BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20338_g1_i1 len=1817 path=[1289:0-157 1446:158-228 @356@!:229-963
2250:964-988 970:989-1132 894:1133-1816]

Length=1817
                                                                      Score     E

ref|XP_006357808.1|  PREDICTED: MATE efflux family protein 9-like       629   0.0      
ref|XP_004232021.1|  PREDICTED: MATE efflux family protein 9-like...    623   0.0      
ref|XP_010316084.1|  PREDICTED: MATE efflux family protein 9-like...    615   0.0      
ref|XP_009796825.1|  PREDICTED: MATE efflux family protein 9-like       592   0.0      
ref|XP_009587574.1|  PREDICTED: MATE efflux family protein 9-like       587   0.0      
ref|XP_004234578.1|  PREDICTED: MATE efflux family protein 9-like       586   0.0      
ref|XP_004233961.1|  PREDICTED: MATE efflux family protein 5-like...    570   0.0      
ref|XP_011099517.1|  PREDICTED: MATE efflux family protein 5-like       563   0.0      
ref|XP_009616550.1|  PREDICTED: MATE efflux family protein 5-like       562   0.0      
ref|XP_011099514.1|  PREDICTED: MATE efflux family protein 5-like...    560   0.0      
ref|XP_006346989.1|  PREDICTED: MATE efflux family protein 9-like       556   0.0      
ref|XP_004233485.1|  PREDICTED: MATE efflux family protein 5            554   0.0      
ref|XP_006346902.1|  PREDICTED: MATE efflux family protein 5-like       551   0.0      
emb|CDP02740.1|  unnamed protein product                                548   0.0      
ref|XP_011099512.1|  PREDICTED: MATE efflux family protein 5-like       545   0.0      
ref|XP_008219099.1|  PREDICTED: MATE efflux family protein 7-like       540   0.0      
gb|EYU44603.1|  hypothetical protein MIMGU_mgv1a005639mg                538   0.0      
emb|CDP02741.1|  unnamed protein product                                536   0.0      
ref|XP_006482188.1|  PREDICTED: MATE efflux family protein 7-like       533   0.0      
ref|XP_002314825.2|  MATE efflux family protein                         531   3e-180   Populus trichocarpa [western balsam poplar]
ref|XP_006478383.1|  PREDICTED: MATE efflux family protein 5-like...    530   4e-180   
ref|XP_011038708.1|  PREDICTED: MATE efflux family protein 9-like...    530   1e-179   
ref|XP_011038712.1|  PREDICTED: MATE efflux family protein 9-like       528   6e-179   
gb|EYU41307.1|  hypothetical protein MIMGU_mgv1a021573mg                526   1e-178   
ref|XP_010068722.1|  PREDICTED: MATE efflux family protein 7-like       528   1e-178   
ref|XP_009776776.1|  PREDICTED: MATE efflux family protein 5-like       525   3e-178   
ref|XP_009606969.1|  PREDICTED: MATE efflux family protein 5-like       524   1e-177   
gb|KDP34996.1|  hypothetical protein JCGZ_09284                         523   3e-177   
ref|XP_009335493.1|  PREDICTED: MATE efflux family protein 5-like       521   9e-177   
ref|XP_008800923.1|  PREDICTED: MATE efflux family protein 5-like       523   1e-176   
gb|EYU41309.1|  hypothetical protein MIMGU_mgv1a019425mg                521   1e-176   
ref|XP_004299020.1|  PREDICTED: MATE efflux family protein 9-like       521   3e-176   
ref|XP_010279418.1|  PREDICTED: MATE efflux family protein 5-like       520   8e-176   
ref|XP_010108909.1|  MATE efflux family protein 7                       517   5e-175   
ref|XP_002314826.2|  hypothetical protein POPTR_0010s12720g             518   6e-175   Populus trichocarpa [western balsam poplar]
ref|XP_011038711.1|  PREDICTED: MATE efflux family protein 5-like...    516   2e-174   
ref|XP_010251273.1|  PREDICTED: MATE efflux family protein 5-like       516   2e-174   
ref|XP_002280212.1|  PREDICTED: MATE efflux family protein 5            516   3e-174   Vitis vinifera
ref|XP_010044140.1|  PREDICTED: MATE efflux family protein 8-like       516   4e-174   
ref|XP_006302197.1|  hypothetical protein CARUB_v10020206mg             515   4e-174   
ref|XP_010044145.1|  PREDICTED: MATE efflux family protein 8-like       515   9e-174   
emb|CAN78227.1|  hypothetical protein VITISV_022104                     514   1e-173   Vitis vinifera
ref|XP_011038710.1|  PREDICTED: MATE efflux family protein 5-like...    516   1e-173   
ref|XP_008243314.1|  PREDICTED: MATE efflux family protein 5-like       514   2e-173   
ref|XP_011035132.1|  PREDICTED: MATE efflux family protein 5-like       513   4e-173   
ref|XP_007225783.1|  hypothetical protein PRUPE_ppa004624mg             513   6e-173   
ref|XP_008339593.1|  PREDICTED: MATE efflux family protein 8-like       513   7e-173   
ref|XP_003518636.1|  PREDICTED: MATE efflux family protein DTX1 i...    512   8e-173   
ref|XP_006383382.1|  hypothetical protein POPTR_0005s15050g             511   1e-172   
ref|XP_011099511.1|  PREDICTED: MATE efflux family protein 5-like       511   2e-172   
ref|XP_008229282.1|  PREDICTED: MATE efflux family protein 5            511   2e-172   
ref|XP_006357807.1|  PREDICTED: MATE efflux family protein 5-like       510   3e-172   
ref|XP_006482189.1|  PREDICTED: MATE efflux family protein 5-like       510   4e-172   
ref|XP_011099516.1|  PREDICTED: MATE efflux family protein 5-like...    508   7e-172   
ref|XP_007021414.1|  MATE efflux family protein                         514   9e-172   
gb|KDO63183.1|  hypothetical protein CISIN_1g011678mg                   509   1e-171   
ref|XP_009357500.1|  PREDICTED: MATE efflux family protein 5-like       509   1e-171   
ref|XP_010044144.1|  PREDICTED: MATE efflux family protein 8-like       509   2e-171   
ref|XP_004232020.1|  PREDICTED: MATE efflux family protein 5-like       508   2e-171   
gb|EYU44602.1|  hypothetical protein MIMGU_mgv1a022553mg                508   2e-171   
ref|XP_006448326.1|  hypothetical protein CICLE_v10015035mg             509   2e-171   
gb|KCW86181.1|  hypothetical protein EUGRSUZ_B02871                     508   3e-171   
ref|XP_008389238.1|  PREDICTED: MATE efflux family protein 5-like...    508   4e-171   
ref|XP_007033147.1|  MATE efflux family protein, putative               507   6e-171   
ref|XP_009357535.1|  PREDICTED: MATE efflux family protein 5-like       507   1e-170   
ref|XP_006468794.1|  PREDICTED: MATE efflux family protein 5-like...    506   2e-170   
gb|KDO64763.1|  hypothetical protein CISIN_1g011296mg                   506   2e-170   
ref|XP_011021312.1|  PREDICTED: MATE efflux family protein 6-like...    505   3e-170   
ref|XP_011099515.1|  PREDICTED: MATE efflux family protein 9-like...    503   5e-170   
ref|XP_007033156.1|  MATE efflux family protein, putative               504   6e-170   
ref|XP_002887351.1|  predicted protein                                  504   6e-170   
ref|XP_011022869.1|  PREDICTED: MATE efflux family protein 5-like       505   6e-170   
ref|XP_006478384.1|  PREDICTED: MATE efflux family protein 5-like...    503   9e-170   
gb|KDO63185.1|  hypothetical protein CISIN_1g011678mg                   504   1e-169   
emb|CBI26941.3|  unnamed protein product                                503   1e-169   
ref|XP_006603046.1|  PREDICTED: MATE efflux family protein DTX1-like    504   1e-169   
ref|XP_006430697.1|  hypothetical protein CICLE_v10011623mg             504   1e-169   
emb|CDP05513.1|  unnamed protein product                                504   2e-169   
ref|XP_003526375.1|  PREDICTED: MATE efflux family protein DTX1-like    503   2e-169   
ref|NP_177270.1|  MATE efflux family protein                            502   5e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497008.1|  PREDICTED: MATE efflux family protein 9-like       502   6e-169   
ref|XP_009606970.1|  PREDICTED: MATE efflux family protein 5-like...    501   1e-168   
ref|XP_009606973.1|  PREDICTED: MATE efflux family protein 7-like       501   1e-168   
ref|XP_011021311.1|  PREDICTED: MATE efflux family protein 6-like...    501   1e-168   
ref|XP_010415814.1|  PREDICTED: MATE efflux family protein 5-like       501   2e-168   
ref|XP_010471122.1|  PREDICTED: MATE efflux family protein 5-like       501   2e-168   
gb|KHN13924.1|  MATE efflux family protein DTX1                         501   2e-168   
gb|AHI48501.1|  multidrug and toxic extrusion transporter               501   2e-168   
ref|XP_002532233.1|  TRANSPARENT TESTA 12 protein, putative             501   2e-168   Ricinus communis
gb|KHN42770.1|  MATE efflux family protein DTX1                         500   4e-168   
ref|XP_010046534.1|  PREDICTED: MATE efflux family protein 8-like       499   4e-168   
ref|XP_010681703.1|  PREDICTED: MATE efflux family protein 6-like       500   5e-168   
emb|CDY67968.1|  BnaAnng25760D                                          500   5e-168   
ref|XP_010427939.1|  PREDICTED: MATE efflux family protein 5-like...    499   6e-168   
ref|XP_009357510.1|  PREDICTED: MATE efflux family protein 5-like       500   6e-168   
ref|XP_009776774.1|  PREDICTED: MATE efflux family protein 5-like...    499   8e-168   
ref|XP_003555117.1|  PREDICTED: MATE efflux family protein 5            500   9e-168   
emb|CAQ51477.1|  putative MATE transporter                              498   1e-167   Nicotiana tabacum [American tobacco]
ref|XP_010317186.1|  PREDICTED: MATE efflux family protein 5-like...    496   1e-167   
ref|XP_003518634.1|  PREDICTED: MATE efflux family protein 5-like       498   1e-167   
gb|ACU24630.1|  unknown                                                 498   2e-167   Glycine max [soybeans]
ref|XP_008389240.1|  PREDICTED: MATE efflux family protein 8-like       498   2e-167   
ref|XP_006494150.1|  PREDICTED: MATE efflux family protein 8-like       498   3e-167   
ref|XP_009127851.1|  PREDICTED: MATE efflux family protein 5-like...    498   4e-167   
ref|XP_003592589.1|  Protein TRANSPARENT TESTA                          498   4e-167   
ref|XP_009127850.1|  PREDICTED: MATE efflux family protein 5-like...    498   4e-167   
ref|XP_009105783.1|  PREDICTED: MATE efflux family protein 5-like       498   5e-167   
ref|XP_010427935.1|  PREDICTED: MATE efflux family protein 5-like...    498   5e-167   
emb|CDX72778.1|  BnaC06g32260D                                          498   6e-167   
ref|XP_008339598.1|  PREDICTED: MATE efflux family protein 5-like       498   6e-167   
ref|XP_010471123.1|  PREDICTED: MATE efflux family protein 5-like       497   6e-167   
ref|XP_002265933.2|  PREDICTED: MATE efflux family protein 5            497   7e-167   Vitis vinifera
ref|XP_008339594.1|  PREDICTED: MATE efflux family protein 5-like       497   7e-167   
ref|XP_004299021.1|  PREDICTED: MATE efflux family protein 9-like       497   8e-167   
ref|XP_007044135.1|  MATE efflux family protein isoform 1               496   1e-166   
ref|XP_010427938.1|  PREDICTED: MATE efflux family protein 5-like       496   1e-166   
ref|XP_007217833.1|  hypothetical protein PRUPE_ppa026002mg             496   1e-166   
ref|XP_011097157.1|  PREDICTED: MATE efflux family protein DTX1-like    496   1e-166   
emb|CDX96304.1|  BnaA07g29150D                                          496   2e-166   
ref|XP_009619851.1|  PREDICTED: MATE efflux family protein 5-like       496   2e-166   
ref|XP_007150880.1|  hypothetical protein PHAVU_004G001900g             496   2e-166   
ref|XP_007139193.1|  hypothetical protein PHAVU_008G009000g             495   2e-166   
gb|KDP34994.1|  hypothetical protein JCGZ_09282                         494   3e-166   
gb|EYU40798.1|  hypothetical protein MIMGU_mgv1a018157mg                494   6e-166   
ref|XP_011097156.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    494   7e-166   
ref|XP_010471119.1|  PREDICTED: MATE efflux family protein 5-like...    494   8e-166   
emb|CAN69572.1|  hypothetical protein VITISV_044050                     494   8e-166   Vitis vinifera
ref|XP_011075977.1|  PREDICTED: MATE efflux family protein 5-like       494   9e-166   
ref|XP_002532229.1|  TRANSPARENT TESTA 12 protein, putative             493   2e-165   Ricinus communis
ref|XP_002532232.1|  TRANSPARENT TESTA 12 protein, putative             493   3e-165   Ricinus communis
ref|XP_008446676.1|  PREDICTED: MATE efflux family protein 7-like       493   3e-165   
ref|XP_006843971.1|  hypothetical protein AMTR_s00006p00119970          491   6e-165   
gb|KHG10126.1|  MATE efflux family protein 9                            492   7e-165   
ref|XP_010415818.1|  PREDICTED: MATE efflux family protein 5-like       493   7e-165   
ref|XP_010427944.1|  PREDICTED: MATE efflux family protein 5-like       492   8e-165   
gb|KHN47243.1|  MATE efflux family protein 7                            491   9e-165   
ref|XP_002280189.2|  PREDICTED: MATE efflux family protein 5            491   1e-164   Vitis vinifera
emb|CDX68324.1|  BnaA07g23640D                                          491   1e-164   
ref|XP_003536654.1|  PREDICTED: MATE efflux family protein 5-like       491   1e-164   
ref|XP_004299022.1|  PREDICTED: MATE efflux family protein 9-like       491   1e-164   
ref|XP_006579797.1|  PREDICTED: MATE efflux family protein 8-like       491   2e-164   
ref|XP_006430703.1|  hypothetical protein CICLE_v10013438mg             490   2e-164   
ref|XP_002528064.1|  TRANSPARENT TESTA 12 protein, putative             490   2e-164   Ricinus communis
ref|XP_004497007.1|  PREDICTED: MATE efflux family protein 5-like       491   2e-164   
ref|XP_008243313.1|  PREDICTED: MATE efflux family protein 9-like       490   2e-164   
ref|XP_010415819.1|  PREDICTED: MATE efflux family protein 5-like...    491   2e-164   
ref|XP_010471124.1|  PREDICTED: MATE efflux family protein 5-like       491   2e-164   
ref|XP_010427932.1|  PREDICTED: MATE efflux family protein 5-like...    491   3e-164   
gb|KEH24739.1|  MATE efflux family protein                              490   3e-164   
ref|XP_006390799.1|  hypothetical protein EUTSA_v10018467mg             490   4e-164   
ref|XP_002887348.1|  predicted protein                                  490   6e-164   
ref|XP_009776773.1|  PREDICTED: MATE efflux family protein 7-like       489   6e-164   
gb|AFK37009.1|  unknown                                                 489   6e-164   
ref|XP_003624403.1|  Protein TRANSPARENT TESTA                          489   8e-164   
ref|XP_011021314.1|  PREDICTED: MATE efflux family protein 7-like       489   8e-164   
ref|XP_003555931.1|  PREDICTED: MATE efflux family protein 5-like       489   9e-164   
ref|XP_002532231.1|  TRANSPARENT TESTA 12 protein, putative             489   1e-163   Ricinus communis
ref|XP_010415815.1|  PREDICTED: MATE efflux family protein 5-like       489   1e-163   
ref|XP_010415810.1|  PREDICTED: MATE efflux family protein 5-like...    489   1e-163   
ref|XP_010427937.1|  PREDICTED: MATE efflux family protein 5-like       488   1e-163   
ref|XP_004300943.1|  PREDICTED: MATE efflux family protein 5-like       488   2e-163   
ref|XP_002528061.1|  TRANSPARENT TESTA 12 protein, putative             487   3e-163   Ricinus communis
ref|XP_004961296.1|  PREDICTED: MATE efflux family protein 5-like...    488   3e-163   
ref|XP_009104925.1|  PREDICTED: MATE efflux family protein 5-like       488   3e-163   
ref|XP_006302179.1|  hypothetical protein CARUB_v10020189mg             488   4e-163   
ref|XP_010415812.1|  PREDICTED: MATE efflux family protein 5-like...    487   4e-163   
ref|XP_006301245.1|  hypothetical protein CARUB_v10021645mg             487   4e-163   
ref|XP_009102405.1|  PREDICTED: MATE efflux family protein 9            486   2e-162   
ref|XP_009394476.1|  PREDICTED: MATE efflux family protein 6-like       486   2e-162   
gb|KHN06720.1|  MATE efflux family protein 7                            484   2e-162   
ref|XP_008229318.1|  PREDICTED: MATE efflux family protein 5            485   2e-162   
gb|KFK41540.1|  hypothetical protein AALP_AA2G142400                    485   2e-162   
ref|XP_009127849.1|  PREDICTED: MATE efflux family protein 6-like...    486   3e-162   
emb|CDY49220.1|  BnaCnng17090D                                          484   5e-162   
ref|XP_006280378.1|  hypothetical protein CARUB_v10026306mg             484   6e-162   
ref|XP_007142994.1|  hypothetical protein PHAVU_007G034700g             484   6e-162   
gb|KEH44143.1|  MATE efflux family protein                              484   7e-162   
ref|XP_010034452.1|  PREDICTED: MATE efflux family protein 5-like       483   1e-161   
ref|XP_006388323.1|  hypothetical protein POPTR_0229s00240g             483   1e-161   
gb|KHN27482.1|  MATE efflux family protein 9                            482   1e-161   
emb|CBI33603.3|  unnamed protein product                                484   2e-161   
ref|XP_007019868.1|  MATE efflux family protein, putative               484   2e-161   
ref|XP_004300942.1|  PREDICTED: MATE efflux family protein 7-like       483   2e-161   
emb|CDY50254.1|  BnaC07g47890D                                          483   3e-161   
ref|XP_006418608.1|  hypothetical protein EUTSA_v10002904mg             483   3e-161   
ref|XP_006420459.1|  hypothetical protein CICLE_v10006745mg             482   3e-161   
ref|XP_011035133.1|  PREDICTED: MATE efflux family protein 9-like       482   3e-161   
emb|CBI26943.3|  unnamed protein product                                481   3e-161   
ref|XP_002305842.2|  hypothetical protein POPTR_0004s09390g             482   3e-161   Populus trichocarpa [western balsam poplar]
ref|XP_007142996.1|  hypothetical protein PHAVU_007G034900g             482   3e-161   
ref|XP_004232019.2|  PREDICTED: MATE efflux family protein DTX1-like    483   4e-161   
gb|KHN19698.1|  MATE efflux family protein 9                            480   7e-161   
gb|AES62852.2|  MATE efflux family protein                              481   7e-161   
ref|XP_006603047.1|  PREDICTED: MATE efflux family protein 8-like       481   1e-160   
ref|XP_003555268.1|  PREDICTED: MATE efflux family protein 7-like...    483   1e-160   
emb|CDP00710.1|  unnamed protein product                                480   2e-160   
ref|XP_009358874.1|  PREDICTED: MATE efflux family protein 5-like       481   2e-160   
ref|NP_001151913.1|  LOC100285550                                       480   3e-160   Zea mays [maize]
gb|KHN13925.1|  MATE efflux family protein 8                            480   3e-160   
ref|XP_006468793.1|  PREDICTED: MATE efflux family protein 9-like       481   3e-160   
ref|XP_006302201.1|  hypothetical protein CARUB_v10020213mg             479   4e-160   
ref|XP_011038709.1|  PREDICTED: MATE efflux family protein 9-like...    476   5e-160   
ref|XP_007142992.1|  hypothetical protein PHAVU_007G034600g             479   7e-160   
ref|XP_009356186.1|  PREDICTED: MATE efflux family protein 9-like       479   9e-160   
gb|KDP34995.1|  hypothetical protein JCGZ_09283                         479   1e-159   
ref|XP_004493054.1|  PREDICTED: MATE efflux family protein 5-like       479   1e-159   
ref|XP_002458328.1|  hypothetical protein SORBIDRAFT_03g031420          479   1e-159   Sorghum bicolor [broomcorn]
gb|KEH24740.1|  MATE efflux family protein                              479   1e-159   
ref|XP_006589654.1|  PREDICTED: MATE efflux family protein 5-like...    478   1e-159   
ref|XP_009764428.1|  PREDICTED: MATE efflux family protein 5-like...    478   1e-159   
ref|NP_001043893.1|  Os01g0684900                                       478   1e-159   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007142990.1|  hypothetical protein PHAVU_007G034500g             478   2e-159   
ref|XP_008358206.1|  PREDICTED: MATE efflux family protein 5-like       478   2e-159   
ref|XP_004969570.1|  PREDICTED: MATE efflux family protein DTX1-like    478   2e-159   
ref|XP_004135071.1|  PREDICTED: MATE efflux family protein 7-like       478   3e-159   
ref|XP_006297538.1|  hypothetical protein CARUB_v10013560mg             476   6e-159   
ref|XP_004162729.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    475   2e-158   
gb|KHN06722.1|  MATE efflux family protein 5                            474   3e-158   
ref|XP_010466975.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    475   3e-158   
ref|XP_006654756.1|  PREDICTED: MATE efflux family protein 9-like       475   4e-158   
ref|XP_002440210.1|  hypothetical protein SORBIDRAFT_09g027830          476   4e-158   Sorghum bicolor [broomcorn]
ref|NP_178499.2|  MATE efflux family protein                            474   4e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488662.1|  PREDICTED: MATE efflux family protein 9-like       474   4e-158   
gb|KEH44144.1|  MATE efflux family protein                              474   6e-158   
ref|XP_010427940.1|  PREDICTED: MATE efflux family protein 5-like...    473   6e-158   
ref|XP_009356182.1|  PREDICTED: MATE efflux family protein 8-like       474   1e-157   
ref|XP_009606968.1|  PREDICTED: MATE efflux family protein 9-like       473   1e-157   
ref|XP_003526583.2|  PREDICTED: MATE efflux family protein 5-like       473   1e-157   
ref|XP_010681702.1|  PREDICTED: MATE efflux family protein 6-like       473   2e-157   
ref|XP_003569578.1|  PREDICTED: MATE efflux family protein 5-like...    473   2e-157   
ref|XP_009615041.1|  PREDICTED: MATE efflux family protein 5-like...    473   2e-157   
ref|XP_010514294.1|  PREDICTED: MATE efflux family protein 9-like...    473   3e-157   
ref|XP_004299024.1|  PREDICTED: MATE efflux family protein 9-like...    472   4e-157   
emb|CDM83923.1|  unnamed protein product                                471   5e-157   
ref|XP_003567938.1|  PREDICTED: MATE efflux family protein 6-like       473   6e-157   
gb|EEC79664.1|  hypothetical protein OsI_20909                          471   1e-156   Oryza sativa Indica Group [Indian rice]
gb|KDP33026.1|  hypothetical protein JCGZ_13057                         470   1e-156   
ref|XP_004981577.1|  PREDICTED: MATE efflux family protein 5-like       471   2e-156   
ref|XP_006344200.1|  PREDICTED: MATE efflux family protein 5-like       470   2e-156   
ref|XP_003567622.1|  PREDICTED: MATE efflux family protein 5-like...    470   3e-156   
emb|CDM83438.1|  unnamed protein product                                469   3e-156   
ref|XP_004238872.1|  PREDICTED: MATE efflux family protein 5 isof...    469   3e-156   
ref|XP_003592601.1|  Protein TRANSPARENT TESTA                          470   4e-156   
dbj|BAJ92554.1|  predicted protein                                      469   6e-156   
ref|XP_006589653.1|  PREDICTED: MATE efflux family protein 5-like       469   6e-156   
gb|EEC71287.1|  hypothetical protein OsI_03300                          468   7e-156   Oryza sativa Indica Group [Indian rice]
