Gaps = 7/283 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl---AKFFEDVEAVKDDLKD  1329
             MND  S SFS  R N   SP     H IEM+A A+          KFF++VE VK++LK+
Sbjct  1     MNDSFSGSFS--RTNDQVSP--DHHHVIEMAATASPTAEGSVNLEKFFQEVEQVKEELKE  56

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             +E+++ +L+ +HE+SK +H+AK VKELR RMD DV+LALK AKL+K RLE LD+SN  ++
Sbjct  57    LERLHENLRGSHEKSKILHSAKAVKELRLRMDSDVTLALKNAKLVKVRLEALDRSNQTSQ  116

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              + G GPGSSSDRTRTSVV+GLR KLK+ M+ FN LRQKI SEYRETVQRRYYTVTGENP
Sbjct  117   SLPGSGPGSSSDRTRTSVVSGLRKKLKDSMDSFNSLRQKISSEYRETVQRRYYTVTGENP  176

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             D++ +D LISTG+SETF+QKAIQ+QGR  VM+T+ EIQERH+ VKE+ERNL ELHQVFLD
Sbjct  177   DDKTIDLLISTGESETFLQKAIQQQGRASVMDTIQEIQERHDTVKEIERNLNELHQVFLD  236

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNT  660
             MAVLV++QGEQLD IES V RANS VR G  QL  ARKHQKNT
Sbjct  237   MAVLVQSQGEQLDGIESHVARANSYVRGGVQQLHVARKHQKNT  279



>emb|CDX90604.1| BnaA03g41770D [Brassica napus]
Length=334

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 242/306 (79%), Gaps = 4/306 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLSRSF   + +     +PP SHTIEM  A   GG NL KFF DVE V  DLK++++
Sbjct  1     MNDLLSRSF---KRSVADDSSPPHSHTIEMPKAKYSGGNNLDKFFLDVEEVNSDLKELDR  57

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +  SL+ +H++SKT+HNAK VKEL+ +MD DVS ALK AK +K  L+ LD+SN  NR + 
Sbjct  58    LCHSLQVSHDKSKTLHNAKAVKELKDKMDSDVSKALKTAKRVKGNLQALDRSNEVNRSLP  117

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
              CGPGSSSDR R +VVNGLR KLK+ M+ F  +R+ I ++YR+T+ R Y+TVTGENPDE+
Sbjct  118   ECGPGSSSDRQRMAVVNGLRKKLKDAMDHFMRVRETISTDYRDTIHRLYFTVTGENPDED  177

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQVFLDMAV
Sbjct  178   TVDHLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDIEKSLNELHQVFLDMAV  237

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliiilivvL  600
             LV++Q EQLD IE  + R N+I+R GADQL+ AR +QKNTRKWTC+A+++L+II+++VVL
Sbjct  238   LVQSQVEQLDTIEDSLKRTNTIIRSGADQLVKARFYQKNTRKWTCYAVLILIIIVVLVVL  297

Query  599   -SIRPW  585
              +++PW
Sbjct  298   FTVKPW  303



>ref|XP_009406699.1| PREDICTED: syntaxin-121-like [Musa acuminata subsp. malaccensis]
Length=305

 Score =   352 bits (902),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/289 (62%), Positives = 222/289 (77%), Gaps = 8/289 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPR--ENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDI  1326
             MN+L S S S  R  E+GG          +EM   A  GGANL +FFEDVEA+KD+L+++
Sbjct  1     MNNLFS-SASWKRDVESGGGGTGD-----VEMGTGAAAGGANLDRFFEDVEAIKDELREV  54

Query  1325  EKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRK  1146
             E+++ SL  A+E  KT+H A  V+ELR RMD DV+LALK+AKLIK RLE LD++NAANR 
Sbjct  55    ERLHRSLHEANEAGKTLHEASAVRELRGRMDADVALALKKAKLIKLRLESLDRANAANRA  114

Query  1145  VYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPD  966
             V GCGPGSS+DRTR+SVV GLR KL++ M  F +LR++I +EYRETV RRYYTVTGE+PD
Sbjct  115   VPGCGPGSSTDRTRSSVVAGLRKKLRDSMEAFAELRRRIAAEYRETVGRRYYTVTGESPD  174

Query  965   EEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDM  786
             E  +D L++TG+ E F+Q+AI+EQGRG V++ V EIQERH AV E+ER+L EL QVF+DM
Sbjct  175   EATVDALVATGEGERFLQRAIEEQGRGRVLDVVAEIQERHGAVAELERSLLELQQVFMDM  234

Query  785   AVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             AVLVE QG+QLDDIES V RA S VRHG D L TAR +QKNTRKWTC A
Sbjct  235   AVLVEAQGQQLDDIESNVGRAQSFVRHGTDNLTTARVYQKNTRKWTCIA  283



>ref|XP_010476034.1| PREDICTED: syntaxin-125 [Camelina sativa]
Length=298

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 221/287 (77%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE+VKDD+K IE 
Sbjct  1     MNDLFSNSFKRNQAQLGDVEAGQETMNLD-------------KFFEDVESVKDDMKGIET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+ KTVHNAK+VKELRA+MD DV+L LK+ KLIK +LE L+++NA +R V 
Sbjct  48    LYKKLQDSNEECKTVHNAKKVKELRAKMDGDVALVLKRVKLIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++ +EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRARMNAEYKETVERRYFTITGEKADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQ+QGRG++++T+ EIQERH+AVKE+E+NL ELHQVF+DMA 
Sbjct  168   TIDNLIASGESENFLQKAIQDQGRGQILDTISEIQERHDAVKEIEKNLLELHQVFMDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>ref|XP_003608218.1| Syntaxin-124 [Medicago truncatula]
 gb|AES90415.1| syntaxin of plants 122 protein [Medicago truncatula]
Length=305

 Score =   343 bits (879),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 173/287 (60%), Positives = 219/287 (76%), Gaps = 7/287 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF              E   ++   A N    NL KFFEDVE +K+D+K IE+
Sbjct  1     MNDLFSNSFK-------KYTDLKEQAYLDDVEAGNRETVNLDKFFEDVENIKEDMKTIEQ  53

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  LK A+E+SKTVHNAK +KELRARMDKDV   LK+ K+IK +LE LD+SNAANR + 
Sbjct  54    LYRKLKEANEESKTVHNAKTMKELRARMDKDVEQVLKRVKIIKGKLEALDRSNAANRNIP  113

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR +++ EY+ETV+RRY+T+TGE  DEE
Sbjct  114   GCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRARMQLEYKETVERRYFTITGEKADEE  173

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LIS+G+SE FMQ+AIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  174   TIENLISSGESENFMQRAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIELHQVFLDMAT  233

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE+QG+QL++IES V  A+S VR G +QL  AR  QKN+RKWTC+A
Sbjct  234   LVESQGQQLNNIESHVAHASSFVRRGTEQLQEARVQQKNSRKWTCYA  280



>ref|XP_010941596.1| PREDICTED: syntaxin-121-like [Elaeis guineensis]
Length=300

 Score =   342 bits (878),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 200/243 (82%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVEA+KD+LK++E+I+  L  ++E SKT+H A  +++LRARMD DV+ ALK+AKLI
Sbjct  37    KFFEDVEAIKDELKEVERIHRRLHESNEASKTLHAASAIRDLRARMDGDVATALKKAKLI  96

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K RLE LD++NAANR + GCGPG+S+DRTRTSVV GLR KLKE M  F +LR+++ ++YR
Sbjct  97    KLRLESLDRANAANRSLPGCGPGTSTDRTRTSVVAGLRKKLKESMESFGELRKRVSADYR  156

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             E V+RRYYTVTGE PDEE ++ L++TG+ E FMQ+AI+EQGRG V++ + EIQERH A  
Sbjct  157   EAVERRYYTVTGEKPDEETVEALVATGEGERFMQRAIEEQGRGRVLDVIAEIQERHGAAA  216

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+ER+L EL QVF+DM+VLV  QGEQLDDIESQV RA S VR G +QL TARKHQKN+RK
Sbjct  217   ELERSLLELQQVFMDMSVLVVAQGEQLDDIESQVGRAQSFVRRGTEQLQTARKHQKNSRK  276

Query  653   WTC  645
             WTC
Sbjct  277   WTC  279



>ref|XP_010458510.1| PREDICTED: syntaxin-125-like [Camelina sativa]
Length=298

 Score =   342 bits (877),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 220/287 (77%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE+VKDD+K +E 
Sbjct  1     MNDLFSNSFKRNQAQLGDVEAGQETMNLD-------------KFFEDVESVKDDMKGVET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+  +E+ KTVHNAK+VKELRA+MD DV+L LK+ KLIK +LE L+++NA +R V 
Sbjct  48    LYKKLQDENEECKTVHNAKKVKELRAKMDGDVALVLKRVKLIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++ +EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRARMNAEYKETVERRYFTITGEKADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQ+QGRG++++TV EIQERH+AVKE+E+NL ELHQVF+DMA 
Sbjct  168   TIDNLIASGESENFLQKAIQDQGRGQILDTVSEIQERHDAVKEIEKNLLELHQVFMDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>ref|XP_010492556.1| PREDICTED: syntaxin-125-like [Camelina sativa]
Length=298

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 220/287 (77%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE+VKDD+K +E 
Sbjct  1     MNDLFSNSFKRNQAQLGDVEAGQETMNLD-------------KFFEDVESVKDDMKGVET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+  +E+ KTVHNAK+VKELRA+MD DV+L LK+ KLIK +LE L+++NA +R V 
Sbjct  48    LYKKLQDENEECKTVHNAKKVKELRAKMDGDVALVLKRVKLIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++ +EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRARMNAEYKETVERRYFTITGEKADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQ+QGRG++++T+ EIQERH+AVKE+E+NL ELHQVF+DMA 
Sbjct  168   TIDNLIASGESENFLQKAIQDQGRGQILDTISEIQERHDAVKEIEKNLLELHQVFMDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>ref|XP_006837396.1| hypothetical protein AMTR_s00111p00136390 [Amborella trichopoda]
 gb|ERN00250.1| hypothetical protein AMTR_s00111p00136390 [Amborella trichopoda]
Length=309

 Score =   342 bits (878),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 204/244 (84%), Gaps = 0/244 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FFEDVE VK+DL  +E++Y  L+ A+E+S+TVHNAK +KELRARMDKDV   LK+AK++K
Sbjct  46    FFEDVENVKEDLHVLERLYQQLQDANEESRTVHNAKTMKELRARMDKDVEQVLKKAKVVK  105

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              +LE LD+SN A+R + GCGPG+S+DRTRTSVV+GL  KLK+ M+ F  LR +I +EYRE
Sbjct  106   GKLEALDRSNVAHRNLPGCGPGTSADRTRTSVVSGLGKKLKDLMDGFQSLRTRIGAEYRE  165

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             TV+RRYYTVTGE PDE  +D+LISTG+SETFMQKAIQ+QGRG V++T+ EIQERH+AVK+
Sbjct  166   TVERRYYTVTGELPDEGTMDRLISTGESETFMQKAIQQQGRGHVLDTISEIQERHDAVKD  225

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +ERNL +LHQVFLDMAVLVE QG+QL+DIES V  ANS VR G DQL T ++ QK+TR W
Sbjct  226   IERNLLDLHQVFLDMAVLVEAQGQQLNDIESHVAHANSFVRRGTDQLQTGKELQKSTRSW  285

Query  650   TCFA  639
             TC+A
Sbjct  286   TCYA  289



>ref|NP_172591.1| syntaxin-125 [Arabidopsis thaliana]
 sp|Q9SXB0.1|SY125_ARATH RecName: Full=Syntaxin-125; Short=AtSYP125 [Arabidopsis thaliana]
 gb|AAD50004.1|AC007259_17 Similar to syntaxin [Arabidopsis thaliana]
 gb|AAY78608.1| putative syntaxin [Arabidopsis thaliana]
 gb|AEE28704.1| syntaxin-125 [Arabidopsis thaliana]
Length=298

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 220/287 (77%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE VKDD+K +E 
Sbjct  1     MNDLFSNSFKKNQAQLGDVEAGQETMNLD-------------KFFEDVENVKDDMKGVEA  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+ KTVHNAK+VKELRA+MD DV++ LK+ K+IK +LE L+++NA +R V 
Sbjct  48    LYKKLQDSNEECKTVHNAKKVKELRAKMDGDVAMVLKRVKIIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++ +EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRARMNNEYKETVERRYFTITGEKADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQEQGRG++++T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TIDNLIASGESENFLQKAIQEQGRGQILDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>ref|XP_002877861.1| SYP122 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54120.1| SYP122 [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   343 bits (880),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 186/311 (60%), Positives = 241/311 (77%), Gaps = 9/311 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM-----SaaanggganlAKFFEDVEAVKDDL  1335
             MNDLLSRSF+    +     +PP SH IEM     S  +  GG NL KF+ DVE V +DL
Sbjct  1     MNDLLSRSFN---RSVADDSSPPHSHNIEMPKAKFSGGSCKGGNNLDKFYLDVEVVNEDL  57

Query  1334  KDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAA  1155
             K+++++  +L+++HEQSKT+HNA  VKEL  +M+ DV+ ALK A+ ++  LE LD++N  
Sbjct  58    KELDRLRRNLQSSHEQSKTLHNAMAVKELMEKMETDVTAALKTARRVQGNLEALDRANEV  117

Query  1154  NRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGE  975
             NR +   GPGSSSDR R SVVNGLR KLK+ M  FN +R+ I  EY+ET+ RRY+TVTGE
Sbjct  118   NRSLPESGPGSSSDRQRISVVNGLRKKLKDDMENFNRVRETITEEYKETIGRRYFTVTGE  177

Query  974   NPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVF  795
              PDE  +D+LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQVF
Sbjct  178   YPDEATVDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDIEKSLNELHQVF  237

Query  794   LDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliii  615
             LDMAVLVE QG QLDDIE  V RANS+VR GAD+L+ AR +QKNTRKWTCFAI+LLLII+
Sbjct  238   LDMAVLVEHQGAQLDDIEGNVKRANSLVRSGADRLVKARFYQKNTRKWTCFAILLLLIIV  297

Query  614   livvL-SIRPW  585
             ++VVL +++PW
Sbjct  298   VLVVLFTVKPW  308



>emb|CAB52174.1| syntaxin protein [Arabidopsis thaliana]
 gb|AAM65172.1| syntaxin-like protein synt4 [Arabidopsis thaliana]
Length=341

 Score =   342 bits (878),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 186/311 (60%), Positives = 242/311 (78%), Gaps = 9/311 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggga-----nlAKFFEDVEAVKDDL  1335
             MNDLLS SF     +G S   PP SH IEMS A   GG+     NL  FF DVE V +DL
Sbjct  1     MNDLLSGSFKTSVADGSS---PPHSHNIEMSKAKVSGGSCHGGNNLDTFFLDVEVVNEDL  57

Query  1334  KDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAA  1155
             K+++++  +L++++EQSKT+HNA  VKEL+ +MD DV+ ALK A+ +K  LE LD++N  
Sbjct  58    KELDRLCHNLRSSNEQSKTLHNANAVKELKKKMDADVTAALKTARRLKGNLEALDRANEV  117

Query  1154  NRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGE  975
             NR +   GPGSSSDR RTSVVNGLR KLK+ M +F+ +R+ I +EY+ETV R  +TVTGE
Sbjct  118   NRSLPESGPGSSSDRQRTSVVNGLRKKLKDEMEKFSRVRETITNEYKETVGRMCFTVTGE  177

Query  974   NPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVF  795
              PDE  L++LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQVF
Sbjct  178   YPDEATLERLISTGESETFLQKAIQEQGRGRILDTISEIQERHDAVKDIEKSLNELHQVF  237

Query  794   LDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliii  615
             LDMAVLVE QG QLDDIE  V RANS+VR GAD+L+ AR +QKNTRKWTCFAI+LLLII+
Sbjct  238   LDMAVLVEHQGAQLDDIEGNVKRANSLVRSGADRLVKARFYQKNTRKWTCFAILLLLIIV  297

Query  614   livvL-SIRPW  585
             +++V+ +++PW
Sbjct  298   VLIVVFTVKPW  308



>ref|XP_004143399.1| PREDICTED: syntaxin-121-like [Cucumis sativus]
 gb|KGN48328.1| hypothetical protein Csa_6G476680 [Cucumis sativus]
Length=303

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/269 (61%), Positives = 213/269 (79%), Gaps = 11/269 (4%)
 Frame = -2

Query  1445  SPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNA  1266
             S   P S TI ++            FF+DVE+VK +L ++E ++ SL+ +HEQSKT+HN+
Sbjct  26    SDNSPSSTTINLNT-----------FFDDVESVKAELTELEGLHRSLQNSHEQSKTLHNS  74

Query  1265  KQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNG  1086
             K +K++R+RM+  V+LALK+A+ IK RLEELD+SN  NRK+ GCG GSS+DR+RTSVV+G
Sbjct  75    KAIKDVRSRMETAVTLALKKARFIKVRLEELDRSNEENRKLPGCGYGSSADRSRTSVVSG  134

Query  1085  LRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKA  906
             LR KL + M  FN LR++I   Y+ET++RRY+T+TGENPDE+ ++ LISTG+SETF+QKA
Sbjct  135   LRKKLCDSMESFNRLREEITKTYKETIERRYFTITGENPDEKTVELLISTGESETFLQKA  194

Query  905   IQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNR  726
             IQ+QGRG V+ T+ EIQERH+AVK++ERNL+ELHQVFLDMAV+V+TQG+QLDDIESQV R
Sbjct  195   IQKQGRGRVLETIQEIQERHDAVKDIERNLRELHQVFLDMAVMVQTQGQQLDDIESQVTR  254

Query  725   ANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             ANS VR G  QL TAR +QKNTRKW C  
Sbjct  255   ANSAVRRGTSQLQTARYYQKNTRKWICIG  283



>gb|KFK43422.1| hypothetical protein AALP_AA1G123800 [Arabis alpina]
Length=298

 Score =   340 bits (873),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 219/287 (76%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   +  E+  ++             KFFEDVE VKDD+K IE 
Sbjct  1     MNDLFSNSFKRNQAQLGDVESGQETMNLD-------------KFFEDVENVKDDMKGIET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+ KTVHNAK+VKELRA+MD DV++ LK+ K+IK +LE L+++NA +R V 
Sbjct  48    LYKKLQDSNEECKTVHNAKKVKELRAKMDGDVAMVLKRVKMIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++ +EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRARMNNEYKETVERRYFTITGEKADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI +G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TIDNLIESGESENFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>ref|XP_010278416.1| PREDICTED: syntaxin-124-like [Nelumbo nucifera]
Length=307

 Score =   340 bits (873),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 172/291 (59%), Positives = 224/291 (77%), Gaps = 12/291 (4%)
 Frame = -2

Query  1499  MNDLLSRSF----SLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL S SF     L ++N        +   +E    A+G G NL KFFEDVE VK+D++
Sbjct  1     MNDLFSSSFKKYTDLKQQN--------QFDDMEAGGDASGEGVNLDKFFEDVENVKEDMR  52

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             ++EK+Y  L+ ++E+SKTVHNAK +K+LR+RMDKDV   LKQ K+IK +LE L++SN AN
Sbjct  53    NVEKLYKRLQESNEESKTVHNAKTMKDLRSRMDKDVEQVLKQVKVIKGKLEALERSNVAN  112

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R V GCGPGSS+DRTRTSVV GL  KLK+ M+ F   R K+ +EY+ETV+RRY+T+TGE 
Sbjct  113   RSVPGCGPGSSADRTRTSVVAGLGKKLKDMMDDFQGFRAKMTAEYKETVERRYFTITGEK  172

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
              DEE ++ LIS+G+SETF+QKAIQ+QGRG++++T+ EIQERH+AVKE+E+NL ELHQVFL
Sbjct  173   ADEETIENLISSGESETFLQKAIQDQGRGQILDTISEIQERHDAVKEIEKNLIELHQVFL  232

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DMA LVE QG+QL+DIES V  ANS VR G +QL  AR++QK++RKWTC A
Sbjct  233   DMAALVEAQGQQLNDIESHVAHANSFVRRGTEQLTVAREYQKSSRKWTCIA  283



>ref|NP_190808.1| syntaxin-122 [Arabidopsis thaliana]
 sp|Q9SVC2.1|SY122_ARATH RecName: Full=Syntaxin-122; Short=AtSYP122; AltName: Full=Synt4 
[Arabidopsis thaliana]
 emb|CAB43444.1| syntaxin-like protein synt4 [Arabidopsis thaliana]
 gb|AAK93584.1| putative syntaxin protein synt4 [Arabidopsis thaliana]
 gb|AAM14349.1| putative syntaxin synt4 protein [Arabidopsis thaliana]
 gb|AAN60366.1| unknown [Arabidopsis thaliana]
 gb|AEE78943.1| syntaxin-122 [Arabidopsis thaliana]
Length=341

 Score =   342 bits (877),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 186/311 (60%), Positives = 242/311 (78%), Gaps = 9/311 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggga-----nlAKFFEDVEAVKDDL  1335
             MNDLLS SF     +G S   PP SH IEMS A   GG+     NL  FF DVE V +DL
Sbjct  1     MNDLLSGSFKTSVADGSS---PPHSHNIEMSKAKVSGGSCHGGNNLDTFFLDVEVVNEDL  57

Query  1334  KDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAA  1155
             K+++++  +L++++EQSKT+HNA  VKEL+ +MD DV+ ALK A+ +K  LE LD++N  
Sbjct  58    KELDRLCHNLRSSNEQSKTLHNANAVKELKKKMDADVTAALKTARRLKGNLEALDRANEV  117

Query  1154  NRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGE  975
             NR +   GPGSSSDR RTSVVNGLR KLK+ M +F+ +R+ I +EY+ETV R  +TVTGE
Sbjct  118   NRSLPESGPGSSSDRQRTSVVNGLRKKLKDEMEKFSRVRETITNEYKETVGRMCFTVTGE  177

Query  974   NPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVF  795
              PDE  L++LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQVF
Sbjct  178   YPDEATLERLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDIEKSLNELHQVF  237

Query  794   LDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFAiillliii  615
             LDMAVLVE QG QLDDIE  V RANS+VR GAD+L+ AR +QKNTRKWTCFAI+LLLII+
Sbjct  238   LDMAVLVEHQGAQLDDIEGNVKRANSLVRSGADRLVKARFYQKNTRKWTCFAILLLLIIV  297

Query  614   livvL-SIRPW  585
             +++V+ +++PW
Sbjct  298   VLIVVFTVKPW  308



>emb|CDY20986.1| BnaA08g25390D [Brassica napus]
Length=298

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 217/287 (76%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE VKDD+K +E 
Sbjct  1     MNDLFSNSFKRNQAQFGDVEAGQETMNLD-------------KFFEDVENVKDDMKGVET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+ KTVHNAK+VKELRA+MD DV   LK+ K+IK +LE L+++NA +R V 
Sbjct  48    LYKKLQDSNEECKTVHNAKKVKELRAKMDADVGQVLKRVKIIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++  EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQSLRARMNDEYKETVERRYFTITGEQADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TIDNLIASGESENFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>ref|XP_008787779.1| PREDICTED: syntaxin-121-like [Phoenix dactylifera]
Length=302

 Score =   340 bits (871),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 174/285 (61%), Positives = 222/285 (78%), Gaps = 5/285 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MN L S S+   RE  GSS     S     S+A+  GGANL +FFEDVEA+KD+LK++E+
Sbjct  1     MNSLFSGSWR--READGSSGDVQMSRN---SSASAAGGANLDRFFEDVEAIKDELKEVER  55

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             I+  L  ++E SKT+H A  V++LRARMD DV+ ALK+AKLIK RLE LD++NAANR + 
Sbjct  56    IHHRLHESNEASKTLHAASAVRDLRARMDGDVATALKKAKLIKLRLESLDRANAANRSLP  115

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPG+S+DRTRTSVV GLR KLK+ M  F +LR+++ ++YRE+V+RRYYTVTGE PDE+
Sbjct  116   GCGPGTSTDRTRTSVVAGLRKKLKDSMEGFVELRKRVAADYRESVERRYYTVTGEKPDEQ  175

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ L++TG+ E F+Q+AI+EQGRG V++ + EIQERH A  ++ER+L EL QVFLDM+V
Sbjct  176   TVETLVATGEGERFLQRAIEEQGRGRVLDVIAEIQERHGAAADLERSLLELQQVFLDMSV  235

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             LV  QGE LDDIESQV RA+S VR G DQL TARKHQKNTRKWTC
Sbjct  236   LVAAQGEHLDDIESQVGRAHSFVRRGTDQLQTARKHQKNTRKWTC  280



>ref|XP_006305987.1| hypothetical protein CARUB_v10011255mg [Capsella rubella]
 gb|EOA38885.1| hypothetical protein CARUB_v10011255mg [Capsella rubella]
Length=299

 Score =   340 bits (871),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 219/287 (76%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE VKD++K +E 
Sbjct  1     MNDLFSNSFKRNQAQLGDVEAGQETMNLD-------------KFFEDVENVKDEMKGVET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+  +E+ KTVHNAK+VKELRA+MD DV++ LK+ K+IK +LE L++SNA +R V 
Sbjct  48    LYKKLQDENEECKTVHNAKKVKELRAKMDGDVAMVLKRVKIIKKKLEALEKSNANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++ +EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRARMNAEYKETVERRYFTITGEKADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQEQGRG++++T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TVDNLIASGESENFLQKAIQEQGRGQILDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>emb|CDY34656.1| BnaC08g42150D [Brassica napus]
Length=298

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 217/287 (76%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE VKDD+K IE 
Sbjct  1     MNDLFSNSFKRNQAQFGDVEAGQETMNLD-------------KFFEDVENVKDDMKGIET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+ KTVHNAK+VKELRA+MD DV   LK+ K+IK +LE L+++NA +R V 
Sbjct  48    LYKKLQDSNEECKTVHNAKKVKELRAKMDGDVGQVLKRVKMIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++  EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRARMNDEYKETVERRYFTITGEQADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TVDNLIASGESENFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>ref|XP_006417375.1| hypothetical protein EUTSA_v10008327mg [Eutrema salsugineum]
 gb|ESQ35728.1| hypothetical protein EUTSA_v10008327mg [Eutrema salsugineum]
Length=298

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 219/287 (76%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE VKDD+K +E 
Sbjct  1     MNDLFSNSFKRNQAQLGDVEAGQETMNLD-------------KFFEDVENVKDDMKGVES  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+ KTVHNAK+VKELRA+MD DV+  LK+ K+IK +LE L+++NA +R V 
Sbjct  48    LYKKLQDSNEECKTVHNAKKVKELRAKMDGDVAQVLKRVKIIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++ +EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRARMNAEYKETVERRYFTITGEQADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQEQGRG++++T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TIDNLIASGESENFLQKAIQEQGRGQILDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>ref|XP_009118197.1| PREDICTED: syntaxin-125-like [Brassica rapa]
Length=298

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 217/287 (76%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE VKDD+K IE 
Sbjct  1     MNDLFSNSFKRNQAQFGDVEAGQETMNLD-------------KFFEDVENVKDDMKGIET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+ KTVHNAK+VKELRA+MD DV   LK+ K+IK +LE L+++NA +R V 
Sbjct  48    LYKKLQDSNEECKTVHNAKKVKELRAKMDGDVGQVLKRVKMIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++  EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRSRMNDEYKETVERRYFTITGEQADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +DKLI++G+ E F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TIDKLIASGECENFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G +QL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTEQLQDAREYQKSSRKWTCYA  274



>gb|KGN48329.1| hypothetical protein Csa_6G476690 [Cucumis sativus]
Length=308

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/269 (60%), Positives = 213/269 (79%), Gaps = 11/269 (4%)
 Frame = -2

Query  1445  SPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNA  1266
             S   P S TI ++            FF+DVE+VK +L ++E ++ SL+ +HEQSKT+HN+
Sbjct  26    SDNSPSSTTINLNT-----------FFDDVESVKAELTELEGLHRSLQNSHEQSKTLHNS  74