ref|XP_010533239.1|  PREDICTED: MATE efflux family protein 5            468   1e-155   
gb|AGL95788.1|  metal/metalloid transporter protein                     469   1e-155   
ref|XP_002885736.1|  mate efflux family protein                         468   1e-155   
ref|XP_006388322.1|  hypothetical protein POPTR_0229s00230g             468   1e-155   
ref|XP_010471121.1|  PREDICTED: MATE efflux family protein 5-like...    467   2e-155   
ref|XP_006482192.1|  PREDICTED: MATE efflux family protein 7-like       468   2e-155   
ref|XP_006360428.1|  PREDICTED: MATE efflux family protein 5-like       467   3e-155   
ref|XP_008446674.1|  PREDICTED: MATE efflux family protein 5-like...    466   6e-155   
ref|XP_004141549.1|  PREDICTED: MATE efflux family protein DTX1-like    465   6e-155   
ref|XP_004489193.1|  PREDICTED: MATE efflux family protein 9-like       466   8e-155   
ref|XP_007216719.1|  hypothetical protein PRUPE_ppa026329mg             465   8e-155   
ref|XP_006470770.1|  PREDICTED: MATE efflux family protein 7-like       465   1e-154   
ref|NP_001043143.1|  Os01g0504500                                       466   2e-154   Oryza sativa Japonica Group [Japonica rice]
emb|CAN69813.1|  hypothetical protein VITISV_043109                     464   2e-154   Vitis vinifera
gb|EEC70721.1|  hypothetical protein OsI_02101                          466   2e-154   Oryza sativa Indica Group [Indian rice]
ref|XP_006344199.1|  PREDICTED: MATE efflux family protein 7-like       463   7e-154   
ref|XP_004299023.1|  PREDICTED: MATE efflux family protein 9-like...    463   2e-153   
ref|XP_010044137.1|  PREDICTED: MATE efflux family protein 7-like       462   2e-153   
ref|XP_006448328.1|  hypothetical protein CICLE_v10015241mg             461   3e-153   
gb|KDO51743.1|  hypothetical protein CISIN_1g015865mg                   459   3e-153   
ref|XP_002885733.1|  mate efflux family protein                         462   3e-153   
ref|XP_004301994.1|  PREDICTED: MATE efflux family protein DTX1-like    461   4e-153   
emb|CDP00709.1|  unnamed protein product                                461   7e-153   
ref|XP_006383381.1|  hypothetical protein POPTR_0005s15040g             461   1e-152   
ref|XP_010415813.1|  PREDICTED: MATE efflux family protein 5-like...    460   1e-152   
emb|CDP00712.1|  unnamed protein product                                459   2e-152   
ref|XP_011021310.1|  PREDICTED: MATE efflux family protein 9-like...    460   2e-152   
ref|XP_004159311.1|  PREDICTED: MATE efflux family protein 8-like       459   4e-152   
tpg|DAA43717.1|  TPA: putative MATE efflux family protein               459   5e-152   
ref|XP_002885735.1|  mate efflux family protein                         458   5e-152   
ref|XP_004156207.1|  PREDICTED: MATE efflux family protein 9-like       458   6e-152   
gb|KDO44957.1|  hypothetical protein CISIN_1g045659mg                   458   6e-152   
ref|XP_008350999.1|  PREDICTED: MATE efflux family protein 9-like       455   9e-152   
ref|NP_178492.1|  MATE efflux family protein                            457   1e-151   
gb|AAD28682.1|  hypothetical protein                                    457   1e-151   
ref|XP_004236983.1|  PREDICTED: MATE efflux family protein 5            457   2e-151   
ref|XP_009394703.1|  PREDICTED: MATE efflux family protein 5-like       456   2e-151   
ref|NP_178497.2|  MATE efflux family protein                            457   3e-151   
ref|XP_009102409.1|  PREDICTED: MATE efflux family protein DTX1         456   3e-151   
ref|XP_006416938.1|  hypothetical protein EUTSA_v10007529mg             456   5e-151   
gb|KHN47245.1|  MATE efflux family protein DTX1                         454   6e-151   
ref|NP_178498.2|  MATE efflux family protein                            456   6e-151   
gb|KDO64768.1|  hypothetical protein CISIN_1g011296mg                   454   6e-151   
ref|XP_009148900.1|  PREDICTED: MATE efflux family protein 7-like       456   6e-151   
ref|XP_010034451.1|  PREDICTED: MATE efflux family protein DTX1-like    456   7e-151   
ref|XP_010524348.1|  PREDICTED: MATE efflux family protein 6-like       456   7e-151   
ref|XP_002890090.1|  mate efflux family protein                         456   7e-151   
ref|XP_008446654.1|  PREDICTED: MATE efflux family protein 8-like...    456   9e-151   
gb|KGN52127.1|  hypothetical protein Csa_5G611090                       455   1e-150   
ref|XP_010514270.1|  PREDICTED: MATE efflux family protein 7            455   2e-150   
gb|KCW86175.1|  hypothetical protein EUGRSUZ_B02867                     454   2e-150   
ref|XP_010554171.1|  PREDICTED: MATE efflux family protein 9-like       455   3e-150   
ref|NP_172967.2|  MATE efflux family protein                            454   4e-150   
gb|EMS68959.1|  MATE efflux family protein 9                            452   6e-150   
gb|KDO64769.1|  hypothetical protein CISIN_1g011296mg                   450   7e-150   
ref|XP_010471125.1|  PREDICTED: MATE efflux family protein 5-like       451   7e-150   
ref|NP_178491.1|  MATE efflux family protein DTX1                       453   8e-150   
ref|XP_010476596.1|  PREDICTED: MATE efflux family protein 5-like...    453   9e-150   
ref|XP_009108186.1|  PREDICTED: MATE efflux family protein 8-like       454   1e-149   
ref|NP_172969.1|  MATE efflux family protein                            453   1e-149   
ref|XP_006468795.1|  PREDICTED: MATE efflux family protein 5-like...    452   1e-149   
ref|XP_011035153.1|  PREDICTED: MATE efflux family protein DTX1-l...    452   1e-149   
ref|XP_010488660.1|  PREDICTED: MATE efflux family protein 5-like...    453   1e-149   
ref|XP_010466974.1|  PREDICTED: MATE efflux family protein 7            452   1e-149   
ref|XP_006448327.1|  hypothetical protein CICLE_v10015035mg             451   1e-149   
ref|XP_010466969.1|  PREDICTED: MATE efflux family protein 5            452   2e-149   
ref|XP_007222152.1|  hypothetical protein PRUPE_ppa005754mg             451   2e-149   
ref|XP_002312424.2|  hypothetical protein POPTR_0008s12540g             449   2e-149   
ref|NP_178496.2|  MATE efflux family protein                            452   2e-149   
ref|XP_004972099.1|  PREDICTED: MATE efflux family protein 5-like       452   2e-149   
ref|XP_002468392.1|  hypothetical protein SORBIDRAFT_01g045100          452   3e-149   
ref|XP_010422678.1|  PREDICTED: MATE efflux family protein 5-like       451   4e-149   
gb|KGN52126.1|  hypothetical protein Csa_5G611080                       451   4e-149   
gb|KDO64764.1|  hypothetical protein CISIN_1g011296mg                   449   7e-149   
ref|XP_011021309.1|  PREDICTED: MATE efflux family protein 5-like...    451   8e-149   
ref|XP_010558566.1|  PREDICTED: MATE efflux family protein 7-like...    451   1e-148   
ref|XP_008350998.1|  PREDICTED: MATE efflux family protein 9-like       447   1e-148   
ref|NP_001140865.1|  uncharacterized protein LOC100272941 precursor     448   2e-148   
gb|EPS64480.1|  hypothetical protein M569_10298                         449   2e-148   
emb|CDX81843.1|  BnaC08g37580D                                          449   2e-148   
ref|XP_002885729.1|  ATDTX1                                             449   4e-148   
ref|XP_010476595.1|  PREDICTED: MATE efflux family protein 7-like...    449   4e-148   
emb|CDY36531.1|  BnaA06g09840D                                          449   5e-148   
ref|XP_002890091.1|  mate efflux family protein                         449   5e-148   
ref|XP_006391434.1|  hypothetical protein EUTSA_v10018422mg             449   5e-148   
ref|XP_010415811.1|  PREDICTED: MATE efflux family protein 5-like...    447   5e-148   
emb|CDX86801.1|  BnaA09g21910D                                          449   7e-148   
ref|XP_010544772.1|  PREDICTED: MATE efflux family protein 8-like...    449   1e-147   
ref|XP_004135383.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    447   1e-147   
ref|XP_009136124.1|  PREDICTED: MATE efflux family protein 5-like       447   2e-147   
ref|XP_010476594.1|  PREDICTED: MATE efflux family protein 5-like...    447   2e-147   
ref|XP_006418613.1|  hypothetical protein EUTSA_v10002512mg             447   2e-147   
emb|CDY13241.1|  BnaC09g24150D                                          447   2e-147   
gb|KHN47244.1|  MATE efflux family protein 9                            446   2e-147   
emb|CDY15087.1|  BnaC03g44480D                                          446   3e-147   
gb|AAD28684.1|  hypothetical protein                                    446   4e-147   
ref|XP_009117648.1|  PREDICTED: MATE efflux family protein 5            446   5e-147   
gb|AAD28683.1|  hypothetical protein                                    445   1e-146   
gb|AAD39644.1|AC007591_9  Strong similarity to gi|4734005 F3L12.7...    445   1e-146   
ref|XP_010459036.1|  PREDICTED: MATE efflux family protein 7-like       444   2e-146   
ref|XP_010683279.1|  PREDICTED: MATE efflux family protein DTX1-like    444   2e-146   
ref|XP_007227658.1|  hypothetical protein PRUPE_ppa015054mg             441   3e-146   
ref|XP_010550263.1|  PREDICTED: MATE efflux family protein 9-like       443   5e-146   
ref|XP_007036669.1|  MATE efflux family protein                         444   6e-146   
ref|XP_010496890.1|  PREDICTED: MATE efflux family protein 5-like       443   7e-146   
ref|XP_006446252.1|  hypothetical protein CICLE_v10018114mg             441   1e-145   
ref|NP_172968.1|  MATE efflux family protein                            442   1e-145   
emb|CDX81701.1|  BnaC08g39000D                                          442   1e-145   
ref|XP_009117843.1|  PREDICTED: MATE efflux family protein 7-like       442   2e-145   
ref|XP_010466967.1|  PREDICTED: MATE efflux family protein DTX1         442   2e-145   
ref|XP_006441649.1|  hypothetical protein CICLE_v10020602mg             438   2e-145   
emb|CDY21736.1|  BnaA09g44870D                                          441   3e-145   
ref|XP_004159310.1|  PREDICTED: MATE efflux family protein 9-like       439   3e-145   
ref|XP_010528507.1|  PREDICTED: MATE efflux family protein 5-like       441   3e-145   
ref|XP_006301721.1|  hypothetical protein CARUB_v10022179mg             442   4e-145   
ref|NP_176850.2|  MATE efflux family protein                            441   4e-145   
gb|KFK41077.1|  hypothetical protein AALP_AA2G082500                    441   4e-145   
ref|XP_008389239.1|  PREDICTED: MATE efflux family protein 5-like...    439   5e-145   
gb|AAD28685.1|  hypothetical protein                                    441   5e-145   
ref|XP_010087833.1|  MATE efflux family protein 6                       441   6e-145   
ref|XP_010514235.1|  PREDICTED: MATE efflux family protein DTX1-like    440   1e-144   
emb|CDP00711.1|  unnamed protein product                                439   2e-144   
ref|XP_010476597.1|  PREDICTED: MATE efflux family protein 5-like       439   3e-144   
gb|KDO62838.1|  hypothetical protein CISIN_1g010345mg                   439   4e-144   
ref|XP_011039092.1|  PREDICTED: MATE efflux family protein 5 isof...    439   4e-144   
gb|KFK41076.1|  hypothetical protein AALP_AA2G082300                    438   4e-144   
ref|XP_004135382.1|  PREDICTED: MATE efflux family protein 9-like       436   5e-144   
ref|XP_002280423.1|  PREDICTED: MATE efflux family protein 6 isof...    438   1e-143   
ref|XP_004235767.1|  PREDICTED: MATE efflux family protein 5            438   1e-143   
ref|XP_006384176.1|  hypothetical protein POPTR_0004s09220g             434   1e-143   
ref|XP_002885730.1|  mate efflux family protein                         437   1e-143   
ref|XP_006490714.1|  PREDICTED: MATE efflux family protein 5-like...    438   2e-143   
ref|XP_006451686.1|  hypothetical protein CICLE_v10008114mg             437   2e-143   
ref|XP_004299560.1|  PREDICTED: MATE efflux family protein 6-like       437   2e-143   
emb|CDY39617.1|  BnaC05g11460D                                          436   4e-143   
ref|XP_010496345.1|  PREDICTED: MATE efflux family protein 9-like       437   4e-143   
gb|EEE64628.1|  hypothetical protein OsJ_19480                          436   4e-143   
gb|AAD39648.1|AC007591_13  Strong similarity to gi|4734005 F3L12....    436   4e-143   
ref|XP_010474270.1|  PREDICTED: MATE efflux family protein 5-like       433   5e-143   
gb|AAD39645.1|AC007591_10  Strong similarity to gi|4734005 F3L12....    436   5e-143   
gb|KHN06719.1|  MATE efflux family protein 7                            434   1e-142   
ref|XP_003560768.1|  PREDICTED: MATE efflux family protein 8            434   1e-142   
gb|AES76567.2|  MATE efflux family protein                              434   2e-142   
ref|NP_849854.1|  MATE efflux family protein                            434   2e-142   
ref|NP_176662.1|  MATE efflux family protein                            434   3e-142   
emb|CBI15521.3|  unnamed protein product                                437   3e-142   
ref|XP_009797187.1|  PREDICTED: MATE efflux family protein 5-like       434   3e-142   
gb|AAK25964.1|AF360254_1  putative MATE efflux family protein           433   4e-142   
ref|XP_002280388.2|  PREDICTED: MATE efflux family protein 6-like       434   4e-142   
ref|XP_010496346.1|  PREDICTED: MATE efflux family protein 9-like       433   7e-142   
ref|XP_006843973.1|  hypothetical protein AMTR_s00006p00126430          433   8e-142   
ref|XP_008374800.1|  PREDICTED: MATE efflux family protein 6-like       433   8e-142   
ref|XP_009383615.1|  PREDICTED: MATE efflux family protein 5-like       433   9e-142   
ref|XP_010470550.1|  PREDICTED: MATE efflux family protein 9-like       432   1e-141   
gb|KCW52095.1|  hypothetical protein EUGRSUZ_J01527                     433   1e-141   
ref|XP_004160426.1|  PREDICTED: MATE efflux family protein 5-like       432   2e-141   
ref|XP_003579577.1|  PREDICTED: MATE efflux family protein 5-like       431   2e-141   
ref|XP_002862675.1|  mate efflux family protein                         431   2e-141   
ref|XP_010415211.1|  PREDICTED: MATE efflux family protein 5-like...    431   3e-141   
ref|XP_010415213.1|  PREDICTED: MATE efflux family protein 5-like...    431   3e-141   
gb|KGN63858.1|  hypothetical protein Csa_1G024900                       432   3e-141   
ref|NP_001274783.1|  uncharacterized protein LOC102604804               431   3e-141   
ref|XP_009110504.1|  PREDICTED: MATE efflux family protein 7-like       431   3e-141   
gb|EEC80663.1|  hypothetical protein OsI_23068                          431   4e-141   
ref|XP_010488657.1|  PREDICTED: MATE efflux family protein DTX1-like    431   4e-141   
ref|XP_006307353.1|  hypothetical protein CARUB_v10008971mg             431   4e-141   
ref|XP_009607555.1|  PREDICTED: MATE efflux family protein 5-like       431   6e-141   
ref|XP_003534150.1|  PREDICTED: MATE efflux family protein 5-like       431   6e-141   
dbj|BAK03656.1|  predicted protein                                      431   6e-141   
ref|XP_010552153.1|  PREDICTED: MATE efflux family protein 5            431   8e-141   
ref|XP_010528510.1|  PREDICTED: MATE efflux family protein 5-like...    429   1e-140   
ref|XP_007211241.1|  hypothetical protein PRUPE_ppa004805mg             429   2e-140   
ref|XP_011084514.1|  PREDICTED: MATE efflux family protein DTX1-l...    429   2e-140   
ref|XP_006844571.1|  hypothetical protein AMTR_s00016p00194610          429   3e-140   
ref|XP_006391429.1|  hypothetical protein EUTSA_v10018475mg             429   3e-140   
ref|XP_006371442.1|  hypothetical protein POPTR_0019s10450g             426   4e-140   
ref|XP_009105231.1|  PREDICTED: MATE efflux family protein 5            427   4e-140   
ref|XP_009764434.1|  PREDICTED: MATE efflux family protein 5-like...    424   9e-140   
ref|NP_001057687.1|  Os06g0494400                                       427   1e-139   
ref|XP_002318533.2|  hypothetical protein POPTR_0012s04810g             427   1e-139   
ref|XP_009119421.1|  PREDICTED: MATE efflux family protein 5-like       427   1e-139   
emb|CDY52017.1|  BnaA08g31300D                                          427   1e-139   
ref|XP_002887075.1|  mate efflux family protein                         427   2e-139   
ref|XP_008389241.1|  PREDICTED: MATE efflux family protein 9-like       423   2e-139   
emb|CDX87974.1|  BnaC03g54220D                                          426   2e-139   
gb|KDO62839.1|  hypothetical protein CISIN_1g010345mg                   427   2e-139   
ref|XP_008453465.1|  PREDICTED: MATE efflux family protein 5-like       427   2e-139   
ref|XP_008240199.1|  PREDICTED: MATE efflux family protein 6-like       427   3e-139   
ref|XP_007152706.1|  hypothetical protein PHAVU_004G152500g             426   4e-139   
gb|KGN63856.1|  hypothetical protein Csa_1G024880                       426   4e-139   
ref|NP_564883.2|  MATE efflux family protein                            425   4e-139   
ref|XP_002979590.1|  hypothetical protein SELMODRAFT_271390             427   4e-139   
ref|XP_002886769.1|  predicted protein                                  426   5e-139   
ref|XP_007036670.1|  MATE efflux family protein                         426   7e-139   
ref|NP_563964.1|  MATE efflux family protein                            425   8e-139   
ref|XP_003532532.1|  PREDICTED: MATE efflux family protein DTX1-like    425   9e-139   
gb|KEH26973.1|  MATE efflux family protein                              424   1e-138   
ref|XP_003620349.1|  hypothetical protein MTR_6g081780                  426   1e-138   
ref|XP_010544770.1|  PREDICTED: MATE efflux family protein 8-like...    427   1e-138   
ref|XP_010320716.1|  PREDICTED: MATE efflux family protein 5 isof...    421   2e-138   
ref|XP_004160427.1|  PREDICTED: MATE efflux family protein 7-like       425   2e-138   
ref|XP_010910116.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    424   2e-138   
ref|XP_006279433.1|  hypothetical protein CARUB_v10007927mg             425   2e-138   
ref|XP_009799149.1|  PREDICTED: MATE efflux family protein 6-like       424   2e-138   
ref|XP_004137332.1|  PREDICTED: MATE efflux family protein 7-like       424   2e-138   
ref|XP_009615043.1|  PREDICTED: MATE efflux family protein 5-like...    420   4e-138   
ref|XP_006307352.1|  hypothetical protein CARUB_v10008971mg             423   5e-138   
gb|AHI48499.1|  multidrug and toxic extrusion transporter               422   6e-138   
emb|CDY12351.1|  BnaA06g19930D                                          423   6e-138   
ref|XP_010251826.1|  PREDICTED: MATE efflux family protein 5-like       422   1e-137   
ref|XP_010279419.1|  PREDICTED: MATE efflux family protein 5-like...    422   1e-137   
gb|KHN42406.1|  MATE efflux family protein 7                            434   1e-137   
ref|XP_003624402.1|  hypothetical protein MTR_7g082800                  419   1e-137   
ref|XP_006299203.1|  hypothetical protein CARUB_v10015349mg             422   1e-137   
ref|XP_006420442.1|  hypothetical protein CICLE_v10006819mg             418   1e-137   
dbj|BAJ34174.1|  unnamed protein product                                420   2e-137   
ref|XP_006430708.1|  hypothetical protein CICLE_v10013864mg             421   3e-137   
ref|XP_010087829.1|  MATE efflux family protein 6                       421   3e-137   
gb|KDO64765.1|  hypothetical protein CISIN_1g011296mg                   418   3e-137   
ref|XP_010232148.1|  PREDICTED: MATE efflux family protein 5-like...    418   5e-137   
gb|EYU26990.1|  hypothetical protein MIMGU_mgv1a008759mg                416   6e-137   
ref|XP_010279441.1|  PREDICTED: MATE efflux family protein 6-like       422   7e-137   
gb|EMT02167.1|  Protein TRANSPARENT TESTA 12                            417   9e-137   
ref|XP_010036921.1|  PREDICTED: MATE efflux family protein 6            420   1e-136   
gb|KDP43814.1|  hypothetical protein JCGZ_23022                         419   2e-136   
ref|XP_006384181.1|  hypothetical protein POPTR_0004s09380g             418   2e-136   
ref|XP_011039093.1|  PREDICTED: MATE efflux family protein 5 isof...    418   2e-136   
gb|EMS50231.1|  MATE efflux family protein 9                            415   3e-136   
ref|XP_009380942.1|  PREDICTED: MATE efflux family protein 5-like...    419   3e-136   
ref|XP_011021313.1|  PREDICTED: MATE efflux family protein 5-like...    416   3e-136   
emb|CDO98390.1|  unnamed protein product                                418   6e-136   
gb|KHN23737.1|  MATE efflux family protein DTX1                         415   7e-136   
ref|XP_008446675.1|  PREDICTED: MATE efflux family protein 5-like...    414   9e-136   
ref|XP_008811783.1|  PREDICTED: MATE efflux family protein 5-like       417   1e-135   
gb|KFK43772.1|  hypothetical protein AALP_AA1G170800                    416   2e-135   
emb|CDP00713.1|  unnamed protein product                                417   2e-135   
gb|AAD39646.1|AC007591_11  Strong similarity to gi|4734005 F3L12....    416   2e-135   
ref|XP_010048671.1|  PREDICTED: MATE efflux family protein 7-like...    417   2e-135   
ref|XP_004965371.1|  PREDICTED: MATE efflux family protein 5-like       416   2e-135   
ref|XP_002890092.1|  mate efflux family protein                         416   2e-135   
ref|XP_008453458.1|  PREDICTED: MATE efflux family protein 5-like...    417   2e-135   
gb|AFK43870.1|  unknown                                                 415   2e-135   
ref|XP_002511323.1|  TRANSPARENT TESTA 12 protein, putative             417   3e-135   
ref|NP_001168616.1|  putative MATE efflux family protein                416   3e-135   
ref|XP_009595541.1|  PREDICTED: MATE efflux family protein 5-like       416   3e-135   
ref|XP_002532228.1|  TRANSPARENT TESTA 12 protein, putative             415   5e-135   
ref|XP_009606971.1|  PREDICTED: MATE efflux family protein 5-like...    412   6e-135   
ref|XP_009380941.1|  PREDICTED: MATE efflux family protein 5-like...    416   6e-135   
emb|CBI15520.3|  unnamed protein product                                432   6e-135   
ref|XP_009615042.1|  PREDICTED: MATE efflux family protein 5-like...    414   7e-135   
ref|XP_004300941.1|  PREDICTED: MATE efflux family protein DTX1-like    415   9e-135   
ref|XP_010048677.1|  PREDICTED: MATE efflux family protein 8-like...    415   1e-134   
ref|XP_004975347.1|  PREDICTED: MATE efflux family protein 5-like       414   1e-134   
ref|XP_007152704.1|  hypothetical protein PHAVU_004G152300g             419   1e-134   