Query  1265  KQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNG  1086
             K +K++R+RM+  V+LALK+A+ IK RLEELD+SN  NRK+ GCG GSS+DR+RTSVV+G
Sbjct  75    KAIKDVRSRMETAVTLALKKARFIKVRLEELDRSNEENRKLPGCGYGSSADRSRTSVVSG  134

Query  1085  LRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKA  906
             LR KL + M  FN LR++I   Y+ET++RRY+T+TGENPDE+ ++ LISTG+SETF+QKA
Sbjct  135   LRKKLCDSMESFNRLREEITKTYKETIERRYFTITGENPDEKTVELLISTGESETFLQKA  194

Query  905   IQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNR  726
             IQ+QGRG V+ T+ EIQERH+AVK++ERNL+ELHQVFLDMAV+V+TQG+QLDDIESQV R
Sbjct  195   IQKQGRGRVLETIQEIQERHDAVKDIERNLRELHQVFLDMAVMVQTQGQQLDDIESQVTR  254

Query  725   ANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             ANS V+ G  QL TAR +QKNTRKW C  
Sbjct  255   ANSAVKRGTSQLQTARYYQKNTRKWICIG  283



>emb|CDY34843.1| BnaA09g47690D [Brassica napus]
Length=298

 Score =   338 bits (867),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 217/287 (76%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE VKDD+K IE 
Sbjct  1     MNDLFSNSFKRNQAQFGDVEAGQETMNLD-------------KFFEDVENVKDDMKGIET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+ KTVHNAK+VKELRA+MD DV   LK+ K+IK +LE L+++NA +R V 
Sbjct  48    LYKKLQDSNEECKTVHNAKKVKELRAKMDGDVGQVLKRVKMIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++  EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRSRMNDEYKETVERRYFTITGEQADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TIDNLIASGESENFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G +QL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTEQLQDAREYQKSSRKWTCYA  274



>ref|XP_004505016.1| PREDICTED: syntaxin-124-like [Cicer arietinum]
Length=305

 Score =   338 bits (868),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/287 (59%), Positives = 220/287 (77%), Gaps = 7/287 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF              E   I+   + N    NL KFFEDVE VK+D+K +EK
Sbjct  1     MNDLFSNSFK-------KYTDLKEQAYIDDVESGNKESVNLDKFFEDVENVKEDMKTVEK  53

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y +L+ A+E+SKTVHNAK +KELR+RMDKDV   LK+ K IK +LE LD+SN ANR + 
Sbjct  54    LYKNLQEANEESKTVHNAKTMKELRSRMDKDVEQVLKRVKFIKGKLEALDRSNVANRNIA  113

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR +++ EY+ET++RRY+T+TGE  DEE
Sbjct  114   GCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRARMQFEYKETIERRYFTITGEKADEE  173

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  174   TIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIELHQVFLDMAA  233

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LV++QG+QL++IES V  A+S VR G DQL  A+ +QK++RKWTC+A
Sbjct  234   LVDSQGQQLNNIESHVAHASSFVRRGTDQLEDAKVYQKSSRKWTCYA  280



>ref|XP_008462624.1| PREDICTED: syntaxin-121 [Cucumis melo]
Length=304

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/293 (58%), Positives = 221/293 (75%), Gaps = 17/293 (6%)
 Frame = -2

Query  1499  MNDLLSR-SFSLPR-----ENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDD  1338
             MNDL S  SF   R     +    S   P S TI ++            FF+DVE+VK +
Sbjct  1     MNDLFSTDSFRQERHHHRHDTVEMSNNSPSSTTINLNT-----------FFDDVESVKAE  49

Query  1337  LKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNA  1158
             L ++E ++ SL+ +HEQSKT+HN+K +K++R+RM+  V+LALK+A+ IK RLEELD+SN 
Sbjct  50    LTELEGLHRSLQNSHEQSKTLHNSKAIKDVRSRMETAVTLALKKARFIKVRLEELDRSNE  109

Query  1157  ANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTG  978
              NRK+ GCG GSS+DR+RTSVV+GLR KL + M  FN LR++I   Y++T++RRY+T+TG
Sbjct  110   ENRKLPGCGYGSSADRSRTSVVSGLRKKLCDSMESFNRLREEITKTYKDTIERRYFTITG  169

Query  977   ENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQV  798
             ENPDE+ +D LISTG+SETF+QKAIQ+QGRG V+ T+ EIQERH+AVK++ERNL+ELHQV
Sbjct  170   ENPDEKTVDLLISTGESETFLQKAIQKQGRGRVLETIQEIQERHDAVKDIERNLRELHQV  229

Query  797   FLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             FLDMAVLV+ QG+QLDDIESQV RANS V+ G  +L TAR +QKNTRKW C  
Sbjct  230   FLDMAVLVQAQGQQLDDIESQVTRANSAVKRGTSELQTARYYQKNTRKWICIG  282



>ref|XP_010515703.1| PREDICTED: syntaxin-122-like isoform X2 [Camelina sativa]
Length=317

 Score =   338 bits (867),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/245 (65%), Positives = 202/245 (82%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KF+ DVE V +DLK+++++  +L++ HEQSKT+HNA  VK+L+ +MD DVS ALK A  +
Sbjct  21    KFYHDVEEVNEDLKELDRLCHNLRSGHEQSKTLHNAMAVKKLKEKMDADVSAALKTATRV  80

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K  LE LD++N  NR +  CGPGSSSDR RTSVVNGLR KLK+ M++FN +R+ I +EYR
Sbjct  81    KGNLEALDRANEVNRGLPECGPGSSSDRQRTSVVNGLRKKLKDAMDKFNRMRETISTEYR  140

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ET+ R Y+TVTGENPDE  +D+LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK
Sbjct  141   ETIMRMYFTVTGENPDEHTVDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVK  200

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E++L ELHQVFLDMAVLV  QGEQLDDIE  V RANS+VR GAD+L+ AR +QKNTRK
Sbjct  201   DIEKSLNELHQVFLDMAVLVVHQGEQLDDIEGNVKRANSLVRSGADRLVKARFYQKNTRK  260

Query  653   WTCFA  639
             WTCFA
Sbjct  261   WTCFA  265



>emb|CDY19350.1| BnaC05g08590D [Brassica napus]
Length=298

 Score =   337 bits (865),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 216/287 (75%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +       A  E+  ++             KFFEDVE VKDD+K +E 
Sbjct  1     MNDLFSNSFKRNQAQMSDVEAGQETMNLD-------------KFFEDVENVKDDMKGVET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+ +TVHNAK+VKELRA+MD DV   LK+ K+IK +LE L+++NA +R V 
Sbjct  48    LYKKLQDSNEECQTVHNAKKVKELRAKMDADVGQVLKRVKIIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++  EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQSLRARMNDEYKETVERRYFTITGEKADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQEQGRGE+M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TIDNLIASGESENFLQKAIQEQGRGEIMDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>ref|XP_009110738.1| PREDICTED: syntaxin-125-like [Brassica rapa]
Length=298

 Score =   337 bits (865),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 216/287 (75%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE VKDD+K +E 
Sbjct  1     MNDLFSNSFKRNQAQFGDVEAGQETMNLD-------------KFFEDVENVKDDMKGVET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
              Y  L+ ++E+ KTVHNAK+VKELRA+MD DV   LK+ K+IK +LE L+++NA +R V 
Sbjct  48    FYKKLQDSNEECKTVHNAKKVKELRAKMDADVGQVLKRVKIIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++  EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQSLRARMNDEYKETVERRYFTITGEQADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAI+EQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TIDNLIASGESENFLQKAIKEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>emb|CDY70107.1| BnaAnng32640D [Brassica napus]
Length=298

 Score =   337 bits (865),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 216/287 (75%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +   G   A  E+  ++             KFFEDVE VKDD+K ++ 
Sbjct  1     MNDLFSNSFKRNQAQFGDVEAGQETMNLD-------------KFFEDVENVKDDMKGVDT  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
              Y  L+ ++E+ KTVHNAK+VKELRA+MD DV   LK+ K+IK +LE L+++NA +R V 
Sbjct  48    FYKKLQDSNEECKTVHNAKKVKELRAKMDADVGQVLKRVKIIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++  EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQSLRARMNDEYKETVERRYFTITGEQADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TIDNLIASGESENFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDARENQKSSRKWTCYA  274



>ref|XP_002889857.1| SYP125 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66116.1| SYP125 [Arabidopsis lyrata subsp. lyrata]
Length=299

 Score =   337 bits (865),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 218/287 (76%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +       A  E+  ++             KFFEDVE VKDD+K +E 
Sbjct  1     MNDLFSNSFKKNQAQLRDVEAGQETMNLD-------------KFFEDVENVKDDMKGVET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+ KTVHNAK+VKELRA+MD DV + LK+ K+IK +LE L+++NA +R V 
Sbjct  48    LYKKLQDSNEECKTVHNAKKVKELRAKMDGDVGMVLKRVKIIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++ +EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRARMNNEYKETVERRYFTITGEKADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQEQGRG++++T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TIDNLIASGESENFLQKAIQEQGRGQILDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>ref|XP_009148453.1| PREDICTED: syntaxin-125 [Brassica rapa]
 emb|CDX97943.1| BnaA06g06940D [Brassica napus]
Length=298

 Score =   337 bits (864),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 216/287 (75%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +       A  E+  ++             KFFEDVE VKDD+K +E 
Sbjct  1     MNDLFSNSFKRNQAQMSDVEAGQETMNLD-------------KFFEDVENVKDDMKGVET  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+ +TVHNAK+VKELRA+MD DV   LK+ K+IK +LE L+++NA +R V 
Sbjct  48    LYKKLQDSNEECQTVHNAKKVKELRAKMDADVGQVLKRVKIIKQKLEALEKANANSRNVP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++  EY+ETV+RRY+T+TGE  DE+
Sbjct  108   GCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQSLRARMNDEYKETVERRYFTITGEKADEQ  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LI++G+SE F+QKAIQEQGRGE+M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  168   TIDNLIASGESENFLQKAIQEQGRGEIMDTISEIQERHDAVKEIEKNLLELHQVFLDMAA  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL++IES V +A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  228   LVEAQGQQLNNIESHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYA  274



>ref|XP_002888093.1| SYP124 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64352.1| SYP124 [Arabidopsis lyrata subsp. lyrata]
Length=303

 Score =   337 bits (865),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 207/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKDD+K +E +Y SL+ ++E+ KTVHNAK+VKELRA+MD DV+  LK+ K+I
Sbjct  35    KFFEDVENVKDDMKAVETLYKSLQDSNEECKTVHNAKKVKELRAKMDGDVAQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L+++NA +R V GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KQKLEALEKANANSRNVPGCGPGSSTDRTRTSVVSGLGKKLKDLMDSFQGLRARMNAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE  DE+ ++ LIS+G+SE F+QKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEQADEQTIENLISSGESENFLQKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG+QL+DIES V++A+S VR G DQL  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGQQLNDIESHVSKASSFVRRGTDQLQDAREYQKSSRK  274

Query  653   WTCFA  639
             WTC+A
Sbjct  275   WTCYA  279



>ref|NP_176324.1| syntaxin-124 [Arabidopsis thaliana]
 sp|O64791.1|SY124_ARATH RecName: Full=Syntaxin-124; Short=AtSYP124 [Arabidopsis thaliana]
 gb|AAC13912.1|AAC13912 T1F9.22 [Arabidopsis thaliana]
 gb|ABE65730.1| syntaxin [Arabidopsis thaliana]
 gb|AEE33817.1| syntaxin-124 [Arabidopsis thaliana]
Length=303

 Score =   337 bits (865),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 208/245 (85%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKD++K +E +Y SL+ ++E+ KTVHNAK+VKELRA+MD DV+  LK+ K+I
Sbjct  35    KFFEDVENVKDNMKGVETLYKSLQDSNEECKTVHNAKKVKELRAKMDGDVAQVLKRVKMI  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L+++NA +R V GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KQKLEALEKANANSRNVSGCGPGSSTDRTRTSVVSGLGKKLKDLMDSFQGLRARMNAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE  DE+ ++ LIS+G+SE F+QKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEQADEQTIENLISSGESENFLQKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE+QG+QL+DIES V++A+S VR G DQL  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVESQGQQLNDIESHVSKASSFVRRGTDQLQDAREYQKSSRK  274

Query  653   WTCFA  639
             WTC+A
Sbjct  275   WTCYA  279



>gb|ABK28446.1| unknown [Arabidopsis thaliana]
Length=304

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 208/245 (85%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKD++K +E +Y SL+ ++E+ KTVHNAK+VKELRA+MD DV+  LK+ K+I
Sbjct  35    KFFEDVENVKDNMKGVETLYKSLQDSNEECKTVHNAKKVKELRAKMDGDVAQVLKRVKMI  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L+++NA +R V GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KQKLEALEKANANSRNVSGCGPGSSTDRTRTSVVSGLGKKLKDLMDSFQGLRARMNAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE  DE+ ++ LIS+G+SE F+QKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEQADEQTIENLISSGESENFLQKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE+QG+QL+DIES V++A+S VR G DQL  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVESQGQQLNDIESHVSKASSFVRRGTDQLQDAREYQKSSRK  274

Query  653   WTCFA  639
             WTC+A
Sbjct  275   WTCYA  279



>ref|XP_006392020.1| hypothetical protein EUTSA_v10023607mg [Eutrema salsugineum]
 gb|ESQ29306.1| hypothetical protein EUTSA_v10023607mg [Eutrema salsugineum]
Length=303

 Score =   337 bits (863),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 204/245 (83%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKDD+K +E +Y  L+ ++E+ KTVHNAK+VKELRA+MD DV+  LK+ K+I
Sbjct  35    KFFEDVENVKDDMKGVETLYMKLQDSNEECKTVHNAKKVKELRAKMDGDVAQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++ NA +R V GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++  EY+
Sbjct  95    KQKLEALEKGNANSRNVLGCGPGSSTDRTRTSVVSGLGKKLKDLMDNFQGLRARMNDEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE  DE+ ++ LIS+G+SE F+QKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEKADEQTIENLISSGESENFLQKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG+QL+DIES V++A+S VR G DQL  AR+HQK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGQQLNDIESHVSKASSFVRRGTDQLQDAREHQKSSRK  274

Query  653   WTCFA  639
             WTC+A
Sbjct  275   WTCYA  279



>gb|KEH24254.1| syntaxin of plants 122 protein [Medicago truncatula]
Length=294

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/287 (59%), Positives = 220/287 (77%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS         G ++      H I+M+         L KFF++VE++K++LK +EK
Sbjct  1     MNDLLS---------GDNN----HHHIIQMAETYTAPVQTLEKFFQEVESLKEELKTLEK  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++ SLK +HE+SKT+H+A+ VKELR+ MD DV+++LK+A+LIK RLE LD+SN A+R + 
Sbjct  48    LHTSLKNSHEKSKTLHSAQAVKELRSAMDSDVTISLKKARLIKVRLESLDRSNEASRSLP  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
              CGPGSSSDRTR +VV+GLR  LK+ M  FN LR++I SEYRETV+RRY+ V  E  D++
Sbjct  108   DCGPGSSSDRTRLAVVSGLRKNLKDSMESFNGLREQISSEYRETVKRRYFAVNEEKADDK  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQ+QGR  +M  + EI+ERH AVKE+ERNLKELHQVFLDMAV
Sbjct  168   TVDLLISTGESETFLQKAIQKQGRATMMEKIQEIEERHGAVKEIERNLKELHQVFLDMAV  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LV++QGE+L+DIESQ+ RANS VR G  QL  ARK+QKNTR+WTCFA
Sbjct  228   LVQSQGEELNDIESQMMRANSYVRGGVQQLHVARKNQKNTREWTCFA  274



>ref|XP_009602572.1| PREDICTED: syntaxin-124-like [Nicotiana tomentosiformis]
Length=313

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/298 (57%), Positives = 221/298 (74%), Gaps = 24/298 (8%)
 Frame = -2

Query  1499  MNDLLSRSF-------------SLPRENGGSSPAPPESHTIEMSaaanggganlAKFFED  1359
             MNDL S S               L    G S P P ++ +I+++           KFFED
Sbjct  1     MNDLFSPSLKKYQDLKQQVQMDDLEAGAGRSGPDPSQNESIDLA-----------KFFED  49

Query  1358  VEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLE  1179
             VE VK+D+KD+EK+Y  L+ ++E+SKTVH+AK VKE+R+RMD DV+  LK+ K+IK +LE
Sbjct  50    VENVKEDMKDVEKLYKRLQESNEESKTVHSAKTVKEIRSRMDNDVTQVLKRVKIIKGKLE  109

Query  1178  ELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQR  999
              L++SNAANRK+ GCGPGSS+DRTRTSVV+GL  KLK  M+ F  LR ++ SEY+ETV R
Sbjct  110   ALERSNAANRKMPGCGPGSSADRTRTSVVSGLGKKLKVLMDDFQALRARMNSEYKETVAR  169

Query  998   RYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERN  819
             RY+TVTGE  D+E+++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+N
Sbjct  170   RYFTVTGEKADDELIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKN  229

Query  818   LKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             L ELHQ+FLDMA LVE QG+QL+DIES V  A+S VR G DQL  AR  QK++RK TC
Sbjct  230   LIELHQIFLDMAALVEAQGQQLNDIESHVAHASSFVRRGTDQLQEARVLQKSSRKCTC  287



>ref|XP_003593444.1| Syntaxin-124 [Medicago truncatula]
 gb|AES63695.1| syntaxin of plants 122 protein [Medicago truncatula]
Length=304

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/290 (57%), Positives = 219/290 (76%), Gaps = 14/290 (5%)
 Frame = -2

Query  1499  MNDLLSRSF---SLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKD  1329
             MNDL S SF   S  +E            +I +            KFFEDVE VK+D++ 
Sbjct  1     MNDLFSSSFKKYSDLKEQAQIDDVEAGKESINLD-----------KFFEDVENVKEDMRL  49

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             +EK+Y  L+ A+E+SK VHNAK +K+LRARMDKDV   LK+ K+IK +LE L++SNAANR
Sbjct  50    VEKLYRKLQEANEESKIVHNAKTMKDLRARMDKDVEQVLKRVKIIKGKLEALERSNAANR  109

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR +++ EY+ET++RRY+T+TGE  
Sbjct  110   NIPGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRARMQQEYKETIERRYFTITGEKA  169

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             DE+ ++ LIS+G+SETFMQ+AIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLD
Sbjct  170   DEDTIENLISSGESETFMQRAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIELHQVFLD  229

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             MA LVE+QG+QL++IES V  A+S VR G +QL  AR+HQK++RKWTC+ 
Sbjct  230   MAALVESQGQQLNNIESHVAHASSFVRRGTEQLHEAREHQKDSRKWTCYV  279



>ref|XP_004485712.1| PREDICTED: syntaxin-124-like [Cicer arietinum]
Length=304

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/290 (57%), Positives = 220/290 (76%), Gaps = 14/290 (5%)
 Frame = -2

Query  1499  MNDLLSRSF---SLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKD  1329
             MNDL S SF   S  +E            +I +            KFFEDVE VK+D++ 
Sbjct  1     MNDLFSSSFKKYSDLKEQAYIDDVEAGKESINLD-----------KFFEDVENVKEDMRL  49

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             +EK+Y  L+ ++E+SK VHNAK +K+LRARMDKDV   LK+ K+IK +LE L++SNAANR
Sbjct  50    VEKLYRKLQESNEESKIVHNAKTMKDLRARMDKDVEQVLKRVKIIKGKLEALERSNAANR  109

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR +++ EY+ET++RRY+T+TGE  
Sbjct  110   NLPGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRARMQQEYKETIERRYFTITGEKA  169

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             DE+ ++ LIS+G+SETFMQ+AIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLD
Sbjct  170   DEDTIENLISSGESETFMQRAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIELHQVFLD  229

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             MA LVE+QG+QL++IES V  A+S VR G +QL  AR+HQK++RKWTC+A
Sbjct  230   MAALVESQGQQLNNIESHVAHASSFVRRGTEQLHEAREHQKDSRKWTCYA  279



>ref|XP_010473338.1| PREDICTED: syntaxin-124-like isoform X2 [Camelina sativa]
 ref|XP_010473339.1| PREDICTED: syntaxin-124-like isoform X2 [Camelina sativa]
Length=283

 Score =   335 bits (858),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 205/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKDD+K +E +Y  L+ ++E+ KTVHNA +VKELRA+MD DVS  LK+ K+I
Sbjct  15    KFFEDVENVKDDMKGVETLYKKLQDSNEECKTVHNANKVKELRAKMDGDVSQVLKRVKII  74

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L+++NA +R V GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  75    KQKLEALEKANANSRNVPGCGPGSSTDRTRTSVVSGLGKKLKDLMDSFQGLRARMNAEYK  134

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE  DE+ ++ LIS+G+SE F+QKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  135   ETVERRYFTITGEKADEQTIENLISSGESENFLQKAIQEQGRGQILDTISEIQERHDAVK  194

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG+QL+DIES V++A+S VR G DQL  AR++QK++RK
Sbjct  195   EIEKNLIELHQVFLDMAALVEAQGQQLNDIESHVSKASSFVRRGTDQLQDAREYQKSSRK  254

Query  653   WTCFA  639
             WTC+A
Sbjct  255   WTCYA  259



>ref|XP_002317241.1| hypothetical protein POPTR_0011s04350g [Populus trichocarpa]
 gb|EEE97853.1| hypothetical protein POPTR_0011s04350g [Populus trichocarpa]
Length=302

 Score =   335 bits (860),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 204/245 (83%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFEDVE +K+D+K +E++Y SL+ A+E+SKTVHNAK +K LR+RMD DV   LK+ K+I
Sbjct  35    RFFEDVENIKEDMKTVERLYRSLQEANEESKTVHNAKTMKNLRSRMDMDVEQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SNAA+R + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F DLR ++ +EY+
Sbjct  95    KGKLEALDRSNAAHRNIPGCGPGSSTDRTRTSVVSGLGKKLKDLMDNFQDLRARMAAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE   +E ++ LIS+G+SE+FMQKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGERASDETIENLISSGESESFMQKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG QL+DIES V  A+S VR G +QL  AR+HQK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGHQLNDIESHVAHASSFVRRGTEQLQEAREHQKSSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>ref|XP_010473337.1| PREDICTED: syntaxin-124-like isoform X1 [Camelina sativa]
Length=303

 Score =   335 bits (860),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 205/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKDD+K +E +Y  L+ ++E+ KTVHNA +VKELRA+MD DVS  LK+ K+I
Sbjct  35    KFFEDVENVKDDMKGVETLYKKLQDSNEECKTVHNANKVKELRAKMDGDVSQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L+++NA +R V GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KQKLEALEKANANSRNVPGCGPGSSTDRTRTSVVSGLGKKLKDLMDSFQGLRARMNAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE  DE+ ++ LIS+G+SE F+QKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEKADEQTIENLISSGESENFLQKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG+QL+DIES V++A+S VR G DQL  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGQQLNDIESHVSKASSFVRRGTDQLQDAREYQKSSRK  274

Query  653   WTCFA  639
             WTC+A
Sbjct  275   WTCYA  279



>ref|XP_004248147.1| PREDICTED: syntaxin-124-like [Solanum lycopersicum]
Length=311

 Score =   335 bits (860),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 170/300 (57%), Positives = 224/300 (75%), Gaps = 26/300 (9%)
 Frame = -2

Query  1499  MNDLLSRSF-------------SLPRENGGSSPAPPESHTIEMSaaanggganlAKFFED  1359
             MNDL S S               L    GG+ P+  ES  I+++           KFFED
Sbjct  1     MNDLFSPSLKKYQDLKQQVQMDDLELGTGGTGPSHNES--IDLA-----------KFFED  47

Query  1358  VEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLE  1179
             VE VK+D+K++EK++  L+ ++E+SKTVH+AK+VK++RARMD DV+L LK+ K+IK +LE
Sbjct  48    VENVKEDMKEVEKLHKRLQDSNEESKTVHSAKKVKDIRARMDSDVTLVLKRVKIIKGKLE  107

Query  1178  ELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQR  999
              L++SN ANRK  GCGPGSS+DRTRTSVV+GL  KLK  M+ F  LR K+ SEY++TV R
Sbjct  108   GLERSNVANRKNLGCGPGSSADRTRTSVVSGLGKKLKVLMDDFQALRAKMNSEYKDTVAR  167

Query  998   RYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERN  819
             RY+TVTGEN D+E++D LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+N
Sbjct  168   RYFTVTGENADDELIDNLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKN  227

Query  818   LKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             L ELHQ+FLDMA LVE QG+QL+DIES V  A+S VR G +QL  AR+ QK++RK TC A
Sbjct  228   LIELHQIFLDMAALVEAQGQQLNDIESHVAHASSFVRRGTEQLTEARELQKSSRKCTCIA  287



>ref|XP_010646969.1| PREDICTED: syntaxin-124-like [Vitis vinifera]
Length=304

 Score =   335 bits (858),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 203/245 (83%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VK D+  +EK+Y  L+ A+E+SKTVHNAK +K+LRARMD DV+  LK+ K+I
Sbjct  35    KFFEDVENVKQDMGGVEKLYKQLQDANEESKTVHNAKTMKDLRARMDSDVTQVLKRVKMI  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA+R V GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR K+ +EY+
Sbjct  95    KGKLEGLERSNAASRNVPGCGPGSSADRTRSSVVSGLGKKLKDMMDDFQGLRAKMSTEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRYYT+TG+  DE+ ++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVK
Sbjct  155   ETVERRYYTITGQKADEDTIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG+QL+DIES V  A+S VR G +QL  AR++QK +RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGQQLNDIESHVAHASSFVRRGTEQLQVAREYQKGSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>ref|XP_004494256.1| PREDICTED: syntaxin-121-like [Cicer arietinum]
Length=292

 Score =   334 bits (857),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 170/287 (59%), Positives = 215/287 (75%), Gaps = 13/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS                   H I+M+  + G   +L KFFE++EAVK++L ++EK
Sbjct  1     MNDLLS-------------ADNNHRHVIQMAENSTGTAISLEKFFEEIEAVKEELNELEK  47

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++  L+ +HE+SK +H+AK+VKELR RMD DVSL+LK+AK +K  LE L++SN A+R + 
Sbjct  48    LHVRLRKSHEKSKRLHSAKEVKELRCRMDSDVSLSLKKAKFVKGSLESLERSNEASRGLK  107

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
              CGPGSSSDRTR+ VV+GLR KLKE M  FN+LR++I  EYR+TV+RRY+TVTGENP ++
Sbjct  108   DCGPGSSSDRTRSGVVSGLRKKLKESMESFNELREEISLEYRQTVKRRYFTVTGENPTDK  167

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF++KAI+EQGR  VM T+ EI+ERH AVKE+ERNLKELHQVFLDMAV
Sbjct  168   TVDLLISTGESETFLKKAIEEQGRATVMETIQEIEERHGAVKEIERNLKELHQVFLDMAV  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QGE L+DIESQ+ RANS V  G  Q   A  HQKNTRK T FA
Sbjct  228   LVEAQGEDLNDIESQMMRANSYVTSGVQQFHVANTHQKNTRKCTFFA  274



>emb|CBI23478.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 203/245 (83%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VK D+  +EK+Y  L+ A+E+SKTVHNAK +K+LRARMD DV+  LK+ K+I
Sbjct  35    KFFEDVENVKQDMGGVEKLYKQLQDANEESKTVHNAKTMKDLRARMDSDVTQVLKRVKMI  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA+R V GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR K+ +EY+
Sbjct  95    KGKLEGLERSNAASRNVPGCGPGSSADRTRSSVVSGLGKKLKDMMDDFQGLRAKMSTEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRYYT+TG+  DE+ ++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVK
Sbjct  155   ETVERRYYTITGQKADEDTIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG+QL+DIES V  A+S VR G +QL  AR++QK +RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGQQLNDIESHVAHASSFVRRGTEQLQVAREYQKGSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>ref|XP_003543086.1| PREDICTED: syntaxin-124-like [Glycine max]
 gb|KHN08582.1| Syntaxin-124 [Glycine soja]
Length=304

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 224/287 (78%), Gaps = 8/287 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF         S    +SH  ++ A       +  KFF++VE VK+D++ +EK
Sbjct  1     MNDLFSSSFK------KYSDLKEQSHIDDVEAGKESVNLD--KFFDEVENVKEDMRLVEK  52

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+SK VHNAK +K+LRARMD+DV   LK+ KLIK +LE L++SNAANR + 
Sbjct  53    LYRKLQESNEESKIVHNAKTMKDLRARMDQDVQQVLKRVKLIKGKLESLERSNAANRNIP  112

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++++EY+ETV+RRY+T+TGE  DE+
Sbjct  113   GCGPGSSADRTRTSVVSGLGKKLKDLMDDFQGLRARMQNEYKETVERRYFTITGEKADED  172

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LIS+G+SE+F+Q+AIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  173   TIENLISSGESESFLQRAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIELHQVFLDMAA  232

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE+QG+QL++IES V RA+S VR G +QL  AR++QK++RKWTC+A
Sbjct  233   LVESQGQQLNNIESHVARASSFVRRGTEQLQDAREYQKSSRKWTCYA  279



>ref|XP_010430146.1| PREDICTED: syntaxin-124 [Camelina sativa]
Length=303

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 205/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKDD+K IE +Y  L+ ++E+ KTVHNA +VKELRA+MD DV+  LK+ K+I
Sbjct  35    KFFEDVENVKDDMKGIETLYKKLQDSNEECKTVHNANKVKELRAKMDGDVAQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L+++NA +R V GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KQKLEALEKANANSRNVPGCGPGSSTDRTRTSVVSGLGKKLKDLMDSFQGLRARMNAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE  DE+ ++ LIS+G+SE F+QKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEKADEQTIENLISSGESENFLQKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG+QL+DIES V++A+S VR G DQL  AR++QK++RK
Sbjct  215   EIEKNLLELHQVFLDMAALVEAQGQQLNDIESHVSKASSFVRRGTDQLQDAREYQKSSRK  274

Query  653   WTCFA  639
             WTC+A
Sbjct  275   WTCYA  279



>ref|XP_007025774.1| Syntaxin of plants 124 [Theobroma cacao]
 gb|EOY28396.1| Syntaxin of plants 124 [Theobroma cacao]
Length=302

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 205/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VK+DLK++E++Y +L+ A+E+SKTVHNAK +K+LRARMD DV   LK+ K+I
Sbjct  35    KFFEDVENVKEDLKNVERLYKALQDANEESKTVHNAKTMKQLRARMDTDVEQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA+R + GCGPGSS+DRTRTSVV+GL  KLK  M+ F  LR +++SEY+
Sbjct  95    KGKLEALERSNAASRSIPGCGPGSSADRTRTSVVSGLGKKLKVLMDDFQGLRSRMQSEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TG+  DE+ ++ LIS+G+SE+F+Q+AIQEQGRG++M+T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGQKADEDTIENLISSGESESFLQRAIQEQGRGQIMDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQ+FLDMA LVE QG QL+DIES V  A+S VR G + L  AR++QKN+RK
Sbjct  215   EIEKNLIELHQIFLDMAALVEAQGHQLNDIESHVAHASSFVRRGTENLQEAREYQKNSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>ref|XP_010533865.1| PREDICTED: syntaxin-124 [Tarenaya hassleriana]
Length=303

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/244 (63%), Positives = 205/244 (84%), Gaps = 0/244 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKDD+K +E +Y  L+ ++E+ KTVHNAK +KELRA+MD DVSL LK+ KLI
Sbjct  35    KFFEDVENVKDDMKGVEDLYRKLQESNEECKTVHNAKTMKELRAKMDNDVSLVLKRVKLI  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNA++R V GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR K+ +EY+
Sbjct  95    KQKLEALERSNASSRNVPGCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRAKMNAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE  DE+ ++ LIS+G+SE F+QKAIQ+QGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEKADEQTIENLISSGESENFLQKAIQDQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE+QG+QL+DIES V +A+S VR G  QL  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVESQGQQLNDIESHVAKASSFVRRGTGQLQEAREYQKSSRK  274

Query  653   WTCF  642
             WTC+
Sbjct  275   WTCY  278



>ref|XP_007159259.1| hypothetical protein PHAVU_002G222900g [Phaseolus vulgaris]
 gb|ESW31253.1| hypothetical protein PHAVU_002G222900g [Phaseolus vulgaris]
Length=304

 Score =   333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 206/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VK+D++ +E +Y  L+ A+E+SKT H AK +K++RARMDKDV L LK+ K+I
Sbjct  35    KFFEDVENVKEDMRGVEVLYRKLQEANEESKTAHTAKAMKDVRARMDKDVELVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAANR V GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KGKLEALERSNAANRNVAGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRTRMHNEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE  +EE+++ LIS+G+SE+F+Q+AIQEQGRG++M+T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEKAEEEMIENLISSGESESFLQRAIQEQGRGQIMDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA +VE QG+QL++IES V  A+S VR G DQL  AR++QK++RK
Sbjct  215   EIEKNLMELHQVFLDMAAMVEAQGQQLNNIESHVAHASSFVRRGTDQLEDAREYQKSSRK  274

Query  653   WTCFA  639
             WTC+A
Sbjct  275   WTCYA  279



>gb|KHN00113.1| Syntaxin-124 [Glycine soja]
Length=304

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 221/287 (77%), Gaps = 8/287 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF         S    ++H  ++ A       +  KFFEDVE VK++++ +EK
Sbjct  1     MNDLFSNSFK------KYSNLKQQAHLDDVEAGKETVNLD--KFFEDVENVKEEMRTVEK  52

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++  L+ A+E+SK VHNAK +KELRARMDKDV   LK+ K+IK +LE L++SNAANR + 
Sbjct  53    LHRKLQEANEESKVVHNAKTMKELRARMDKDVEQVLKRVKVIKGKLEALERSNAANRNIP  112

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR +++ EY+ETV+RRY+T+TGE PD+E
Sbjct  113   GCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRTRMQMEYKETVERRYFTITGEKPDKE  172

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LI +G+SE+F+Q+AIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  173   TIENLIWSGESESFLQRAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIELHQVFLDMAA  232

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE+QG+QL++IES V  A+S VR G DQL  AR +QK++RKWTC+A
Sbjct  233   LVESQGQQLNNIESHVAHASSFVRRGTDQLQDARDYQKSSRKWTCYA  279



>gb|KFK40720.1| hypothetical protein AALP_AA2G032200 [Arabis alpina]
Length=303

 Score =   333 bits (853),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 205/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKDD+K IE +Y  L+ ++E+ KTVHNAK+VKELRA+MD DV+  LK+ K+I
Sbjct  35    KFFEDVENVKDDMKGIETLYKRLQDSNEECKTVHNAKKVKELRAKMDGDVAQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L+++NA +R V GCGPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KQKLEALEKANANSRNVPGCGPGSSTDRTRSSVVSGLGKKLKDLMDSFQGLRARMNAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE  DE+ ++ LI +G+SE F+QKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEKADEQTIENLIESGESENFLQKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG+QL+DIES V++A+S VR G DQL  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGQQLNDIESHVSKASSFVRRGTDQLQDAREYQKSSRK  274

Query  653   WTCFA  639
             WTC+A
Sbjct  275   WTCYA  279



>ref|XP_010554816.1| PREDICTED: syntaxin-122, partial [Tarenaya hassleriana]
Length=261

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 209/265 (79%), Gaps = 9/265 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-----AKFFEDVEAVKDDL  1335
             MNDLLSR+FS       SSP     H I+MSAA   GG         KFF+DVE   DD+
Sbjct  1     MNDLLSRTFSSDSSRRNSSPP----HIIQMSAAMTSGGDGGGGNNLEKFFKDVETASDDI  56

Query  1334  KDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAA  1155
             ++++++ G L+++HEQSKT+H A  VKELRA+MD DV+ ALK AK +K RLEE+D+SN  
Sbjct  57    RELDRLCGELRSSHEQSKTLHRAAAVKELRAKMDADVAAALKTAKRVKTRLEEIDRSNEV  116

Query  1154  NRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGE  975
             NR V GCGPGSSSDR R SVVNGLR K+K+ M++FN LR+KI  EYRETVQRRY+TVTGE
Sbjct  117   NRSVPGCGPGSSSDRQRISVVNGLRKKMKDSMDEFNRLREKISEEYRETVQRRYFTVTGE  176

Query  974   NPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVF  795
             NPDE+ LD+LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVK++E++L ELHQVF
Sbjct  177   NPDEKTLDRLISTGESETFLQKAIQEQGRGRILDTINEIQERHDAVKDIEKSLNELHQVF  236

Query  794   LDMAVLVETQGEQLDDIESQVNRAN  720
             LDMAVLVE QG+QLDDIES V RA+
Sbjct  237   LDMAVLVEHQGQQLDDIESHVKRAD  261



>ref|XP_009146680.1| PREDICTED: syntaxin-121-like [Brassica rapa]
Length=325

 Score =   333 bits (855),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/244 (65%), Positives = 204/244 (84%), Gaps = 12/244 (5%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE+VK++LK+++++  +L+++HEQSKT+ NA+ VK+LR++MD DV +ALK+AK+I
Sbjct  37    KFFEDVESVKEELKELDRVNDTLQSSHEQSKTLPNAQAVKDLRSKMDGDVGVALKKAKMI  96

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SNAANR + GCGPGSSSDRTRTS++NGLR KLK+ M+ FN LR+ I SEYR
Sbjct  97    KVKLEALDRSNAANRSLPGCGPGSSSDRTRTSLLNGLRKKLKDSMDSFNRLREVISSEYR  156

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETVQRRY+TVTGENPDE+ LD+LIST            EQGRG V++T+ EIQERH+AVK
Sbjct  157   ETVQRRYFTVTGENPDEKTLDRLIST------------EQGRGRVLDTINEIQERHDAVK  204

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++E+NL+ELHQVFLDMAVLVE QG QLDDIES V RA+S +R G ++L TAR +QKNTRK
Sbjct  205   DIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTEELHTARVYQKNTRK  264

Query  653   WTCF  642
             WTC+
Sbjct  265   WTCY  268



>ref|XP_002272992.1| PREDICTED: syntaxin-124 [Vitis vinifera]
 emb|CBI28926.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   332 bits (852),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 165/287 (57%), Positives = 214/287 (75%), Gaps = 6/287 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF         +   P+S  +E    A     NL KFFE+VE VKDD++ +E 
Sbjct  1     MNDLFSSSFKR------FTDLKPQSFDVEAGGDAGRESVNLEKFFEEVENVKDDMRAVEN  54

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
              Y  L+  +E+SKTVHNAK +K+LRARMD DV   LK+ K+IK +LE L++SNAANR   
Sbjct  55    FYKKLQDLNEESKTVHNAKTMKDLRARMDTDVVQVLKRVKIIKGKLEALERSNAANRNHP  114

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV GL  KLK+ M+ F +LR ++ +EY++T++RRY+T+TGE  DEE
Sbjct  115   GCGPGSSADRTRTSVVGGLGKKLKDMMDDFQNLRVRMNAEYKDTIERRYFTITGEKADEE  174

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LIS+G+SETF+QKAIQ+QGRG++M+T+ E+QERH AVKE+E+NL ELHQVFLDMA 
Sbjct  175   TIENLISSGESETFLQKAIQDQGRGQIMDTISELQERHGAVKEIEKNLIELHQVFLDMAA  234

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+ L+DIES V  A+S VR G DQL  AR +QK++RKWTC A
Sbjct  235   LVEAQGQHLNDIESHVAHASSFVRKGTDQLQIARNYQKSSRKWTCIA  281



>ref|XP_002305002.2| syntaxin 125 family protein [Populus trichocarpa]
 gb|EEE85513.2| syntaxin 125 family protein [Populus trichocarpa]
Length=302

 Score =   332 bits (852),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 203/245 (83%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFEDVE VK+D+K +E++Y SL+ A+E+ KTVHNAK +K LR+RMD DV   LK+ K+I
Sbjct  35    RFFEDVENVKEDMKTVERLYKSLQEANEECKTVHNAKTMKNLRSRMDIDVEQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SNAA+R + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F DLR ++ +EY+
Sbjct  95    KGKLEALDRSNAAHRNIPGCGPGSSADRTRTSVVSGLGKKLKDLMDNFQDLRARMAAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE   EE ++ LIS+G+SE+FMQKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGERASEETIENLISSGESESFMQKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG Q++DIES V  A+S VR G +QL  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGHQINDIESHVAHASSFVRRGTEQLSEAREYQKSSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>ref|XP_010052377.1| PREDICTED: syntaxin-124-like [Eucalyptus grandis]
 gb|KCW76338.1| hypothetical protein EUGRSUZ_D00709 [Eucalyptus grandis]
Length=301

 Score =   332 bits (851),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 216/292 (74%), Gaps = 18/292 (6%)
 Frame = -2

Query  1499  MNDLLSRSF----SLPRENG-GSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDL  1335
             MNDL S SF     L ++N      A  E+  +E             KFFEDVE VK D+
Sbjct  1     MNDLFSGSFKKYTDLKQQNYLDEMEAGKETVNLE-------------KFFEDVENVKGDM  47

Query  1334  KDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAA  1155
               +EK+Y  L+ A+E+SKTVHNA  +K+LR+RMD DV   LK+AK+IK +LE L++SN A
Sbjct  48    NQVEKLYKRLQEANEESKTVHNANTMKQLRSRMDADVGQVLKRAKIIKGKLEALERSNVA  107

Query  1154  NRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGE  975
             +R + GCGPG+S+DRTRT+VV GL  KLK+ M+ F  LR K+  EY+ETV+RRY+T+TG+
Sbjct  108   HRSIPGCGPGTSADRTRTAVVGGLGKKLKDLMDDFQSLRAKMNEEYKETVERRYFTITGQ  167

Query  974   NPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVF  795
               DEE ++ LIS+G+SE+F+QKAIQEQGRG++++T+ EIQERH+AVKE+E+NL ELHQVF
Sbjct  168   KADEETIENLISSGESESFLQKAIQEQGRGQILDTISEIQERHDAVKEIEKNLLELHQVF  227

Query  794   LDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LDMA LVE QG QL+DIES V  ANS VR GA QL  AR+HQK++RKWTC+A
Sbjct  228   LDMAALVEAQGHQLNDIESHVTHANSFVRRGAGQLQEAREHQKSSRKWTCYA  279



>ref|XP_004497645.1| PREDICTED: syntaxin-121-like [Cicer arietinum]
Length=306

 Score =   332 bits (851),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 218/262 (83%), Gaps = 1/262 (0%)
 Frame = -2

Query  1427  SHTIEMSaaanggg-anlAKFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKE  1251
             +H IEMS+        +L +FFE+VE VK++LK+++++Y SL+ +HE+SKT+H+AK VK+
Sbjct  24    NHVIEMSSPTTEQAGVHLDRFFEEVEGVKEELKELDRLYESLRVSHEKSKTLHSAKAVKD  83

Query  1250  LRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKL  1071
             +R+RMD DV+ ALK AKL+K RLE LD+SN A+R + G GP SSSDRTR+SVV+GLR KL
Sbjct  84    IRSRMDADVANALKNAKLVKVRLEALDRSNEASRSLPGAGPDSSSDRTRSSVVSGLRKKL  143

Query  1070  KEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQG  891
             K+ M+ FN+LRQ+I SEY+ET+QRRYYTVTGE PD++ +D LISTG+SETF+QKAIQ+QG
Sbjct  144   KDSMDSFNNLRQQISSEYKETIQRRYYTVTGEKPDDKTVDLLISTGESETFLQKAIQQQG  203

Query  890   RGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIV  711
             +  +++T+ EIQERH+ VKE+ERNL ELHQVF+DMAVLV++QGEQLDDIES V RANS V
Sbjct  204   KANIIDTIQEIQERHDIVKEMERNLMELHQVFMDMAVLVQSQGEQLDDIESHVARANSYV  263

Query  710   RHGADQLLTARKHQKNTRKWTC  645
             R G  QL  ARKHQKNTRKWTC
Sbjct  264   RGGVQQLHVARKHQKNTRKWTC  285



>ref|XP_006366031.1| PREDICTED: syntaxin-124-like [Solanum tuberosum]
Length=311

 Score =   332 bits (852),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 168/300 (56%), Positives = 223/300 (74%), Gaps = 26/300 (9%)
 Frame = -2

Query  1499  MNDLLSRSF-------------SLPRENGGSSPAPPESHTIEMSaaanggganlAKFFED  1359
             MNDL S S               L    GG+ P+  ES  I+++           KFFED
Sbjct  1     MNDLFSPSLKKYQDLKQQIQMDDLELGTGGTGPSQNES--IDLA-----------KFFED  47

Query  1358  VEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLE  1179
             VE VK+D+K++E ++  L+ ++E+SKTVH+A++VK++RARMD DV+L LK+ K+IK +LE
Sbjct  48    VENVKEDMKEVENLHKRLQESNEESKTVHSAQKVKDIRARMDSDVTLVLKRVKIIKGKLE  107

Query  1178  ELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQR  999
              L++SN ANRK  GCGPGSS+DRTRTSVV+GL  KLK  M+ F  LR K+ SEY++TV R
Sbjct  108   GLERSNVANRKNMGCGPGSSADRTRTSVVSGLGKKLKVLMDDFQALRAKMNSEYKDTVAR  167

Query  998   RYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERN  819
             RY+TVTGEN D+E++D LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+N
Sbjct  168   RYFTVTGENADDELIDNLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKN  227

Query  818   LKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             L ELHQ+FLDMA LVE QG+QL+DIES V  A+S VR G +QL  AR+ QK++RK TC A
Sbjct  228   LIELHQIFLDMAALVEAQGQQLNDIESHVAHASSFVRRGTEQLTEARELQKSSRKCTCIA  287



>ref|XP_002438619.1| hypothetical protein SORBIDRAFT_10g022930 [Sorghum bicolor]
 gb|EER89986.1| hypothetical protein SORBIDRAFT_10g022930 [Sorghum bicolor]
Length=309

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/293 (57%), Positives = 217/293 (74%), Gaps = 18/293 (6%)
 Frame = -2

Query  1499  MNDLLSRSF------SLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDD  1338
             MNDL S S       S P  + G + A  ES              NL KFFEDVEAVK+D
Sbjct  1     MNDLFSSSSFKKYADSSPATSAGGTDAGSES------------VVNLDKFFEDVEAVKED  48

Query  1337  LKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNA  1158
             ++ +E +Y  L++ +E++KT H+A+ VK LR+RMDKDV   L++AK IK +LEELD+SNA
Sbjct  49    MRGLEGMYKGLQSTNEETKTAHDARTVKSLRSRMDKDVEQVLRRAKAIKGKLEELDRSNA  108

Query  1157  ANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTG  978
              +RKV GCGPGSS+DRTRTSVV GL  KLK+ M+ F  LR ++ +EY+ETV RRYYTVTG
Sbjct  109   TSRKVPGCGPGSSTDRTRTSVVAGLGKKLKDLMDDFQGLRARMAAEYKETVARRYYTVTG  168

Query  977   ENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQV  798
             E P++  ++ LIS+G+SE+F+QKAIQEQGRG+VM+T+ EIQERH+AVK++ER+L +LHQV
Sbjct  169   EKPEDSTIEALISSGESESFLQKAIQEQGRGQVMDTISEIQERHDAVKDIERSLMDLHQV  228

Query  797   FLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             FLDMA LVE QG QL+DIES V  A+S VR G  +L +AR++QK++RKW C A
Sbjct  229   FLDMAALVEAQGHQLNDIESHVAHASSFVRRGTVELESAREYQKSSRKWMCIA  281



>ref|XP_010925349.1| PREDICTED: syntaxin-124 [Elaeis guineensis]
Length=312

 Score =   332 bits (852),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 203/245 (83%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKDDL+ +EK+Y  L+ A+E+SKTVHNA  +K++RARMD D+   L++AK +
Sbjct  45    KFFEDVENVKDDLRGLEKLYRRLQEANEESKTVHNANTMKDVRARMDADIEQVLRRAKAV  104

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD++N A+RK+ GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR +I +EY+
Sbjct  105   KGKLEALDRANIAHRKLPGCGPGSSADRTRTSVVSGLGKKLKDLMDDFQGLRTRIAAEYK  164

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV RRYYTVTGE  DE+ ++ LIS+G+SETF+QKAIQEQGRG++M+T+ EIQERH+AVK
Sbjct  165   ETVGRRYYTVTGEQADEQTIEALISSGESETFLQKAIQEQGRGQIMDTISEIQERHDAVK  224

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E++L +LHQVFLDMA LVE QG QL+DIES V  ANS VR G ++L+TAR++QK++RK
Sbjct  225   EIEKSLLDLHQVFLDMAALVEAQGHQLNDIESHVAHANSFVRRGTEELVTAREYQKSSRK  284

Query  653   WTCFA  639
             W C A
Sbjct  285   WYCMA  289



>ref|XP_006584927.1| PREDICTED: syntaxin-124-like [Glycine max]
Length=304

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 222/287 (77%), Gaps = 8/287 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF         S    ++H  ++ A       +  KFFEDVE VK++++ +EK
Sbjct  1     MNDLFSNSFK------KYSNLKQQAHLDDVEAGKETVNLD--KFFEDVENVKEEMRTVEK  52

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++  L+ A+E+SK VHNAK +KELRARMDKDV   LK+ K+IK +LE L++SNAANR + 
Sbjct  53    LHRKLQEANEESKVVHNAKTMKELRARMDKDVEQVLKRVKVIKGKLEALERSNAANRNIP  112

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR +++ EY+ETV+RRY+T+TGE PD+E
Sbjct  113   GCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRTRMQMEYKETVERRYFTITGEKPDKE  172

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LI +G+SE+F+Q+AIQEQG+G++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  173   TIENLIWSGESESFLQRAIQEQGKGQIMDTISEIQERHDAVKEIEKNLIELHQVFLDMAA  232

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE+QG+QL++IES V  A+S VR G DQL  AR++QK++RKWTC+A
Sbjct  233   LVESQGQQLNNIESHVAHASSFVRRGTDQLQDAREYQKSSRKWTCYA  279



>ref|XP_002466338.1| hypothetical protein SORBIDRAFT_01g005900 [Sorghum bicolor]
 gb|EER93336.1| hypothetical protein SORBIDRAFT_01g005900 [Sorghum bicolor]
Length=307

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/288 (58%), Positives = 207/288 (72%), Gaps = 5/288 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDIE  1323
             MN L S S+    + GG      ES ++EMSA           +FFEDVE++KD+L+D+E
Sbjct  1     MNSLFSSSW----KRGGGDDGDIESGSVEMSAPPGAAAGASLDRFFEDVESIKDELRDLE  56

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +I  SL   +E  K++H+A  V++LRARMD DVS A+K+AK++K RLE LD++NAANR V
Sbjct  57    RIQRSLHDGNEAGKSLHDASAVRDLRARMDADVSAAIKKAKVVKLRLESLDRANAANRSV  116

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSS+DRTRTSVV GLR KL++ M  F+ LR ++ SEYR+TV RRY+TVTG  PDE
Sbjct  117   PGCGPGSSTDRTRTSVVAGLRKKLRDSMESFSSLRSRVASEYRDTVARRYFTVTGTQPDE  176

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
               LD L  +G+ E F+Q+AI EQGRG+V+  V EIQERH AV E+ER+L EL QVF DMA
Sbjct  177   ATLDALAESGEGERFLQRAIAEQGRGQVLGVVAEIQERHGAVAELERSLLELQQVFNDMA  236

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             VLV  QGEQLDDIE  V RA S V  G +QL  ARKHQK+TRKWTC A
Sbjct  237   VLVAAQGEQLDDIEGNVGRARSFVDRGREQLQVARKHQKSTRKWTCIA  284



>ref|XP_004967209.1| PREDICTED: syntaxin-124-like [Setaria italica]
Length=309

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/287 (57%), Positives = 217/287 (76%), Gaps = 6/287 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S S    ++   +SPAP          A      NL KFFEDVEAVK+D++ +E 
Sbjct  1     MNDLFSSSSF--KKYADASPAPSGGDM----EAGGESVVNLDKFFEDVEAVKEDMRGLEG  54

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L++ +E++KT H+A+ VK LRARMDKDV   L++AK +K +LEELD+SNA +RKV 
Sbjct  55    MYKGLQSTNEETKTAHDARTVKSLRARMDKDVEQVLRRAKAVKSKLEELDRSNATSRKVP  114

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTR+SVV GL  KLK+ M+ F  LR ++ +EY+ETV RRY+TVTGE  ++ 
Sbjct  115   GCGPGSSTDRTRSSVVAGLGKKLKDLMDDFQGLRARMAAEYKETVARRYFTVTGEKAEDS  174

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LIS+G+SE+FMQKAIQEQGRG+VM+T+ EIQERH+AVK++ER+L +LHQVFLDMA 
Sbjct  175   TIEALISSGESESFMQKAIQEQGRGQVMDTISEIQERHDAVKDIERSLMDLHQVFLDMAA  234

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG QL+DIES V  A+S VR G  +L TAR++QK++RKW CFA
Sbjct  235   LVEAQGHQLNDIESHVAHASSFVRRGTVELETAREYQKSSRKWMCFA  281



>ref|XP_009782594.1| PREDICTED: syntaxin-124-like [Nicotiana sylvestris]
Length=314

 Score =   331 bits (849),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 223/287 (78%), Gaps = 17/287 (6%)
 Frame = -2

Query  1505  IEMNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDI  1326
             ++M+DL + +       GGS   P ++ +I+++           KFFEDVE VK+D+KD+
Sbjct  19    VQMDDLEAGA------GGGSGLDPSQNESIDLA-----------KFFEDVENVKEDMKDV  61

Query  1325  EKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRK  1146
             EK+Y  L+ ++E+SKTVH+AK VKE+R+RMD +V+  LK+ K+IK +LE L++SNAA+RK
Sbjct  62    EKLYKRLQESNEESKTVHSAKTVKEIRSRMDNEVTQVLKRVKIIKGKLEALERSNAAHRK  121

Query  1145  VYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPD  966
             + GCGPGSS+DRTRTSVV+GL  KLK  M+ F  LR ++ SEY+ETV RRY+TVTGE  D
Sbjct  122   IPGCGPGSSADRTRTSVVSGLGKKLKVLMDDFQALRARMNSEYKETVARRYFTVTGEKAD  181

Query  965   EEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDM  786
             +++++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQ+FLDM
Sbjct  182   DDLIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIELHQIFLDM  241

Query  785   AVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             A LVE QG+QL+DIES V  A+S VR G DQL  AR+ QK++RK TC
Sbjct  242   AALVEAQGQQLNDIESHVAHASSFVRRGTDQLQEARELQKSSRKCTC  288



>ref|XP_009412504.1| PREDICTED: syntaxin-121-like [Musa acuminata subsp. malaccensis]
Length=311

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 199/242 (82%), Gaps = 0/242 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FFEDVE +K+DL+++E+++ SL  A+E+ K++H A  V+ LRARMD DV+LALK+AK IK
Sbjct  36    FFEDVETLKNDLREVERLHRSLHEANEEGKSLHEASAVRALRARMDADVALALKKAKFIK  95

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              RLE LD++NAANR V GCGPG+++DRTRTSVV GLR KL++ M+ F +LR K+ S+YRE
Sbjct  96    LRLESLDRANAANRAVPGCGPGTTTDRTRTSVVAGLRKKLRDSMDVFAELRSKVASDYRE  155

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             TV+RRYYTVTG+ PDE  +D+L++TG+ E F+Q+AI+EQGRG V++ V EI+E H AV E
Sbjct  156   TVERRYYTVTGDVPDEATVDELVATGEGERFLQRAIEEQGRGRVLDVVAEIREWHGAVAE  215

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +ER+L EL QVF+DMAVLVE QG+QLDDIES V RA S VRHG +QL  AR+HQK+TRKW
Sbjct  216   LERSLLELQQVFMDMAVLVEAQGQQLDDIESNVGRAQSFVRHGTEQLGAARQHQKSTRKW  275