>ref|XP_006357808.1| PREDICTED: MATE efflux family protein 9-like [Solanum tuberosum]
Length=474

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/452 (67%), Positives = 371/452 (82%), Gaps = 0/452 (0%)
 Frame = -2

Query  1543  DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSL  1364
             DVF+ ELKK++ IAIPM+VVTV Q ++  VS MM+GH+SELSLSG A+ATS TNVTGFSL
Sbjct  16    DVFVEELKKVSNIAIPMVVVTVSQHLLRVVSMMMIGHLSELSLSGAAIATSLTNVTGFSL  75

Query  1363  IFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDP  1184
             +FGM+SALETLCGQAYGA +Y KLG YT GAI+SL +V IPIS+LW+F+DKFLI +GQDP
Sbjct  76    LFGMSSALETLCGQAYGAEEYRKLGIYTNGAIISLLLVCIPISVLWLFVDKFLILIGQDP  135

Query  1183  LISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFR  1004
             LIS EAGKYS WLI+A+FPYAILQ L+RYLQ QSLI+PML+SS  +LCFH+P+CWAL F+
Sbjct  136   LISIEAGKYSSWLIAALFPYAILQALIRYLQTQSLILPMLMSSIAALCFHVPLCWALVFK  195

Query  1003  SGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSAS  824
               LGS G A+AIGLSY FNV+LL +YVKYSSSCEK+R+C   +      EFF LAIPSAS
Sbjct  196   LNLGSGGAAIAIGLSYSFNVLLLCLYVKYSSSCEKTRLCFTKEVLPSTKEFFHLAIPSAS  255

Query  823   MACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGA  644
             M CLEWWT EIVILL GLLP PQ+ETSVLSICL++ SLH++IPFSIGAGASTRISNELGA
Sbjct  256   MVCLEWWTSEIVILLAGLLPKPQLETSVLSICLLVSSLHYFIPFSIGAGASTRISNELGA  315

Query  643   GNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLML  464
             GN + ARM+V  VT++GM E +VA+++L+    V+GYAFSNE EVV Y++ M PL+ L++
Sbjct  316   GNPEAARMSVLSVTVLGMAEAIVASIILLCSCHVLGYAFSNEKEVVYYLRDMTPLLCLLI  375

Query  463   VSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLAS  284
              +D I  +LSGVARGSGWQHLGAYVNLG+YYLVG P A +LGF   L+G GLW+GLN  S
Sbjct  376   ATDCIQAVLSGVARGSGWQHLGAYVNLGSYYLVGIPVAILLGFFLHLKGKGLWIGLNAGS  435

Query  283   LVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
             LVQ+++ +LIT  TDW+KQ S A+ER+ +   
Sbjct  436   LVQSLLFSLITCLTDWQKQASIARERIYHSKE  467



>ref|XP_004232021.1| PREDICTED: MATE efflux family protein 9-like isoform X1 [Solanum 
lycopersicum]
Length=474

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/451 (67%), Positives = 367/451 (81%), Gaps = 0/451 (0%)
 Frame = -2

Query  1540  VFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLI  1361
             VF+ ELKK++ IAIPM+VVTV Q ++  VS MM+GH+SELSLSG A+A S TNVTGFSL+
Sbjct  17    VFVEELKKVSYIAIPMVVVTVSQHLLRVVSMMMIGHLSELSLSGAAIAISLTNVTGFSLL  76

Query  1360  FGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPL  1181
             FGM+SALETLCGQAYGA +Y KLG YT GAI+SL VV IP+S+LW+F+DKFLI +GQDPL
Sbjct  77    FGMSSALETLCGQAYGAEEYRKLGIYTNGAIISLLVVCIPVSVLWLFVDKFLILIGQDPL  136

Query  1180  ISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRS  1001
             IS EAGKYS WLI+ +FPYAILQ L+RYLQ QSLI+PML+SS  +LCFH+P+CWAL F+ 
Sbjct  137   ISIEAGKYSSWLIATLFPYAILQALIRYLQTQSLILPMLMSSIAALCFHVPLCWALVFKL  196

Query  1000  GLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASM  821
              LGS G A+AIGLSYWFNV LL +YVKYSSSCEK+R+C   +      EFF LAIPSASM
Sbjct  197   NLGSGGAAIAIGLSYWFNVFLLCLYVKYSSSCEKTRLCFTKEVLPSTKEFFHLAIPSASM  256

Query  820   ACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAG  641
              CLEWWT EIVILL GLLP PQ+ETSVLSICL++ SL+++IPFSIGAGASTRISNELGAG
Sbjct  257   VCLEWWTSEIVILLAGLLPKPQLETSVLSICLLVSSLNYFIPFSIGAGASTRISNELGAG  316

Query  640   NTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLV  461
             N + ARM+V  VT++GM E +VA+++L+    ++GYAFSNE EVVDY++ M PL+ L++ 
Sbjct  317   NPEAARMSVMSVTVLGMAEAIVASIILLCSCRILGYAFSNEKEVVDYLRDMTPLLCLLIA  376

Query  460   SDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASL  281
             +D I  +LSGVARGSGWQHLGAYVNLG+YYLVG P A +LGF   L+G GLW+GLN  SL
Sbjct  377   TDCIQAVLSGVARGSGWQHLGAYVNLGSYYLVGIPVAILLGFFLHLKGKGLWIGLNAGSL  436

Query  280   VQNVVLALITIFTDWKKQESKAQERLLNDSH  188
             VQ+++  LIT  TDW+ Q S A+ER+ +   
Sbjct  437   VQSLLFFLITCLTDWQNQASIARERIFHSKE  467



>ref|XP_010316084.1| PREDICTED: MATE efflux family protein 9-like isoform X2 [Solanum 
lycopersicum]
Length=472

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/451 (66%), Positives = 365/451 (81%), Gaps = 2/451 (0%)
 Frame = -2

Query  1540  VFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLI  1361
             VF+ ELKK++ IAIPM+VVTV Q ++  VS MM+GH+SELSLSG A+A S TNVTGFSL+
Sbjct  17    VFVEELKKVSYIAIPMVVVTVSQHLLRVVSMMMIGHLSELSLSGAAIAISLTNVTGFSLL  76

Query  1360  FGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPL  1181
             FGM+SALETLCGQAYGA +Y KLG YT GAI+SL VV IP+S+LW+F+DKFLI +GQDPL
Sbjct  77    FGMSSALETLCGQAYGAEEYRKLGIYTNGAIISLLVVCIPVSVLWLFVDKFLILIGQDPL  136

Query  1180  ISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRS  1001
             IS EAGKYS WLI+ +FPYAILQ L+RYLQ QSLI+PML+SS  +LCFH+P+CWAL F+ 
Sbjct  137   ISIEAGKYSSWLIATLFPYAILQALIRYLQTQSLILPMLMSSIAALCFHVPLCWALVFKL  196

Query  1000  GLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASM  821
              LGS G A+AIGLSYWFNV LL +YVKYSSSCEK+R+C   +      EFF LAIPSASM
Sbjct  197   NLGSGGAAIAIGLSYWFNVFLLCLYVKYSSSCEKTRLCFTKEVLPSTKEFFHLAIPSASM  256

Query  820   ACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAG  641
              CLEWWT EIVILL GLLP PQ+ETSVLSICL++ SL+++IPFSIGAGA  RISNELGAG
Sbjct  257   VCLEWWTSEIVILLAGLLPKPQLETSVLSICLLVSSLNYFIPFSIGAGA--RISNELGAG  314

Query  640   NTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLV  461
             N + ARM+V  VT++GM E +VA+++L+    ++GYAFSNE EVVDY++ M PL+ L++ 
Sbjct  315   NPEAARMSVMSVTVLGMAEAIVASIILLCSCRILGYAFSNEKEVVDYLRDMTPLLCLLIA  374

Query  460   SDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASL  281
             +D I  +LSGVARGSGWQHLGAYVNLG+YYLVG P A +LGF   L+G GLW+GLN  SL
Sbjct  375   TDCIQAVLSGVARGSGWQHLGAYVNLGSYYLVGIPVAILLGFFLHLKGKGLWIGLNAGSL  434

Query  280   VQNVVLALITIFTDWKKQESKAQERLLNDSH  188
             VQ+++  LIT  TDW+ Q S A+ER+ +   
Sbjct  435   VQSLLFFLITCLTDWQNQASIARERIFHSKE  465



>ref|XP_009796825.1| PREDICTED: MATE efflux family protein 9-like [Nicotiana sylvestris]
Length=469

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/465 (62%), Positives = 367/465 (79%), Gaps = 2/465 (0%)
 Frame = -2

Query  1591  EVPLLSEKRPAAAISK-DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSL  1415
             E  LL EKR     +  +V++  +KK++ I +PML+V + Q +V   S MM+GH+ ELSL
Sbjct  3     EALLLPEKREKLNTTTWNVYIEAMKKVSYITLPMLMVNLSQHLVRIGSMMMIGHLGELSL  62

Query  1414  SGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPIS  1235
             SG +VATS TNVTGFSL+ GMAS LETLCGQAYGA QY+KLG YT GAI+SL +V IPIS
Sbjct  63    SGASVATSLTNVTGFSLVLGMASGLETLCGQAYGAEQYNKLGIYTTGAIISLLMVCIPIS  122

Query  1234  ILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSS  1055
             +LW+F+DK LIF+GQDPLIS EA KYS+WLI+A+FP+AILQ L+RYLQ QSLI+PM+LSS
Sbjct  123   VLWLFVDKILIFMGQDPLISIEAAKYSIWLIAAVFPFAILQALIRYLQTQSLILPMVLSS  182

Query  1054  ALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWND  875
               +LCFH+P+CW L F+  LGS G A+AIGLSYWFNV+LL +YVKYSSSCEK+R+    +
Sbjct  183   FATLCFHVPICWLLIFKLNLGSCGAAVAIGLSYWFNVLLLGLYVKYSSSCEKTRLRFSAE  242

Query  874   SF-ARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
              F A + EFF LAIPSA M CLEWWTFEIVILL GLLP PQ+ETSVLSIC+ + S  ++I
Sbjct  243   EFLASIREFFPLAIPSACMVCLEWWTFEIVILLAGLLPKPQLETSVLSICMSVASTLYFI  302

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
             PFS+GAGASTR+SNELGAGN + A+MA+     I M   ++ + VL   R+++GYAFSNE
Sbjct  303   PFSLGAGASTRVSNELGAGNPEGAKMAIRATLTISMAAAIICSSVLFGCRNILGYAFSNE  362

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
              EVVDY++ M P + +++VSD I  +LSGVARGSGWQHLGAYVNLG++YLVG P A + G
Sbjct  363   KEVVDYLRDMTPFLCVLIVSDCIQAVLSGVARGSGWQHLGAYVNLGSFYLVGIPVAILSG  422

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             F+   +G GLW GLN+ +L+Q+++L+LIT FTDWKKQ SKA+ER+
Sbjct  423   FVLHFQGKGLWFGLNVGNLMQSLLLSLITSFTDWKKQASKARERI  467



>ref|XP_009587574.1| PREDICTED: MATE efflux family protein 9-like [Nicotiana tomentosiformis]
Length=470

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/466 (61%), Positives = 364/466 (78%), Gaps = 3/466 (1%)
 Frame = -2

Query  1591  EVPLLSEKRPA--AAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
             E  LL EKR     A + D +   +KK++ IA+PML+V + Q +V   S MM+GH+ ELS
Sbjct  3     EALLLPEKRTTLKTATTWDTYKEAMKKVSYIALPMLMVNLSQHLVRIGSMMMIGHLGELS  62

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LSG +VATS TNVTGFSL+ GMASALETLCGQAYGA QY+KLG YT GA++SL +V IPI
Sbjct  63    LSGASVATSLTNVTGFSLVLGMASALETLCGQAYGAEQYNKLGIYTTGAMISLLMVCIPI  122

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             SILW+F+DK LIF+GQDPLIS EA KYS+WLI+++FP+ ILQ L+RYLQ QSLI+PM+L+
Sbjct  123   SILWLFVDKILIFMGQDPLISIEAAKYSIWLIASVFPFTILQALIRYLQTQSLILPMVLT  182

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             S  +LCFH+P+CW L F+  LGS G A+AIGLSYW NV+LL +YVKYSSSCEK+R+C  +
Sbjct  183   SVATLCFHVPICWLLIFKLNLGSCGAAVAIGLSYWCNVLLLGLYVKYSSSCEKTRICFSS  242

Query  877   DS-FARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
                 A + EFF LAIPSA M CLEWWTFEIVILL GLLP PQ+ETSVLSIC+ + S  ++
Sbjct  243   QEVLASIREFFPLAIPSACMVCLEWWTFEIVILLAGLLPKPQLETSVLSICMSVASTLYF  302

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IPFS+GAGASTR+SNELGAGN + A++A+     I M   ++ + VL   R+++GYAFSN
Sbjct  303   IPFSLGAGASTRVSNELGAGNPEGAKLAIRATLTISMAAAIICSSVLFCCRNILGYAFSN  362

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E EVVDY++ M P + +++VSD I  +LSGVARGSGWQHLGAYVNLG++YL G P A + 
Sbjct  363   EKEVVDYLRDMTPFLCVLIVSDCIQAVLSGVARGSGWQHLGAYVNLGSFYLAGIPIAILS  422

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             GF+   +G GLW GLN+ +L+Q+++L+LIT FTDWKKQ S A+ER+
Sbjct  423   GFVFHFQGKGLWFGLNVGNLMQSLLLSLITSFTDWKKQASMARERI  468



>ref|XP_004234578.1| PREDICTED: MATE efflux family protein 9-like [Solanum lycopersicum]
Length=470

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/463 (62%), Positives = 360/463 (78%), Gaps = 3/463 (1%)
 Frame = -2

Query  1582  LLSEKRPA--AAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSG  1409
             LL EKR +     +    L  +KK+  IAIPM+VV V Q ++  +S MMLGH+SELSLSG
Sbjct  6     LLPEKRESLKTITTWGSLLEAMKKVCYIAIPMIVVNVTQHLIRVLSMMMLGHLSELSLSG  65

Query  1408  GAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISIL  1229
              +VATS TNVTGFSL+ GMAS LETLCGQAYGA QY KLG YT GAI+SL +V IPISIL
Sbjct  66    ASVATSLTNVTGFSLLVGMASGLETLCGQAYGAKQYKKLGIYTTGAIISLLLVCIPISIL  125

Query  1228  WVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSAL  1049
             W+FMDK LIF+ QDPLIS EAGKYS+WL+ ++FP+AILQ + RYLQ QSLI+PM++SS  
Sbjct  126   WLFMDKILIFMHQDPLISREAGKYSIWLLISLFPFAILQAVTRYLQTQSLILPMVVSSIA  185

Query  1048  SLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDS-  872
             +LCFH+P+CW   F    GS G A AIGLSYWFN+++L +YVKYS SCEK+R+    +  
Sbjct  186   TLCFHVPICWLCVFTLDFGSVGAAFAIGLSYWFNLLILGLYVKYSKSCEKTRLYFSKEEV  245

Query  871   FARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPF  692
              A + EFF LAIPSA M CLEWWTFEIVILL G+LPNPQ+ETSVLSICL+I S H+++PF
Sbjct  246   LASIREFFPLAIPSACMVCLEWWTFEIVILLAGVLPNPQLETSVLSICLLIASTHYFLPF  305

Query  691   SIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETE  512
             S+GAGASTR+SNELGAGN + A+MAV     I M + +++  +    R +VGYAFSNE E
Sbjct  306   SLGAGASTRVSNELGAGNDEAAKMAVRAALTISMADAIISGTLFYCCRHIVGYAFSNEKE  365

Query  511   VVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFL  332
             VVDYI +M P + +++VSD I G+LSGVARGSGWQHLGAYVNLG++YL G P A + GFL
Sbjct  366   VVDYISEMAPFLCILMVSDCIQGVLSGVARGSGWQHLGAYVNLGSFYLAGIPTAIVCGFL  425

Query  331   TSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
               L+G GLW+GLN+ +++Q+++L++IT FTDWKKQ S A+ER+
Sbjct  426   FHLQGKGLWIGLNVGNVLQSLLLSIITSFTDWKKQASIARERI  468



>ref|XP_004233961.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Solanum 
lycopersicum]
Length=492

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/470 (57%), Positives = 354/470 (75%), Gaps = 0/470 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             M  E PL++ ++    +++ VF+ E+K+ +RIA+PM+VVTV Q ++     +MLGH+ EL
Sbjct  1     MTEEEPLVNLEKEDVVVTEKVFIEEVKETSRIALPMIVVTVSQYLLRVSPMIMLGHLGEL  60

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             SLS  ++ATS +NVTG+S++FGM SALETLCGQAYGAGQY KLGT+TY AI+ L +V IP
Sbjct  61    SLSSASIATSLSNVTGYSVLFGMCSALETLCGQAYGAGQYRKLGTFTYSAIICLFLVCIP  120

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             +S+LW+F DK LI  GQDP I+ EAGKY++WLI  +FPYAILQ LVRYLQ QSLI PMLL
Sbjct  121   VSVLWIFTDKLLILTGQDPSIATEAGKYAIWLIPTLFPYAILQSLVRYLQAQSLIQPMLL  180

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             S+ +SLCF + +CWA  F+  LG AG AL+I LSYW NVILL++YVKYSS CEK+R    
Sbjct  181   SAVVSLCFQVTICWAFIFKLNLGIAGAALSISLSYWLNVILLILYVKYSSVCEKTRASFS  240

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              D F   G+FFR AIPSA M CLEWW FE++ILL GL PNP +ETSVLSIC  I ++H++
Sbjct  241   TDFFLTTGDFFRFAIPSAVMVCLEWWAFELIILLSGLFPNPMLETSVLSICFTITTVHYH  300

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+S GA ASTRISNELGAG    A++A+  V ++   E V+A++ L  +R+V GYAFS 
Sbjct  301   IPYSFGAAASTRISNELGAGRPQAAKIALAAVIVLSATEFVLASITLFVVRNVWGYAFSY  360

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E EVV Y+ ++ P++ + ++ DGI  +LSGVARGSGWQH+GAYVNLGAYYLVG PA  +L
Sbjct  361   EKEVVTYVAEITPILCISIIMDGIQAVLSGVARGSGWQHIGAYVNLGAYYLVGIPAVLLL  420

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             GF+  L+G GLW GL   + VQ + L+L+T FT+W+KQ  +A+ R+ ++ 
Sbjct  421   GFVFHLKGKGLWSGLVAGTTVQCISLSLVTGFTNWEKQAIEARRRIFSEK  470



>ref|XP_011099517.1| PREDICTED: MATE efflux family protein 5-like [Sesamum indicum]
Length=465

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/455 (60%), Positives = 349/455 (77%), Gaps = 0/455 (0%)
 Frame = -2

Query  1591  EVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLS  1412
             E  LL  +   +  + +VF+ ELK ++ IA PM+VVTV Q +   VS MM+GH+ EL+LS
Sbjct  2     EEALLHGREKISVSTWEVFVEELKNVSYIAAPMVVVTVSQILSRVVSMMMVGHLGELALS  61

Query  1411  GGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISI  1232
             G AVATS  NVTG S++FGMA ALETLCGQA+GA QY KLG Y+Y +I+ L +V +PIS+
Sbjct  62    GAAVATSLANVTGLSILFGMAGALETLCGQAFGAKQYQKLGVYSYASIICLLLVCLPISL  121

Query  1231  LWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSA  1052
             LW+FMDK LIF+GQDP IS EAG+Y+VWLI A+FPYAILQ LVRYLQ QSLI+PML SS 
Sbjct  122   LWMFMDKLLIFMGQDPSISVEAGRYAVWLIPALFPYAILQSLVRYLQTQSLILPMLWSSV  181

Query  1051  LSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDS  872
              +L FH+PVCWAL F+  LG+AG A  IGLSYWFNV+L++ YVKYSS+C+K+      D 
Sbjct  182   AALLFHVPVCWALVFKLELGTAGAAFTIGLSYWFNVLLILAYVKYSSTCKKTDTPSSKDI  241

Query  871   FARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPF  692
              + + EF RLAIPSA M CLEWW+ EIV+LL GLLPNPQ+ETSVLS+CL++ +LH++IP+
Sbjct  242   LSGMREFSRLAIPSAVMVCLEWWSCEIVVLLSGLLPNPQLETSVLSVCLLVAALHYFIPY  301

Query  691   SIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETE  512
             SIGA ASTR+SNELGAG +  AR +VW   ++ + E +VA  +L+  R+++GYAFSNE E
Sbjct  302   SIGAAASTRVSNELGAGRSVRARASVWAANVLSVAEAIVACTILLRCRNLLGYAFSNEKE  361

Query  511   VVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFL  332
             V D++ +M P V L+L  D I  +LSGVARGSGWQHLGAYVNLGA+YLVG P A +LGF+
Sbjct  362   VADHLGEMTPFVCLLLTMDCIQAVLSGVARGSGWQHLGAYVNLGAFYLVGLPTAVVLGFV  421

Query  331   TSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQ  227
               LRG GLW GLN+ S+ Q+ +L+ +T   +WKKQ
Sbjct  422   LRLRGKGLWFGLNMGSIAQSALLSFVTCSMNWKKQ  456



>ref|XP_009616550.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana tomentosiformis]
Length=484

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/459 (58%), Positives = 355/459 (77%), Gaps = 2/459 (0%)
 Frame = -2

Query  1546  KDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFS  1367
             K VF  E+K+++RIA+PM+VVTV Q ++     +MLGH+ EL LS  ++ATS +NVTGFS
Sbjct  24    KVVFGKEVKEVSRIAMPMIVVTVSQYLLRVSPMIMLGHLGELQLSSASIATSLSNVTGFS  83

Query  1366  LIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQD  1187
             L+FGMASALETLCGQAYGAGQY KLGT+TYGAI+ L +V IP+S+LW+F D+ LI +GQD
Sbjct  84    LLFGMASALETLCGQAYGAGQYRKLGTFTYGAIICLFLVCIPVSVLWIFTDRLLILMGQD  143

Query  1186  PLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSF  1007
             P I+ EAGKY++WLI  +FPYAILQ LVRYLQ QSLI+PMLLS+ +SLCF +P+CW   F
Sbjct  144   PEIATEAGKYTIWLIPTLFPYAILQSLVRYLQAQSLILPMLLSAVVSLCFQVPICWVFIF  203

Query  1006  RSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSA  827
             +  LG+AG A++IGLSYW NVILL++YVKYSS+C ++R     D F  +G+FFR AIPSA
Sbjct  204   KLDLGNAGAAMSIGLSYWLNVILLMLYVKYSSACAETRASFSRDVFLTIGDFFRFAIPSA  263

Query  826   SMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELG  647
              M CLEWW+FE++ILL GLLPNP +ETSVLSIC    S+H++IP+S GA ASTR+SNELG
Sbjct  264   VMVCLEWWSFELIILLSGLLPNPALETSVLSICFTTTSVHYHIPYSFGAAASTRVSNELG  323

Query  646   AGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLM  467
             AG    A++A+  V I+ + E+V+A++ +  +R V GY F+ E EV+ Y+ ++ P++ + 
Sbjct  324   AGRPQAAKVALGAVLILSVTEVVLASISIFVVRHVWGYVFTYEKEVITYVAEITPVLCIS  383

Query  466   LVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLA  287
             ++ DG   +LSGVARGSGWQH+GAYVNLGAYYLVG P A +LGF+  L+G GLW+GL   
Sbjct  384   IIMDGTQAVLSGVARGSGWQHIGAYVNLGAYYLVGIPTALLLGFVLHLKGKGLWIGLVAG  443

Query  286   SLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
             + VQ++ L+LIT  T+W+KQ  +A+ R+   S  PAV+N
Sbjct  444   ATVQSISLSLITGLTNWEKQAIEARHRIF--SGRPAVEN  480



>ref|XP_011099514.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Sesamum 
indicum]
Length=481

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/475 (57%), Positives = 363/475 (76%), Gaps = 3/475 (1%)
 Frame = -2

Query  1600  MDAEVPLL--SEKRPAAAISK-DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHI  1430
             M+AEVPLL  S +   +   +      EL ++  IA+PM+VVT+ Q ++      MLGH+
Sbjct  1     MEAEVPLLTGSNRDSESGFRRWGTISRELNRVNFIALPMIVVTISQYLLRTSPIFMLGHL  60

Query  1429  SELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVV  1250
              ELSLS  ++ATS  NVTGFS++FGMASALETLCGQAYGAGQY ++GT+TYGAI+ L +V
Sbjct  61    DELSLSSASIATSLCNVTGFSVLFGMASALETLCGQAYGAGQYLRVGTFTYGAILCLFLV  120

Query  1249  AIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVP  1070
              IP+S+LW++ +K LIF GQDPLISAEAGK+++WLI  +FPYAILQ LVRYLQ QS+I+P
Sbjct  121   CIPVSLLWIYTEKLLIFFGQDPLISAEAGKFAIWLIPTLFPYAILQSLVRYLQTQSVIIP  180

Query  1069  MLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRV  890
             ML SS +SLCF + +CWA  F+  LG+AG AL+IG+SYW NVILLV+YV+YS++C+K+R 
Sbjct  181   MLWSSLVSLCFQLALCWAFIFKLNLGNAGAALSIGISYWVNVILLVLYVRYSTNCKKTRS  240

Query  889   CLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSL  710
                 D F  + EFF+ AIPSA M CLEWW+FE+VILL G+LPNPQ+ETSVLSICL I SL
Sbjct  241   SFSKDVFVIMREFFQFAIPSAVMVCLEWWSFELVILLSGVLPNPQLETSVLSICLTITSL  300

Query  709   HFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYA  530
             H++IP+S GA AST +SNELGAG    AR+A+  V ++ + E ++A++ +   RS++GYA
Sbjct  301   HYHIPYSFGAAASTLVSNELGAGKPQAARLALCSVLVLSVAEFLIASITIYICRSIMGYA  360

Query  529   FSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAA  350
             FS+E EVV+++++M+P + + ++ D +  +LSGVARGSGWQH+GAYVNLGAYYLVG P A
Sbjct  361   FSDEKEVVNHVQEMVPFLCISIIMDSLQAVLSGVARGSGWQHIGAYVNLGAYYLVGIPVA  420

Query  349   GMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHP  185
              +LGF+  L+G GLW GL   + VQ++ L+LIT  T+W+KQ  +A+ER+  +  P
Sbjct  421   LLLGFVLHLKGEGLWSGLVAGATVQSLSLSLITGLTNWEKQAREARERIFAEKSP  475



>ref|XP_006346989.1| PREDICTED: MATE efflux family protein 9-like [Solanum tuberosum]
Length=511

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/489 (55%), Positives = 358/489 (73%), Gaps = 19/489 (4%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTV---------------CQQM  1466
             M  E PL++ ++   A+++ VF+ E+K+ +RIA+PM+VVTV                 + 
Sbjct  1     MAEEEPLVNLEKEDVAVTEKVFVEEVKETSRIALPMIVVTVRGGATLARGVSSDTPSSEN  60

Query  1465  VIF---VSTM-MLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYH  1298
              ++   VS M MLGH+ ELSLS  ++ATS +NVTG+S++FGM SALETLCGQAYGAGQY 
Sbjct  61    YVYLLRVSPMIMLGHLGELSLSSASIATSLSNVTGYSVLFGMCSALETLCGQAYGAGQYR  120

Query  1297  KLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAI  1118
             KLGT+TY AI+ L +V IP+S+LW+F DK LI +GQDP I+ EAGKY++WLI  +FPYAI
Sbjct  121   KLGTFTYSAIICLFLVCIPVSVLWIFTDKLLILMGQDPSIATEAGKYAIWLIPTLFPYAI  180

Query  1117  LQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVIL  938
             LQ LVRYLQ QSLI+PMLLS+ +SLCF + +CW   F+  LG  G AL+IGLSYW NVIL
Sbjct  181   LQSLVRYLQAQSLILPMLLSAVVSLCFQVTICWVFIFKLNLGIIGAALSIGLSYWLNVIL  240

Query  937   LVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNP  758
             L++YVKYSS CEK+R     D F   G+FFR AIPSA M CLEWW FE++ILL GL PNP
Sbjct  241   LILYVKYSSVCEKTRASFSRDVFLTTGDFFRFAIPSAVMVCLEWWAFELIILLSGLFPNP  300

Query  757   QVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELV  578
              +ETSVLSIC  I ++H++IP+S GA ASTRISNELGAG    A++A+  V ++   E+V
Sbjct  301   MLETSVLSICFTITTVHYHIPYSFGAAASTRISNELGAGRPQAAKIALAAVIVLSATEVV  360

Query  577   VAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLG  398
             +A++ L  +R V GYAFS E EVV Y+ ++ P++ + ++ DG   +LSGVARGSGWQH+G
Sbjct  361   LASITLFVVRDVWGYAFSYENEVVTYVAEITPILCISIIMDGTQAVLSGVARGSGWQHIG  420

Query  397   AYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESK  218
             AYVNLGAYYLVG PA  +LGF+  L+G GLW GL   + VQ++ L+L+T FT+W+KQ  +
Sbjct  421   AYVNLGAYYLVGIPAVLLLGFVLHLKGKGLWSGLVAGTTVQSISLSLVTGFTNWEKQAIE  480

Query  217   AQERLLNDS  191
             A+ R+ ++ 
Sbjct  481   ARRRIFSEK  489



>ref|XP_004233485.1| PREDICTED: MATE efflux family protein 5 [Solanum lycopersicum]
Length=480

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/454 (57%), Positives = 348/454 (77%), Gaps = 0/454 (0%)
 Frame = -2

Query  1552  ISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTG  1373
             +S+ VF+ ELK+ +RIA+PM+VVTV Q ++     +MLGH+ ELSLS  ++ATS  NVTG
Sbjct  18    VSRKVFIEELKEASRIALPMIVVTVSQYLLRVSPMIMLGHLGELSLSSASIATSLCNVTG  77

Query  1372  FSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVG  1193
             +S++FGM+SALETLCGQAYGAGQY KLGT+TY AI+ L +V IP+S+LW+F DK LI +G
Sbjct  78    YSVLFGMSSALETLCGQAYGAGQYRKLGTFTYSAIICLFLVCIPVSVLWIFTDKLLILMG  137

Query  1192  QDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWAL  1013
             QDP I+ EAGKY++WLI  +FPYAILQ +VRYLQ QSLI+PML+++  SLCF + +CWA 
Sbjct  138   QDPSIAKEAGKYAIWLIPTLFPYAILQSVVRYLQAQSLILPMLINAVASLCFQVAICWAF  197

Query  1012  SFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIP  833
              F+  LG  G AL+IGLSYW NVILL++YVKYSS+CEK+R     D F  +G+FFRLAIP
Sbjct  198   IFKLNLGIVGAALSIGLSYWLNVILLMLYVKYSSACEKTRASFSTDVFLTLGDFFRLAIP  257

Query  832   SASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNE  653
             SA M CLEWW+FE++IL  GLLPNP +ETSVLSIC    S+H++IP+S GA ASTR+SNE
Sbjct  258   SAVMVCLEWWSFELIILSSGLLPNPMLETSVLSICFTTTSVHYHIPYSFGAAASTRVSNE  317

Query  652   LGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVS  473
             LGAG    A++A+  V ++   E+V+A++ L  +R+V GY F+ E EV  Y+ ++ P++ 
Sbjct  318   LGAGRPQAAKIALVAVLVLSATEVVLASITLFVVRNVWGYTFTYEKEVATYVAEITPVLC  377

Query  472   LMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLN  293
             + ++ DG   +LSGVARGSGWQH+GAYVNLGAYYLVG PAA  LGF+  L G GLW GL 
Sbjct  378   ISIIMDGTQAVLSGVARGSGWQHIGAYVNLGAYYLVGIPAALFLGFVLHLNGKGLWSGLV  437

Query  292   LASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
               + VQ++ L+++T FT+W+KQ  +A+ R+ ++ 
Sbjct  438   AGATVQSISLSVVTGFTNWEKQAIEARHRIFSEK  471



>ref|XP_006346902.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=480

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/471 (56%), Positives = 353/471 (75%), Gaps = 1/471 (0%)
 Frame = -2

Query  1600  MDAEVPLLSE-KRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             M  E PLL   ++    +S+ VF+ E+K+ +RIA+PM+VVTV Q ++     +MLGH+ E
Sbjct  1     MAMEEPLLVNLEKDDVTVSRKVFIEEVKEASRIALPMIVVTVSQYLLRVSPMIMLGHLGE  60

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             LSLS  ++ATS  NVTG+S++FGM+SALETLCGQAYGA QY K+GT++Y AI+ L +V I
Sbjct  61    LSLSSASIATSLCNVTGYSVLFGMSSALETLCGQAYGARQYRKVGTFSYSAIICLFLVCI  120

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW+F DK LI +GQDP I+ EAGKY++WLI  +FPYAILQ LVRYLQ QSLI+PML
Sbjct  121   PVSVLWIFTDKLLILMGQDPSIATEAGKYAIWLIPTLFPYAILQSLVRYLQAQSLILPML  180

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             L++  SL F + +CWA  F+  LG  G AL+IGLSYW NVI L++YVKYSS+CEK+R   
Sbjct  181   LNAVASLFFQVTICWAFIFKLNLGIVGAALSIGLSYWLNVISLMLYVKYSSACEKTRASF  240

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
               D F  +G+FFRLAIPSA M CLEWW+FE++ILL GLLPNP +ETSVLSIC    S+H+
Sbjct  241   SMDVFLTIGDFFRLAIPSAVMVCLEWWSFELIILLSGLLPNPMLETSVLSICFTTTSVHY  300

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
             +IP+S GA ASTR+SNELGAG    A++A+  V ++   E+V+A++ L  +R V GYAF+
Sbjct  301   HIPYSFGAAASTRVSNELGAGRPQAAKIALVAVIVLSAAEVVLASITLFMVRDVWGYAFT  360

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
              E EV  Y+ ++ P++ + ++ DG   +LSGVARGSGWQH+GAYVNLGAYYLVG P A +
Sbjct  361   YEKEVATYVAEITPILCISIIMDGTQAVLSGVARGSGWQHIGAYVNLGAYYLVGIPTALL  420

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             LGF+  L G GLW GL   + VQ++ L+L+T FT+W+KQ  +A+ R+ ++ 
Sbjct  421   LGFVLHLNGKGLWSGLVAGAAVQSISLSLVTSFTNWEKQAIEARHRIFSEK  471



>emb|CDP02740.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/479 (57%), Positives = 344/479 (72%), Gaps = 6/479 (1%)
 Frame = -2

Query  1612  LLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             LLP  + E     + R   A +   ++ ELK++  IA+PM+V TV Q ++      MLGH
Sbjct  5     LLPYENVE-----DTRSRKAETCKPYVEELKRVNSIALPMIVATVAQYLLRVSPIFMLGH  59

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
             + EL LSG ++ATSF+NVTGFS++FGM+SALETLCGQA+GA QY +LG YTYGAIM L +
Sbjct  60    LGELQLSGVSIATSFSNVTGFSVLFGMSSALETLCGQAFGAEQYQRLGAYTYGAIMGLFM  119