Query  650   TC  645
             TC
Sbjct  276   TC  277



>ref|XP_003545852.1| PREDICTED: syntaxin-124-like [Glycine max]
Length=304

 Score =   330 bits (846),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 223/287 (78%), Gaps = 8/287 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF         S    ++H  ++ A       +  KFF++VE VK+D++ +EK
Sbjct  1     MNDLFSSSFK------KYSDLKEQAHIDDVEAGKESVNLD--KFFDEVENVKEDMRLVEK  52

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+SK VHNAK +K+LRARMD+DV   LK+ KLIK +LE L++SNAANR + 
Sbjct  53    LYRKLQESNEESKIVHNAKTMKDLRARMDQDVQQVLKRVKLIKGKLESLERSNAANRNIP  112

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++++EY+ETV+RRY+T+TGE  DE+
Sbjct  113   GCGPGSSADRTRTSVVSGLGKKLKDLMDDFQGLRARMQNEYKETVERRYFTITGEKADED  172

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LIS+G+SE+F+Q+AIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFLDMA 
Sbjct  173   TIENLISSGESESFLQRAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIELHQVFLDMAA  232

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE+QG+QL++IES V  A+S VR G +QL  AR++QK++RKWTC+A
Sbjct  233   LVESQGQQLNNIESHVAHASSFVRRGTEQLQDAREYQKSSRKWTCYA  279



>ref|XP_011043281.1| PREDICTED: syntaxin-124 [Populus euphratica]
Length=302

 Score =   330 bits (846),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 202/245 (82%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFEDVE +K D+K +E++Y SL+ A+E+SKTVHNAK +K LR+RMD DV   LK+ K+I
Sbjct  35    RFFEDVENIKGDMKTVERLYRSLQEANEESKTVHNAKTMKNLRSRMDVDVEQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SN A+R V GCGPGSS+DRTRTSVV+GL  KLK+ M+ F DLR ++ +EY+
Sbjct  95    KGKLEALDRSNVAHRNVPGCGPGSSTDRTRTSVVSGLGKKLKDLMDNFQDLRARMAAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE   +E ++ LIS+G+SE+FMQKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGERASDETIENLISSGESESFMQKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG QL+DIES V  A+S VR G +QL  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGHQLNDIESHVAHASSFVRRGTEQLQEAREYQKSSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>ref|XP_002521435.1| syntaxin, putative [Ricinus communis]
 gb|EEF40925.1| syntaxin, putative [Ricinus communis]
Length=302

 Score =   330 bits (845),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 203/245 (83%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VK+D+K +EK+Y SL+ A+E+SKTVHNAK +K +RARMD DV   LK+AK+I
Sbjct  35    KFFEDVENVKEDMKLVEKLYKSLQEANEESKTVHNAKTMKNIRARMDSDVEQVLKRAKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA R V GCGPGSS+DRTRTSVV+GL  KLK+ M++F +LR ++ +EY+
Sbjct  95    KGKLEALERSNAAARNVPGCGPGSSADRTRTSVVSGLGKKLKDLMDEFQNLRAQMTAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE   EE ++ LIS+G+SE+F+Q AIQ+QGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEKASEETIENLISSGESESFLQIAIQDQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG QL+DIES V  A+S VR G D L  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGHQLNDIESHVAHASSFVRRGTDNLQDAREYQKSSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>ref|XP_006852126.1| hypothetical protein AMTR_s00049p00050990 [Amborella trichopoda]
 gb|ERN13593.1| hypothetical protein AMTR_s00049p00050990 [Amborella trichopoda]
Length=317

 Score =   330 bits (846),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 214/287 (75%), Gaps = 2/287 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF+   +    +  P     +      +G   NL +FF DVEA+KD+L+ IE 
Sbjct  1     MNDLFSSSFNRQAQPDLEAGGP--GTEMRRGPHRDGATVNLDQFFSDVEALKDELRAIES  58

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++  LK AHE+SKT+H    V+ LR RMD DVS A+++AKL+K RLE LD++NAA+R   
Sbjct  59    LHSHLKEAHEESKTLHERASVRALRTRMDSDVSQAVRRAKLVKVRLEALDRANAAHRVQP  118

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV+GLR KL++ M +F  LR  I+ EYRET++RRY+TVTGE PDE 
Sbjct  119   GCGPGSSTDRTRTSVVSGLRKKLRDLMEEFQSLRNTIQGEYRETIERRYFTVTGEKPDEA  178

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
             +LD+L+STG+ E FM++A+QE GRG++++ + EIQER +AVKE+E++L ELHQVF+DM+V
Sbjct  179   MLDRLVSTGEGENFMRRALQEGGRGQILDVISEIQERRDAVKELEKSLVELHQVFMDMSV  238

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LV  QGEQLD+IES V RANS VR G  QL TARKHQK+TRKWTC  
Sbjct  239   LVNAQGEQLDNIESHVERANSYVRGGTQQLETARKHQKSTRKWTCIG  285



>ref|XP_008649133.1| PREDICTED: syntaxin-124-like [Zea mays]
 gb|AFW76454.1| hypothetical protein ZEAMMB73_632845 [Zea mays]
Length=309

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 201/245 (82%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVEAVKDD++ +E +Y  L++ +E++KT H+A+ VK LR+RMDKDV   L++AK I
Sbjct  37    KFFEDVEAVKDDMRGLEGMYKGLQSTNEETKTAHDARTVKSLRSRMDKDVEQVLRRAKAI  96

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE+LD+SNA +RKV GCGPGSS+DRTRTSVV GL  KLK+ M+ F  LR ++ +EY+
Sbjct  97    KTKLEDLDRSNATSRKVPGCGPGSSTDRTRTSVVAGLGKKLKDLMDDFQGLRARMAAEYK  156

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV RRYYTVTGE P++  ++ LIS+G+SE+F+QKAIQEQGRG+VM+T+ EIQERH+AVK
Sbjct  157   ETVARRYYTVTGEKPEDSTIEALISSGESESFLQKAIQEQGRGQVMDTISEIQERHDAVK  216

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++ER+L +LHQVFLDMA LVE QG QL+DIES V  A+S VR G  +L +AR++QK++RK
Sbjct  217   DIERSLMDLHQVFLDMAALVEAQGHQLNDIESHVAHASSFVRRGTVELESAREYQKSSRK  276

Query  653   WTCFA  639
             W C A
Sbjct  277   WMCIA  281



>ref|XP_010665520.1| PREDICTED: syntaxin-125-like [Beta vulgaris subsp. vulgaris]
Length=305

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/290 (56%), Positives = 216/290 (74%), Gaps = 14/290 (5%)
 Frame = -2

Query  1499  MNDLLSRSF---SLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKD  1329
             MNDL S SF   S   + G  +     +  + +            KFFEDVE VK+D+K+
Sbjct  1     MNDLFSNSFRKYSEFEQQGFKNDVESGTEGMNLD-----------KFFEDVEKVKEDMKE  49

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             +EKIY  L+  +E+SK VHNAK +KELRARMD DVSL LK+ K++K +LE LD+SN   R
Sbjct  50    VEKIYKRLQDQNEESKVVHNAKTMKELRARMDSDVSLVLKKVKIVKAKLEALDKSNVQAR  109

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              V GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K++SEY+ET++RRY+T+TGE  
Sbjct  110   NVPGCGPGSSADRTRTSVVSGLGKKLKDMMDNFQALRAKMQSEYKETMERRYFTITGEKA  169

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             DE +++ LI++G+SE F+QKAIQ+QGRG++++T+ E+QERH+AVKE+E+NL ELHQVFLD
Sbjct  170   DETMIENLIASGESENFLQKAIQDQGRGQILDTISELQERHDAVKEIEKNLIELHQVFLD  229

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             MA LVE QG+QL++IES V  A+S VR G ++L+ AR  QKN+RKW C+A
Sbjct  230   MAALVEAQGQQLNNIESHVAHASSFVRRGTEELVEARVQQKNSRKWYCYA  279



>ref|XP_006351945.1| PREDICTED: syntaxin-124-like [Solanum tuberosum]
Length=310

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/296 (56%), Positives = 218/296 (74%), Gaps = 20/296 (7%)
 Frame = -2

Query  1499  MNDLLSRSFS---------LPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAV  1347
             MNDL S SF          +  +  G     P + +I+++           KFFEDVE V
Sbjct  1     MNDLFSNSFKKYQDLKKQVVVDDLEGGQVGQPGTESIDLA-----------KFFEDVENV  49

Query  1346  KDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQ  1167
             K+D+KD+EK +  L+ ++E+SK VHNAK VKE+R+RMD DVS  LK+ K+IK +LE L++
Sbjct  50    KEDMKDVEKFHKKLQESNEESKLVHNAKTVKEIRSRMDSDVSQVLKRVKMIKGKLEALER  109

Query  1166  SNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYT  987
             SNAA+RK+ GCGPGSS+DRTRTSVV+GL  KLK  M+ F  LR ++  EY+ETV RRY+T
Sbjct  110   SNAAHRKISGCGPGSSADRTRTSVVSGLGKKLKVLMDDFQALRTRMNDEYKETVARRYFT  169

Query  986   VTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKEL  807
             VTGE   +E+++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL EL
Sbjct  170   VTGEKAGDELIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIEL  229

Query  806   HQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             HQ+FLDMA LVE QG+QL+DIES V  A+S VR G DQL  AR+ QK++RK  CFA
Sbjct  230   HQIFLDMAALVEAQGQQLNDIESHVAHASSFVRRGTDQLQEAREIQKSSRKCACFA  285



>ref|XP_007148239.1| hypothetical protein PHAVU_006G191600g [Phaseolus vulgaris]
 gb|ESW20233.1| hypothetical protein PHAVU_006G191600g [Phaseolus vulgaris]
Length=304

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 219/287 (76%), Gaps = 8/287 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF             P+ + +E             KFF++VE VK+D++ +EK
Sbjct  1     MNDLFSSSF----RKFSDLNEQPQMNDVEAGKENVNLD----KFFDEVENVKEDMRLVEK  52

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+SK VHNAK +K+LRA+MD+DV   LK+ K+IK +LE L++SNAANR + 
Sbjct  53    LYRKLQESNEESKIVHNAKTMKDLRAKMDQDVQQVLKRVKIIKGKLESLERSNAANRNLP  112

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV GL  KLK+ M+ F  LR ++++EY+ETV+RRY+T+TGE  DE+
Sbjct  113   GCGPGSSTDRTRTSVVGGLGKKLKDMMDDFQGLRARMQNEYKETVERRYFTITGEKADED  172

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LIS+G+SE+F+Q+AIQEQGRG++M+T+ EIQERH++VKE+E+NL ELHQVFLDMA 
Sbjct  173   TIENLISSGESESFLQRAIQEQGRGQIMDTISEIQERHDSVKEIEKNLIELHQVFLDMAA  232

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE+QG+QL+ IES V RA+S VR G +QL  AR+HQK++RKWTC+A
Sbjct  233   LVESQGQQLNTIESHVARASSFVRKGTEQLQEAREHQKSSRKWTCYA  279



>ref|XP_008442020.1| PREDICTED: syntaxin-124 [Cucumis melo]
Length=303

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 202/245 (82%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFEDVE VKDD+K +E +Y  L+ A+E+ K VHNAK +KELR RM+ DV+  LK+ KLI
Sbjct  35    RFFEDVENVKDDMKQVENLYKKLQQANEECKVVHNAKTMKELRGRMEADVAQVLKRVKLI  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA+R + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KGKLEALERSNAAHRGLPGCGPGSSADRTRTSVVSGLGKKLKDVMDDFQGLRARMNAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+TVTG+  +EE ++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVK
Sbjct  155   ETVERRYFTVTGQKANEETIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQ+FLDMA LVE QG QL+DIES V  ANS VR G +QL  AR++QK++RK
Sbjct  215   EIEKNLIELHQIFLDMAALVEAQGHQLNDIESHVAHANSFVRRGTEQLQEAREYQKSSRK  274

Query  653   WTCFA  639
             WTC+A
Sbjct  275   WTCYA  279



>ref|XP_004146633.1| PREDICTED: syntaxin-124-like [Cucumis sativus]
 ref|XP_004158058.1| PREDICTED: syntaxin-124-like [Cucumis sativus]
 gb|KGN64631.1| hypothetical protein Csa_1G071930 [Cucumis sativus]
Length=303

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 202/245 (82%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFEDVE VKDD+K +E +Y  L+ A+E+ K VHNAK +KELR RM+ DV+  LK+ KLI
Sbjct  35    RFFEDVENVKDDMKQVENLYKKLQQANEECKVVHNAKTMKELRGRMETDVAQVLKRVKLI  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA+R + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KGKLEALERSNAAHRGLPGCGPGSSADRTRTSVVSGLGKKLKDVMDDFQGLRARMNAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+TVTG+  +EE ++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVK
Sbjct  155   ETVERRYFTVTGQKANEETIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQ+FLDMA LVE QG QL+DIES V  ANS VR G +QL  AR++QK++RK
Sbjct  215   EIEKNLIELHQIFLDMAALVEAQGHQLNDIESHVAHANSFVRRGTEQLQEAREYQKSSRK  274

Query  653   WTCFA  639
             WTC+A
Sbjct  275   WTCYA  279



>ref|XP_011001123.1| PREDICTED: syntaxin-124-like [Populus euphratica]
Length=302

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 202/245 (82%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFEDVE VK+D+K +E++Y SL+ A+E+ K VHNAK +K LR+RMD DV   LK+ K+I
Sbjct  35    RFFEDVENVKEDMKTVERLYKSLQEANEECKIVHNAKTMKNLRSRMDIDVEQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+SNAA+R + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F DLR ++ +EY+
Sbjct  95    KGKLEALDRSNAAHRNIPGCGPGSSADRTRTSVVSGLGKKLKDLMDNFQDLRTRMAAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE   EE ++ LIS+G+SE+FM+KAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGERASEETIENLISSGESESFMKKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG Q++DIES V  A+S VR G +QL  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGHQINDIESHVAHASSFVRRGTEQLSEAREYQKSSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>ref|XP_010557974.1| PREDICTED: syntaxin-121-like [Tarenaya hassleriana]
Length=331

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/287 (58%), Positives = 214/287 (75%), Gaps = 14/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFS-LPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIE  1323
             MNDL S SFS LP  +G  SP   +   + +            KFFEDVE+VK +LK+++
Sbjct  1     MNDLFSGSFSRLP--SGEPSPHGGDGGGVNLD-----------KFFEDVESVKGELKELD  47

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++  +L+  HEQSK + +A  VK+LR++MD DV+ AL++AK IK +LE LD++NAANR  
Sbjct  48    RLSDTLQLCHEQSKMIRDANAVKDLRSKMDGDVAAALRKAKTIKLKLESLDRANAANRSK  107

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSS+DRTR SVVNGLR  LK+ M  FN LR+K+ SEY E V+RRY+TVTGENPDE
Sbjct  108   PGCGPGSSADRTRISVVNGLRKTLKDSMESFNRLREKVWSEYGEIVERRYFTVTGENPDE  167

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             E LD+LISTG+SE  +QKAIQEQG G +++T+ EIQERHEAVKE+E+NL+EL+QVFL M 
Sbjct  168   ETLDRLISTGESERLLQKAIQEQGSGRILDTINEIQERHEAVKEIEKNLEELNQVFLGMV  227

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCF  642
             V+VE QG  LD+IES V  A+S VR G +QL TA+ +QKNTRKWT F
Sbjct  228   VMVEHQGSGLDNIESHVAHASSFVRAGTEQLDTAKMYQKNTRKWTFF  274



>ref|XP_011085365.1| PREDICTED: syntaxin-125-like [Sesamum indicum]
Length=308

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 213/294 (72%), Gaps = 21/294 (7%)
 Frame = -2

Query  1499  MNDLLSRSFSL---------PRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAV  1347
             MNDL S SF           P E+   +  PP +  + +            KFFEDVE V
Sbjct  1     MNDLFSHSFKKYQDVKVVQGPVEDL-EAGVPPRTEGVNLD-----------KFFEDVEGV  48

Query  1346  KDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQ  1167
             K D+ D+EK+Y  L+  +E+SKT HNAK +KELRARMD DV+  LK+ K+IK +LE L++
Sbjct  49    KKDMADVEKLYKQLQERNEESKTAHNAKTMKELRARMDSDVTQVLKRVKVIKGKLEALEK  108

Query  1166  SNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYT  987
             SNAA RKV GCGPGSS+DRTRTSVV+GL  KLK  M+ F  LR ++ +EY+ETV RRY+T
Sbjct  109   SNAAQRKVPGCGPGSSADRTRTSVVSGLGKKLKNLMDDFQGLRARMNAEYKETVGRRYFT  168

Query  986   VTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKEL  807
             VTGE  D+++++ +IS+G+SETF+QKAIQEQGRG++M+ + EIQERH+AVKE+E+NL EL
Sbjct  169   VTGEKADDDMIESMISSGESETFLQKAIQEQGRGQIMDAISEIQERHDAVKEIEKNLLEL  228

Query  806   HQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             HQ+FLDMA LVE QG+QL+DIES V  A+S VR G +QL  AR+ QK +RKW C
Sbjct  229   HQIFLDMAALVEAQGQQLNDIESHVAHASSFVRRGTEQLQEARELQKGSRKWCC  282



>emb|CDP14712.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/297 (56%), Positives = 220/297 (74%), Gaps = 25/297 (8%)
 Frame = -2

Query  1499  MNDLLSRSF----SLPR------ENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEA  1350
             MNDL S SF     + R      E GG  P+  +   +              KFF+DVE 
Sbjct  1     MNDLFSHSFKKYQDIKRQVIDDLEAGG--PSGNDDSNLN-------------KFFDDVEN  45

Query  1349  VKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELD  1170
             VK D++D+EK+Y  L+ ++E+SKTVHNAK +KELR+RMD DV   LK+ K+IK +LE LD
Sbjct  46    VKKDMEDVEKLYKRLQESNEESKTVHNAKTMKELRSRMDSDVCQVLKRVKIIKGKLEALD  105

Query  1169  QSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYY  990
             +SN ANRKV GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ +EY+ETV RRY+
Sbjct  106   RSNQANRKVPGCGPGSSTDRTRTSVVSGLGKKLKDLMDDFQGLRAKMNAEYKETVGRRYF  165

Query  989   TVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKE  810
             TVTGE  ++++++ LIS+G+SETF+QKAIQEQGRG++++T+ EIQERH++VKE+E+NL E
Sbjct  166   TVTGEKANDDLIENLISSGESETFLQKAIQEQGRGQILDTISEIQERHDSVKEIEKNLIE  225

Query  809   LHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LHQ+FLDMA LVE QG+QL+DIES V  A+S VR G +QL  AR++QKN+RK TC A
Sbjct  226   LHQIFLDMAALVEAQGQQLNDIESHVAHASSFVRRGTEQLQDAREYQKNSRKCTCIA  282



>gb|KDO75760.1| hypothetical protein CISIN_1g036284mg, partial [Citrus sinensis]
Length=282

 Score =   327 bits (839),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/244 (63%), Positives = 200/244 (82%), Gaps = 0/244 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FFEDVE VK ++K +EK+Y  L+ A+E+SK VHNA+ +KELRARMD DV   LK+ K+IK
Sbjct  36    FFEDVENVKAEMKTVEKLYKRLQEANEESKIVHNARTMKELRARMDADVQQVLKRVKIIK  95

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              +LE L++SNAA+R + GCGPGSSSDRTRTSVV+GL  KLK+ M+ F + R K++ EY+E
Sbjct  96    GKLEALERSNAASRNIPGCGPGSSSDRTRTSVVSGLGKKLKDLMDDFQNFRNKMQYEYKE  155

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             TV+RRY+TVTG+  DEE ++ LI++G+SE+F+QKAIQEQGRG++++T+ EIQERH+A+KE
Sbjct  156   TVERRYFTVTGQKADEETIENLIASGESESFLQKAIQEQGRGQILDTISEIQERHDAIKE  215

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +E+NL ELHQVFLDMA LVE QG QL+DIES V  ANS VR G +QL  AR+ QK +RKW
Sbjct  216   IEKNLLELHQVFLDMAALVEAQGHQLNDIESHVAHANSFVRRGTEQLQEARELQKGSRKW  275

Query  650   TCFA  639
             TC+A
Sbjct  276   TCYA  279



>ref|XP_004251500.1| PREDICTED: syntaxin-124 [Solanum lycopersicum]
Length=310

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/296 (56%), Positives = 219/296 (74%), Gaps = 20/296 (7%)
 Frame = -2

Query  1499  MNDLLSRSF----SLPRENG-----GSSPAPPESHTIEMSaaanggganlAKFFEDVEAV  1347
             MNDL S SF     L ++       G     P + +I+++           KFFEDVE V
Sbjct  1     MNDLFSNSFKKYQDLKKQTEVDDLEGGQDGQPGTESIDLA-----------KFFEDVENV  49

Query  1346  KDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQ  1167
             K+D+KD+EK +  L+ ++E+SK VHNAK VKE+R+RMD DVS  LK+ K+IK +LE L++
Sbjct  50    KEDMKDVEKFHKKLQESNEESKLVHNAKTVKEIRSRMDSDVSQVLKRVKMIKGKLEALER  109

Query  1166  SNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYT  987
             SNAA+RK+ GCGPGSS+DRTRTSVV+GL  KLK  M+ F  LR ++  EY+ETV RRY+T
Sbjct  110   SNAAHRKISGCGPGSSADRTRTSVVSGLGKKLKVLMDDFQGLRTRMNDEYKETVARRYFT  169

Query  986   VTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKEL  807
             VTGE  D+ +++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL EL
Sbjct  170   VTGEKADDGLIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIEL  229

Query  806   HQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             HQ+FLDMA LVE QG+QL+DIES V  A+S VR G +QL  AR+ QK++RK  CFA
Sbjct  230   HQIFLDMAALVEAQGQQLNDIESHVAHASSFVRRGTEQLQEAREIQKSSRKCACFA  285



>gb|KDP41779.1| hypothetical protein JCGZ_26797 [Jatropha curcas]
Length=279

 Score =   327 bits (839),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 200/245 (82%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDV++V D+LK+++K+  SL++A+EQSKT+H A  VK+L  RM+ DV+ ALK+AKLI
Sbjct  15    KFFEDVDSVTDELKELQKLNDSLQSANEQSKTLHTANAVKDLLRRMEGDVAEALKKAKLI  74

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LEELDQSNAANR+  GCGPGSSSDRTRTSVV GLR KLK+ M  FN LR+KI +EYR
Sbjct  75    KVQLEELDQSNAANRRFPGCGPGSSSDRTRTSVVIGLRKKLKDSMESFNSLREKISTEYR  134

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             +TV RRYY VTGENPDE  LD+LISTG+SE F++KAI+EQG+G +++T+ EIQERH+AV+
Sbjct  135   DTVHRRYYMVTGENPDERTLDRLISTGESENFLEKAIEEQGKGRILDTINEIQERHDAVQ  194

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+ L ELH+VFLDMAVL E QGE+LDDIES + RANS +R G  +L TA  +QK T K
Sbjct  195   EMEKYLNELHKVFLDMAVLAEGQGEELDDIESNMQRANSSIRGGTQELHTATVYQKKTWK  254

Query  653   WTCFA  639
             W  + 
Sbjct  255   WVSYG  259



>ref|XP_009598377.1| PREDICTED: syntaxin-124-like [Nicotiana tomentosiformis]
Length=311

 Score =   328 bits (841),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/298 (57%), Positives = 222/298 (74%), Gaps = 24/298 (8%)
 Frame = -2

Query  1499  MNDLLSRSF----SLPR-------ENGGSSPAPPESHTIEMSaaanggganlAKFFEDVE  1353
             MNDL S SF     L +       E G  S +  ES  I+++           KFFEDVE
Sbjct  1     MNDLFSNSFKKYQDLKKQVQVDDLEGGQVSQSGNES--IDLA-----------KFFEDVE  47

Query  1352  AVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEEL  1173
              VK+D+KD+EK+Y  L+ ++E+SK VHNAK VKE+R+RMD DVS  LK+ K+IK +LE L
Sbjct  48    NVKEDMKDVEKLYKKLQESNEESKLVHNAKTVKEIRSRMDSDVSQVLKRVKMIKGKLEAL  107

Query  1172  DQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRY  993
             ++SNAA+RK+ GCGPGSS+DRTRTSVV+GL  KLK  M+ F  LR ++  EY+ETV RRY
Sbjct  108   ERSNAAHRKIPGCGPGSSADRTRTSVVSGLGKKLKVLMDDFQALRARMNDEYKETVARRY  167

Query  992   YTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLK  813
             YTVTGE  ++++++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL 
Sbjct  168   YTVTGEKANDDLIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLI  227

Query  812   ELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             ELHQ+FLDMA LVE QG+QL+DIES V  A+S VR G +QL  AR+ QK++RK TC A
Sbjct  228   ELHQIFLDMAALVEAQGQQLNDIESHVAHASSFVRRGTEQLTEARELQKSSRKCTCIA  285



>ref|XP_009381245.1| PREDICTED: syntaxin-124-like [Musa acuminata subsp. malaccensis]
Length=310

 Score =   327 bits (839),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 166/287 (58%), Positives = 212/287 (74%), Gaps = 1/287 (0%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS + S  +          +     MS      G NL +FFE+VE+VK DL+ +E 
Sbjct  1     MNDLLSTT-SFKKYTNLKQQVQMDQMEAGMSEMGAVAGVNLEQFFEEVESVKKDLRGLEG  59

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ A+E+SKTVHNAK +KE+R RMD D+ L L+ AK +K +LE LD+SNA +R V 
Sbjct  60    LYRRLQDANEESKTVHNAKAMKEVRGRMDSDIGLVLRSAKAVKAKLEALDRSNAQHRNVP  119

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV+GL NKLK+ M+ F  LR +I  EY+ETV RRYYTVTG + DEE
Sbjct  120   GCGPGSSADRTRTSVVSGLGNKLKDLMDSFQGLRTRIAEEYKETVGRRYYTVTGTHADEE  179

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LIS+G SETF+QKAIQEQGRG+VM+T+ EIQERH+AVKE+E++L +LHQVFLDMA 
Sbjct  180   TIETLISSGASETFVQKAIQEQGRGDVMDTISEIQERHDAVKEIEKSLLDLHQVFLDMAA  239

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG QL+DIES V  A+S VR G  +L TAR++QK++RKW C  
Sbjct  240   LVEAQGHQLNDIESHVAHASSFVRRGTVELETAREYQKSSRKWVCIG  286



>ref|XP_010418104.1| PREDICTED: syntaxin-124-like [Camelina sativa]
Length=303

 Score =   327 bits (838),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 202/245 (82%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKDD+K IE +Y  L+ ++E+ KTVHNA +VKELRA+MD DV+  LK+ K+I
Sbjct  35    KFFEDVENVKDDMKGIETLYKRLQDSNEECKTVHNANKVKELRAKMDGDVAQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++ NA +R V GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KQKLEALEKPNANSRNVPGCGPGSSTDRTRTSVVSGLGKKLKDLMDSFQGLRARMNAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+T E  DE+ ++ LIS+G+SE F+QKAIQEQGRG++++T+ EIQERH+ VK
Sbjct  155   ETVERRYFTITREKADEQTIENLISSGESENFLQKAIQEQGRGQILDTISEIQERHDEVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG+QL+DIES V++A+S VR G DQL  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGQQLNDIESHVSKASSFVRRGTDQLQDAREYQKSSRK  274

Query  653   WTCFA  639
             WTC+A
Sbjct  275   WTCYA  279



>ref|XP_009801269.1| PREDICTED: syntaxin-124-like [Nicotiana sylvestris]
Length=311

 Score =   327 bits (838),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/296 (55%), Positives = 220/296 (74%), Gaps = 20/296 (7%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENG---------GSSPAPPESHTIEMSaaanggganlAKFFEDVEAV  1347
             MNDL S SF   ++           G      E+ +I+++           KFFEDVE V
Sbjct  1     MNDLFSNSFKKYQDLKKQVQVDDLEGGQVGQSENESIDLA-----------KFFEDVENV  49