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
             V IPIS+LW+F DK LI  GQDP I+ EAG Y +WLI  +FPY ILQ LVR+LQ QSLI 
Sbjct  120   VCIPISLLWIFTDKLLILTGQDPAIATEAGLYLIWLIPTLFPYVILQSLVRFLQTQSLIF  179

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             PML S+  SLC  +P+CWAL F+  LG+ G AL+IG+SYW NVILL +YVKYS SC+ SR
Sbjct  180   PMLYSTVASLCLQVPLCWALVFKFNLGNTGAALSIGISYWLNVILLGLYVKYSPSCKDSR  239

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
             +    D+   +GEF R AIPSA M CLEWW FE++ILL GL PNPQ+ETSVLSIC  I S
Sbjct  240   LPFSMDALQTMGEFLRFAIPSAVMVCLEWWAFELIILLSGLSPNPQLETSVLSICFTIAS  299

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
             LH++IP+S G  ASTR+SNELGAGN   AR+A+  V ++ + E +VA+  L   R+++GY
Sbjct  300   LHYHIPYSFGTAASTRVSNELGAGNPQAARVALCMVLLVSVSEFLVASTTLFLCRTILGY  359

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             AFS+E EV+ Y+K M PL+ + ++ D   G+LSGVARGSGWQHLGAYVNLGAYYLVG P 
Sbjct  360   AFSDEKEVISYVKDMTPLLCISIMMDSTQGVLSGVARGSGWQHLGAYVNLGAYYLVGVPM  419

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLN-DSHPPA  179
             A +LGF   LRGMGLW GL   + VQ + L+ IT  T+W+KQ  +A+ R+       PA
Sbjct  420   ALILGFALHLRGMGLWGGLLSGATVQTLSLSAITSLTNWEKQSMEARRRIFEGQKEEPA  478



>ref|XP_011099512.1| PREDICTED: MATE efflux family protein 5-like [Sesamum indicum]
Length=477

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/474 (55%), Positives = 360/474 (76%), Gaps = 3/474 (1%)
 Frame = -2

Query  1600  MDAEVPLL--SEKRPAAAISK-DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHI  1430
             M+AEVPLL  S +   +   +      EL ++  IA+PM+VVT+ Q ++      M+GH+
Sbjct  1     MEAEVPLLTGSNRESESGFRRWGTTSRELNRVNYIALPMIVVTISQYLLRTSPIFMVGHL  60

Query  1429  SELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVV  1250
              ELSLS  ++ATSF NVTGFS++FGMASALETLCGQAYGAGQY ++GT+TYGAI+ L +V
Sbjct  61    DELSLSSASIATSFCNVTGFSVLFGMASALETLCGQAYGAGQYPRVGTFTYGAILCLFLV  120

Query  1249  AIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVP  1070
              IP+S+LW++ +K LIFVGQDPLISAEAG++++WLI  +FPYAILQ LVRYLQ QS I+P
Sbjct  121   CIPVSLLWIYTEKLLIFVGQDPLISAEAGRFAIWLIPTLFPYAILQSLVRYLQTQSAIIP  180

Query  1069  MLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRV  890
             ML SS +SLCF + +CWA  F+  LG+AG AL+IG+SYW NVILLV+YVKYS++C+K+R 
Sbjct  181   MLWSSLVSLCFQLALCWAFIFKLNLGNAGAALSIGISYWVNVILLVLYVKYSTNCKKTRS  240

Query  889   CLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSL  710
                 D F  + EFF+ AIPSA M CLEWW+F++VILL G+LPNPQ+ETSVLSIC  I SL
Sbjct  241   LFSKDVFVTMREFFQFAIPSAVMVCLEWWSFQLVILLSGVLPNPQLETSVLSICFTITSL  300

Query  709   HFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYA  530
             H++IP+S GA AST +SNELGAG    AR+A+  V ++ + E ++ ++ +     ++GYA
Sbjct  301   HYHIPYSFGAAASTLVSNELGAGKPQAARLALRAVLVLSVAEFLITSITIFICGGIMGYA  360

Query  529   FSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAA  350
             FS+E EVV+++++M+P + + ++ D +  +LSGVARGSGWQH+GAYVNLGAYYLVG P A
Sbjct  361   FSDEKEVVNHVQEMVPFLCVSIIMDSLQAVLSGVARGSGWQHIGAYVNLGAYYLVGIPVA  420

Query  349   GMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
              +LGF+  L+G GLW GL   + VQ++ L+L+T  T+W+KQ  +A+ER+  ++ 
Sbjct  421   LLLGFVLHLKGEGLWSGLVAGATVQSLSLSLLTGLTNWEKQAREARERIFAENQ  474



>ref|XP_008219099.1| PREDICTED: MATE efflux family protein 7-like [Prunus mume]
Length=465

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/450 (57%), Positives = 340/450 (76%), Gaps = 1/450 (0%)
 Frame = -2

Query  1540  VFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLI  1361
             VFL EL+K++ +A PM+ VTV Q ++  VS MM+GH+ +LSLSG ++ATSFTNVTGFSL+
Sbjct  7     VFLKELRKVSYVAAPMVAVTVMQYLIQVVSVMMVGHVDQLSLSGVSIATSFTNVTGFSLL  66

Query  1360  FGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPL  1181
             FG+  ALETLCGQA+GA QY KLG YTY +I+ L +V +PIS+LW+F DK L  +GQDPL
Sbjct  67    FGLVGALETLCGQAHGAEQYQKLGIYTYTSILCLCLVCVPISLLWIFTDKILQLIGQDPL  126

Query  1180  ISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRS  1001
             IS  A KYS+ LI  +F YA+LQ LVRY Q QSLI+PML SS  +LC H+P+CW L+F+ 
Sbjct  127   ISNVAHKYSLCLIPNLFSYAVLQSLVRYFQTQSLILPMLYSSCAALCLHVPLCWGLTFKL  186

Query  1000  GLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN-DSFARVGEFFRLAIPSAS  824
              LGS G ALAI  SYWFNV+LL  Y+KYS +CEK+R  + + + F  + EFFR A+PSA 
Sbjct  187   KLGSIGAALAISFSYWFNVLLLGFYMKYSVACEKTRAHVLSIEVFLNIKEFFRFAVPSAL  246

Query  823   MACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGA  644
             M CLEWW++E++ILL G+L NP++ETSVLSIC  I  LH++IP++ GA ASTR+SNELGA
Sbjct  247   MVCLEWWSYEVLILLSGILSNPKLETSVLSICFTITYLHYFIPYAFGATASTRVSNELGA  306

Query  643   GNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLML  464
             GN   A++ V  V ++ M+E++V +  L S R ++GYAFS++ E+V+ I  M PL+SL +
Sbjct  307   GNPQAAKVTVCAVMVLAMVEMIVVSTALFSYRHILGYAFSSDKEIVERIADMAPLISLSI  366

Query  463   VSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLAS  284
             V+DG+  +LSGVARG+GWQH+GAYVNLGAYY VG P   +L FL  LR  GLW+GL   S
Sbjct  367   VTDGLQAVLSGVARGTGWQHIGAYVNLGAYYFVGTPVGVVLAFLAHLRAEGLWIGLLTGS  426

Query  283   LVQNVVLALITIFTDWKKQESKAQERLLND  194
              VQ ++LAL T  T+W+KQ S A+ER+ N+
Sbjct  427   AVQALLLALKTSLTNWEKQASIARERITNE  456



>gb|EYU44603.1| hypothetical protein MIMGU_mgv1a005639mg [Erythranthe guttata]
Length=476

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/452 (59%), Positives = 347/452 (77%), Gaps = 1/452 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
             ++++F+ ELKK++ IA PM+VVTV Q +    S MM+GH+ EL LSG AVATSF NVTG 
Sbjct  13    TRELFVEELKKVSYIAAPMVVVTVSQSLSRVASMMMVGHLGELPLSGAAVATSFANVTGL  72

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             S++FGMASALETLCGQA+GA QY K+G YTY +I+ L  V +PIS++W+FMDK LI +GQ
Sbjct  73    SILFGMASALETLCGQAFGAKQYEKIGAYTYASIVCLLFVCLPISLVWIFMDKLLILMGQ  132

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             D  IS EAGKY+VWLI A+FPYAILQ L+RYLQ QSLI PML SS  +L FH+PVCWAL 
Sbjct  133   DSSISIEAGKYAVWLIPALFPYAILQSLIRYLQTQSLIFPMLWSSVAALAFHVPVCWALV  192

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN-DSFARVGEFFRLAIP  833
             F++G G+AG A  IGLSY FNV+LLVVY+KYSS+C+ +    ++ D    + EF   A+P
Sbjct  193   FKAGFGAAGAAFTIGLSYSFNVVLLVVYIKYSSNCKSTNYASFSKDIVPSLREFSCFAVP  252

Query  832   SASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNE  653
             S  M CLEWWT EIV+LL G LPNPQ+ETSVLSICL++ SLH++IP+SIGA ASTR+SNE
Sbjct  253   STVMVCLEWWTCEIVVLLSGFLPNPQLETSVLSICLLVASLHYFIPYSIGAAASTRVSNE  312

Query  652   LGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVS  473
             LGAG  + AR  VW    + + E ++A  +L+S RS +GYAFS E EVVDY+  + P + 
Sbjct  313   LGAGCPERARATVWAANTLSITEAILACTILLSCRSFLGYAFSYEKEVVDYMGAITPFLC  372

Query  472   LMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLN  293
             L++  D I  +LSGVARGSGWQH+GAYVNLGAYY+VG P A +LGF+  LRG GLW+GLN
Sbjct  373   LLIAMDCIQAVLSGVARGSGWQHVGAYVNLGAYYVVGLPTALVLGFVLHLRGTGLWVGLN  432

Query  292   LASLVQNVVLALITIFTDWKKQESKAQERLLN  197
             + S+VQ+++L+++T  T+W KQ + A++RL +
Sbjct  433   MGSIVQSILLSVVTCSTNWTKQATIARQRLFD  464



>emb|CDP02741.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/479 (56%), Positives = 338/479 (71%), Gaps = 6/479 (1%)
 Frame = -2

Query  1612  LLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             LLP  + E     + R     +   ++ ELK++  IA+PM+V TV Q ++      MLGH
Sbjct  5     LLPSENVE-----DTRSRKEATCKPYVEELKRVNSIALPMIVATVGQYLLRVSPIFMLGH  59

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
             + EL LSG ++ATSF+NVTGFS++FGM+SALETLCGQA+GA QY +LG YTYGAI+ L +
Sbjct  60    LGELQLSGVSIATSFSNVTGFSVLFGMSSALETLCGQAFGAEQYQRLGAYTYGAIICLFM  119

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
             V IPIS+LW+F DK LI  GQDP I+ EAG Y +W I  +FPY ILQ LVR+LQ QSLI 
Sbjct  120   VCIPISLLWIFTDKLLILTGQDPAIATEAGIYLIWFIPTLFPYVILQSLVRFLQAQSLIF  179

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             PML S+  SLC  +P+CWAL F+  LG+ G AL+IG+SYW NVILL +YVKYSSSC+ SR
Sbjct  180   PMLYSTVASLCLQVPLCWALVFKFNLGNTGAALSIGISYWLNVILLGLYVKYSSSCKNSR  239

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
             V    D+   +GEF R AIPSA M CLEWW FE++ILL GL  NPQ+ETSVLSIC  I +
Sbjct  240   VPFSMDALQTMGEFLRFAIPSAVMVCLEWWAFELIILLSGLSRNPQLETSVLSICFTITA  299

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
             LH+ IP S  A ASTR+SNELGAGN   AR+A+  V ++ + E +VA+  L   R+++GY
Sbjct  300   LHYQIPASFSAAASTRVSNELGAGNPQAARVALCMVLLVSVSEFLVASTTLFLCRTILGY  359

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             AFS+E EV+ Y+K M PL  + ++ D    +LSGVARGSGWQHLGAYVNLGAYYLVG P 
Sbjct  360   AFSDEKEVISYVKDMTPLFCISIMMDSTQAVLSGVARGSGWQHLGAYVNLGAYYLVGVPT  419

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLN-DSHPPA  179
             A +LGF   LRGMGLW GL   + VQ + L+ IT  T+W+KQ  +A+ R+       PA
Sbjct  420   ALILGFALHLRGMGLWGGLLCGATVQTLSLSAITSLTNWEKQSMEARRRIFEAQKEEPA  478



>ref|XP_006482188.1| PREDICTED: MATE efflux family protein 7-like [Citrus sinensis]
Length=474

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/477 (56%), Positives = 345/477 (72%), Gaps = 4/477 (1%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             MD EV    EKR   AI+   F+ ELKK  RIA PM+ V+V Q ++  VST+M+GH+S+L
Sbjct  1     MDMEVGESQEKR--WAITWGGFMEELKKAGRIAAPMVAVSVLQYLLQVVSTVMVGHLSQL  58

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+ATS TNVTGFSL+ GMA  LETLCGQAYGA Q+ KLG +TY AI+SL +V   
Sbjct  59    ALSSVAIATSLTNVTGFSLLSGMAGGLETLCGQAYGAAQFRKLGVHTYTAIISLILVCPL  118

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             + +LW+FMDK L  +GQDP+IS EA KYS+WLI A+F  AIL+ L RY Q QSLI+PM  
Sbjct  119   VCLLWIFMDKLLPLIGQDPVISHEARKYSMWLIPALFGSAILKPLTRYFQTQSLILPMFA  178

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS L LCFHIP CW L F+  LGS G ALA  LS W NVILL +Y+ YSS+CEK+R  + 
Sbjct  179   SSFLILCFHIPACWTLVFKLELGSMGAALAFSLSTWLNVILLGLYMMYSSACEKTRAPVS  238

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              +SF  +G+FFRLAIPSA M CL+WW+ EI+ILL GLLPNP++ETSVLSICL I +LHF 
Sbjct  239   KESFLAIGQFFRLAIPSAIMVCLKWWSMEILILLSGLLPNPKLETSVLSICLTISTLHFT  298

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP++ G  ASTR+SNELGAGN   AR+AVW  T   ++E V+   +L   R  +GYA++ 
Sbjct  299   IPYAFGVAASTRVSNELGAGNPQAARVAVWAATTYAVVEAVIVGTILFCCRYFLGYAYTK  358

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             +++VV YI  M PL+ L +++D +  + SGVA+G GWQH+G Y+NLGA+YLVG P   ML
Sbjct  359   DSQVVHYIAVMAPLICLSVITDSLQAVFSGVAKGCGWQHIGVYINLGAFYLVGLPVGAML  418

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
             GF+  LRG GLW+G+   S+VQ+ +L+L T FT+WKKQ + A+ R+++     AV N
Sbjct  419   GFVAHLRGKGLWIGIVAGSVVQSSLLSLATTFTNWKKQAAMARMRVVDGCS--AVQN  473



>ref|XP_002314825.2| MATE efflux family protein [Populus trichocarpa]
 gb|EEF00996.2| MATE efflux family protein [Populus trichocarpa]
Length=482

 Score =   531 bits (1368),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 258/466 (55%), Positives = 338/466 (73%), Gaps = 5/466 (1%)
 Frame = -2

Query  1564  PAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFT  1385
             P    +  VF+ E+K+L  IA PM+ V + Q  +  +S MM+GH+ EL+LS  A+A S +
Sbjct  20    PTPTPTWGVFIQEVKRLGYIAGPMVAVILTQYSLQVISMMMVGHLGELALSSAAMALSLS  79

Query  1384  NVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFL  1205
              VTGFSL+ GMASALETLCGQAYGA QY KLGT TY AI  L +V IP+S++W++M K L
Sbjct  80    GVTGFSLMMGMASALETLCGQAYGAKQYKKLGTQTYTAIFCLNLVCIPLSVIWIYMGKIL  139

Query  1204  IFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPV  1025
              F GQDP IS EAGK+ VWL+ A+F YA LQ LVRY Q QS I+PML+SS  +LCFHIP+
Sbjct  140   HFTGQDPAISHEAGKFIVWLVPALFAYATLQPLVRYFQTQSFIMPMLISSCATLCFHIPL  199

Query  1024  CWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFR  845
             CWAL ++SGL + G A+A+G+SYW NVI L +Y+KYSS+C K+RV ++ + F  VGEFFR
Sbjct  200   CWALVYKSGLKNVGSAVAMGISYWLNVIFLGLYIKYSSACAKTRVPIYKELFYGVGEFFR  259

Query  844   LAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTR  665
              AIPSA M CLEWW+FE++ILL G LPNPQ+ETSVLS+CLM  S  + IPF +GA ASTR
Sbjct  260   FAIPSAVMICLEWWSFELLILLSGFLPNPQLETSVLSVCLMTISTLYGIPFGLGAAASTR  319

Query  664   ISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMI  485
             ++NELGAGN   AR+AV+    + + E ++    L + R V GY FSNE EV+DY+  M 
Sbjct  320   VANELGAGNPRAARLAVYAAMFLAVSETIIVTSALFASRRVFGYLFSNEKEVIDYVTTMA  379

Query  484   PLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLW  305
             PLV L ++ D + G+LSGVARG GWQH+GAY+NLGA+YL G PAA +L F  +L GMGLW
Sbjct  380   PLVCLSVIMDSLQGVLSGVARGCGWQHIGAYINLGAFYLCGIPAAALLAFWLNLGGMGLW  439

Query  304   MGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             +G+   +  Q ++L+++T  T+W+KQ   A+ER+  + H    DNG
Sbjct  440   IGIQTGAFTQTILLSIVTSCTNWEKQARMARERIF-EGH----DNG  480



>ref|XP_006478383.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Citrus 
sinensis]
Length=467

 Score =   530 bits (1365),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 254/452 (56%), Positives = 334/452 (74%), Gaps = 1/452 (0%)
 Frame = -2

Query  1540  VFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLI  1361
             V L E+KK++ IA PM+ VTV Q ++  VS +M+GH+ ELSLSG ++ATSFT+VTGFSL+
Sbjct  7     VSLKEIKKVSSIAAPMVAVTVLQYLLQVVSVIMVGHLDELSLSGASIATSFTSVTGFSLL  66

Query  1360  FGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPL  1181
             FGMASALETLCGQAYGA Q+ KLG YT+ +I+SL +V  PIS+LW+F DK LI VGQDP 
Sbjct  67    FGMASALETLCGQAYGAEQFQKLGIYTHCSIISLIIVCFPISLLWIFTDKLLILVGQDPS  126

Query  1180  ISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRS  1001
             IS  A KY+++LI  +F YA+LQ  +R+ Q+QSLI+PML SS L+LCFHIP+CWAL F+ 
Sbjct  127   ISRIAKKYAIFLIPNLFSYAVLQSFIRFFQVQSLILPMLYSSVLTLCFHIPLCWALVFKI  186

Query  1000  GLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASM  821
              LGS G ALA+GLSYWFNV+LL  Y+K SS CEK+R     D F+ + EF R A+PSA M
Sbjct  187   KLGSNGAALAVGLSYWFNVLLLGFYIKCSSECEKTRASFSIDVFSSIKEFIRFAVPSAVM  246

Query  820   ACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAG  641
              C EWW++E++ILL GLLPNP++E SV S+C  I  LH++IP+  G+  STR+SNELGAG
Sbjct  247   VCFEWWSYEVLILLSGLLPNPKLEASVFSLCFTITYLHYFIPYGFGSTVSTRVSNELGAG  306

Query  640   NTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLV  461
             N   A+MAV  + I+   E+V  ++VL+  R ++GYA S+  ++V  +  M+P + L ++
Sbjct  307   NPKAAKMAVCAIIILAAAEMVTVSIVLLFCRHILGYALSSSEDIVHRLADMVPFICLSII  366

Query  460   SDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASL  281
              D +  +LSGVARGSGWQ +GA+VNLGAYYLVG P A +L F+  L+G GL +GL   S 
Sbjct  367   MDSLQAVLSGVARGSGWQKIGAFVNLGAYYLVGIPIAAVLAFVFQLKGKGLLIGLATGSF  426

Query  280   VQNVVLALITIFTDWKKQESKAQERLLN-DSH  188
             VQ  +LAL  +FTDW KQ SKA+ER+   DS 
Sbjct  427   VQAALLALKIVFTDWGKQASKARERIFEGDSQ  458



>ref|XP_011038708.1| PREDICTED: MATE efflux family protein 9-like isoform X1 [Populus 
euphratica]
Length=482

 Score =   530 bits (1364),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 260/476 (55%), Positives = 342/476 (72%), Gaps = 10/476 (2%)
 Frame = -2

Query  1579  LSEKR-----PAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSL  1415
             + EKR     P    +  VF+ E+K+L  IA PM+ V + Q  +  +S MM+GH+ EL+L
Sbjct  10    VDEKRQGIIGPTPTPTWGVFIQEVKRLGYIAGPMVAVILTQYSLQVISMMMVGHLGELAL  69

Query  1414  SGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPIS  1235
             S  A+A S   VTGFSL+ GMASALETLCGQAYGA QY KLGT TY AI  L +V IP+S
Sbjct  70    SSAAMALSLCGVTGFSLMMGMASALETLCGQAYGAKQYKKLGTQTYTAIFCLNLVCIPLS  129

Query  1234  ILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSS  1055
             ++W++M K L F GQDP IS EAGK++VWL+ A+F YA LQ LVRY Q QSLI+PML+SS
Sbjct  130   VIWIYMGKILHFTGQDPAISHEAGKFTVWLVPALFAYATLQPLVRYFQTQSLIMPMLISS  189

Query  1054  ALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWND  875
               +LCFHIP+CWAL ++SGL + G A+A+G+SYW NVI L +Y+KYSS+C K+RV +  +
Sbjct  190   CATLCFHIPLCWALVYKSGLKNVGSAVAMGISYWLNVIFLGLYIKYSSACAKTRVPISKE  249

Query  874   SFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIP  695
              F  VGEFFR AIPSA M CLEWW+FE++ILL G LPNPQ++TSVLS+CLM  S  + IP
Sbjct  250   LFYGVGEFFRFAIPSAVMICLEWWSFELLILLSGFLPNPQLQTSVLSVCLMTISTLYGIP  309

Query  694   FSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNET  515
             F +GA ASTR++NELGAGN   AR+AV+    + + E ++    L + R V GY FSNE 
Sbjct  310   FGLGAAASTRVANELGAGNPRAARLAVYAAMFLAVSETIMVTSALFASRRVFGYIFSNEK  369

Query  514   EVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGF  335
             EV+DY+  M PLV L ++ D + G+LSGVARG GWQH+GAY+NLGA+YL G P A +L F
Sbjct  370   EVIDYVTTMDPLVCLSVIMDSLQGVLSGVARGCGWQHIGAYINLGAFYLCGIPVAALLAF  429

Query  334   LTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
               +L GMGLW+G+ + +  Q ++L+++T  T+W+KQ   A+ER+  + H    DNG
Sbjct  430   WLNLGGMGLWIGIQIGAFTQTILLSIVTSCTNWEKQARMARERIF-EGH----DNG  480



>ref|XP_011038712.1| PREDICTED: MATE efflux family protein 9-like [Populus euphratica]
Length=482

 Score =   528 bits (1359),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 259/476 (54%), Positives = 341/476 (72%), Gaps = 10/476 (2%)
 Frame = -2

Query  1579  LSEKR-----PAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSL  1415
             + EKR     P    +  VF+ E+K+L  IA PM+ V + Q  +  +S MM+GH+ EL+L
Sbjct  10    VDEKRQGIIGPTPTPTWGVFIQEVKRLGYIAGPMVAVILTQYSLQVISMMMVGHLGELAL  69

Query  1414  SGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPIS  1235
             S  A+A S + VTGFS + GMASALETLCGQAYGA QY KLGT TY AI  L +V IP+S
Sbjct  70    SSAAMALSLSGVTGFSPMMGMASALETLCGQAYGAKQYKKLGTQTYTAIFCLNLVCIPLS  129

Query  1234  ILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSS  1055
             ++W++M K L F GQDP IS EAGK++VWL+ A+F YA LQ LVRY Q QS I+PML+SS
Sbjct  130   VIWIYMGKILHFTGQDPAISHEAGKFTVWLVPALFAYATLQPLVRYFQTQSFIMPMLISS  189

Query  1054  ALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWND  875
               +LCFHIP+CWAL ++SGL + G A+A+G+SYW NVI L +Y+KYSS+C K+RV +  +
Sbjct  190   CATLCFHIPLCWALVYKSGLKNVGSAVAMGISYWLNVIFLGLYIKYSSACAKTRVPISKE  249

Query  874   SFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIP  695
              F  VGEFFR AIPSA M CLEWW+FE++ILL G LPNPQ++TSVLS+CLM  S  + IP
Sbjct  250   LFYGVGEFFRFAIPSAVMICLEWWSFELLILLSGFLPNPQLQTSVLSVCLMTISTLYGIP  309

Query  694   FSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNET  515
             F +GA ASTR++NELGAGN   AR+AV+    + + E ++    L + R V GY FSNE 
Sbjct  310   FGLGAAASTRVANELGAGNPRAARLAVYAAMFLAVSETIMVTSALFASRRVFGYIFSNEK  369

Query  514   EVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGF  335
             EV+DY+  M PLV L ++ D + G+LSGVARG GWQH+GAY+NLGA+YL G P A +L F
Sbjct  370   EVIDYVTTMDPLVCLSVIMDSLQGVLSGVARGCGWQHIGAYINLGAFYLCGIPVAALLAF  429

Query  334   LTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
               +L GMGLW+G+ + +  Q +VL+++T  T+W+KQ   A+ER+  + H    DNG
Sbjct  430   WLNLGGMGLWIGIQIGAFTQTIVLSIVTSCTNWEKQARMARERIF-EGH----DNG  480



>gb|EYU41307.1| hypothetical protein MIMGU_mgv1a021573mg [Erythranthe guttata]
Length=471

 Score =   526 bits (1356),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 263/463 (57%), Positives = 339/463 (73%), Gaps = 2/463 (0%)
 Frame = -2

Query  1606  PEMDAEVPLLSEKRPAAAISK--DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             P +   VP   + R     +K  + F+ EL  ++ IA+PM+VV+V Q M+  VS MMLGH
Sbjct  6     PLLLLLVPDNDDAREEKDSTKKWEAFVRELNMVSYIAMPMVVVSVSQYMLRAVSLMMLGH  65

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
             + EL+LSG ++ATS +NVTGFSL+ GMASALETLCGQAYGA QY K+G  TYG+I+ L +
Sbjct  66    LGELALSGASIATSLSNVTGFSLLTGMASALETLCGQAYGARQYEKVGILTYGSIIWLCL  125

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
               +P+S+LW++ +  LI +GQDPLISAEAG +S+WLI ++FPYAILQ LVRYLQ+QSLI 
Sbjct  126   ACLPVSLLWIYTENILILLGQDPLISAEAGNFSIWLIPSLFPYAILQSLVRYLQIQSLIF  185

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             PML+SS  SLC H+P+ W   F+  LG+AG ALAIG SYW NVI+LV+YVKYSS+C+K+R
Sbjct  186   PMLVSSLASLCIHVPLSWVFIFKLNLGNAGAALAIGFSYWSNVIMLVLYVKYSSTCKKTR  245

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
                  D F  +G FF+ AIPSA M CLEWWT+EI+ILLGGLLPNP +ETSVLSICL I +
Sbjct  246   AKFSRDLFLTMGIFFQYAIPSAVMICLEWWTYEIIILLGGLLPNPGLETSVLSICLTITT  305

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
             +HF +P+S GA ASTRISNELGAG    AR+ +  V  + M+ELV+A  V+   R+++GY
Sbjct  306   MHFLVPYSFGAAASTRISNELGAGKPQSARVVLSAVMFLAMVELVIAVTVIFFCRNILGY  365

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             +FSNE  V  Y+K+M P + L +  D I   LSGV RG GWQ +GAYVNLGAYY+VG P 
Sbjct  366   SFSNEKNVAYYVKEMTPFLCLSIGMDCIVAALSGVVRGGGWQRMGAYVNLGAYYIVGIPI  425

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQE  224
             A +LGF+  L+G GLW GL     VQ ++L  IT  T+W++QE
Sbjct  426   ALVLGFVLHLKGEGLWAGLVAGGTVQAILLGFITSRTNWEEQE  468



>ref|XP_010068722.1| PREDICTED: MATE efflux family protein 7-like [Eucalyptus grandis]
Length=509

 Score =   528 bits (1359),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 251/453 (55%), Positives = 335/453 (74%), Gaps = 0/453 (0%)
 Frame = -2

Query  1546  KDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFS  1367
             +  F  E+K++ ++A P++VV++ Q ++  +S MM+GH+ ELSLS  ++A S   V+GFS
Sbjct  50    RREFCEEVKRVGQVAGPLVVVSLLQFLLQVISVMMVGHLGELSLSSTSIAVSLAGVSGFS  109

Query  1366  LIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQD  1187
             L+ GMASALETLCGQAYGA QYHKLGT TY AI SL +V  PIS+LW++M K L F+GQD
Sbjct  110   LLLGMASALETLCGQAYGAQQYHKLGTQTYTAIFSLILVCFPISVLWIYMGKVLAFIGQD  169

Query  1186  PLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSF  1007
              LIS EAGK++ WL+ A+F YA LQ L+RY Q QSLI+PML+SS  +LC H+P+CW L F
Sbjct  170   RLISLEAGKFTAWLVPALFAYATLQPLIRYFQTQSLIMPMLVSSCATLCIHVPLCWVLVF  229

Query  1006  RSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSA  827
             RSGL + G ALAI +SYW NV+ L VY+KYS SC K+RV +  + F  +GEFFR A+PSA
Sbjct  230   RSGLDNLGAALAISVSYWLNVVFLGVYMKYSPSCTKTRVPVSMELFQGIGEFFRYAVPSA  289

Query  826   SMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELG  647
              M CLEWW+FE+++LL G+LPNPQ+ETSVLS+CL   +  + IP+ +GA  STR+SNELG
Sbjct  290   VMVCLEWWSFELLVLLSGILPNPQLETSVLSVCLNTIATLYMIPYGLGAAGSTRVSNELG  349

Query  646   AGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLM  467
             AGN + AR++V+    + + E ++ + +L   R V GY FSNE EVVDY+ KM PLV L 
Sbjct  350   AGNPEAARLSVYATLFLTITETIIVSTILFISRRVFGYTFSNEEEVVDYVTKMAPLVCLS  409

Query  466   LVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLA  287
             ++ D + G+L+G+ARG GWQH+GA+VNLG++YL G P A +LGF   L GMGLWMG+   
Sbjct  410   VILDSLLGVLTGIARGCGWQHIGAFVNLGSFYLCGIPVAVILGFWVKLGGMGLWMGIQTG  469

Query  286   SLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
             SLVQ V+L ++T  TDW+ Q SKA+ER+    H
Sbjct  470   SLVQAVLLFIVTSCTDWEVQASKARERVFEGRH  502



>ref|XP_009776776.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana sylvestris]
Length=470

 Score =   525 bits (1353),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 261/468 (56%), Positives = 338/468 (72%), Gaps = 1/468 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             M  E+P  S K     I+ D    ELKK +RI  PM+ VTV Q ++ FVS +M+GH+ +L
Sbjct  1     MADELPQ-SWKEKKWQINWDAVSQELKKTSRIMAPMVAVTVFQYLLQFVSIVMVGHLGQL  59

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+ATS TNVTGFSL+ G+   LETLCGQAYGA QYHKL TYTY AI+SL +V IP
Sbjct  60    ALSSVAIATSLTNVTGFSLLSGLVGGLETLCGQAYGAQQYHKLSTYTYTAIISLFLVCIP  119

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             I +LW FMDK LI +GQD  IS EA KYS+W+I A+F  AI + LVRY+Q QSLI+PMLL
Sbjct  120   ICVLWFFMDKLLILIGQDHSISVEAQKYSMWVIPALFGGAISKPLVRYMQTQSLILPMLL  179

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS   LCFH+P+ WA  F+  LG+ G A+A  +S W  V+ L  YVKYSSSCEK+R    
Sbjct  180   SSFAVLCFHLPISWAFIFKLKLGNIGAAIAFSVSSWLYVLFLAFYVKYSSSCEKTRAPFS  239

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              D+F  +G+FFRLA+PSA M CL+WW+ E++ LL GLLPNP +ETSV+SICL I +LHF 
Sbjct  240   MDAFLGIGQFFRLAVPSAVMVCLKWWSLEVLTLLSGLLPNPTLETSVMSICLTISTLHFT  299

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+  GA ASTRISNELGAGN   AR+AV  V  + +IE VV +  L   R V+G AFSN
Sbjct  300   IPYGFGAAASTRISNELGAGNPQKARLAVQLVMFLAVIETVVLSTSLFGSRRVLGKAFSN  359

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             + +V+DYI +M P + L +++D +  ++SG+ARGSGWQH+GAY+NLGA+YLV  P A +L
Sbjct  360   DKQVLDYIAEMTPFLCLSIITDSLQAVISGIARGSGWQHIGAYINLGAFYLVAIPLAVVL  419

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLN  197
             GF+  L+  GLW+G+   S VQ ++L+++T FTDWKKQ  KA+ER+ +
Sbjct  420   GFVLHLKAKGLWIGIVAGSTVQTIILSIVTSFTDWKKQAKKARERIHD  467



>ref|XP_009606969.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana tomentosiformis]
Length=470

 Score =   524 bits (1350),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 261/466 (56%), Positives = 338/466 (73%), Gaps = 1/466 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             M  E+P  S K     I+ D    ELKK +RI  PM+ VTV Q ++ FVS +M+GH+ +L
Sbjct  1     MTEELPQ-SLKEKKWQINWDAVSQELKKTSRIMAPMVAVTVLQYLLQFVSVVMVGHLGQL  59

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+ATS TNVTGFSL+ G+   LETLCGQAYGA QYHKL TYTY AI+SL +V IP
Sbjct  60    ALSSVAIATSLTNVTGFSLLSGLVGGLETLCGQAYGAQQYHKLSTYTYTAIISLFLVCIP  119

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             I +LW FMDK LI +GQD  IS EA KYS+W+I A+F  AI + LVRY+Q QSLI+PMLL
Sbjct  120   ICVLWFFMDKLLILMGQDHSISVEAQKYSMWVIPALFGGAISKPLVRYMQTQSLILPMLL  179

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS   LCFH+P+ WAL F+   G+ G A+A  +S W  V+ L  YVKYSSSCEK+R    
Sbjct  180   SSFGVLCFHLPISWALIFKLERGNIGAAIAFSISSWLYVLFLAFYVKYSSSCEKTRAPFS  239

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              D+F  +G+FFRLA+PSA M CL+WW+ E++ LL GLLPNP +ETSV+SICL I +LHF 
Sbjct  240   MDAFLGIGQFFRLAVPSAVMVCLKWWSLEVLTLLSGLLPNPTLETSVMSICLTISTLHFT  299

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+  GA ASTRISNELGAGN   AR+AV  V  + +IE VV +  L   R V+G AFSN
Sbjct  300   IPYGFGAAASTRISNELGAGNPQKARLAVQLVMFLAVIETVVLSTSLFGSRRVLGKAFSN  359

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             + +VVDYI +M P + L +++D +  ++SG+ARGSGWQH+GAY+NLGA+YLV  P A +L
Sbjct  360   DKQVVDYIAEMTPFLCLSIITDSLQAVISGIARGSGWQHIGAYINLGAFYLVAIPLAVVL  419

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             GF+  L+  GLW+G+ + S VQ ++L+++T FTDW+KQ  KA+ER+
Sbjct  420   GFVLHLKAKGLWIGIVVGSTVQTIILSIVTSFTDWEKQAKKARERI  465



>gb|KDP34996.1| hypothetical protein JCGZ_09284 [Jatropha curcas]
Length=480

 Score =   523 bits (1347),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 258/469 (55%), Positives = 344/469 (73%), Gaps = 1/469 (0%)
 Frame = -2

Query  1597  DAEVPLLSEKR-PAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             + E  LLS+K+    A++ DVFL E KKL  IA PM+VVT+  Q++  +S MM+GH+ EL
Sbjct  10    EVEETLLSKKKGEGLALTWDVFLQEGKKLGYIAAPMVVVTLSLQLINVISMMMVGHLGEL  69

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+A SF+ VTGFSLI GMASALETLCGQAYGA QY KLG  TY AI SL +VA+ 
Sbjct  70    ALSSSAMAISFSIVTGFSLISGMASALETLCGQAYGAEQYRKLGNQTYSAIFSLILVAVA  129

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             +SILW  M+KFLI +GQDPLI+ EAGK+  WL+ A+F YAI Q L RY Q QSLI+PM++
Sbjct  130   VSILWFNMEKFLILIGQDPLIAYEAGKFIRWLVPALFAYAIFQSLNRYYQTQSLIIPMVI  189

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS +++ FHIP+CW+L F+ GL + G AL+I +S W NVI LV Y+KYSS+C K+RV + 
Sbjct  190   SSCVTISFHIPLCWSLVFKLGLRNLGGALSISISNWLNVIFLVFYMKYSSACAKTRVPIS  249

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              + F  VGEFFR AIPSA M CL+WW++E VILL GLLPNPQ+ETSVLS+CL+     + 
Sbjct  250   LELFQEVGEFFRFAIPSAIMICLQWWSYECVILLSGLLPNPQLETSVLSVCLLTIGTLYT  309

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+ + A  STR+SNELGA N   AR++V+    I +IEL++ +  L + + + GY FS+
Sbjct  310   IPYGLSAAVSTRVSNELGASNPQAARISVYSAMSITVIELILVSGTLFASKHIFGYIFSS  369

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E EVVD +  + PLV L ++ DG   +LSGVARG GWQH+GAYVNL A YL G PAA +L
Sbjct  370   EVEVVDSVSTIAPLVCLTVIIDGFQTVLSGVARGCGWQHIGAYVNLAALYLCGVPAAAIL  429

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             GF   LRG GLW+G+ + +++Q ++L+++T +T+W+KQ  KA+ER+  +
Sbjct  430   GFWLQLRGRGLWIGIQIGAILQTILLSVVTCYTNWEKQVIKARERIFQE  478



>ref|XP_009335493.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=465

 Score =   521 bits (1343),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 262/459 (57%), Positives = 336/459 (73%), Gaps = 2/459 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             FL ELKK++ +A PM+ V V Q ++  VS MM+GH+ +LSLSG ++ATSFT+VTGFSL+F
Sbjct  8     FLKELKKVSYMAAPMVAVMVMQYLIQVVSVMMVGHVDQLSLSGVSIATSFTSVTGFSLLF  67

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             G+A ALETLCGQAYGA QY KLG +TY +I+ L +V +PIS+LWVF DK L  +GQDP I
Sbjct  68    GLAGALETLCGQAYGAQQYQKLGIHTYTSILCLCLVCLPISLLWVFTDKLLNLIGQDPSI  127

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S  A KYSV LI  +F YAILQ L+RY Q QSLI+PML SS  +LC HIP+CWA + +  
Sbjct  128   SKVAHKYSVCLIPNLFSYAILQSLIRYFQTQSLILPMLYSSGATLCLHIPLCWAFTLKLN  187

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFAR-VGEFFRLAIPSASM  821
             LGS G ALAI  SYWFNVI+L  Y+KYS +CEK+R  + +    R V EFF  A PSA+M
Sbjct  188   LGSVGAALAITFSYWFNVIVLGFYMKYSVACEKTRARVLSVEVIRNVKEFFCFATPSAAM  247

Query  820   ACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAG  641
             ACLEWW++E++ILL GLL NP++E SVLSIC  I  LH+YIP++ GA ASTR+SNELGAG
Sbjct  248   ACLEWWSYEVLILLSGLLANPKLEASVLSICFTITYLHYYIPYAFGATASTRVSNELGAG  307

Query  640   NTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLV  461
             N   A++ V  +T++ + E++V +  L S R  +GYAFS + EVV+ I  M  L+SL +V
Sbjct  308   NPRAAKVTVCAITVLAIAEMIVVSTTLFSYRHNLGYAFSKDKEVVERIADMGLLISLSIV  367

Query  460   SDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASL  281
              DG+  LLSGVARG+GWQ +GAYVNLGAYYLVG P   +L F+  LR  GLW+GL   S 
Sbjct  368   MDGLQALLSGVARGTGWQEIGAYVNLGAYYLVGTPVGVVLAFVVHLRAKGLWIGLLTGST  427

Query  280   VQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNGG  164
             VQ ++LAL T  T+W+KQ S A+ER+L +   P V++ G
Sbjct  428   VQALLLALKTGLTNWQKQASLARERMLKEV-VPIVESAG  465



>ref|XP_008800923.1| PREDICTED: MATE efflux family protein 5-like [Phoenix dactylifera]
Length=495

 Score =   523 bits (1346),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 244/457 (53%), Positives = 345/457 (75%), Gaps = 2/457 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F  E +++  +A PM+ VT+ Q +V  +S+MM+GH+ EL+LS  A+ATS T VTGFSL+ 
Sbjct  39    FKEEGRRMGYVAAPMVAVTLSQYLVQVISSMMVGHLGELALSSSAIATSLTGVTGFSLLL  98

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             GMAS LETLCGQAYGA QYHKL  +TY AI+SL VV IPIS++W  M+K L+F GQDPLI
Sbjct  99    GMASGLETLCGQAYGAQQYHKLAIHTYRAILSLVVVCIPISLIWASMEKILLFTGQDPLI  158