Query  1346  KDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQ  1167
             K+D+K++EK+Y  L+ ++E+SK VHNAK VKE+R+RMD DVS  LK+ K+IK +LE L++
Sbjct  50    KEDMKNVEKLYKKLQESNEESKLVHNAKTVKEIRSRMDSDVSQVLKRVKMIKGKLEALER  109

Query  1166  SNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYT  987
             SNAA+RK+ GCGPGSS+DRTRTSVV+GL  KLK  M+ F  LR ++  EY+ETV RRY+T
Sbjct  110   SNAAHRKIPGCGPGSSADRTRTSVVSGLGKKLKVLMDDFQALRARMNDEYKETVARRYFT  169

Query  986   VTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKEL  807
             VTGE  ++E+++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL EL
Sbjct  170   VTGEKANDELIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLIEL  229

Query  806   HQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             HQ+FLDMA LVE QG+QL+DIES V  A+S VR G +QL  AR+ QK++RK TC A
Sbjct  230   HQIFLDMAALVEAQGQQLNDIESHVAHASSFVRRGTEQLTEARELQKSSRKCTCIA  285



>ref|XP_008780342.1| PREDICTED: syntaxin-124 [Phoenix dactylifera]
Length=312

 Score =   327 bits (838),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/244 (63%), Positives = 200/244 (82%), Gaps = 0/244 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VKDDL+ + K+Y  L+ A+E+SKTVHNAK +K+LRARMD D+   L++AK +
Sbjct  45    KFFEDVENVKDDLRGLGKLYRRLQEANEESKTVHNAKTMKDLRARMDADIDQVLRRAKAV  104

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD++NAA+RK+ GCGPG+S+DRTRTSVV+GL  KLK+ M+ F  LR +I +EY+
Sbjct  105   KGKLEALDRANAAHRKLPGCGPGTSADRTRTSVVSGLGKKLKDLMDDFQGLRTRIAAEYK  164

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV RRYYTVTGE+ DE+ ++ LIS+G+SETF+QKAIQEQGRG++M+ + EIQERH+AVK
Sbjct  165   ETVGRRYYTVTGEHADEQTIETLISSGESETFLQKAIQEQGRGQIMDAISEIQERHDAVK  224

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E++L +LHQVFLDMA LVE QG QL+DIES V  ANS VR G  +L TAR +QK++RK
Sbjct  225   EIEKSLLDLHQVFLDMAALVEAQGHQLNDIESHVAHANSFVRRGTVELETARDYQKSSRK  284

Query  653   WTCF  642
             W C 
Sbjct  285   WYCM  288



>ref|XP_006449228.1| hypothetical protein CICLE_v10016060mg [Citrus clementina]
 gb|ESR62468.1| hypothetical protein CICLE_v10016060mg [Citrus clementina]
Length=305

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/244 (63%), Positives = 200/244 (82%), Gaps = 0/244 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VK ++K +EK+Y  L+ A+E+SK VHNA+ +KELRARMD DV   LK+ K+I
Sbjct  35    KFFEDVENVKAEMKTVEKLYKRLQEANEESKIVHNARTMKELRARMDADVQQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA+R + GCGPGSSSDRTRTSVV+GL  KLK+ M+ F + R K++ EY+
Sbjct  95    KGKLEALERSNAASRNIPGCGPGSSSDRTRTSVVSGLGKKLKDLMDDFQNFRNKMQYEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+TVTG+  DEE ++ LI++G+SE+F+QKAIQEQGRG++++T+ EIQERH+A+K
Sbjct  155   ETVERRYFTVTGQKADEETIENLIASGESESFLQKAIQEQGRGQILDTISEIQERHDAIK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG QL+DIES V  ANS VR G +QL  AR+ QK +RK
Sbjct  215   EIEKNLLELHQVFLDMAALVEAQGHQLNDIESHVAHANSFVRRGTEQLQEARELQKGSRK  274

Query  653   WTCF  642
             WTC+
Sbjct  275   WTCY  278



>gb|KDO43783.1| hypothetical protein CISIN_1g045802mg [Citrus sinensis]
Length=301

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/291 (56%), Positives = 215/291 (74%), Gaps = 19/291 (7%)
 Frame = -2

Query  1499  MNDLLSRSF----SLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL+S SF    ++  E GG      E+               L KFF+DVE VK+D+K
Sbjct  1     MNDLISNSFKRYSNVDLEAGGVIRKGTEN---------------LDKFFDDVENVKEDMK  45

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
              +EK+Y  L+ ++E++K  HNAK +K++RARMD DV   LK+ K+IK +LE L++SNAAN
Sbjct  46    VVEKLYKRLQESNEETKVAHNAKTMKQIRARMDSDVEQVLKRVKVIKGKLEALEKSNAAN  105

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             RKV GCGPGSS DRTRTSVV GL  KLK+ M+ F  LR K+ +EY+ET++RRY+TVTG+ 
Sbjct  106   RKVPGCGPGSSVDRTRTSVVAGLGKKLKDTMDDFQHLRAKMTAEYKETIERRYFTVTGQQ  165

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
              DE++++ LIS+G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFL
Sbjct  166   ADEQMIENLISSGESENFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQVFL  225

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DM  LVE QG QL+DIES V  ANS VR G +QL  A++ QK++RKWTC A
Sbjct  226   DMFALVEAQGHQLNDIESHVAHANSFVRRGTEQLEFAKESQKDSRKWTCIA  276



>ref|XP_008659741.1| PREDICTED: syntaxin-124-like [Zea mays]
 gb|AFW87161.1| hypothetical protein ZEAMMB73_770023 [Zea mays]
Length=309

 Score =   326 bits (835),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 218/287 (76%), Gaps = 5/287 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S S    ++   SSPA   +      A     G +L KFFEDVEAVK+D++ +E 
Sbjct  1     MNDLFSSSSF--KKYADSSPA---TSAGGTEAGGGESGVDLDKFFEDVEAVKEDMRGLEG  55

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L++ +E++KT H+A+ VK LR+RMDKDV   L++AK IK +LE+LD+SNA +R+V 
Sbjct  56    MYKGLQSTNEETKTAHDARTVKSLRSRMDKDVEQVLRRAKAIKGKLEDLDRSNATSRQVP  115

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV GL  KLK+ M+ F  LR ++ +EY+ETV RRYYTVTGE P++ 
Sbjct  116   GCGPGSSTDRTRTSVVAGLGKKLKDLMDDFQGLRARMAAEYKETVARRYYTVTGEKPEDS  175

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LIS+G+SE+F+QKAIQEQGRG+VM+T+ EIQERH+AVK++ER+L +LHQVFLDMA 
Sbjct  176   TIEALISSGESESFLQKAIQEQGRGQVMDTISEIQERHDAVKDIERSLMDLHQVFLDMAA  235

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG QL+DIES V  A+S VR G  +L +AR++QK++RKW C A
Sbjct  236   LVEAQGHQLNDIESHVAHASSFVRRGTVELESAREYQKSSRKWMCIA  282



>ref|XP_010092626.1| hypothetical protein L484_006388 [Morus notabilis]
 gb|EXB51815.1| hypothetical protein L484_006388 [Morus notabilis]
Length=305

 Score =   325 bits (834),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 199/245 (81%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VK+D++ +EK+Y  L+ A+E+SK VHNAK +KELR+RMD DV   LK+ KLI
Sbjct  35    KFFEDVENVKEDMRVVEKLYRKLQEANEESKIVHNAKTMKELRSRMDSDVEQVLKRVKLI  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA+R + G GPGSS+DRTRTSVV+GL  KLK  M+ F  LR +++ EY+
Sbjct  95    KAKLEALERSNAAHRSLPGSGPGSSADRTRTSVVSGLGKKLKNLMDDFQGLRGRMQFEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE   EE ++ LIS+G+SE+F+QKAIQEQGRG++M+T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGERASEETIENLISSGESESFLQKAIQEQGRGQIMDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQ+FLDMA LVE QG QL+DIES V  A+S VR G D L  AR+HQK++RK
Sbjct  215   EIEKNLIELHQIFLDMAALVEAQGHQLNDIESHVAHASSFVRRGTDNLQEAREHQKSSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>ref|XP_006467886.1| PREDICTED: syntaxin-124-like [Citrus sinensis]
Length=305

 Score =   325 bits (832),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/243 (63%), Positives = 199/243 (82%), Gaps = 0/243 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FFEDVE VK ++K +EK+Y  L+ A+E+SK VHNA+ +KELRARMD DV   LK+ K+IK
Sbjct  36    FFEDVENVKAEMKTVEKLYKRLQEANEESKIVHNARTMKELRARMDADVQQVLKRVKIIK  95

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              +LE L++SNAA+R + GCGPGSSSDRTRTSVV+GL  KLK+ M+ F + R K++ EY+E
Sbjct  96    GKLEALERSNAASRNIPGCGPGSSSDRTRTSVVSGLGKKLKDLMDDFQNFRNKMQYEYKE  155

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             TV+RRY+TVTG+  DEE ++ LI++G+SE+F+QKAIQEQGRG++++T+ EIQERH+A+KE
Sbjct  156   TVERRYFTVTGQKADEETIENLIASGESESFLQKAIQEQGRGQILDTISEIQERHDAIKE  215

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +E+NL ELHQVFLDMA LVE QG QL+DIES V  ANS VR G +QL  AR+ QK +RKW
Sbjct  216   IEKNLLELHQVFLDMAALVEAQGHQLNDIESHVAHANSFVRRGTEQLQEARELQKGSRKW  275

Query  650   TCF  642
             TC+
Sbjct  276   TCY  278



>ref|XP_006447372.1| hypothetical protein CICLE_v10017913mg [Citrus clementina]
 ref|XP_006469857.1| PREDICTED: syntaxin-125-like [Citrus sinensis]
 gb|ESR60612.1| hypothetical protein CICLE_v10017913mg [Citrus clementina]
Length=301

 Score =   324 bits (831),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 164/289 (57%), Positives = 214/289 (74%), Gaps = 19/289 (7%)
 Frame = -2

Query  1499  MNDLLSRSF----SLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL+S SF    ++  E GG      E+               L KFF+DVE VK+D+K
Sbjct  1     MNDLISNSFKRYSNVDLEAGGEIRKGTEN---------------LDKFFDDVENVKEDMK  45

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
              +EK+Y  L+ ++E++K  HNAK +K++RARMD DV   LK+ K+IK +LE L++SNAAN
Sbjct  46    VVEKLYKRLQESNEETKVAHNAKTMKQIRARMDSDVEQVLKRVKVIKGKLEALEKSNAAN  105

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             RKV GCGPGSS DRTRTSVV GL  KLK+ M+ F  LR K+ +EY+ET++RRY+TVTG+ 
Sbjct  106   RKVPGCGPGSSVDRTRTSVVAGLGKKLKDTMDDFQHLRAKMTAEYQETIERRYFTVTGQQ  165

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
              DE++++ LIS+G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVKE+E+NL ELHQVFL
Sbjct  166   ADEQMIENLISSGESENFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQVFL  225

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             DM  LVE QG QL+DIES V  ANS VR G +QL  AR+ QK++RKWTC
Sbjct  226   DMFALVEAQGHQLNDIESHVAHANSFVRRGTEQLEFARESQKDSRKWTC  274



>ref|XP_004143398.1| PREDICTED: syntaxin-121-like, partial [Cucumis sativus]
Length=251

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 190/224 (85%), Gaps = 0/224 (0%)
 Frame = -2

Query  1310  SLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVYGCG  1131
             SL+ +HEQSKT+HN+K +K++R+RM+  V+LALK+A+ IK RLEELD+SN  NRK+ GCG
Sbjct  3     SLQNSHEQSKTLHNSKAIKDVRSRMETAVTLALKKARFIKVRLEELDRSNEENRKLPGCG  62

Query  1130  PGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEEVLD  951
              GSS+DR+RTSVV+GLR KL + M  FN LR++I   Y+ET++RRY+T+TGENPDE+ ++
Sbjct  63    YGSSADRSRTSVVSGLRKKLCDSMESFNRLREEITKTYKETIERRYFTITGENPDEKTVE  122

Query  950   KLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAVLVE  771
              LISTG+SETF+QKAIQ+QGRG V+ T+ EIQERH+AVK++ERNL+ELHQVFLDMAV+V+
Sbjct  123   LLISTGESETFLQKAIQKQGRGRVLETIQEIQERHDAVKDIERNLRELHQVFLDMAVMVQ  182

Query  770   TQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             TQG+QLDDIESQV RANS VR G  QL TAR +QKNTRKW C  
Sbjct  183   TQGQQLDDIESQVTRANSAVRRGTSQLQTARYYQKNTRKWICIG  226



>ref|XP_004981508.1| PREDICTED: syntaxin-121-like [Setaria italica]
Length=309

 Score =   322 bits (826),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 191/245 (78%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE++KD+L+D+E+I  SL  A+E SK++H+A  V+ELR+RMD DV+ A+K+AK++
Sbjct  43    KFFEDVESIKDELRDLERIQRSLHEANEGSKSLHDAAAVRELRSRMDGDVASAIKKAKVV  102

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K RLE LD++NAANR V GCGPGSS+DRTRTSVV GLR KL++ M  F+ LR +I +EYR
Sbjct  103   KLRLESLDRANAANRSVPGCGPGSSTDRTRTSVVAGLRKKLRDSMEAFSSLRSRIAAEYR  162

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             +TV RRY+TVTG  PDE  LD L  +G+ E F+Q+AI EQGRGEV+  V EIQERH AV 
Sbjct  163   DTVARRYFTVTGSQPDEATLDALAESGEGERFLQRAIAEQGRGEVLGVVAEIQERHGAVA  222

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+ER+L EL QVF DMAVLV  QGEQLDDIE  V RA S V  G +QL  ARKHQK+TRK
Sbjct  223   ELERSLLELQQVFNDMAVLVAAQGEQLDDIEGNVGRARSFVDRGREQLQVARKHQKSTRK  282

Query  653   WTCFA  639
             WT  A
Sbjct  283   WTFIA  287



>gb|EYU26106.1| hypothetical protein MIMGU_mgv1a027054mg [Erythranthe guttata]
Length=308

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 220/287 (77%), Gaps = 3/287 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF   +     +  P E   I   AA    G NL KFF+DVE+VK D+ D+E 
Sbjct  1     MNDLFSHSF--KKYQDVKTQGPMEDIEIG-GAAGRTEGVNLDKFFDDVESVKKDMLDVEM  57

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E+SKTVHNAK +KELRARMD DV+  LK+ K++K++LE L++SNA++R+V 
Sbjct  58    LYKRLQESNEESKTVHNAKTMKELRARMDADVNQVLKRVKVVKNKLEALEKSNASHRRVP  117

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++  EY+ETV RRY+TVTGE  D+E
Sbjct  118   GCGPGSSADRTRTSVVSGLGKKLKDIMDDFQGLRARMNEEYKETVGRRYFTVTGEKADDE  177

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
             +++ +IS+G+SE+F+QKAIQEQGRG++++ + EIQERH++VKE+E+NL ELHQ+FLDMA 
Sbjct  178   LIENMISSGESESFLQKAIQEQGRGQILDAISEIQERHDSVKEIEKNLLELHQIFLDMAA  237

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL+DIES V  A+S VR G +QL  AR++QK +RKWT  A
Sbjct  238   LVEAQGQQLNDIESHVAHASSFVRRGTEQLQEAREYQKGSRKWTYIA  284



>gb|KDP20894.1| hypothetical protein JCGZ_21365 [Jatropha curcas]
Length=302

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 199/245 (81%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFF DVE VK+D+K +EK+Y +L+ A+E+SK  HNAK +K +R+RMD +V   LK+ K+I
Sbjct  35    KFFGDVENVKEDMKTVEKLYKNLQDANEESKVAHNAKTMKAIRSRMDSEVEQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA R + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ +EY+
Sbjct  95    KGKLEGLERSNAAARNIPGCGPGSSADRTRTSVVSGLGKKLKDLMDNFQGLRAKMTAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE P EE ++ LI +G+SE+F+QKAIQ+QGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEKPSEETIENLIESGESESFLQKAIQDQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG QL+DIES V  A+S VR G +QL  AR++QK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGHQLNDIESHVAHASSFVRRGTEQLQEAREYQKSSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>ref|XP_010543067.1| PREDICTED: syntaxin-123-like [Tarenaya hassleriana]
Length=302

 Score =   320 bits (821),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/244 (62%), Positives = 199/244 (82%), Gaps = 0/244 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FF  VE VK+D+K +E+++  L+ A+E+SKTVH++K +K+LR RMD DV L LK+ K+IK
Sbjct  37    FFGYVENVKEDMKAVEELHKRLQDANEESKTVHDSKAMKKLRGRMDSDVELVLKRVKMIK  96

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              +LE ++++NAA RKV GCGPGSS DRTRTSVV+GL  KLK+ M+ F  LR KI SEY+E
Sbjct  97    SKLEAVEKANAAQRKVPGCGPGSSVDRTRTSVVSGLGKKLKDMMDDFQGLRAKISSEYKE  156

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             TV+RRY+TVTG+  DEE ++KLIS+G+SE F+QKAIQEQGRG++M+T+ EIQER E+VKE
Sbjct  157   TVERRYFTVTGQRADEETIEKLISSGESEGFLQKAIQEQGRGQIMDTLSEIQERQESVKE  216

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +ER+L ELHQVFLDMA LVE QG  L+DIE+ V +A+S V  G+DQL  AR+HQK++RKW
Sbjct  217   IERSLVELHQVFLDMAALVEAQGHMLNDIETHVAKASSFVMRGSDQLQLAREHQKSSRKW  276

Query  650   TCFA  639
             TC A
Sbjct  277   TCIA  280



>ref|NP_001051494.1| Os03g0787000 [Oryza sativa Japonica Group]
 gb|AAT75251.1| putative syntaxin [Oryza sativa Japonica Group]
 gb|ABF99241.1| Syntaxin 121, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13408.1| Os03g0787000 [Oryza sativa Japonica Group]
 gb|EAY92102.1| hypothetical protein OsI_13808 [Oryza sativa Indica Group]
 dbj|BAG89748.1| unnamed protein product [Oryza sativa Japonica Group]
Length=330

 Score =   321 bits (823),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 194/245 (79%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFEDVE++KD+L+D+E+I  SL  A+E  K++H+A  V+ LRARMD DV+ A+K+AK++
Sbjct  44    RFFEDVESIKDELRDLERIQRSLHDANEGGKSLHDAAAVRALRARMDADVAAAIKKAKVV  103

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K RLE LD++NAANR V GCGPGSS+DRTRTSVV GLR KL++ M  F+ LR +I SEYR
Sbjct  104   KLRLESLDRANAANRSVPGCGPGSSTDRTRTSVVAGLRKKLRDSMESFSSLRARISSEYR  163

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV RRYYTVTGE PDE  LD L  TG+ E F+Q+AI EQGRGEV+  V EIQERH AV 
Sbjct  164   ETVARRYYTVTGEQPDEATLDNLAETGEGERFLQRAIAEQGRGEVLGVVAEIQERHGAVA  223

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+ER+L ELHQVF DMAVLV  QGEQLDDIE+ V RA S V  G +QL+ ARKHQK+TRK
Sbjct  224   ELERSLLELHQVFNDMAVLVAAQGEQLDDIETHVGRARSFVDRGREQLVVARKHQKSTRK  283

Query  653   WTCFA  639
             WTC A
Sbjct  284   WTCIA  288



>gb|ABB22782.1| SNARE protein [Oryza sativa Japonica Group]
Length=330

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 194/245 (79%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFEDVE++KD+L+D+E+I  SL  A+E  K++H+A  V+ LRARMD DV+ A+K+AK++
Sbjct  44    RFFEDVESIKDELRDLERIQRSLHDANEGGKSLHDAAAVRALRARMDADVATAIKKAKVV  103

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K RLE LD++NAANR V GCGPGSS+DRTRTSVV GLR KL++ M  F+ LR +I SEYR
Sbjct  104   KLRLESLDRANAANRSVPGCGPGSSTDRTRTSVVAGLRKKLRDSMESFSSLRARISSEYR  163

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV RRYYTVTGE PDE  LD L  TG+ E F+Q+AI EQGRGEV+  V EIQERH AV 
Sbjct  164   ETVARRYYTVTGEQPDEATLDNLAETGEGERFLQRAIAEQGRGEVLGVVAEIQERHGAVA  223

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+ER+L ELHQVF DMAVLV  QGEQLDDIE+ V RA S V  G +QL+ ARKHQK+TRK
Sbjct  224   ELERSLLELHQVFNDMAVLVAAQGEQLDDIETHVGRARSFVDRGREQLVVARKHQKSTRK  283

Query  653   WTCFA  639
             WTC A
Sbjct  284   WTCIA  288



>ref|XP_008383811.1| PREDICTED: syntaxin-124 [Malus domestica]
 ref|XP_008358692.1| PREDICTED: syntaxin-124-like [Malus domestica]
Length=303

 Score =   320 bits (819),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 198/243 (81%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VK+D++ +E++Y  L+ A+E+SKTVHNAK +KELR RMD DV   LK+ K+I
Sbjct  35    KFFEDVENVKEDMRQVERLYKQLQEANEESKTVHNAKTMKELRTRMDLDVEQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA+R + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KGKLEGLERSNAAHRNLPGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRARMTAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ET++RRY+T+TGE   E+ ++ LIS+G+SE+F+QKAIQEQGRG++M+T+ E+QERH+AVK
Sbjct  155   ETIERRYFTITGEKASEDTIETLISSGESESFLQKAIQEQGRGQIMDTISEMQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQ+FLDMA LVE QG QL+DIES V  A+S VR G D L  A++ QK +RK
Sbjct  215   EIEKNLIELHQIFLDMAALVEAQGHQLNDIESHVMHASSFVRRGTDNLQVAKEQQKKSRK  274

Query  653   WTC  645
             WTC
Sbjct  275   WTC  277



>ref|XP_008224938.1| PREDICTED: syntaxin-124 [Prunus mume]
Length=303

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 198/245 (81%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VK+D++ ++K+Y  L+ A+E+SKTVHNAK +KELR RMD DV   LK+ K+I
Sbjct  35    KFFEDVENVKEDMRQVDKLYKQLQEANEESKTVHNAKTMKELRTRMDLDVEQVLKKVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNA +R + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KGKLEGLERSNATHRNLPGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRGRMTAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ET++RRY+T+TGE   EE ++ LIS+G+SE+F+QKAIQEQGRG++++T+ E+QERH+AVK
Sbjct  155   ETIERRYFTITGEKASEETIENLISSGESESFLQKAIQEQGRGQILDTISEMQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQ+FLDMA LVE QG QL+DIES V  A+S VR G D L  A++ QK +RK
Sbjct  215   EIEKNLIELHQIFLDMAALVEAQGHQLNDIESHVMHASSFVRRGTDNLQEAKEQQKKSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>tpg|DAA51797.1| TPA: syntaxin 121 [Zea mays]
Length=306

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/290 (57%), Positives = 206/290 (71%), Gaps = 10/290 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDIE  1323
             MN L S S+   + +GG      ES  +EMSA           +FFEDVE++KD+L+D+E
Sbjct  1     MNSLFSSSW---KRDGGD----IESGGVEMSAPPGAAAGASLDRFFEDVESIKDELRDLE  53

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +I  SL  A+E  K++H+A  V+ LRARMD DV+ A+K+AK++K RLE LD++NAANR V
Sbjct  54    RIQRSLHDANEGGKSMHDAAAVRGLRARMDADVAAAIKKAKVVKLRLESLDRANAANRSV  113

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSS+DRTRTSVV GLR KL++ M  F+ LR ++ +EYR+TV RRY+TVTG  PDE
Sbjct  114   PGCGPGSSTDRTRTSVVAGLRKKLRDSMESFSSLRSRVAAEYRDTVARRYFTVTGAQPDE  173

Query  962   EVLDKLISTGQSETFMQKAIQE--QGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
               LD L  +G+ E F+Q+AI E  QGRGEV+  V EIQERH AV  +ER+L EL QVF D
Sbjct  174   ATLDALAESGEGERFLQRAIAEQGQGRGEVLGVVAEIQERHGAVAGLERSLLELQQVFND  233

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             MAVLV  QGEQLDDIE  V RA S V  G +QL  ARKHQK+TRKWTC A
Sbjct  234   MAVLVAAQGEQLDDIEGNVGRARSFVDRGREQLQVARKHQKSTRKWTCIA  283



>gb|KFK30926.1| hypothetical protein AALP_AA6G043900 [Arabis alpina]
Length=305

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/291 (56%), Positives = 218/291 (75%), Gaps = 13/291 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM----SaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL+S SF               +H +++    S  A+    NL +FF  VE+VK+D+K
Sbjct  1     MNDLISSSFK---------RYTDLNHQVQLDDIESQNASLDSGNLDEFFGYVESVKEDMK  51

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
              +E+I+  L+ A+E+SKTVH++K VK+LRARMD  V+  LK+ K+IK +L  L++SNAA 
Sbjct  52    AVEEIHKRLQDANEESKTVHDSKAVKKLRARMDSSVTEVLKRVKMIKSKLVALEKSNAAQ  111

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             RKV GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ SEY+ET++RRY+TVTG+ 
Sbjct  112   RKVSGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQRLRTKMASEYKETIERRYFTVTGQK  171

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
              DEE ++KLIS+G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVKE+ER+L ELHQ+FL
Sbjct  172   ADEETIEKLISSGESEHFLQKAIQEQGRGQIMDTISEIQERHDAVKEIERSLLELHQIFL  231

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DMA LVE QG  L+DIES V++A+S V  G DQL  A+  Q+N+RKWTC A
Sbjct  232   DMAALVEAQGNMLNDIESNVSKASSFVMRGTDQLHGAKVLQRNSRKWTCIA  282



>ref|XP_006396560.1| hypothetical protein EUTSA_v10028836mg [Eutrema salsugineum]
 gb|ESQ38013.1| hypothetical protein EUTSA_v10028836mg [Eutrema salsugineum]
Length=305

 Score =   318 bits (815),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/244 (62%), Positives = 200/244 (82%), Gaps = 0/244 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FF  VE+VK+D+K +++I+  L+ A+E+SKTVH++K VK+LRARMD  V+  LK+ K+IK
Sbjct  39    FFGYVESVKEDMKAVDEIHKRLQEANEESKTVHDSKAVKKLRARMDSSVTEVLKRVKMIK  98

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              +L  L++SNAA RKV GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ +EY+E
Sbjct  99    SKLVALEKSNAAQRKVPGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQRLRTKMATEYKE  158

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             TV+RRY+TVTG+  DEE ++KLIS+G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVKE
Sbjct  159   TVERRYFTVTGQKADEETIEKLISSGESERFLQKAIQEQGRGQIMDTLSEIQERHDAVKE  218

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +ER+L ELHQVFLDMA LVE QG  L+DIES V++A+S V  G+DQL  A+  QKN+RKW
Sbjct  219   IERSLLELHQVFLDMAALVEAQGNMLNDIESNVSKASSFVMRGSDQLHEAKDLQKNSRKW  278

Query  650   TCFA  639
             TC A
Sbjct  279   TCIA  282



>ref|XP_007213408.1| hypothetical protein PRUPE_ppa026160mg [Prunus persica]
 gb|EMJ14607.1| hypothetical protein PRUPE_ppa026160mg [Prunus persica]
Length=303

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 197/243 (81%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VK+D++ ++K+Y  L+ A+E+SKTVHNAK +KELR RMD DV   LK+ K+I
Sbjct  35    KFFEDVENVKEDMRQVDKLYKQLQDANEESKTVHNAKTMKELRTRMDLDVEQVLKKVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNA +R + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ SEY+
Sbjct  95    KGKLEGLERSNATHRNLPGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRGRMTSEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ET++RRY+T+TGE   EE ++ LIS+G+SE+F+QKAIQEQGRG++++T+ E+QERH+AVK
Sbjct  155   ETIERRYFTITGEKASEETIENLISSGESESFLQKAIQEQGRGQILDTISEMQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQ+FLDMA LVE QG QL+DIES V  A+S VR G D L  A++ QK +RK
Sbjct  215   EIEKNLIELHQIFLDMAALVEAQGHQLNDIESHVMHASSFVRRGTDNLQEAKEQQKKSRK  274