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAGKY+VW+I ++F YA  Q L+++LQ QSLI+PMLLSS  +LC HIP+CW + F+SG
Sbjct  159   SLEAGKYAVWMIPSLFAYATAQALMKFLQSQSLILPMLLSSMTTLCLHIPLCWVMVFKSG  218

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             LG+ G AL+I +SYW NV +LV+Y+KYS+SC+ +R  +  + F  + EF +LA+PSA M 
Sbjct  219   LGNVGAALSISISYWLNVFMLVLYIKYSASCKSTRSPISKECFRGINEFLKLALPSAVMI  278

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW++E+++LL GL PNP++ETSVLSICL   S+ + IP+ +GA ASTR+SNELGAGN
Sbjct  279   CLEWWSYELLVLLSGLFPNPELETSVLSICLTSISMLYTIPYGLGAAASTRVSNELGAGN  338

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
                AR+AV  V  + + E ++ +  + +LR ++GYA+SNE EV+ Y+++M+PLV + ++ 
Sbjct  339   PQRARLAVRVVMFLAVTEAILVSGTVFALRRILGYAYSNEEEVISYVREMVPLVCVSVIM  398

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D + G+LSG+ARG GWQH+GAYVNLG++YL+G P A  LGF   + G GLW+G+   +  
Sbjct  399   DSLQGVLSGIARGCGWQHIGAYVNLGSFYLIGIPVAVTLGFPLHIGGKGLWIGILCGATT  458

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             Q+++L+LIT FT+W++Q + A++RL  +  P  ++NG
Sbjct  459   QSILLSLITGFTNWQQQVNMARKRLFEERLP--LENG  493



>gb|EYU41309.1| hypothetical protein MIMGU_mgv1a019425mg [Erythranthe guttata]
Length=468

 Score =   521 bits (1343),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 244/453 (54%), Positives = 337/453 (74%), Gaps = 0/453 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
              +  F+ ELK +  IA PM+ V+V Q ++ FVS +M+GH+ +L+LS  A+ATS TNVTGF
Sbjct  16    KRSDFVQELKSVCCIAAPMVAVSVLQYLIQFVSVVMVGHLGQLTLSSVAIATSLTNVTGF  75

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             SL+ G+   LETLCGQ YGA QYHKLG YTY A+ SL +V IP+ + W FM+K L+ +GQ
Sbjct  76    SLLSGLVGGLETLCGQVYGAKQYHKLGIYTYSAVFSLLLVCIPVCVTWFFMEKLLVLIGQ  135

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DPL+S EA KY++ LI A+F  AI + LVR+LQ QSL  PML+SS + LCFH+P+ WAL 
Sbjct  136   DPLVSFEAQKYALKLIPALFGAAISKPLVRFLQTQSLTFPMLISSLVVLCFHVPMSWALV  195

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             +R  LGS G A+AI +S W  V++L +Y+++S+SC+ SR+    +SF  +GEFFRLA+PS
Sbjct  196   YRLNLGSGGAAIAICVSNWLYVLVLALYIRFSASCKNSRLAFSVESFFAMGEFFRLAVPS  255

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             A M CL+WW+ E+++L+ GLLPNPQ+ETSVLSICL I +LHF IP+ +GA ASTR+SNEL
Sbjct  256   AVMVCLKWWSLEVLVLVSGLLPNPQLETSVLSICLTISTLHFTIPYGLGAAASTRVSNEL  315

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN D AR+AVW V  + + E +  +++L   R + G AFSNE +VV YI  M PL+ +
Sbjct  316   GAGNPDKARVAVWAVMFLAVTETITISILLFCFRHITGRAFSNEKQVVKYIALMTPLICV  375

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
               ++D +  ++SG+ARGSGWQH+GAYVNLGA+YLVG P A +LGF+  L+  G W+G+ +
Sbjct  376   STITDSLQAVISGIARGSGWQHIGAYVNLGAFYLVGIPIALVLGFIEELKAKGFWIGIVI  435

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              S +Q+ VL++IT FTDW+KQ +KA+ER+  ++
Sbjct  436   GSALQSTVLSIITGFTDWQKQATKARERMKEET  468



>ref|XP_004299020.1| PREDICTED: MATE efflux family protein 9-like [Fragaria vesca 
subsp. vesca]
Length=485

 Score =   521 bits (1341),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 258/482 (54%), Positives = 336/482 (70%), Gaps = 5/482 (1%)
 Frame = -2

Query  1612  LLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             LLP    +V    +++ + +++   FL E+K+L  IA PM+VV + Q +V  VSTMM+GH
Sbjct  6     LLPRGKDQV---EQRKGSTSLTWFSFLEEVKRLGCIAGPMVVVVLSQYLVQVVSTMMVGH  62

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
             + EL+LS  A+ATS   VT FSL+ GMASALETLCGQAYGA QY KLG  TY AI SL +
Sbjct  63    LGELALSSTAIATSLATVTAFSLLLGMASALETLCGQAYGAEQYQKLGLQTYTAIFSLNL  122

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
             V +PIS +W +++  LIF+GQDP IS EAGK+ +WLI A+F YA LQ L RY Q QSLI+
Sbjct  123   VCLPISFIWFYVEDLLIFMGQDPSISHEAGKFIIWLIPALFAYATLQPLNRYFQTQSLIL  182

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             PML+SS  +L FHIP+CW L F+SGL + G ALA+ +SYW N I L +Y+K+SS+C K+R
Sbjct  183   PMLMSSCAALLFHIPICWVLVFKSGLDNIGGALAMSISYWLNAIFLGLYMKFSSTCSKTR  242

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
               +  + F  +GEFFR A+PSA M CLEWW+FE++ILL GLLPNP +ETS+LS+CL   S
Sbjct  243   APISKEVFQGIGEFFRFAVPSAVMICLEWWSFEVLILLCGLLPNPALETSLLSVCLQTIS  302

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
               + IP+  GA ASTR+SNELGAGN + AR+A      +   E  + A  L   R + GY
Sbjct  303   TLYSIPYGFGAAASTRVSNELGAGNPEGARIATCAAMFLAAAETSIVATTLFCCRYIFGY  362

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
              FSNE EVVDY+  M PLV L ++ D   G+LSG+ARG GWQH+GAY+NLGA+YL G P 
Sbjct  363   LFSNEEEVVDYVSTMAPLVCLSVILDSFQGVLSGIARGCGWQHIGAYINLGAFYLCGIPV  422

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVD  173
             A  LGF   LRG GLW+G+ + + VQ  +LA +T  T+W+KQ S A+ER+   + P  VD
Sbjct  423   AATLGFWLQLRGKGLWIGIQVGAFVQVTLLAFVTTCTNWEKQSSTARERIFEGNTP--VD  480

Query  172   NG  167
              G
Sbjct  481   KG  482



>ref|XP_010279418.1| PREDICTED: MATE efflux family protein 5-like [Nelumbo nucifera]
Length=478

 Score =   520 bits (1338),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 269/477 (56%), Positives = 356/477 (75%), Gaps = 4/477 (1%)
 Frame = -2

Query  1591  EVPLLSEKR--PAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
             E  LL+++R      +   VF+ E+K++  IA PM+ VTV Q ++  +S MM+GH+ EL+
Sbjct  2     EEGLLAKERGDRGEVLRWGVFVEEVKRVGFIAGPMVAVTVSQYLLQVISVMMVGHLGELA  61

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LS  A+A+S T VTGFSL+ GMASALETLCGQAYGA QY KLG++TYGAI+SL +V +P+
Sbjct  62    LSSAAIASSLTGVTGFSLLLGMASALETLCGQAYGAQQYRKLGSHTYGAILSLNLVCVPL  121

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             S++WV M K L  +GQDP IS EAGKY++WLI A+F YA LQ L+RY Q QS+++PMLLS
Sbjct  122   SLIWVSMGKLLSLIGQDPAISREAGKYTIWLIPALFAYATLQPLIRYFQAQSMLLPMLLS  181

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             S ++L  HIP+CW L FRSGLG+ G ALAI +SYW NVI LV+Y+K+SSSC K+RV L  
Sbjct  182   SFVTLLLHIPLCWTLVFRSGLGNVGAALAISISYWLNVIFLVLYMKFSSSCGKTRVPLSM  241

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
             ++F  +GEF RLA+PSA M CLEWW+FE+++LL GLLPNP++ETSVLS+CL   SL + I
Sbjct  242   EAFRGIGEFVRLAVPSAVMICLEWWSFELLVLLSGLLPNPELETSVLSVCLTTISLLYTI  301

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
             P+ +GA ASTR+SNELGAGN   AR AV  V  + + E  + +  L + R +  YA+SNE
Sbjct  302   PYGVGAAASTRVSNELGAGNPQAARTAVCAVMFLSLTETTILSTSLYAGRYIWSYAYSNE  361

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
              EVV+Y+K M PL+S+ +V D + G+LSGVARG GWQH+GAYVNLGA+YL G P A  LG
Sbjct  362   KEVVNYVKGMAPLISMSVVMDSLQGVLSGVARGCGWQHIGAYVNLGAFYLAGVPIAAFLG  421

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             F T LRG GLW+G+   S +Q+ +L+LITIFT+W+KQ  KA+ER+       +++NG
Sbjct  422   FRTPLRGKGLWIGILTGSTLQSAMLSLITIFTNWEKQAIKAKERIFEGRF--SIENG  476



>ref|XP_010108909.1| MATE efflux family protein 7 [Morus notabilis]
 gb|EXC20549.1| MATE efflux family protein 7 [Morus notabilis]
Length=474

 Score =   517 bits (1332),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 251/451 (56%), Positives = 330/451 (73%), Gaps = 0/451 (0%)
 Frame = -2

Query  1552  ISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTG  1373
             +S+  F AELKK   IA PM+ V V Q ++  VS +++GH+ ELSLS  A+ATS TNVTG
Sbjct  13    VSRRAFAAELKKEGVIAAPMVAVAVLQYLLQVVSLVIVGHLGELSLSSVAIATSLTNVTG  72

Query  1372  FSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVG  1193
             FSL+ GMAS LETLCGQA+GA Q+HKLGTYT  AI+SL +V  P+ +LW+FMDKFL  +G
Sbjct  73    FSLLSGMASGLETLCGQAFGAEQFHKLGTYTCTAIISLNLVCPPVCVLWIFMDKFLSLIG  132

Query  1192  QDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWAL  1013
             QDPLIS +A  YS+WLI  +F  AIL+ L RY Q QS I+PML +S + L FHIP CW L
Sbjct  133   QDPLISLKARDYSMWLIPGLFGSAILKPLTRYCQTQSSILPMLFASFVVLVFHIPTCWTL  192

Query  1012  SFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIP  833
              ++  +GS G A+A  LS W  V LL +YV YSSS  +SR+    D+F  +GEFFRLAIP
Sbjct  193   VYKLQIGSHGAAIAFSLSTWLYVALLGLYVTYSSSFARSRIAFSKDAFLGIGEFFRLAIP  252

Query  832   SASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNE  653
             SA M CL+WW+ E++ LL GLLPNP++ETSVLSICL + +LHF IP+ +GA ASTR+SNE
Sbjct  253   SAIMICLKWWSCELITLLSGLLPNPKLETSVLSICLTLSTLHFTIPYGVGAAASTRVSNE  312

Query  652   LGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVS  473
             LGAGN + AR+AVW    +   E V+    L +  +V+GYA++N+ +VVDYI  M PL+ 
Sbjct  313   LGAGNPEAARLAVWAAVFLATTEAVIVGTALFACHNVLGYAYTNDKQVVDYIASMAPLIC  372

Query  472   LMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLN  293
             + +  D +  +LSG+ARG GWQH+GAY+NL A+YLVG P   +LGF+  L+G GLW+G+ 
Sbjct  373   VSVFMDSLQAVLSGIARGGGWQHIGAYINLAAFYLVGLPVGAILGFVLPLKGKGLWIGIV  432

Query  292   LASLVQNVVLALITIFTDWKKQESKAQERLL  200
             + S VQ+ +L+L+TIFT+WKKQ  KA+ER+L
Sbjct  433   IGSAVQSTLLSLVTIFTNWKKQAIKARERVL  463



>ref|XP_002314826.2| hypothetical protein POPTR_0010s12720g [Populus trichocarpa]
 gb|EEF00997.2| hypothetical protein POPTR_0010s12720g [Populus trichocarpa]
Length=484

 Score =   518 bits (1333),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 250/477 (52%), Positives = 343/477 (72%), Gaps = 4/477 (1%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
             + LLP+  +E+    E R    +++DVF  E KKLA IA PM+V      +++ +S MM+
Sbjct  4     SLLLPKKRSEL----EGRERLVLTRDVFTQEAKKLAYIAGPMVVTITSLYLLLVISNMMV  59

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL+LS  A++ SF NVTG SL+ G+ASALETLCGQAYGA QY K+G  TYGA+ SL
Sbjct  60    GHLGELALSSAAISVSFCNVTGMSLLNGLASALETLCGQAYGAQQYQKVGHQTYGAMFSL  119

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +VA  +S++W+ ++K LI +GQDP+I+ EAG++++W +  +F YAI Q L RYLQ+QSL
Sbjct  120   VLVASLVSLVWINVEKVLILIGQDPIIAHEAGRFTLWTVPTLFAYAIFQPLSRYLQIQSL  179

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
              +PML SS ++L  HIP+CW L F+SGL + G ALAI +S W NVI L++Y+KYSS+C K
Sbjct  180   TIPMLASSVVTLLLHIPLCWFLVFKSGLENVGGALAISISNWLNVIFLLLYMKYSSACAK  239

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +RV +  + F  +GEFFR AIPSA M CL+WW +EIV+LL GLL NPQ+ETSVLS+CL  
Sbjct  240   TRVPVSMEMFHGIGEFFRFAIPSAVMICLQWWAYEIVVLLSGLLSNPQLETSVLSVCLTT  299

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              S  + IP+ IGA  STR+SNELGAG    AR+AV+ V I+ +IE+++ +  L   R + 
Sbjct  300   TSTLYSIPYGIGAAVSTRVSNELGAGRPQAARIAVYTVMILAIIEVIIVSGTLFGTRDIF  359

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY+FSNE EVVDY+  M PLV L ++ DG+  +LSGVARG GWQH+GAYVNL A+YL G 
Sbjct  360   GYSFSNEKEVVDYVSNMTPLVCLSVILDGLQVVLSGVARGCGWQHIGAYVNLAAFYLCGV  419

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
             P A +LG    L+  GLW+G+ + +++Q V+L LIT  T+W+KQ S A+ER+  + +
Sbjct  420   PVAAILGLWLRLKARGLWIGIQVGAILQTVLLTLITSCTNWEKQASDARERIFEERY  476



>ref|XP_011038711.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Populus 
euphratica]
Length=486

 Score =   516 bits (1330),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 251/483 (52%), Positives = 345/483 (71%), Gaps = 6/483 (1%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
             + L P+  +E+    E R    +++DVF  E KKLA IA PM+V      +++ +S MM+
Sbjct  6     SLLRPKKRSEL----EGRERLVLTRDVFTQEAKKLAYIAGPMVVTITSLYLLLVISNMMV  61

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL+LS  A++ SF NVTG SL+ G+ASALETLCGQAYGA QY K+G  TYGA+ SL
Sbjct  62    GHLGELALSSAAISVSFCNVTGMSLLNGLASALETLCGQAYGAQQYQKVGHQTYGAMFSL  121

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +VA  +S++W+ M+K LI +GQDP+I+ EAG++++W +  +F YAI Q L RYLQ+QSL
Sbjct  122   VLVASLVSLVWINMEKVLILIGQDPIIAHEAGRFTLWTVPTLFAYAIFQPLSRYLQIQSL  181

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
              +PML SS ++L  HIP+CW L F+SGL + G ALAI +S W NVI L++Y+KYSS+C K
Sbjct  182   TIPMLASSVVTLLLHIPLCWFLVFKSGLENVGGALAISISNWLNVIFLLLYMKYSSACAK  241

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +R  +  + F  +GEFFR AIPSA M CL+WW +EIV+LL GLL NPQ+ETSVLS+CL  
Sbjct  242   TRAPVSMEMFHGIGEFFRFAIPSAVMICLQWWAYEIVVLLSGLLSNPQLETSVLSVCLTT  301

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              S  + IP+ IGA  STR+SNELGAG    AR+AV+ V I+ +IE+++ +  L   R + 
Sbjct  302   TSTLYSIPYGIGAAVSTRVSNELGAGRPQAARIAVYTVMILAIIEVIIVSGTLFGTRDIF  361

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY+FSNE EVVDY+  M PLV L ++ DG+  +LSGVARG GWQH+GAYVNL A+YL G 
Sbjct  362   GYSFSNEKEVVDYVSNMTPLVCLSVILDGLQVVLSGVARGCGWQHIGAYVNLAAFYLCGV  421

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPA  179
             P A +LG    L+  GLW+G+ +  ++Q V+L+LIT  T+W+KQ S A+ER+  + +  +
Sbjct  422   PVAAILGLWLQLKARGLWIGIQVGGILQTVLLSLITSCTNWEKQASDARERIFEERY--S  479

Query  178   VDN  170
             V+N
Sbjct  480   VEN  482



>ref|XP_010251273.1| PREDICTED: MATE efflux family protein 5-like [Nelumbo nucifera]
Length=474

 Score =   516 bits (1328),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 264/471 (56%), Positives = 342/471 (73%), Gaps = 0/471 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             M+  + L +      A+   VF  E+K +  IA PM+VVT+ + +   +S MM+GH+ EL
Sbjct  1     MEEGLLLKNRGDEKEALRWGVFAEEVKNVGYIAGPMVVVTISEYLQQVISVMMVGHLGEL  60

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             SLS  A+ATS   VTGFSLI GMASALETLCGQAYGA QY +LG  TYGAI+SL +V  P
Sbjct  61    SLSSTAIATSLAGVTGFSLILGMASALETLCGQAYGAQQYRQLGVQTYGAIISLNLVCFP  120

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             I+++W+ M K L  +GQDP IS EAGK+++WLI A+F YA LQ L+RY Q QSLI P+LL
Sbjct  121   IALVWISMGKLLPLIGQDPSISIEAGKFAIWLIPALFAYATLQPLIRYFQSQSLIFPLLL  180

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS  SL  HIP+CW L  +SGLG+ G ALAI LSYWFNVI L +Y+KYSSSC+K+RV L 
Sbjct  181   SSCTSLLLHIPLCWVLVLKSGLGNCGAALAISLSYWFNVIFLGLYMKYSSSCDKTRVPLS  240

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              ++   V +FFRLAI SA M CL+WW+FE++ILL GLL NP++ETSVLSICL   SL + 
Sbjct  241   MEALQGVSQFFRLAISSAVMICLDWWSFEVLILLSGLLSNPELETSVLSICLTTTSLLYT  300

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+ IGA ASTR+SNELGAGN   A++AV+ V ++ + E V+ +  L + R ++GYA+SN
Sbjct  301   IPYGIGAAASTRVSNELGAGNPQAAQVAVYVVMLLSVTEAVIVSTALFAGRYILGYAYSN  360

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E EVV+Y+ KM PL  L ++ D + G+LSGVARG GWQH+GA +NLGA+YLVG P A +L
Sbjct  361   EKEVVNYVTKMAPLFCLTVIMDSLQGVLSGVARGCGWQHIGAIINLGAFYLVGIPVAALL  420

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
             GF   LRG GLW+G+   S +Q+ +LALIT  T+WKKQ  KA++RL  +  
Sbjct  421   GFYIHLRGEGLWIGILTGSTLQSALLALITSCTNWKKQALKARDRLFENQQ  471



>ref|XP_002280212.1| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
Length=481

 Score =   516 bits (1328),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 254/462 (55%), Positives = 337/462 (73%), Gaps = 0/462 (0%)
 Frame = -2

Query  1573  EKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVAT  1394
             EKR    +   +   E+K+L  +A PM+ V + Q +V  VS MM+GH+ EL+LS  A+A 
Sbjct  13    EKREEEGLRWVLVCEEVKRLGCLAAPMVAVVLSQYLVQVVSVMMVGHLGELALSSTAIAI  72

Query  1393  SFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMD  1214
             S + V+GFSL+ GMASALETLCGQAYGA QY KLGT TY AI SL +V +P+S++W++M 
Sbjct  73    SLSGVSGFSLLLGMASALETLCGQAYGAKQYSKLGTQTYTAIFSLFLVCLPLSVIWIYMG  132

Query  1213  KFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFH  1034
             K L F+GQDPLIS EAGK+++WL+ A+F YA LQ LVRY Q QSL +PMLLSS  +LCFH
Sbjct  133   KLLTFMGQDPLISYEAGKFTMWLVPALFAYATLQPLVRYFQTQSLTMPMLLSSCAALCFH  192

Query  1033  IPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGE  854
             +P+CW L F+SGLG+ G ALAI +SYW N I LV+Y+KYSS+CEK+RV +  + F  +GE
Sbjct  193   MPLCWVLVFKSGLGNLGAALAISISYWLNAIFLVLYMKYSSACEKTRVPVSMEVFQGMGE  252