Query  653   WTC  645
             WTC
Sbjct  275   WTC  277



>ref|XP_010689643.1| PREDICTED: syntaxin-124-like [Beta vulgaris subsp. vulgaris]
Length=305

 Score =   318 bits (814),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 215/287 (75%), Gaps = 6/287 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF         +    ++   ++      G ANL KFF DV+ VK D+  +EK
Sbjct  1     MNDLFSSSFK------RYANLKDQAQLDDLELGNQTGTANLDKFFIDVDGVKGDMTHVEK  54

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ A+E+ K   NAK V++LRARMD DV   LK+AK+IK +LE L++SNAA+R + 
Sbjct  55    LYKRLQDANEECKIATNAKAVRDLRARMDGDVEQVLKRAKIIKGKLEGLERSNAAHRNLP  114

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCG GSS+DRTRTSVV+GL  KLK+ M++F  LR K+  EY+ETV+RRY+T+TGE  +EE
Sbjct  115   GCGSGSSADRTRTSVVSGLGLKLKDMMDKFQTLRTKMSLEYKETVERRYFTITGEKAEEE  174

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +++LIS+G+SE+F+QKAIQ+QGRG++M+TV EIQERH+A+KE+E+NL ELHQVFLDMA 
Sbjct  175   TIEQLISSGESESFLQKAIQDQGRGQIMDTVKEIQERHDAIKEIEKNLLELHQVFLDMAA  234

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG+QL+DI + VNRA+S V  G ++L+ A+ HQKN+RKWTC A
Sbjct  235   LVEAQGQQLNDIATNVNRASSFVSQGVNELVVAKDHQKNSRKWTCIA  281



>ref|XP_010422475.1| PREDICTED: syntaxin-123 [Camelina sativa]
 ref|XP_010455904.1| PREDICTED: syntaxin-123 isoform X1 [Camelina sativa]
 ref|XP_010455905.1| PREDICTED: syntaxin-123 isoform X2 [Camelina sativa]
Length=305

 Score =   317 bits (813),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 164/291 (56%), Positives = 217/291 (75%), Gaps = 13/291 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM----SaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL+S SF               +H +++    S  A+    NL +FF  VE+VK+D+K
Sbjct  1     MNDLISSSFK---------RYTDLNHQVQLDDIESQNASLDSGNLDEFFGYVESVKEDMK  51

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
              +++I+  L+ A+E+SKTVH++K VK+LRARMD  V+  LK+ K+IK +L  L++SNAA 
Sbjct  52    AVDEIHKRLQDANEESKTVHDSKAVKKLRARMDSSVTEVLKRVKMIKSKLVALEKSNAAQ  111

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             RKV GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ SEY+ETV+RRY+TVTG+ 
Sbjct  112   RKVSGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQRLRTKMASEYKETVERRYFTVTGQK  171

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
              DEE ++KLIS+G+SE F+QKAIQEQGRG++M+T+ EIQERH+ VKE+ER+L ELHQVFL
Sbjct  172   ADEETVEKLISSGESERFLQKAIQEQGRGQIMDTLSEIQERHDTVKEIERSLLELHQVFL  231

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DMA LVE QG  L+DIES V++A+S V  G DQL  A+  QKN+RKWTC A
Sbjct  232   DMAALVEAQGNMLNDIESNVSKASSFVMRGTDQLQGAKVLQKNSRKWTCIA  282



>ref|XP_010430946.1| PREDICTED: syntaxin-123-like [Camelina sativa]
Length=305

 Score =   317 bits (813),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 164/291 (56%), Positives = 217/291 (75%), Gaps = 13/291 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM----SaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL+S SF               +H +++    S  A+    NL +FF  VE+VK+D+K
Sbjct  1     MNDLISSSFK---------RYTDLNHQVQLDDIESQNASLDSGNLDEFFGYVESVKEDMK  51

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
              +++I+  L+ A+E+SKTVH++K VK+LRARMD  V+  LK+ K+IK +L  L++SNAA 
Sbjct  52    AVDEIHKRLQDANEESKTVHDSKAVKKLRARMDSSVTEVLKRVKMIKSKLVALEKSNAAQ  111

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             RKV GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ SEY+ETV+RRY+TVTG+ 
Sbjct  112   RKVSGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQRLRTKMASEYKETVERRYFTVTGQK  171

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
              DEE ++KLIS+G+SE F+QKAIQEQGRG++M+T+ EIQERH+ VKE+ER+L ELHQVFL
Sbjct  172   ADEETVEKLISSGESERFLQKAIQEQGRGQIMDTLSEIQERHDTVKEIERSLLELHQVFL  231

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DMA LVE QG  L+DIES V++A+S V  G DQL  A+  QKN+RKWTC A
Sbjct  232   DMAALVEAQGNMLNDIESNVSKASSFVMRGTDQLQGAKVLQKNSRKWTCIA  282



>gb|KHN43701.1| Syntaxin-121 [Glycine soja]
Length=309

 Score =   317 bits (813),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 231/310 (75%), Gaps = 34/310 (11%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM----SaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL S SFS  R +  S   P   H IEM    S    GG  NL KFFEDVE VK++LK
Sbjct  1     MNDLFSGSFSRFRSDQSS---PDRHHDIEMGATASGGGRGGEVNLDKFFEDVEGVKEELK  57

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             ++E +  SL+++HEQSKT+HNAK V++LRARMD DVS ALK+AKLIK +LE L++SNAAN
Sbjct  58    ELEGLAQSLRSSHEQSKTLHNAKAVRDLRARMDGDVSAALKKAKLIKLKLEALERSNAAN  117

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R + GCGPGSSSDRTRTSVVNGL+ KLK+ M  FN++RQ + SEYRETVQRRY+TVTGEN
Sbjct  118   RNMPGCGPGSSSDRTRTSVVNGLKKKLKDAMESFNEIRQLVSSEYRETVQRRYFTVTGEN  177

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
             PD++ LD LISTG+SETF+QKAIQEQGRG +++T+ EIQERH+AVKE+E+NLKELHQVFL
Sbjct  178   PDDKTLDLLISTGESETFLQKAIQEQGRGRILDTITEIQERHDAVKEIEKNLKELHQVFL  237

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA-iillliii  615
             DM VLV+ Q                           +RKHQKNTRKWTC+  I+LL+II+
Sbjct  238   DMTVLVQHQ--------------------------DSRKHQKNTRKWTCYCIILLLVIIL  271

Query  614   livvLSIRPW  585
              +V+ +++PW
Sbjct  272   FVVLFTVKPW  281



>ref|XP_010106999.1| hypothetical protein L484_016928 [Morus notabilis]
 gb|EXC12997.1| hypothetical protein L484_016928 [Morus notabilis]
Length=508

 Score =   324 bits (830),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  1310  SLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVYGCG  1131
              L  +H+QSKT+HNAK +K+LR+RMD DVSLALK+AKLIK RLE LD+ NAAN+  +GCG
Sbjct  71    CLNASHQQSKTLHNAKAIKDLRSRMDADVSLALKKAKLIKVRLEALDRCNAANQNFHGCG  130

Query  1130  PGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEEVLD  951
             PGSSSDRTRTSVVNGL  KLK+ M  FN L Q I SEYR+T+QRRY+TVTGENPDE+ +D
Sbjct  131   PGSSSDRTRTSVVNGLMKKLKDSMESFNSLHQLISSEYRDTIQRRYFTVTGENPDEKTID  190

Query  950   KLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAVLVE  771
              LISTG+SETF+Q+AIQEQGR  V++T+ EIQER +AVKE+E+NLKELH VFLDM VLV+
Sbjct  191   LLISTGESETFLQRAIQEQGRARVLDTIKEIQERQDAVKEMEKNLKELHHVFLDMMVLVQ  250

Query  770   TQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCF  642
              QGE+LD+IESQV RA+S+VR GA +L  AR +Q NTRK TC+
Sbjct  251   AQGEELDNIESQVARASSVVRSGAKRLQGARAYQNNTRKGTCY  293



>ref|NP_001057967.1| Os06g0590500 [Oryza sativa Japonica Group]
 dbj|BAD32916.1| putative syntaxin-related protein Nt-syr1 [Oryza sativa Japonica 
Group]
 dbj|BAF19881.1| Os06g0590500 [Oryza sativa Japonica Group]
 gb|EAZ01512.1| hypothetical protein OsI_23545 [Oryza sativa Indica Group]
 gb|EAZ37504.1| hypothetical protein OsJ_21838 [Oryza sativa Japonica Group]
 dbj|BAG97937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=308

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/245 (60%), Positives = 194/245 (79%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFEDVE VK+D+K +E +Y  L++ +E++KT H+A+ VK LR+RMD DV   L++AK +
Sbjct  39    RFFEDVEGVKEDMKGLEALYKRLQSTNEETKTAHDARAVKALRSRMDGDVEQVLRRAKAV  98

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD+ NA +RKV GCGPGSS+DRTRTSVV GL  KLK+ M+ F  LR ++ +EY+
Sbjct  99    KGKLEALDRDNATSRKVPGCGPGSSTDRTRTSVVAGLGKKLKDIMDDFQGLRTRMAAEYK  158

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV RRYYTVTGE  ++  +D LI +G+SE+F+QKAIQEQGRG+VM+T+ EIQERH+AVK
Sbjct  159   ETVARRYYTVTGEKAEDSTIDSLIESGESESFLQKAIQEQGRGQVMDTISEIQERHDAVK  218

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++ER+L +LHQVFLDMA LVE QG QL+DIES V  A+S VR G  +L  AR+HQK++RK
Sbjct  219   DIERSLLDLHQVFLDMAALVEAQGHQLNDIESHVAHASSFVRRGTVELEVAREHQKSSRK  278

Query  653   WTCFA  639
             W C A
Sbjct  279   WACVA  283



>ref|NP_001172852.1| Os02g0209900 [Oryza sativa Japonica Group]
 dbj|BAD25019.1| putative syntaxin-related protein Nt-syr1 [Oryza sativa Japonica 
Group]
 gb|EAZ22194.1| hypothetical protein OsJ_05857 [Oryza sativa Japonica Group]
 dbj|BAH91581.1| Os02g0209900 [Oryza sativa Japonica Group]
Length=311

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/245 (60%), Positives = 197/245 (80%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFE+VE VK +++ +E ++G L+ +HE SKT H+A+ V+ LRARMD DV   L++A+ +
Sbjct  42    QFFEEVEGVKGEMRGLEALHGRLQASHEGSKTAHDARAVRSLRARMDADVEQVLRRARAV  101

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K RL+ LD++NAA+RK+ G GPGSS+DRTR+S+V+GL  KLK+ M+ F  LR ++  EY+
Sbjct  102   KGRLQALDRANAASRKLPGRGPGSSTDRTRSSIVSGLGTKLKDLMDDFQGLRSRMAEEYK  161

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV RRYYTVTGE  +E  ++ LIS+G+SETF+QKAIQEQGRG+V++T+ EIQERH+AVK
Sbjct  162   ETVARRYYTVTGEKAEESTVEALISSGESETFLQKAIQEQGRGQVLDTISEIQERHDAVK  221

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+ER L +LHQVFLDMA LVE QG QL+DIES V RANS VR GA +L TAR++Q+++RK
Sbjct  222   EIERGLLDLHQVFLDMAALVEAQGHQLNDIESHVARANSFVRRGAVELETAREYQRSSRK  281

Query  653   WTCFA  639
             W C A
Sbjct  282   WACIA  286



>ref|XP_009403416.1| PREDICTED: syntaxin-124-like [Musa acuminata subsp. malaccensis]
Length=307

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 211/287 (74%), Gaps = 1/287 (0%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS + S  +          +     MS      GANL +FFE+VE VK+DL+ +E 
Sbjct  1     MNDLLSTT-SFKQYTNLKHQVQMDQMEAGMSGPGADVGANLERFFEEVENVKNDLRGLES  59

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ A+E+SKT H+AK +K +RARMD D+   L+QAK +K +LE LDQ+NA +R + 
Sbjct  60    LYRRLQEANEESKTAHSAKTMKAVRARMDADIGQVLRQAKAVKAKLEALDQANAQHRNIP  119

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR +I +EY+ETV RRYYTVTG + D++
Sbjct  120   GCGPGSSADRTRTSVVSGLGKKLKDLMDDFQGLRTRIAAEYKETVGRRYYTVTGTHADDD  179

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ LIS+G SE FMQKAIQEQGRG+VM+T+ EIQERH+AVKE+ER+L +LHQVFLDMA 
Sbjct  180   TIETLISSGASEKFMQKAIQEQGRGQVMDTISEIQERHDAVKEIERSLLDLHQVFLDMAA  239

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG QL+DIES V  A+S VR G  +L TAR++QK++RKW C  
Sbjct  240   LVEAQGHQLNDIESHVAHASSFVRRGTVELETAREYQKSSRKWFCIG  286



>gb|EAY84968.1| hypothetical protein OsI_06334 [Oryza sativa Indica Group]
Length=312

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/245 (60%), Positives = 196/245 (80%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFE+VE VK +++ +E ++G L+ +HE SKT H+A+ V+ LRARMD DV   L++A+ +
Sbjct  43    QFFEEVEGVKGEMRGLEALHGRLQASHEGSKTAHDARAVRSLRARMDADVEQVLRRARAV  102

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K RL+ LD++NAA+RK+ G GPGSS+DRTR+SVV+GL  KLK+ M+ F  LR ++  EY+
Sbjct  103   KGRLQALDRANAASRKLPGRGPGSSTDRTRSSVVSGLGTKLKDLMDDFQGLRSRMAEEYK  162

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV RRYYTVTGE  +E  ++ LIS+G+SETF+QKAIQEQGRG+V++T+ EIQERH+AVK
Sbjct  163   ETVARRYYTVTGEKAEESTVEALISSGESETFLQKAIQEQGRGQVLDTISEIQERHDAVK  222

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+ER L +LHQVFLDMA LVE QG QL+DIES V RANS VR GA +L TAR++Q++ RK
Sbjct  223   EIERGLLDLHQVFLDMAALVEAQGHQLNDIESHVARANSFVRRGAVELETAREYQRSGRK  282

Query  653   WTCFA  639
             W C A
Sbjct  283   WACIA  287



>ref|XP_006288308.1| hypothetical protein CARUB_v10001553mg [Capsella rubella]
 gb|EOA21206.1| hypothetical protein CARUB_v10001553mg [Capsella rubella]
Length=305

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/289 (56%), Positives = 217/289 (75%), Gaps = 13/289 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM----SaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL+S SF               +H +++    S  A+    NL +FF  VE+VK+D+K
Sbjct  1     MNDLISSSFK---------RYTDLNHQVQLDDIESQNASLDSGNLDEFFGYVESVKEDMK  51

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
              +++I+  L+ A+E+SKTVH++K VK+LRARMD  V+  LK+ K+IK +L  L++SNAA 
Sbjct  52    AVDEIHKRLQDANEESKTVHDSKAVKKLRARMDSSVTEVLKRVKMIKSKLVALEKSNAAQ  111

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             RKV GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ SEY+ETV+RRY+TVTG+ 
Sbjct  112   RKVSGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQRLRSKMASEYKETVERRYFTVTGQK  171

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
              DEE ++KLIS+G+SE F+QKAIQEQGRG++M+T+ EIQERH+ VKE+ER+L ELHQVFL
Sbjct  172   ADEETVEKLISSGESERFLQKAIQEQGRGQIMDTLSEIQERHDTVKEIERSLLELHQVFL  231

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             DMA LVE QG  L+DIES V++A+S V  G DQL  A++ QKN+RKWTC
Sbjct  232   DMAALVEAQGNMLNDIESNVSKASSFVMRGTDQLHGAKELQKNSRKWTC  280



>ref|XP_007043496.1| Syntaxin of plants 124 [Theobroma cacao]
 gb|EOX99327.1| Syntaxin of plants 124 [Theobroma cacao]
Length=307

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/287 (55%), Positives = 216/287 (75%), Gaps = 4/287 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S SF    +          S  +E +  A     NL KFFEDV+ VKDD++ +++
Sbjct  1     MNDLFSSSF----KKYSDLKQQAYSDNLEAAGEAWKETVNLDKFFEDVDNVKDDMRVVKQ  56

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +Y  L+ ++E++KT  NAK +K+LRARMD DV   LK+ K+IK +LE L++SNAA++K+ 
Sbjct  57    LYKRLQESNEETKTAQNAKAMKDLRARMDSDVEQVLKRVKVIKGKLEALERSNAAHQKLP  116

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+ RTRTSVV+GL N LK+ M+ F  LR K+ +EY+ TV+RRY+TVTG+  DEE
Sbjct  117   GCGPGSSAYRTRTSVVSGLGNTLKDMMDDFQGLRAKMTAEYKGTVERRYFTVTGQKADEE  176

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
             +++ LI++GQSETF Q+AIQ+QGRG++++T+ EIQERH+A+KE+E+NL ELHQ+FLDMAV
Sbjct  177   MIENLIASGQSETFFQEAIQDQGRGQILDTISEIQERHDAIKEIEKNLVELHQLFLDMAV  236

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG QL+DIES V  A+S V  G +QL  A+++QKN+RKW CFA
Sbjct  237   LVEAQGLQLNDIESHVAHASSFVMRGTEQLEVAKEYQKNSRKWGCFA  283



>gb|EYU38683.1| hypothetical protein MIMGU_mgv1a011630mg [Erythranthe guttata]
Length=276

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/286 (59%), Positives = 214/286 (75%), Gaps = 13/286 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S   SL R           SH+IEM+           +FF+DVE++KD+L ++E 
Sbjct  1     MNDLFSAG-SLSR------YGDQGSHSIEMTTGGVNLD----RFFKDVESIKDELTNLET  49

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++  L  AHEQSKT+HNA  +K+LR++MD DV+ +LK+AKL+K +LE LD+SNAANR V 
Sbjct  50    LHAKLNAAHEQSKTLHNAAAIKDLRSQMDADVAASLKKAKLVKVKLEALDRSNAANRSVP  109

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSSSDRTR SVVNGLR  L + MN+FNDLRQK+ SEYRETVQR YYTVTGENPDE+
Sbjct  110   GCGPGSSSDRTRNSVVNGLRKNLHDAMNRFNDLRQKMVSEYRETVQRIYYTVTGENPDEK  169

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
             VLD+LI TG+SE  +QKAIQEQGRG  M+TVMEIQERH+AVKE+E+NL +LHQVFLDMAV
Sbjct  170   VLDRLIETGKSENLLQKAIQEQGRG--MDTVMEIQERHDAVKEMEKNLMKLHQVFLDMAV  227

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCF  642
             LV++QGEQL+DIE  V +A   ++ G ++L TA+  +K      C 
Sbjct  228   LVQSQGEQLNDIEGHVLKAKPFIKDGTEKLQTAKNSKKCFGLCVCL  273



>ref|XP_002874867.1| SYP123 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51126.1| SYP123 [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score =   315 bits (807),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/288 (56%), Positives = 215/288 (75%), Gaps = 7/288 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRE-NGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIE  1323
             MNDL+S SF    + N        ES  + + +          +FF  VE+VK+D+K ++
Sbjct  1     MNDLISSSFKRYTDLNHQVQLDDIESQNVSLDSGNLD------EFFGYVESVKEDMKAVD  54

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +I+  L+ A+E+SKTVH++K VK+LRARMD +V+  LK+ K+IK +L  L++SNAA RKV
Sbjct  55    EIHKRLQDANEESKTVHDSKAVKKLRARMDSNVTEVLKRVKMIKSKLVALEKSNAAQRKV  114

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ +EY+ETV+RRY+TVTG+  DE
Sbjct  115   AGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQRLRTKMATEYKETVERRYFTVTGQKADE  174

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             E ++KLIS+G+SE F+QKAIQEQGRG++M+T+ EIQERH+ VKE+ER+L ELHQVFLDMA
Sbjct  175   ETVEKLISSGESERFLQKAIQEQGRGQIMDTLSEIQERHDTVKEIERSLLELHQVFLDMA  234

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
              LVE QG  L+DIES V++A+S V  G DQL  A+  Q+N+RKWTC A
Sbjct  235   ALVEAQGNMLNDIESNVSKASSFVMRGTDQLHGAKVLQRNSRKWTCIA  282



>ref|XP_009376513.1| PREDICTED: syntaxin-124 [Pyrus x bretschneideri]
Length=303

 Score =   315 bits (806),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/243 (59%), Positives = 198/243 (81%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFED+E VK+D++ +E++Y  L+ ++E++KTVHNA+ +KELR RMD DV   LK+ K+I
Sbjct  35    KFFEDIENVKEDMRQVERLYKQLQESNEETKTVHNAQTMKELRTRMDLDVEQVLKKVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA+R + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KGKLEGLERSNAAHRNLPGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRARMTAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ET++RRY+T+TGE   E+ ++ LIS+G+SE+F+QKAIQEQGRG++M+T+ E+QERH+AVK
Sbjct  155   ETIERRYFTITGEKASEDTIETLISSGESESFLQKAIQEQGRGQIMDTISEMQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQ+F+DMA LVE QG QL+DIES V  A+S VR G D L  A++ QK +RK
Sbjct  215   EIEKNLIELHQIFMDMAALVEAQGHQLNDIESHVMHASSFVRRGTDNLQVAKEQQKKSRK  274

Query  653   WTC  645
             WTC
Sbjct  275   WTC  277



>emb|CDY48554.1| BnaA09g01500D [Brassica napus]
Length=305

 Score =   314 bits (804),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 200/244 (82%), Gaps = 0/244 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FF  VE+VK+D+K +E+I+  L+ A+E+SKTVH++K VK+LRARMD  V+  LK+ K+IK
Sbjct  39    FFGYVESVKEDMKAVEEIHKRLQDANEESKTVHDSKAVKKLRARMDTSVTEVLKRVKMIK  98

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              +L  L++SNAA RKV GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ SEY+E
Sbjct  99    TKLVALEKSNAAQRKVPGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQRLRTKMASEYKE  158

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             T++RRY+TVTG+  DEE ++KLIS+G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVK+
Sbjct  159   TIERRYFTVTGQKADEETIEKLISSGESERFLQKAIQEQGRGQIMDTLSEIQERHDAVKD  218

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +ER+L ELHQ+FLDMA LVE QG  L+DIES V++A+S V  G++QL  A+  Q+N+RKW
Sbjct  219   IERSLLELHQIFLDMAALVEAQGSILNDIESNVSKASSFVMRGSEQLQGAKVLQRNSRKW  278

Query  650   TCFA  639
             TC A
Sbjct  279   TCIA  282



>ref|XP_008371295.1| PREDICTED: syntaxin-124-like [Malus domestica]
Length=303

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/243 (59%), Positives = 197/243 (81%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFED+E VK+D++ +E++Y  L+ ++E+SKTVHNA+ +KELR RMD DV   LK+ K+I
Sbjct  35    KFFEDIENVKEDMRQVERLYKQLQESNEESKTVHNAQTMKELRTRMDLDVEQVLKRVKII  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNA +R + GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR ++ +EY+
Sbjct  95    KGKLEGLERSNAXHRNLPGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRARMTAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ET++RRY+T+TGE   E+ ++ LIS+G+SE+F+QKAIQEQGRG++M+T+ E+QERH+AVK
Sbjct  155   ETIERRYFTITGEKASEDTIETLISSGESESFLQKAIQEQGRGQIMDTISEMQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQ+F+DMA LVE QG QL+DIES V  A+S VR G D L  A++ QK +RK
Sbjct  215   EIEKNLIELHQIFMDMAALVEAQGHQLNDIESHVMHASSFVRRGTDNLQVAKEQQKKSRK  274

Query  653   WTC  645
             WTC
Sbjct  275   WTC  277



>gb|AAP75621.1| syntaxin [Hordeum vulgare subsp. vulgare]
 gb|AAP75622.1| syntaxin [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89390.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=318

 Score =   314 bits (804),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 200/286 (70%), Gaps = 3/286 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDIE  1323
             MN+L S S+      GG          +EM+A           +FFEDVE++KDDL+++E
Sbjct  1     MNNLFSSSWKRA-GAGGDGDLESGGGGVEMTAPPGAAAGASLDRFFEDVESIKDDLRELE  59

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +I  SL   +E  K++H+A  V+ LR+RMD DV+ A+K+AK++K RLE LD++NAANR V
Sbjct  60    RIQRSLHDGNESGKSLHDASAVRALRSRMDADVAAAIKKAKVVKLRLESLDRANAANRSV  119

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSS+DRTRTSVV GLR KL++ M  F+ LR +I SEYRETV RRY+TVTG  PDE
Sbjct  120   AGCGPGSSTDRTRTSVVAGLRKKLRDAMESFSSLRSRITSEYRETVARRYFTVTGSQPDE  179

Query  962   EVLDKLISTGQSETFMQKAIQE-QGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDM  786
               LD L  TG+ E  +Q+AI E QGRGEV+  V EIQERH AV ++ER+L EL QVF DM
Sbjct  180   ATLDTLAETGEGERLLQRAIAEQQGRGEVLGVVAEIQERHGAVADLERSLLELQQVFNDM  239

Query  785   AVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWT  648
             AVLV  QGEQLDDIE  V RA S V  G +QL  ARKHQK++RKWT
Sbjct  240   AVLVAAQGEQLDDIEGHVGRARSFVDRGREQLQVARKHQKSSRKWT  285



>gb|EPS62072.1| hypothetical protein M569_12717 [Genlisea aurea]
Length=303

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/288 (53%), Positives = 212/288 (74%), Gaps = 17/288 (6%)
 Frame = -2

Query  1499  MNDLLSRSFSLPREN----GGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL S SF   + +    GG   +  E   ++             +FF++VE+VK D+ 
Sbjct  1     MNDLFSHSFKRYQNDLEAGGGDDGSRTEGVNLD-------------RFFDEVESVKRDMS  47

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
             D++ +Y  L+ ++E+SKT H+ + +KE+R+RMD DV+  LK+ K+IK +LE L++SNA N
Sbjct  48    DVDGLYRRLQESNEESKTAHSGRAMKEVRSRMDGDVARVLKRVKIIKGKLEALEKSNATN  107

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             R+V GCGPGSS+DRTRTSVV GL  KLK+ M+ F  LR ++  EY+ETV RRY+TVTGE 
Sbjct  108   RRVPGCGPGSSADRTRTSVVAGLGKKLKDLMDDFQGLRSRMNEEYKETVARRYFTVTGEK  167

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
             PD+E ++ +IS G+SETF+QKAIQEQGRG++++ + EIQERH+AVK++E+NL ELHQ+FL
Sbjct  168   PDDETVENMISCGESETFLQKAIQEQGRGQILDAITEIQERHDAVKDIEKNLVELHQIFL  227

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWT  648
             DMA LVE QG+QL+DIES V  A+S VR G +QL  AR++QK++RKWT
Sbjct  228   DMAALVEAQGQQLNDIESHVAHASSFVRRGTEQLHEAREYQKSSRKWT  275



>ref|XP_009121917.1| PREDICTED: syntaxin-123 [Brassica rapa]
Length=305

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/291 (55%), Positives = 218/291 (75%), Gaps = 13/291 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEM----SaaanggganlAKFFEDVEAVKDDLK  1332
             MNDL+S SF               +H +++    S  A     NL +FF  VE+VK+D+K
Sbjct  1     MNDLISSSFK---------RYTDLNHQVQLDDIESQNATLDSGNLDEFFGYVESVKEDMK  51

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
              +++I+  L+ A+E+SKTVH++K VK+LRARMD  V+  LK+ K+IK +L  L++SNAA 
Sbjct  52    AVDEIHKRLQDANEESKTVHDSKAVKKLRARMDTSVTEVLKRVKMIKTKLVALEKSNAAQ  111

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             RKV GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ SEY+ETV+RRY+TVTG+ 
Sbjct  112   RKVPGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQRLRTKMASEYKETVERRYFTVTGQK  171

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
              DEE ++KLIS+G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVK++ER+L ELHQ+FL
Sbjct  172   ADEETIEKLISSGESERFLQKAIQEQGRGQIMDTLSEIQERHDAVKDIERSLLELHQIFL  231

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DMA LVE QG  L+DIES V++A+S V  G++QL  A+  Q+N+RKWTC A
Sbjct  232   DMAALVEAQGSILNDIESNVSKASSFVMRGSEQLQGAKVLQRNSRKWTCIA  282



>ref|XP_003563699.1| PREDICTED: syntaxin-124-like [Brachypodium distachyon]
Length=307

 Score =   313 bits (801),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 193/244 (79%), Gaps = 0/244 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FFE+VEAVK+D++  E +Y  L++ +E++KT H A+ +K LR+RMD DV   LK+AK +K
Sbjct  39    FFEEVEAVKEDMRGFETLYKRLQSTNEETKTAHEARAIKSLRSRMDGDVEQVLKRAKAVK  98

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              +LE LD+ NA +RK  GCGPGSS+DRTRTSVV GL  KLK+ M+ F  LR ++ +EY+E
Sbjct  99    AKLEALDKDNANSRKAPGCGPGSSTDRTRTSVVAGLGKKLKDIMDDFQGLRTRMAAEYKE  158

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             TV RRYYTVTGE+ +E  ++ LIS+G+SE+FMQKAIQ+QGRG+VM+T+ EIQERH+AVKE
Sbjct  159   TVARRYYTVTGEHAEESTIESLISSGESESFMQKAIQDQGRGQVMDTISEIQERHDAVKE  218

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +ER+L +LHQVFLDMA LVE QG QL+DIES V  A+S VR G  +L TA + QK++RKW
Sbjct  219   IERSLMDLHQVFLDMAALVEAQGHQLNDIESHVAHASSFVRRGTVELETAHEIQKDSRKW  278

Query  650   TCFA  639
              CFA
Sbjct  279   MCFA  282



>ref|NP_001150776.1| syntaxin 121 [Zea mays]
 gb|ACG40338.1| syntaxin 121 [Zea mays]
Length=306

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 204/287 (71%), Gaps = 10/287 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDIE  1323
             MN L S S+   + +GG      ES  +EMSA           +FFEDVE++KD+L+D+E
Sbjct  1     MNSLFSSSW---KRDGGD----IESGGVEMSAPPGAAAGASLDRFFEDVESIKDELRDLE  53

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +I  SL  A+E  K++H+A  V+ LRARMD DV+ A+K+AK++K RLE LD++NAANR V
Sbjct  54    RIQRSLHDANEGGKSMHDAAAVRGLRARMDADVAAAIKKAKVVKLRLESLDRANAANRSV  113

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSS+DRTRTSVV GLR KL++ M  F+ LR ++ +EYR+TV RRY+TVTG  PDE
Sbjct  114   PGCGPGSSTDRTRTSVVAGLRKKLRDSMESFSSLRSRVAAEYRDTVARRYFTVTGAQPDE  173

Query  962   EVLDKLISTGQSETFMQKAIQE--QGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
               LD L  +G+ E F+Q+AI E  QGRGEV+  V EIQERH AV  +ER+L EL QVF D
Sbjct  174   ATLDALAESGEGERFLQRAIAEQGQGRGEVLGVVAEIQERHGAVAGLERSLLELQQVFND  233

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWT  648
             MAVLV  QGEQLDDIE  V RA S V  G +QL  ARKHQK+TRKWT
Sbjct  234   MAVLVAAQGEQLDDIEGNVGRARSFVDRGREQLQVARKHQKSTRKWT  280



>ref|NP_192242.1| syntaxin-123 [Arabidopsis thaliana]
 sp|Q9ZQZ8.1|SY123_ARATH RecName: Full=Syntaxin-123; Short=AtSYP123 [Arabidopsis thaliana]
 gb|AAD14461.1| SYR1-like syntaxin [Arabidopsis thaliana]
 emb|CAB77818.1| SYR1-like syntaxin [Arabidopsis thaliana]
 gb|AAM65230.1| SYR1-like syntaxin [Arabidopsis thaliana]
 dbj|BAF00925.1| SYR1-like syntaxin [Arabidopsis thaliana]
 gb|ACI31312.1| At4g03330 [Arabidopsis thaliana]
 gb|ADM21178.1| SYP123 [Arabidopsis thaliana]
 gb|AEE82307.1| syntaxin-123 [Arabidopsis thaliana]
Length=305

 Score =   312 bits (799),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/288 (56%), Positives = 212/288 (74%), Gaps = 7/288 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRE-NGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIE  1323
             MNDL+S SF    + N        ES  + + +          +FF  VE+VK+D+K ++
Sbjct  1     MNDLISSSFKRYTDLNHQVQLDDIESQNVSLDSGNLD------EFFGYVESVKEDMKAVD  54

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +I+  L+ A+E+SKTVH++K VK+LRARMD  V+  LK+ K+IK +L  L++SNAA RKV
Sbjct  55    EIHKRLQDANEESKTVHDSKAVKKLRARMDSSVTEVLKRVKMIKTKLVALEKSNAAQRKV  114

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ +EY+ETV+RRY+TVTG+  DE
Sbjct  115   AGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQRLRTKMATEYKETVERRYFTVTGQKADE  174

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             E ++KLIS+G+SE F+QKAIQEQGRG+VM+T+ EIQERH+ VKE+ER+L ELHQVFLDMA
Sbjct  175   ETVEKLISSGESERFLQKAIQEQGRGQVMDTLSEIQERHDTVKEIERSLLELHQVFLDMA  234

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
              LVE QG  L+DIES V++A+S V  G DQL  A+  Q+N RKW C A
Sbjct  235   ALVEAQGNMLNDIESNVSKASSFVMRGTDQLHGAKVLQRNNRKWACIA  282



>gb|ABK26928.1| unknown [Picea sitchensis]
Length=300

 Score =   311 bits (797),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 162/291 (56%), Positives = 208/291 (71%), Gaps = 14/291 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIE----MSaaanggganlAKFFEDVEAVKDDLK  1332
             MNDLLSRSFS  RE G        S  IE    M  AA     NL  FF +V  +K +++
Sbjct  1     MNDLLSRSFS--REKG--------SFDIESGGDMEMAAMDAEKNLTPFFSEVSLMKTEME  50

Query  1331  DIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAAN  1152
              I ++   LK AHE+SKT+H A+ +K LR RMD+DV   LK+AK IK +LEELD++N ++
Sbjct  51    QIRQLLLKLKEAHEESKTIHKAQAMKSLRERMDRDVLQILKKAKFIKGKLEELDKANLSS  110

Query  1151  RKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGEN  972
             RK+ GCG GSS+DRTRT+  NGLRN LK+ M +F  LRQ I +EY+ET++RRYYTVTGE 
Sbjct  111   RKIPGCGQGSSTDRTRTATTNGLRNSLKKLMGEFQSLRQIIMAEYKETIERRYYTVTGEK  170

Query  971   PDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFL  792
              DEE +D +I TG+SE  +Q+AIQEQG+G+++  + EIQERH+ VKE+E+NL EL QVFL
Sbjct  171   ADEETIDHIIETGESENMLQRAIQEQGKGQIIEVIREIQERHDTVKEIEKNLLELQQVFL  230

Query  791   DMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             DMAVLV+TQG++LD IE+ V RA+S V  G  +L  ARK QKNTRKWTC  
Sbjct  231   DMAVLVQTQGQELDSIEANVERASSFVDGGTRKLRKARKLQKNTRKWTCIG  281



>emb|CDY21958.1| BnaC09g00640D [Brassica napus]
Length=305

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 199/244 (82%), Gaps = 0/244 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FF  VE+VK+D+K +++I+  L+ A+E+SKTVH++K VK+LRARMD  V+  LK+ K+IK
Sbjct  39    FFGYVESVKEDMKAVDEIHKRLQDANEESKTVHDSKAVKKLRARMDTSVTEVLKRVKMIK  98

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              +L  L++SNAA RKV GCGPGSS+DRTRTSVV+GL  KLK+ M+ F  LR K+ SEY+E
Sbjct  99    TKLVALEKSNAAQRKVPGCGPGSSADRTRTSVVSGLGKKLKDMMDDFQRLRTKMASEYKE  158

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             TV+RRY TVTG+  DEE ++KLIS+G+SE F+QKAIQEQGRG++M+T+ EIQERH+AVK+
Sbjct  159   TVERRYSTVTGQKADEETIEKLISSGESERFLQKAIQEQGRGQIMDTLSEIQERHDAVKD  218

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +ER+L ELHQ+FLDMA LVE QG  L+DIES V++A+S V  G++QL  A+  Q+N+RKW
Sbjct  219   IERSLLELHQIFLDMAALVEAQGSILNDIESNVSKASSFVMRGSEQLQGAKVLQRNSRKW  278

Query  650   TCFA  639
             TC A
Sbjct  279   TCIA  282



>ref|XP_010059359.1| PREDICTED: syntaxin-124-like [Eucalyptus grandis]
 gb|KCW74736.1| hypothetical protein EUGRSUZ_E03461 [Eucalyptus grandis]
Length=300

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/290 (53%), Positives = 211/290 (73%), Gaps = 14/290 (5%)
 Frame = -2

Query  1499  MNDLLSRSF---SLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKD  1329
             MNDL S SF   S  +E         +  T+ +             FFE+VE VK+D+  
Sbjct  1     MNDLFSNSFKRYSDLKEQVYLDDTDSKKETVNLD-----------NFFEEVERVKEDMAQ  49

Query  1328  IEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANR  1149
             +EK+Y  L+ ++E+SK +H+ K +K++RA MD DV  ALKQ K+IK +LE L++SN A+R
Sbjct  50    VEKLYKRLQKSNEESKAIHHGKTIKQVRACMDSDVQQALKQVKIIKGKLEALERSNVAHR  109

Query  1148  KVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENP  969
              + GCGPGSS+DRTRTSVV GL  KLK+ M+ F +LR K+ +EY+E V RRY+T+TG+  
Sbjct  110   NLPGCGPGSSADRTRTSVVIGLGKKLKDMMDDFQELRAKMNAEYKENVGRRYFTITGQKA  169

Query  968   DEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
             DEE +D LIS+G+SE+ +QKAIQEQGRG++++T+ EIQER +A+KE+E+NL ELHQ+FLD
Sbjct  170   DEETIDNLISSGESESIVQKAIQEQGRGQILDTISEIQERRDAIKEIEKNLIELHQIFLD  229

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             MA LVE QG QL+DIESQV +A+S VR GAD L  A++++K++RKWTC A
Sbjct  230   MAALVEAQGHQLNDIESQVLQASSFVRRGADHLQVAKEYKKSSRKWTCIA  279



>ref|XP_003553621.1| PREDICTED: syntaxin-121-like [Glycine max]
Length=301

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/287 (54%), Positives = 205/287 (71%), Gaps = 4/287 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS  FS  ++         + H IE++           KFF++VE+VK+DLK++E+
Sbjct  1     MNDLLSGLFSKGKQQQQQQQQRHQ-HVIEITQGGGMDLD---KFFQEVESVKEDLKELER  56

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++ SL+  ++  K +H+ K V+ELR+RMD DV+L+L +AKL+K RL  L ++N A   + 
Sbjct  57    LHLSLRATNQHGKALHSPKGVRELRSRMDLDVALSLTKAKLVKGRLAALHRTNQATLSLP  116

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGS SDRTRT++V  L   L++ M  FN LR++I  EYR+TVQRRYY VTGENPD+E
Sbjct  117   GCGPGSYSDRTRTALVGALTKNLRQSMESFNKLREQISYEYRDTVQRRYYAVTGENPDQE  176

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQ+QGR  +M+T+ EIQERH+ +KE+ERNL ELHQVF+DMAV
Sbjct  177   TIDLLISTGESETFLQKAIQQQGRATIMDTIQEIQERHDTMKEIERNLHELHQVFMDMAV  236

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             L++ QGE LD+IES +  ANS V  G   L   R HQKNTR  TCFA
Sbjct  237   LIQHQGEHLDNIESHMELANSFVSIGVQHLQVVRSHQKNTRNCTCFA  283



>ref|XP_006656195.1| PREDICTED: syntaxin-124-like [Oryza brachyantha]
Length=309

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/245 (59%), Positives = 194/245 (79%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFEDVE VK+D++ +E +Y  L++ +E++KT H+A+ VK LR+RMD DV   L++AK +
Sbjct  40    QFFEDVEGVKEDMRGLEALYKRLQSTNEETKTAHDARAVKALRSRMDGDVEQVLRRAKGV  99

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE  D+ NA +RKV GCGPGSS+DRTRTSVV GL  KLK+ M+ F  LR ++ +EY+
Sbjct  100   KGKLEAFDRDNATSRKVPGCGPGSSTDRTRTSVVAGLGKKLKDIMDDFQGLRTRMAAEYK  159

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV RRYYTVTGE  ++  ++ LIS+G+SE+F+QKAIQEQGRG+VM+T+ EIQERH+AVK
Sbjct  160   ETVARRYYTVTGEKAEDSTIESLISSGESESFLQKAIQEQGRGQVMDTISEIQERHDAVK  219

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++ER+L +LHQVFLDMA LVE QG QL+DIES V  A+S VR G  +L  AR++QK++RK
Sbjct  220   DIERSLLDLHQVFLDMAALVEAQGHQLNDIESHVAHASSFVRRGTVELEVAREYQKSSRK  279

Query  653   WTCFA  639
             W C A
Sbjct  280   WACIA  284



>gb|AAP79426.1| syntaxin-like protein 4 [Hordeum vulgare subsp. vulgare]
Length=303

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 196/245 (80%), Gaps = 1/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFFEDVE VK+D++ +E IY  L++ +E+SKT H+A+ VK LRARM  DV   L++AK++
Sbjct  33    KFFEDVEGVKEDIRGLEAIYRRLQSVNEESKTAHDARAVKSLRARMGDDVEQVLRRAKVV  92

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD++NAA+RK+ GCG GSS+DRTR+SVV+GL NKLK+ M+ F  LR ++ +EY+
Sbjct  93    KAKLEALDRANAASRKLPGCGAGSSTDRTRSSVVSGLGNKLKDLMDDFQGLRTRMAAEYK  152

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQ-EQGRGEVMNTVMEIQERHEAV  837
             ETV RRYYTVTGE  +E  ++ LIS+G+SETF+QKAIQ +QGRGEVM TV EIQERH+AV
Sbjct  153   ETVARRYYTVTGETAEESTIEALISSGESETFLQKAIQRDQGRGEVMATVSEIQERHDAV  212

Query  836   KEVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTR  657
             K++ER+L ELHQVFLDMA LVE QG QL++IE+ V RA+S V  G  +L +AR +QK++R
Sbjct  213   KDIERSLLELHQVFLDMAALVEAQGHQLNNIETHVARASSFVVRGTVELESARVYQKSSR  272

Query  656   KWTCF  642
             KW C 
Sbjct  273   KWACI  277



>ref|XP_008679858.1| PREDICTED: syntaxin-124-like [Zea mays]
Length=313

 Score =   310 bits (795),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 192/244 (79%), Gaps = 2/244 (1%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FFEDVE VK+DL+ +E +   L++AHE+SKT H+A+ VK LRARMD DV   L++AK +K
Sbjct  42    FFEDVEGVKEDLRGMEALCRRLQSAHEESKTAHDARAVKALRARMDADVDEVLRRAKAVK  101

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              RLE LD+++AA+RKV GCGPGSS+DRTRTSVV GL  KLK+  + F  LR ++ +EYRE
Sbjct  102   DRLEALDRASAASRKVAGCGPGSSTDRTRTSVVTGLGKKLKDLTDDFQSLRTRMAAEYRE  161

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQ--GRGEVMNTVMEIQERHEAV  837
             TV RRYYTVTGE   +  ++ LIS+GQSETF++KAIQEQ  GRG+V++TV EIQERH AV
Sbjct  162   TVARRYYTVTGEEAADSTVEALISSGQSETFLRKAIQEQAAGRGQVLDTVSEIQERHGAV  221

Query  836   KEVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTR  657
              EVER+L+ELHQVFLD+A LVE QG QL+DIES V RA+S V  GA +L  AR++Q++ R
Sbjct  222   VEVERSLRELHQVFLDVAALVEAQGHQLNDIESHVARASSFVLRGAVELEAAREYQRSGR  281

Query  656   KWTC  645
             KW C
Sbjct  282   KWAC  285



>ref|XP_007162979.1| hypothetical protein PHAVU_001G196400g [Phaseolus vulgaris]
 gb|ESW34973.1| hypothetical protein PHAVU_001G196400g [Phaseolus vulgaris]
Length=298

 Score =   308 bits (790),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 158/288 (55%), Positives = 203/288 (70%), Gaps = 9/288 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPES-HTIEMSaaanggganlAKFFEDVEAVKDDLKDIE  1323
             MNDLLS  FS     G       E  H IE++           KFF++VE+VK++LK++E
Sbjct  1     MNDLLSSLFS----KGKQQQQQQEGQHVIEITQGGMALD----KFFQEVESVKEELKELE  52

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +++ SL+ +++  K +++ K V+ELR+RMD DV+LAL +AKL+K RLE L ++N A   +
Sbjct  53    RLHLSLRGSNQNGKALYSPKGVRELRSRMDLDVALALTKAKLVKTRLEALRRANQATLSL  112

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
               CGPGS SDRTRT++V  L   LK+ M  FN LR++I  EYR+TVQRRYY VTGENPD 
Sbjct  113   PDCGPGSYSDRTRTALVGALTKNLKQSMENFNKLREQISYEYRDTVQRRYYAVTGENPDA  172

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             E +D LISTG+SE F+QKAIQ+QGR  +M+T+ EIQERH  VKE+ERNL+ELHQVFLDMA
Sbjct  173   ETIDLLISTGESENFLQKAIQQQGRATIMDTIQEIQERHGTVKEIERNLQELHQVFLDMA  232

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             +LV+ QGE LDDIES +  ANS V  G   L   R HQKNTR  TCFA
Sbjct  233   LLVQHQGEHLDDIESHMELANSFVGKGVHHLQVVRNHQKNTRNLTCFA  280



>ref|XP_002987120.1| hypothetical protein SELMODRAFT_125429 [Selaginella moellendorffii]
 gb|EFJ11696.1| hypothetical protein SELMODRAFT_125429 [Selaginella moellendorffii]
Length=334

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/296 (53%), Positives = 207/296 (70%), Gaps = 22/296 (7%)
 Frame = -2

Query  1499  MNDLLSRSFSLPR-----------ENGGSSPAPPESHTIEMSaaanggganlAKFFEDVE  1353
             MNDL+SRSFS PR           E GG +         EM+   +     L  F E+  
Sbjct  1     MNDLMSRSFSGPRSYVDLRHDRDLEAGGET---------EMTVVDSERNLAL--FLEEAN  49

Query  1352  AVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEEL  1173
              ++  +K +E +   L+ A+E+SK++H A+ VK +R RMDKDV   LK AK IK +LEEL
Sbjct  50    EIQAKMKSVEGLLARLQQANEESKSIHKAQAVKAIRQRMDKDVEQVLKLAKSIKAQLEEL  109

Query  1172  DQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRY  993
             D++NAANRK+ G G G+ +DRTRTS+   +R KLK+ M  F +LRQ+++ EYRE + RRY
Sbjct  110   DKANAANRKIAGFGAGTPTDRTRTSLTASMRKKLKDIMGDFQELRQRMKGEYREAIGRRY  169

Query  992   YTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLK  813
             +TVTG +PDEE L+ +I TG+SETF+Q+AIQEQGRG+VM T+ EIQERH+AV+E+E+NL 
Sbjct  170   FTVTGTDPDEETLETMIETGESETFLQRAIQEQGRGQVMETIREIQERHDAVREIEKNLL  229

Query  812   ELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             ELHQ+FLDMAVLVE QGEQL+ IE QV+RA+S V  G   L  A+KHQ++ RKWTC
Sbjct  230   ELHQIFLDMAVLVEAQGEQLNSIEDQVHRASSFVARGTTNLQVAKKHQRSARKWTC  285



>ref|XP_002976210.1| hypothetical protein SELMODRAFT_151097 [Selaginella moellendorffii]
 gb|EFJ22470.1| hypothetical protein SELMODRAFT_151097 [Selaginella moellendorffii]
Length=334

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/296 (53%), Positives = 207/296 (70%), Gaps = 22/296 (7%)
 Frame = -2

Query  1499  MNDLLSRSFSLPR-----------ENGGSSPAPPESHTIEMSaaanggganlAKFFEDVE  1353
             MNDL+SRSFS PR           E GG +         EM+   +     L  F E+  
Sbjct  1     MNDLMSRSFSGPRSYVDLRHDRDLEAGGET---------EMTVVDSERNLAL--FLEEAN  49

Query  1352  AVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEEL  1173
              ++  +K +E +   L+ A+E+SK++H A+ VK +R RMDKDV   LK AK IK +LEEL
Sbjct  50    EIQAKMKSVEGLLARLQQANEESKSIHKAQAVKAIRQRMDKDVEQVLKLAKSIKAQLEEL  109

Query  1172  DQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRY  993
             D++NAANRK+ G G G+ +DRTRTS+   +R KLK+ M  F +LRQ+++ EYRE + RRY
Sbjct  110   DKANAANRKIAGFGAGTPTDRTRTSLTASMRKKLKDIMGDFQELRQRMKGEYREAIGRRY  169

Query  992   YTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLK  813
             +TVTG +PDEE L+ +I TG+SETF+Q+AIQEQGRG+VM T+ EIQERH+AV+E+E+NL 
Sbjct  170   FTVTGTDPDEETLETMIETGESETFLQRAIQEQGRGQVMETIREIQERHDAVREIEKNLL  229

Query  812   ELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             ELHQ+FLDMAVLVE QGEQL+ IE QV+RA+S V  G   L  A+KHQ++ RKWTC
Sbjct  230   ELHQIFLDMAVLVEAQGEQLNSIEDQVHRASSFVARGTTNLQVAKKHQRSARKWTC  285



>dbj|BAK07448.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 213/287 (74%), Gaps = 6/287 (2%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDL S S S  +     + A P++   +M  A   G ANL +FF DVEA+K+DL+  E 
Sbjct  1     MNDLFSSS-SFKK----YADANPQTSAADM-EAGGEGVANLDQFFSDVEALKEDLRGFET  54

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++  L++ +E++KT H+A+ +K LR+RMD DV   LK+AK +K +LE L++ NA +RK  
Sbjct  55    LHKRLQSTNEETKTAHDARAIKALRSRMDGDVEQVLKRAKGVKAKLEALERDNANSRKAP  114

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GCGPGSS+DRTRTSVV GL  KLK+ M+ F  LR K+ +EY+ETV RRYYT+TGE+ +E 
Sbjct  115   GCGPGSSTDRTRTSVVAGLGKKLKDVMDDFQGLRAKMAAEYKETVARRYYTITGEHAEES  174

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LIS+G+SE+F+QKAIQ+QGRG+VM+T+ EIQERH+AVK++ER+L +LHQVFLDMA 
Sbjct  175   TIDSLISSGESESFLQKAIQDQGRGQVMDTISEIQERHDAVKDIERSLMDLHQVFLDMAA  234

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE QG QL+DIES V  A+S VR G  +L  A + QK+TRKW CFA
Sbjct  235   LVEAQGHQLNDIESHVAHASSFVRRGTVELEQAHEIQKDTRKWMCFA  281



>gb|AFW66077.1| hypothetical protein ZEAMMB73_372212 [Zea mays]
Length=394

 Score =   310 bits (793),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 192/244 (79%), Gaps = 2/244 (1%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FFEDVE VK+DL+ +E +   L++AHE+SKT H+A+ VK LRARMD DV   L++AK +K
Sbjct  123   FFEDVEGVKEDLRGMEALCRRLQSAHEESKTAHDARAVKALRARMDADVDEVLRRAKAVK  182

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              RLE LD+++AA+RKV GCGPGSS+DRTRTSVV GL  KLK+  + F  LR ++ +EYRE
Sbjct  183   DRLEALDRASAASRKVAGCGPGSSTDRTRTSVVTGLGKKLKDLTDDFQSLRTRMAAEYRE  242

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQ--GRGEVMNTVMEIQERHEAV  837
             TV RRYYTVTGE   +  ++ LIS+GQSETF++KAIQEQ  GRG+V++TV EIQERH AV
Sbjct  243   TVARRYYTVTGEEAADSTVEALISSGQSETFLRKAIQEQAAGRGQVLDTVSEIQERHGAV  302

Query  836   KEVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTR  657
              EVER+L+ELHQVFLD+A LVE QG QL+DIES V RA+S V  GA +L  AR++Q++ R
Sbjct  303   VEVERSLRELHQVFLDVAALVEAQGHQLNDIESHVARASSFVLRGAVELEAAREYQRSGR  362

Query  656   KWTC  645
             KW C
Sbjct  363   KWAC  366



>ref|XP_010522637.1| PREDICTED: syntaxin-123 [Tarenaya hassleriana]
Length=303

 Score =   306 bits (784),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 154/292 (53%), Positives = 211/292 (72%), Gaps = 20/292 (7%)
 Frame = -2

Query  1499  MNDLLSRSFSLPREN------GGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDD  1338
             MNDL+S SF    +       G       ES  ++             +FF  VE +K+D
Sbjct  1     MNDLISSSFKKYTDQKQQALLGDIEAGQTESGNLD-------------EFFGHVEDIKED  47

Query  1337  LKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNA  1158
             ++ +E+++  L+ A+E++KTVH++K +K+LR+RMD DV L LK+ + IK +LE L++SN 
Sbjct  48    MRAVEELHKLLQDANEEAKTVHDSKAMKKLRSRMDSDVKLVLKRVRTIKSKLEALEKSNE  107

Query  1157  ANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTG  978
             A R+V GCGPGSS DRTRTSVV+GL   L++ M+ F  LR KI SEY+ETV+RRY+TVTG
Sbjct  108   AQREVPGCGPGSSVDRTRTSVVSGLGKNLEDMMDDFQRLRAKISSEYKETVERRYFTVTG  167

Query  977   ENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQV  798
             +  DEE ++KLIS+G+SE F+QKAI+EQGRG++M T+ EIQERH+AVKE+ERNL ELH+V
Sbjct  168   QRADEETIEKLISSGESERFLQKAIEEQGRGQIMETLSEIQERHDAVKEIERNLVELHEV  227

Query  797   FLDM-AVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             FLDM A +VE Q   L+DIE+ V RA+S V HG+DQLL  ++HQK++RKWTC
Sbjct  228   FLDMAAAIVEAQCHMLNDIETNVKRASSFVMHGSDQLLVMKEHQKSSRKWTC  279



>ref|XP_003520718.1| PREDICTED: syntaxin-121-like isoform X1 [Glycine max]
 ref|XP_006577101.1| PREDICTED: syntaxin-121-like isoform X2 [Glycine max]
Length=294

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/287 (54%), Positives = 199/287 (69%), Gaps = 11/287 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS  FS             E H IE++           KF E+VE+VK+DLK++E+
Sbjct  1     MNDLLSGLFS---------KGKQEEHVIEITEGGGIMELE--KFLEEVESVKEDLKELER  49

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++ SL   ++  K +H+ K V+ELR+RMD DV+L+L +AK +K RL  L ++N A   + 
Sbjct  50    LHLSLDATNQNGKALHSPKGVRELRSRMDLDVALSLTKAKHVKGRLAALHRANQATLSLP  109

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
              CGPGS SDRTRT++V  L   L++ M  FN LR++I  EYR+TVQRRYY VTGENPD+E
Sbjct  110   DCGPGSYSDRTRTALVGALTKNLRQSMASFNKLREQISYEYRDTVQRRYYAVTGENPDQE  169

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQ+QGR  VM+T+ EI+ERH  +KE+ER+L ELHQVF+DMAV
Sbjct  170   TIDLLISTGESETFLQKAIQQQGRASVMDTIQEIRERHGTMKEIERSLHELHQVFMDMAV  229

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             L++ QGE LDDIES V  ANS V  G   L   R HQKNTR +TCFA
Sbjct  230   LIQHQGEHLDDIESHVELANSFVSKGVQHLQVVRNHQKNTRNFTCFA  276



>gb|KHN22602.1| Syntaxin-121 [Glycine soja]
Length=294

 Score =   304 bits (779),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/287 (54%), Positives = 198/287 (69%), Gaps = 11/287 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS  FS             E H IE++           KF E+VE+VK+DLK++E+
Sbjct  1     MNDLLSGLFS---------KGKQEEHVIEITEGGGIMELE--KFLEEVESVKEDLKELER  49

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++ SL   ++  K +H+ K V+ELR+RMD DV+L+L +AK +K RL  L ++N A   + 
Sbjct  50    LHLSLDATNQNGKALHSPKGVRELRSRMDLDVALSLTKAKHVKGRLAALHRANQATLSLP  109

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
              CGPGS SDRTRT++V  L   L++ M  FN LR++I  EYR+TVQRRYY VTGENPD+E
Sbjct  110   DCGPGSYSDRTRTALVGALTKNLRQSMASFNKLREQISYEYRDTVQRRYYAVTGENPDQE  169

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SET +QKAIQ+QGR  VM+T+ EIQERH  +KE+ER+L ELHQVF+DMAV
Sbjct  170   TIDLLISTGESETLLQKAIQQQGRASVMDTIQEIQERHGTMKEIERSLHELHQVFMDMAV  229

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             L++ QGE LDDIES V  ANS V  G   L   R HQKNTR +TCFA
Sbjct  230   LIQHQGEHLDDIESHVELANSFVSKGVQHLQVVRNHQKNTRNFTCFA  276



>ref|XP_002453527.1| hypothetical protein SORBIDRAFT_04g007360 [Sorghum bicolor]
 gb|EES06503.1| hypothetical protein SORBIDRAFT_04g007360 [Sorghum bicolor]
Length=315

 Score =   305 bits (780),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 193/245 (79%), Gaps = 4/245 (2%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFEDVE VK+DL+ +E ++  L++AHE+SKT H+A+ VK LRARMD DV   L++AK +
Sbjct  41    RFFEDVEGVKEDLRGLESLHRRLQSAHEESKTAHDARAVKALRARMDADVDQVLRRAKAV  100

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE LD++NAA+R++ GCGPGSS+DRTRTSVV GL  KLK+ M+ F  LR ++ +EY+
Sbjct  101   KTKLEALDRANAASRRLPGCGPGSSADRTRTSVVTGLGKKLKDLMDDFQGLRTRMAAEYK  160

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQ----GRGEVMNTVMEIQERH  846
             ETV RRYYTVTGE   E  ++ LI++GQSETF+QKAIQEQ    GR +V++TV EIQER 
Sbjct  161   ETVARRYYTVTGEEAAEGTVEALIASGQSETFLQKAIQEQAAAAGRAQVVDTVSEIQERR  220

Query  845   EAVKEVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQK  666
             +AV EVER+L+ELHQVFLDMA LVE QG QL+DIES V RA+S V  GA +L  AR++Q+
Sbjct  221   DAVVEVERSLRELHQVFLDMAALVEAQGHQLNDIESHVARASSFVLRGAVELEAAREYQR  280

Query  665   NTRKW  651
             + RKW
Sbjct  281   SGRKW  285



>ref|XP_001763191.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
 gb|EDQ72068.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
Length=309

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/298 (51%), Positives = 207/298 (69%), Gaps = 22/298 (7%)
 Frame = -2

Query  1499  MNDLLSRSFS-----------LPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVE  1353
             MN+LLS SF            + R +     A      ++MS           +FF++V 
Sbjct  1     MNNLLSNSFGKAMNYVDLKKDIRRGDIELGEASIGDGEVDMS-----------QFFDEVG  49

Query  1352  AVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEEL  1173
              +K +++ I+     +K A+E+S+TVH A+ +K LR+RMD D++   K AK IK +LEEL
Sbjct  50    VIKSEMEKIKHCLEKVKDANEESRTVHKAQAMKALRSRMDADIAQVTKIAKSIKFKLEEL  109

Query  1172  DQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRY  993
             D++NAANR+V GC  G+ +DRTR+S+ N LR KLK+ M +F  LRQK+  EY+ETV+RRY
Sbjct  110   DRANAANRRVRGCEEGTPTDRTRSSITNTLRKKLKDLMGEFQILRQKMMEEYKETVERRY  169

Query  992   YTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLK  813
             YTVTG++ D+E ++ +I TG SETF+QKAIQEQGRG+V+ T+ EIQERH+AVK++ERNL 
Sbjct  170   YTVTGQHADDETIENIIETGNSETFLQKAIQEQGRGQVLETIKEIQERHDAVKDIERNLI  229

Query  812   ELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             ELHQ+F+DMA LVETQGEQL+DIESQVN+A S V  G  QL  A+ HQ+NTRKW C  
Sbjct  230   ELHQIFMDMATLVETQGEQLNDIESQVNKAASFVERGTTQLKIAKNHQRNTRKWMCMG  287



>ref|XP_008230270.1| PREDICTED: syntaxin-124 [Prunus mume]
Length=305

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/244 (61%), Positives = 190/244 (78%), Gaps = 0/244 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FF+++E VK D+K + ++Y  L+ A+E+SK +H+AK +KEL ARMD DV   LK  K+IK
Sbjct  41    FFKEIENVKHDMKAVVQLYKRLQEANEESKLIHDAKSMKELSARMDSDVEQVLKLVKIIK  100

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              +LE L+ SNA  RK+ GCG GSSSDRTRTSV+NGL  KLK+ M+ F  LR K+ SEY+E
Sbjct  101   GKLETLELSNADQRKLPGCGAGSSSDRTRTSVLNGLAKKLKDMMDDFQGLRTKMGSEYKE  160

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             TVQRR +T+TGE  +EE ++ LIS+G SET +QKAI+EQGRG+V++TV EIQERH+AVKE
Sbjct  161   TVQRRCFTITGEKANEETIENLISSGASETLLQKAIEEQGRGQVLDTVQEIQERHDAVKE  220

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +E++L ELHQVFLDMA LV+ QG+QL+DIES V RANS VR G  QL  A+ +QKN RKW
Sbjct  221   MEKSLIELHQVFLDMAALVDAQGQQLNDIESHVARANSFVRRGNVQLEVAKDYQKNNRKW  280

Query  650   TCFA  639
              C A
Sbjct  281   ACIA  284



>gb|EMT15634.1| Syntaxin-124 [Aegilops tauschii]
Length=308

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/247 (59%), Positives = 196/247 (79%), Gaps = 4/247 (2%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FFEDVE VK+D++ +E ++  L++ +E+SKT H+A+ VK LRARMD DV   L++AK++K
Sbjct  36    FFEDVEGVKEDIRSLEAMHRRLQSVNEESKTAHDARAVKSLRARMDGDVEQVLRRAKVVK  95

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQF---NDLRQKIESE  1020
              +LE LD++NAA+RK+ GCG GSS+DRTR+SVV+GL NKLK+ M+ F     LR ++ +E
Sbjct  96    AKLEALDRANAASRKLPGCGAGSSTDRTRSSVVSGLGNKLKDLMDDFQRVQGLRTRMAAE  155

Query  1019  YRETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQ-EQGRGEVMNTVMEIQERHE  843
             Y+ETV RRYYTVTGE  +E  +D LIS+G+SETF+QKAIQ +QGRG+VM TV EIQERH+
Sbjct  156   YKETVARRYYTVTGETAEESTIDALISSGESETFLQKAIQRDQGRGQVMATVSEIQERHD  215

Query  842   AVKEVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKN  663
             AVK++ER+L ELHQVFLDMA LVE QG QL++IE+ V RA+S V  G  +L +AR +QK+
Sbjct  216   AVKDIERSLLELHQVFLDMAALVEAQGHQLNNIETHVARASSFVIRGTVELDSARVYQKS  275

Query  662   TRKWTCF  642
             +RKW C 
Sbjct  276   SRKWACI  282



>gb|AFN53706.1| putative dead box ATP-dependent RNA helicase [Linum usitatissimum]
Length=1272

 Score =   323 bits (829),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 201/245 (82%), Gaps = 0/245 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             KFF+DVE VKDD+  + K++ SL+ ++E+ KTVHNAK VK+LR+RMD DV+  LK+ ++I
Sbjct  35    KFFQDVENVKDDMSTVAKLHKSLQESNEEIKTVHNAKTVKDLRSRMDSDVAQVLKRVRVI  94

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE L++SNAA R + GCGPGSS+DRTRTSVV GL  KLK+ M+ F +LR K+ +EY+
Sbjct  95    KGKLEALERSNAAARSIPGCGPGSSADRTRTSVVGGLGKKLKDLMDDFQNLRAKMSAEYK  154

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRY+T+TGE   E++++ LI +G+SE+F+QKAIQEQGRG++++T+ EIQERH+AVK
Sbjct  155   ETVERRYFTITGEKASEDLIENLIESGESESFLQKAIQEQGRGQILDTISEIQERHDAVK  214

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             E+E+NL ELHQVFLDMA LVE QG QL+DIES V  A+S VR G +QL  AR+HQK++RK
Sbjct  215   EIEKNLIELHQVFLDMAALVEAQGHQLNDIESHVAHASSFVRRGTEQLQEAREHQKSSRK  274

Query  653   WTCFA  639
             WTC A
Sbjct  275   WTCIA  279



>ref|XP_007216766.1| hypothetical protein PRUPE_ppa024730mg [Prunus persica]
 gb|EMJ17965.1| hypothetical protein PRUPE_ppa024730mg [Prunus persica]
Length=305

 Score =   296 bits (757),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 144/244 (59%), Positives = 188/244 (77%), Gaps = 0/244 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             FF+++E VK D+  + ++Y  L+ A+++SK +H+AK +KEL ARMD DV   LK  K+IK
Sbjct  41    FFKEIENVKHDMGAVVQLYKRLQEANKESKLIHDAKSMKELSARMDSDVEQVLKLVKIIK  100

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
               LE L+ SNA  RK+  CG GSSSDRTRTSV++GL  K K+ M+ F  LR K+ SEY+E
Sbjct  101   GTLETLELSNADQRKLPSCGAGSSSDRTRTSVLSGLAKKFKDMMDDFQGLRTKMGSEYKE  160

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             TVQRRY+T+TGE  +EE+++ LIS+G SET +QKAI+EQGRG+V++TV EIQERH+AVKE
Sbjct  161   TVQRRYFTITGEKANEEMIENLISSGASETLLQKAIEEQGRGQVLDTVQEIQERHDAVKE  220

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +E++L ELHQVFLDMA LV+ QG+QL+DIES V RANS VR G  QL  A+ +QKN RKW
Sbjct  221   MEKSLIELHQVFLDMAALVDAQGQQLNDIESHVARANSFVRRGNLQLEVAKDYQKNNRKW  280

Query  650   TCFA  639
              C A
Sbjct  281   ACIA  284



>ref|XP_007162978.1| hypothetical protein PHAVU_001G196300g [Phaseolus vulgaris]
 gb|ESW34972.1| hypothetical protein PHAVU_001G196300g [Phaseolus vulgaris]
Length=306

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 220/289 (76%), Gaps = 4/289 (1%)
 Frame = -2

Query  1436  PPESHT-IEMSaaangg--ganlAKFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNA  1266
             PP  H+ IEM+   +      +LAK+F +VEA+ ++L  +E++  SLK +HEQ KT+HN 
Sbjct  17    PPSDHSVIEMAGGDDDDDGAKSLAKYFGNVEAITEELNKVEQLKQSLKRSHEQGKTLHNG  76

Query  1265  KQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNG  1086
             K +K+LR  M+ +V+LAL+ AK ++ +LE L+++NA +R + G GPGSSSDR+RTSVV  
Sbjct  77    KAMKDLRFSMEAEVALALETAKFVRFQLEALERANADHRSLPGRGPGSSSDRSRTSVVIS  136

Query  1085  LRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKA  906
             L  KLK+ ++ FN+LR +I +E+RETVQR+Y+TVTG NPD+  LD LIS+G+SE  +Q+A
Sbjct  137   LWKKLKDSLDGFNELRHQINTEHRETVQRQYFTVTGNNPDDSTLDLLISSGESENLLQRA  196

Query  905   IQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNR  726
             I+EQGRG + + + EI+ERH+ +KE+E+NLKELHQVFLDM VLVE+QGEQLDDIE+QV R
Sbjct  197   IEEQGRGRIEDIMNEIKERHDEMKELEKNLKELHQVFLDMTVLVESQGEQLDDIENQVAR  256

Query  725   ANSIVRHGADQLLTARKHQKNTRKW-TCFAiillliiilivvLSIRPWK  582
             ANS VR+G+  L  ARK QKN RKW  C  I+L+ I++ +V+  +RPW+
Sbjct  257   ANSFVRNGSQNLEIARKEQKNHRKWGYCAIILLVAIVLFVVLFFVRPWE  305



>gb|KHN43607.1| Syntaxin-121 [Glycine soja]
Length=290

 Score =   293 bits (750),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 198/287 (69%), Gaps = 15/287 (5%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS  FS  ++         + H IE++           KFF++VE+VK+DLK++E+
Sbjct  1     MNDLLSGLFSKGKQQQQQQQQRHQ-HVIEITQGGGMDLD---KFFQEVESVKEDLKELER  56

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             ++ SL+  ++  K +H+ K V+ELR+RMD DV+L+L +AKL+K  L   D          
Sbjct  57    LHLSLRATNQHGKALHSPKGVRELRSRMDLDVALSLTKAKLVKATLSLPD----------  106

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
              CGPGS SDRTRT++V  L   L++ M  FN LR++I  EYR+TVQRRYY VTGENPD+E
Sbjct  107   -CGPGSYSDRTRTALVGALTKNLRQSMESFNKLREQISYEYRDTVQRRYYAVTGENPDQE  165

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              +D LISTG+SETF+QKAIQ+QGR  +M+T+ EIQERH+ +KE+ERNL ELHQVF+DMAV
Sbjct  166   TIDLLISTGESETFLQKAIQQQGRATIMDTIQEIQERHDTMKEIERNLHELHQVFMDMAV  225

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             L++ QGE LD+IES +  ANS V  G   L   R HQKNTR  TCFA
Sbjct  226   LIQHQGEHLDNIESHMELANSFVSIGVQHLQVVRSHQKNTRNCTCFA  272



>gb|EMT29769.1| Syntaxin-124 [Aegilops tauschii]
Length=306

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 205/288 (71%), Gaps = 8/288 (3%)
 Frame = -2

Query  1499  MNDLLS-RSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIE  1323
             MNDL S  SF         + A PE+   +M       GANL +FF DVEAVK+DLK  E
Sbjct  1     MNDLFSTNSFK------KYADANPETSAADM-EGGGMNGANLDQFFSDVEAVKEDLKGFE  53

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
              ++  L++ +E++KT H+A+ +K LR+RMD DV   LK+AK +K +LE L + NA +RK 
Sbjct  54    TLHKRLQSTNEETKTAHDARTIKALRSRMDGDVEQVLKRAKAVKAKLEALKRDNANSRKA  113

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
                GPGSS DRTRTSVV GL  KLK+ M+ F  LR K+ +EY+ETV RRY+TVTGE+ +E
Sbjct  114   PDWGPGSSVDRTRTSVVAGLGKKLKDIMDDFQGLRAKMAAEYKETVARRYFTVTGEHAEE  173

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
               +D LIS+G+SE+F+QKAIQ+QGRG+VM+T+ EIQER +AVK++ER+L +LHQVFLDMA
Sbjct  174   STIDSLISSGESESFLQKAIQDQGRGQVMDTISEIQERSDAVKDIERSLMDLHQVFLDMA  233

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
              LVE QG Q++DIE  V  A+S VR G  +L  A + QK+TRKW CFA
Sbjct  234   ALVEAQGHQINDIERHVAHASSFVRRGTVELEQAHEIQKDTRKWMCFA  281



>ref|XP_001767977.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
 gb|EDQ67252.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
Length=319

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 188/243 (77%), Gaps = 0/243 (0%)
 Frame = -2

Query  1373  KFFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLI  1194
             +FFE+V  +K ++  I+++   +K A+E+S+ VH A+ +K LR+RMD D++   K AK I
Sbjct  45    QFFEEVGVIKSEMDKIKQLLEKVKAANEESRIVHKAQAMKALRSRMDADIAQVTKIAKSI  104

Query  1193  KHRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYR  1014
             K +LE+LD++NAANR+V GC  G+ +DRTRTS+   LR KLK+ M +F  LRQK+  EY+
Sbjct  105   KLKLEDLDRANAANRRVRGCEEGTPTDRTRTSITGTLRKKLKDLMGEFQTLRQKMMEEYK  164

Query  1013  ETVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVK  834
             ETV+RRYYTVTGE+ D++ ++ +I TG SETF+QKAIQEQGRG+V+ T+ EIQERH+AVK
Sbjct  165   ETVERRYYTVTGEHADDDTIEHIIETGNSETFLQKAIQEQGRGQVLETIKEIQERHDAVK  224

Query  833   EVERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRK  654
             ++ERNL ELH +F+DMA LVE QGEQL++IES VN+A+S +  G  QL  A+ HQ+NTRK
Sbjct  225   DIERNLIELHSIFMDMATLVEAQGEQLNNIESHVNKASSFIDRGTQQLKIAKDHQRNTRK  284

Query  653   WTC  645
             W C
Sbjct  285   WMC  287



>ref|XP_001755039.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
 gb|EDQ79983.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
Length=307

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/290 (51%), Positives = 202/290 (70%), Gaps = 12/290 (4%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGS-----SPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDL  1335
             MNDLL+  FS  R NG       S   P +   +M        +    FF +VE +K D+
Sbjct  1     MNDLLA--FS-GRNNGRGYDDLESGGGPSTQMADMGGGDQKMES----FFAEVEKIKGDM  53

Query  1334  KDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAA  1155
               I++I   L  A+E+SK VH A  +KELR RMD D++   K A+ IK +LE+LD+ NA 
Sbjct  54    DRIKQILIKLVDANEESKGVHRAPAMKELRGRMDADIAQVSKLARGIKGKLEDLDRKNAD  113

Query  1154  NRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGE  975
             +R+V GC  G+ +DRTR ++ N  R KLK+ M  F  LR+++ +EY+ET++RRYYTVTG+
Sbjct  114   SRRVKGCEEGTPTDRTRMTITNNQRKKLKDLMGDFQSLRERMMNEYKETIERRYYTVTGQ  173

Query  974   NPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVF  795
               DEE +D++I TG+SETF+QKAIQEQGRG VM T+ EIQERH++VKE+E+NL ELHQ+F
Sbjct  174   QADEETIDQIIETGESETFLQKAIQEQGRGHVMETIREIQERHDSVKEIEKNLLELHQIF  233

Query  794   LDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTC  645
             +DMAVLVE QGEQL++IE+QVNR++S V  G   L  A++HQ++ RKWTC
Sbjct  234   MDMAVLVEAQGEQLNNIEAQVNRSSSYVERGTTHLRVAKQHQRSKRKWTC  283



>ref|XP_004306005.1| PREDICTED: syntaxin-124-like [Fragaria vesca subsp. vesca]
Length=303

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 189/244 (77%), Gaps = 0/244 (0%)
 Frame = -2

Query  1370  FFEDVEAVKDDLKDIEKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIK  1191
             +F  +E VK+D+  +EK++  L+ A+E+SK VH+AK +K LR+RMD DV   LK AK+IK
Sbjct  39    YFRKIENVKEDMGAVEKLFKQLEEANEESKQVHDAKSMKGLRSRMDSDVEKVLKLAKVIK  98

Query  1190  HRLEELDQSNAANRKVYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRE  1011
              +LE L+ SNA  RK+ GCG GSSSDRTRTS++NGL  KLK  M+ F  LR KI SEY+E
Sbjct  99    EKLEALELSNAEQRKLPGCGSGSSSDRTRTSLLNGLTKKLKAMMDDFQGLRAKIASEYKE  158

Query  1010  TVQRRYYTVTGENPDEEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKE  831
             TV RRY+T+TGE  + E+++ LI++G+ ET +Q+AIQEQGRG++++T+ EIQER +AVKE
Sbjct  159   TVGRRYFTITGEKANNEMIENLIASGEGETLVQRAIQEQGRGQILDTIQEIQERRDAVKE  218

Query  830   VERNLKELHQVFLDMAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             +E++L ELHQVFLDMA LVE QG+QL+DIESQV RA+S VR G  QL  A+++QK++RK 
Sbjct  219   IEQSLIELHQVFLDMAALVEAQGQQLNDIESQVARASSFVRKGTVQLEEAKQYQKSSRKC  278

Query  650   TCFA  639
              C  
Sbjct  279   ICIG  282



>ref|XP_001765144.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
 gb|EDQ70139.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
Length=307

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/287 (51%), Positives = 204/287 (71%), Gaps = 2/287 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganlAKFFEDVEAVKDDLKDIEK  1320
             MNDLLS++FS  R+ GG+        + +M+    G       FF DVE +K D+  I++
Sbjct  1     MNDLLSQTFS-ARKAGGAYDDLESGPSTQMADLGGGDQKLDG-FFADVEKIKADMDKIKQ  58

Query  1319  IYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKVY  1140
             +   L+ A+E+SK VH A  +K LR RMD D++   K A+ +K +LE L++ NAA+R+V 
Sbjct  59    LLLKLQEANEESKGVHRAPAMKALRERMDTDIAQVSKLARGLKGKLEALERGNAASRRVK  118

Query  1139  GCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDEE  960
             GC  G+ +DRTR ++    R KLK+ M +F  LR+++ +EYRET++RRYYTVTG+  DE+
Sbjct  119   GCEEGTPTDRTRMTITINQRKKLKDLMGEFQVLRERMMNEYRETIERRYYTVTGQQADED  178

Query  959   VLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMAV  780
              ++ +I TGQSE+F+QKAIQEQGRG VM T+ EIQERH++VKE+E+NL ELHQ+F+DMAV
Sbjct  179   TIETIIETGQSESFLQKAIQEQGRGHVMETIREIQERHDSVKEIEKNLLELHQIFMDMAV  238

Query  779   LVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             LVE+QGEQL++IE+QVNR+ S V  G   L  A+ HQ++ RKWTC A
Sbjct  239   LVESQGEQLNNIEAQVNRSASYVERGTTHLRVAKSHQRSKRKWTCIA  285



>ref|XP_003558056.1| PREDICTED: syntaxin-121-like [Brachypodium distachyon]
Length=318

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 201/286 (70%), Gaps = 9/286 (3%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaanggganl-AKFFEDVEAVKDDLKDIE  1323
             MN+L S S+        +     ES  +EMSA           KFFEDVE++KDDL+D++
Sbjct  1     MNNLFSSSWKR------AGDGDLESGGVEMSAPPGAAAGASLDKFFEDVESIKDDLRDLD  54

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             +I  SL   +E  K++H+A  V+ LRARMD D + A+K+AK++K RLE LD++NAANR V
Sbjct  55    RIQRSLHDGNESGKSLHDASAVRALRARMDADAAAAIKKAKVVKLRLESLDRANAANRSV  114

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GCGPG+S+DRTRTSVV GLR KL++ M  F+ LR ++ SEYR+TV RRY+TVTG  PDE
Sbjct  115   PGCGPGTSTDRTRTSVVAGLRKKLRDSMESFSALRARVSSEYRDTVARRYFTVTGAQPDE  174

Query  962   EVLDKLISTGQSETFMQKAIQE--QGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLD  789
               LD L  TG+ E F+Q+AI E  QGRGEVM  V EIQERH AV ++ER+L ELHQVF D
Sbjct  175   ATLDTLAETGEGERFLQRAIAEQGQGRGEVMGVVAEIQERHGAVADLERSLLELHQVFND  234

Query  788   MAVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
             MAVLV  QGEQLDDIE  V RA S V  G +QL  ARKHQK++RKW
Sbjct  235   MAVLVAAQGEQLDDIEGHVGRARSFVDRGREQLQVARKHQKSSRKW  280



>ref|XP_001763192.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
 gb|EDQ72069.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
Length=310

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 203/284 (71%), Gaps = 1/284 (0%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaangg-ganlAKFFEDVEAVKDDLKDIE  1323
             MNDLLSRSF     N            IE+   A+ G   ++ KFF++V  +K +++ I+
Sbjct  1     MNDLLSRSFGRDGSNYVDLKKDSRHGDIELGNKASTGPEIDMTKFFDEVAVIKGEMEKIK  60

Query  1322  KIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRKV  1143
             ++   ++ AH++S+TV  A+ +K LRARM+ D+    K AK IK +LEELD++N  NR+V
Sbjct  61    QLLSKVQDAHDESRTVTKAQGMKALRARMETDIRQVTKIAKAIKFKLEELDKANVENRRV  120

Query  1142  YGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPDE  963
              GC  G+ +DRTRTS+ + LR KLK+ M +F  LRQ +  EY+E+V+RRYYTVTGE+ DE
Sbjct  121   IGCEEGAPTDRTRTSITSTLRKKLKDLMGEFQILRQNMNDEYKESVERRYYTVTGEHADE  180

Query  962   EVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDMA  783
             E +D +I TG SETF+QKAIQEQGRG V+ T+ EIQERH+AVK++ER+L ELHQ+F+DMA
Sbjct  181   ETIDTIIETGNSETFLQKAIQEQGRGHVLETIKEIQERHDAVKDIERSLLELHQIFMDMA  240

Query  782   VLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKW  651
              LV+ QGEQL+DIE QVN+A+S ++ G  QL  A+  Q+++RKW
Sbjct  241   TLVDAQGEQLNDIEQQVNKASSFIQRGTQQLQVAKNTQRSSRKW  284



>ref|XP_001785723.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
 gb|EDQ49458.1| Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group [Physcomitrella patens]
Length=311

 Score =   288 bits (737),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 141/289 (49%), Positives = 201/289 (70%), Gaps = 2/289 (1%)
 Frame = -2

Query  1499  MNDLLSRSFSLPRENGGSSPAPPESHTIEMSaaangg--ganlAKFFEDVEAVKDDLKDI  1326
             MNDL SRSF     N            +E+   +  G    ++  FF +V+ +K +++ I
Sbjct  1     MNDLFSRSFGREGSNYVDLKKDSRKGDVELGEKSVAGGPEIDMGPFFAEVDKIKSEMEKI  60

Query  1325  EKIYGSLKTAHEQSKTVHNAKQVKELRARMDKDVSLALKQAKLIKHRLEELDQSNAANRK  1146
             +++   ++ AHE+S+TV  A+ +K+LR RMD D+    K AK IK +LEELD++N  NRK
Sbjct  61    KQLLAKVQGAHEESRTVSKAQAMKDLRVRMDNDIKQVTKIAKTIKSKLEELDKANVENRK  120

Query  1145  VYGCGPGSSSDRTRTSVVNGLRNKLKEYMNQFNDLRQKIESEYRETVQRRYYTVTGENPD  966
             V GC  G+ +DRTR S+ + LR KLK+ M +F  LRQ +  EY+ETV+RRYYTVTG++ D
Sbjct  121   VRGCEEGTPTDRTRVSITSTLRKKLKDLMGEFQILRQNMNEEYKETVERRYYTVTGKHAD  180

Query  965   EEVLDKLISTGQSETFMQKAIQEQGRGEVMNTVMEIQERHEAVKEVERNLKELHQVFLDM  786
             +E ++ +I TG SETF+QKAIQEQGRG+V+ T+ EIQERH+AVK++ERNL ELHQ+F+DM
Sbjct  181   DETIETIIETGNSETFLQKAIQEQGRGQVLETIKEIQERHDAVKDIERNLLELHQIFMDM  240

Query  785   AVLVETQGEQLDDIESQVNRANSIVRHGADQLLTARKHQKNTRKWTCFA  639
             A LV+ QGEQL+DIE Q+ +A+S +  GA  L  A+ +Q+++RKW C A
Sbjct  241   ATLVDAQGEQLNDIEQQMGKASSFIARGAQNLQVAKNNQRSSRKWCCIA  289



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4862288125142