Query  853   FFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGA  674
             FFR AIPSA M CLEWW+FE++ILL GLLPNP++ETSVLS+CL   S  + IP+ +GA  
Sbjct  253   FFRFAIPSAVMICLEWWSFELLILLSGLLPNPELETSVLSVCLNTISTLYTIPYGLGAAG  312

Query  673   STRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIK  494
             STR+SNELGAGN   AR+AV+ +  + + E  + +  L + R V GY FSNE EVVDY+ 
Sbjct  313   STRVSNELGAGNPQKARLAVYALMFLAVTETALVSTTLFASRRVFGYLFSNEKEVVDYVT  372

Query  493   KMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGM  314
              M PLV L ++ D + G+LSGVARG GWQH+GA++NLGA+YL G P A  L F   LRG 
Sbjct  373   NMSPLVCLSVILDSMQGVLSGVARGCGWQHIGAFINLGAFYLCGIPVAATLAFWLQLRGR  432

Query  313   GLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
             GLW+G+   +L+Q  +L ++T FT+W+K  +KA++R+    +
Sbjct  433   GLWIGIQTGALLQTTLLCVMTGFTNWEKLATKARQRIFEGRY  474



>ref|XP_010044140.1| PREDICTED: MATE efflux family protein 8-like [Eucalyptus grandis]
 gb|KCW86177.1| hypothetical protein EUGRSUZ_B02868 [Eucalyptus grandis]
Length=489

 Score =   516 bits (1328),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 257/468 (55%), Positives = 338/468 (72%), Gaps = 2/468 (0%)
 Frame = -2

Query  1570  KRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATS  1391
             +R +  I+      E+K++  IA PM+VVT  Q  +  V  MM+GH+ ELSLS  A+A S
Sbjct  21    ERKSDGITWGGVTEEVKRVGSIAAPMVVVTSSQYFLQLVCVMMVGHLGELSLSSTAIAIS  80

Query  1390  FTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDK  1211
                V+GFSL+ GMA+ALETLCGQAYGA QY KLGT TY AI S+T+V +P+S LW  M K
Sbjct  81    LAGVSGFSLLLGMATALETLCGQAYGAQQYQKLGTQTYTAIFSMTLVCVPLSFLWFNMGK  140

Query  1210  FLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHI  1031
              L+ +GQDPLIS EAG++ VWL+ A+  YA LQ LVRY Q QSL  PML+ S+ +LC H+
Sbjct  141   LLLLMGQDPLISREAGRFIVWLVPALLAYAALQPLVRYFQTQSLTTPMLIGSSATLCLHV  200

Query  1030  PVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEF  851
             P+CW L F+SGL + G ALA+G+SYW NV  LV+Y+ +SS+C+K+R  +  + F  + EF
Sbjct  201   PLCWVLVFKSGLHNLGAALALGISYWLNVTFLVLYMTFSSACQKTRAPVSMEIFRGIQEF  260

Query  850   FRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGAS  671
             FR A+PSA M CLEWW+FE++ILL GLLPNPQ+ETSVLS+CL   S  + IPF+IGA  S
Sbjct  261   FRFAVPSAVMICLEWWSFELLILLSGLLPNPQLETSVLSVCLGTISTLYAIPFAIGAAGS  320

Query  670   TRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKK  491
             TR+SNELGAGN   AR+AV+ V++I + E  + + VL +   V GYAFSNE EVVDY+ K
Sbjct  321   TRVSNELGAGNAQAARVAVYAVSLIAIAETSIMSAVLFATHKVFGYAFSNEKEVVDYVTK  380

Query  490   MIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMG  311
             M PLV L ++ D + G+LSG+ARG GWQH+GAYVNLGA+YL G P A  LGF   LRG+G
Sbjct  381   MSPLVCLSVIVDSLQGVLSGIARGCGWQHIGAYVNLGAFYLCGIPVAATLGFWVGLRGVG  440

Query  310   LWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             LW+G+ + ++VQ  +L+++T  T+W+K  SKA+ER+   S P   DNG
Sbjct  441   LWIGIQVGAIVQTSLLSIVTCCTNWEKLASKARERIFGGSCP--ADNG  486



>ref|XP_006302197.1| hypothetical protein CARUB_v10020206mg [Capsella rubella]
 gb|EOA35095.1| hypothetical protein CARUB_v10020206mg [Capsella rubella]
Length=485

 Score =   515 bits (1327),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 251/452 (56%), Positives = 336/452 (74%), Gaps = 0/452 (0%)
 Frame = -2

Query  1546  KDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFS  1367
             KD FL E+KKL  IA PM+ V     +++ +STMM+GH+ EL LS  A+A SF +VTGFS
Sbjct  20    KDGFLREMKKLGYIAGPMVAVNSSMYVLLVISTMMVGHLGELFLSSTAIAISFCSVTGFS  79

Query  1366  LIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQD  1187
             L+FG+ASALETLCGQA+GA Q+ KLG +TY  I+SL +V+IP+S+LW +M   L  +GQD
Sbjct  80    LVFGLASALETLCGQAHGAKQFEKLGVHTYTGIVSLFLVSIPLSVLWSYMGDILSSIGQD  139

Query  1186  PLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSF  1007
             PL++ EAGK++ WLI A+F YA LQ LVR+ Q QSLI+P+++SS  +LC H+ +CW+L F
Sbjct  140   PLVAQEAGKFATWLIPALFGYATLQPLVRFFQAQSLILPLIMSSISALCVHVVLCWSLVF  199

Query  1006  RSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSA  827
             + GLGS G A++IG+SYW NVI+L +Y+ +SSSC KSR  +    F  +GEFFR  IPSA
Sbjct  200   KFGLGSLGAAISIGVSYWLNVIVLTLYMMFSSSCSKSRAPISMTLFEGMGEFFRFGIPSA  259

Query  826   SMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELG  647
             SM CLEWW+FE +++L GLLPNP++ETSVLS+CL   S  + IP S+GA ASTR++NELG
Sbjct  260   SMICLEWWSFEFLVILSGLLPNPKLETSVLSVCLSTISSLYQIPESLGAAASTRVANELG  319

Query  646   AGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLM  467
             AGN   ARMAV+ V +I  +E ++   ++ + R+V GY FS+ETEVVDY++ M PLVSL 
Sbjct  320   AGNPKQARMAVYTVMVIAGVESIMVGAIVFAARNVFGYLFSSETEVVDYVRSMAPLVSLS  379

Query  466   LVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLA  287
             ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +L F   +RG GLW+G+ + 
Sbjct  380   VIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLFGIPTAIVLAFGFKMRGRGLWIGITVG  439

Query  286   SLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             S VQ V+L LI I T+WK+Q  KA+ER++ D 
Sbjct  440   SFVQAVLLGLIVILTNWKQQARKARERVMGDD  471



>ref|XP_010044145.1| PREDICTED: MATE efflux family protein 8-like [Eucalyptus grandis]
 ref|XP_010044146.1| PREDICTED: MATE efflux family protein 8-like [Eucalyptus grandis]
 gb|KCW86182.1| hypothetical protein EUGRSUZ_B02872 [Eucalyptus grandis]
Length=489

 Score =   515 bits (1326),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 259/482 (54%), Positives = 343/482 (71%), Gaps = 4/482 (1%)
 Frame = -2

Query  1606  PEMDAEVPLLSEK--RPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             P+M+  +    E+  R +  I+      E+K++  IA PM+VVT  Q  +  V  MM+GH
Sbjct  7     PKMEERLLAKREEGERKSDGITWGGVTEEVKRVGSIAAPMVVVTSSQYFLQMVCVMMVGH  66

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
             + ELSLS  A+A S   V+GFSL+ GMA+ALETLCGQAYGA QY KLGT TY AI SLT+
Sbjct  67    LGELSLSSTAIAISLAGVSGFSLLLGMATALETLCGQAYGAQQYQKLGTQTYTAIFSLTL  126

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
             V +P+S LW  M K L+ +GQDPLIS EAG++ VWL+ A+  YA LQ LVRY Q QS   
Sbjct  127   VCVPLSFLWFNMGKLLLLMGQDPLISREAGRFIVWLVPALLAYAALQPLVRYFQTQSRTT  186

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             PML+ S+ +LC H+P+CW L F+SGL + G ALA+G+SYW NV  LV+Y+ +SS+C+K+R
Sbjct  187   PMLIGSSATLCLHVPLCWVLVFKSGLHNLGAALALGISYWLNVTFLVLYMTFSSACQKTR  246

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
               +  + F  + EFFR A+PSA M CLEWW+FE++ILL GLLPNPQ+ETSVLS+CL   S
Sbjct  247   APVSMEIFRGIQEFFRFAVPSAVMICLEWWSFELLILLSGLLPNPQLETSVLSVCLGTIS  306

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
               + IPF+IGA  STR+SNELGAGN   AR+AV+ V +I + E  + + VL + R V GY
Sbjct  307   TLYAIPFAIGAAGSTRVSNELGAGNAQAARVAVYAVLLIAITETSITSTVLFATRKVFGY  366

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             AFSNE EVVDY+ KM PLV L ++ D + G+LSG+ARG GWQH+GAYVNLGA+YL G P 
Sbjct  367   AFSNEKEVVDYVTKMSPLVCLSVIIDSLQGVLSGIARGCGWQHIGAYVNLGAFYLCGIPV  426

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVD  173
             A  LGF   LRG+GLW+G+   ++VQ  +L+++T  T+W+K  +KA+ER+ + S   + D
Sbjct  427   AATLGFWVGLRGVGLWIGIQAGAIVQTSLLSIVTCCTNWEKLANKARERIFDGSF--SAD  484

Query  172   NG  167
             NG
Sbjct  485   NG  486



>emb|CAN78227.1| hypothetical protein VITISV_022104 [Vitis vinifera]
Length=481

 Score =   514 bits (1324),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 253/462 (55%), Positives = 336/462 (73%), Gaps = 0/462 (0%)
 Frame = -2

Query  1573  EKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVAT  1394
             EKR    +   +   E+K+L  +A PM+ V + Q +V  VS MM+GH+ EL+LS  A+A 
Sbjct  13    EKREEEGLRWVLVCEEVKRLGCLAAPMVAVVLSQYLVQVVSVMMVGHLGELALSSTAIAI  72

Query  1393  SFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMD  1214
             S + V+GFSL+ GMASALETLCGQAYGA QY KLGT TY AI SL +V +P+S++W++M 
Sbjct  73    SLSGVSGFSLLLGMASALETLCGQAYGAKQYSKLGTQTYTAIFSLFLVCLPLSVIWIYMG  132

Query  1213  KFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFH  1034
             K L F+GQDPLIS EAGK+++WL+ A+F YA LQ LVRY Q QSL +PMLLSS  +LCFH
Sbjct  133   KLLTFMGQDPLISYEAGKFTMWLVPALFAYATLQPLVRYFQTQSLTMPMLLSSCAALCFH  192

Query  1033  IPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGE  854
             +P+CW L F+SGLG+ G ALAI +SYW N I LV+Y+KYSS+CEK+RV +  + F  +GE
Sbjct  193   MPLCWVLVFKSGLGNLGAALAISISYWLNAIFLVLYMKYSSACEKTRVPVSMEVFQGMGE  252

Query  853   FFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGA  674
             FFR AIPSA M CLEWW+FE++ILL GLLPNP++ETSVLS+CL   S  + IP+ +GA  
Sbjct  253   FFRFAIPSAVMICLEWWSFELLILLSGLLPNPELETSVLSVCLNTISTLYTIPYGLGAAG  312

Query  673   STRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIK  494
             STR+SNELGAGN   AR+AV+ +  + + E  + +    + R V GY FSNE EVVDY+ 
Sbjct  313   STRVSNELGAGNPQKARLAVYALMFLAVTETALVSTTXFASRRVFGYLFSNEKEVVDYVT  372

Query  493   KMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGM  314
              M PLV L ++ D + G+LSGVARG GWQH+GA++NLGA+YL G P A  L F   LRG 
Sbjct  373   NMSPLVCLSVILDSMQGVLSGVARGCGWQHIGAFINLGAFYLCGIPVAATLAFWLQLRGR  432

Query  313   GLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
             GLW+G+   +L+Q  +L ++T FT+W+K  +KA++R+    +
Sbjct  433   GLWIGIQTGALLQTTLLCVMTGFTNWEKLATKARQRIFEGRY  474



>ref|XP_011038710.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Populus 
euphratica]
Length=529

 Score =   516 bits (1328),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 251/483 (52%), Positives = 345/483 (71%), Gaps = 6/483 (1%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
             + L P+  +E+    E R    +++DVF  E KKLA IA PM+V      +++ +S MM+
Sbjct  49    SLLRPKKRSEL----EGRERLVLTRDVFTQEAKKLAYIAGPMVVTITSLYLLLVISNMMV  104

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL+LS  A++ SF NVTG SL+ G+ASALETLCGQAYGA QY K+G  TYGA+ SL
Sbjct  105   GHLGELALSSAAISVSFCNVTGMSLLNGLASALETLCGQAYGAQQYQKVGHQTYGAMFSL  164

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +VA  +S++W+ M+K LI +GQDP+I+ EAG++++W +  +F YAI Q L RYLQ+QSL
Sbjct  165   VLVASLVSLVWINMEKVLILIGQDPIIAHEAGRFTLWTVPTLFAYAIFQPLSRYLQIQSL  224

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
              +PML SS ++L  HIP+CW L F+SGL + G ALAI +S W NVI L++Y+KYSS+C K
Sbjct  225   TIPMLASSVVTLLLHIPLCWFLVFKSGLENVGGALAISISNWLNVIFLLLYMKYSSACAK  284

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +R  +  + F  +GEFFR AIPSA M CL+WW +EIV+LL GLL NPQ+ETSVLS+CL  
Sbjct  285   TRAPVSMEMFHGIGEFFRFAIPSAVMICLQWWAYEIVVLLSGLLSNPQLETSVLSVCLTT  344

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              S  + IP+ IGA  STR+SNELGAG    AR+AV+ V I+ +IE+++ +  L   R + 
Sbjct  345   TSTLYSIPYGIGAAVSTRVSNELGAGRPQAARIAVYTVMILAIIEVIIVSGTLFGTRDIF  404

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY+FSNE EVVDY+  M PLV L ++ DG+  +LSGVARG GWQH+GAYVNL A+YL G 
Sbjct  405   GYSFSNEKEVVDYVSNMTPLVCLSVILDGLQVVLSGVARGCGWQHIGAYVNLAAFYLCGV  464

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPA  179
             P A +LG    L+  GLW+G+ +  ++Q V+L+LIT  T+W+KQ S A+ER+  + +  +
Sbjct  465   PVAAILGLWLQLKARGLWIGIQVGGILQTVLLSLITSCTNWEKQASDARERIFEERY--S  522

Query  178   VDN  170
             V+N
Sbjct  523   VEN  525



>ref|XP_008243314.1| PREDICTED: MATE efflux family protein 5-like [Prunus mume]
Length=504

 Score =   514 bits (1324),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 254/459 (55%), Positives = 334/459 (73%), Gaps = 2/459 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F  E+K+L  IA PM+ V + Q ++  +S MM+GH+ EL+LS  A+A S + VTGFSL  
Sbjct  40    FFEEVKRLGCIAGPMVAVILSQYLLQVISMMMVGHLGELALSSTAIAISLSGVTGFSLFL  99

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             GMASALETLCGQAYGA QY KLG  TY AI SL +V +P+S++W++M+K LIF+GQDP+I
Sbjct  100   GMASALETLCGQAYGAKQYQKLGLQTYTAIFSLNLVCLPLSLIWIYMEKILIFIGQDPVI  159

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAGK++ WL+ A+F YA LQ L+RY Q QSLI+PML+SS  +L FHIP+CW L F+SG
Sbjct  160   SHEAGKFTTWLLPALFAYATLQPLIRYFQTQSLIIPMLISSFATLLFHIPLCWILVFKSG  219

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             L + G ALAI +SYW NVILL +Y+K+SS+C K+R  +  + F  +GEFFR A+PSA M 
Sbjct  220   LDNLGGALAISISYWLNVILLGLYMKFSSACSKTRAPISKEIFQGIGEFFRFAVPSAIMI  279

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW+FE++ILL GLLPNP +ETSVLS+CL   S  + IP+  GA ASTR+SNELGAGN
Sbjct  280   CLEWWSFELLILLSGLLPNPALETSVLSVCLQTISTLYAIPYGFGAAASTRVSNELGAGN  339

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
                AR+A      + + E  +    L + R+V GY FSNE EV+DY+  M PLV L ++ 
Sbjct  340   PQGARIATCAAMFLAVTETSIITTTLFACRNVFGYTFSNEKEVIDYVTTMAPLVCLSVIL  399

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D + G+LSG+ARG+GWQH+GAY+NLGA+YL G P A  L F   LRG GLW+G+ + S V
Sbjct  400   DSLQGVLSGIARGTGWQHIGAYINLGAFYLCGIPVAATLAFWVQLRGRGLWIGIQVGSFV  459

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNGGC  161
             Q ++L+ +T  T+W+KQ SKA+ER+  +  PP V NG C
Sbjct  460   QTILLSFVTSCTNWEKQASKARERIF-EGRPPEV-NGLC  496



>ref|XP_011035132.1| PREDICTED: MATE efflux family protein 5-like [Populus euphratica]
Length=475

 Score =   513 bits (1320),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 261/477 (55%), Positives = 340/477 (71%), Gaps = 6/477 (1%)
 Frame = -2

Query  1597  DAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
             +A +P   E+ PA+      ++ ELKK+  IA PM+VVTV   ++  VS MM GH+ ELS
Sbjct  3     EALLPNAEERTPAS----TTYVEELKKVTCIAAPMVVVTVSLHLLQVVSLMMAGHLGELS  58

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LSG ++  SF  VTGFSL+FG+A  LETLCGQAYGAGQY K GTYTY AI+SL  + +P+
Sbjct  59    LSGVSIGGSFAGVTGFSLLFGLAGGLETLCGQAYGAGQYQKFGTYTYCAIISLLPICVPV  118

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             SI+W+FMD+ LI +GQDP IS  A +Y+ +LI A+F YA+LQ L+RY Q Q LI+PML S
Sbjct  119   SIIWMFMDRILIAIGQDPEISTVACRYATFLIPALFAYAVLQSLLRYYQSQGLILPMLFS  178

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             +  +LCFHIP+CWAL F+  LGS G ALAI +SYW NV+ L +Y+ +SSSC+K+RV  WN
Sbjct  179   TCATLCFHIPLCWALIFKWELGSTGAALAIDVSYWLNVVFLALYMGFSSSCKKTRVIYWN  238

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
               F+ + EFFR A+PSA M CLEWWTFE++ILL GLLP+ Q+ETSVLSICL   SLHFY 
Sbjct  239   HIFSSITEFFRFALPSAVMVCLEWWTFELLILLAGLLPDSQLETSVLSICLATTSLHFYA  298

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
                I A  S ++SN LGAGN   A++ V  V  I ++E V+ +  +   R V GYAFSNE
Sbjct  299   LSGIAAAGSAQVSNHLGAGNHKAAQVVVRAVLSISLVEAVIVSTNIFCYRHVFGYAFSNE  358

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
               VVDY+ ++ PL+ L ++ D +  +LSG+ARG GWQH+GAY+NLGAYY  G P A +L 
Sbjct  359   KVVVDYVTEVAPLLCLSVIVDSLQTVLSGIARGCGWQHIGAYINLGAYYFAGIPVAILLC  418

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             F+  LRG GLWMG+   S VQ  +LALIT  T+WKKQ +KA+ER+L+ +   + DNG
Sbjct  419   FILHLRGKGLWMGVLTGSTVQATLLALITGLTNWKKQATKARERMLDGT--ASADNG  473



>ref|XP_007225783.1| hypothetical protein PRUPE_ppa004624mg [Prunus persica]
 gb|EMJ26982.1| hypothetical protein PRUPE_ppa004624mg [Prunus persica]
Length=499

 Score =   513 bits (1321),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 253/459 (55%), Positives = 334/459 (73%), Gaps = 2/459 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F  E+K+L  IA PM+ V + Q ++  +S MM+GH+SEL+LS  A+A S + VTGFSL  
Sbjct  35    FFEEVKRLGCIAGPMVAVILSQYLLQVISMMMVGHLSELALSSTAIAISLSGVTGFSLFL  94

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             GMASALETLCGQAYGA QY KLG  TY AI SL +V +P+S++W++M+K LIF+GQDP+I
Sbjct  95    GMASALETLCGQAYGAKQYQKLGLQTYTAIFSLNLVCLPLSLIWIYMEKILIFIGQDPVI  154

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAGK++ WL+ A+F YA LQ L+RY Q QSLI+PML+SS   L FHIP+CW L F+SG
Sbjct  155   SHEAGKFTTWLLPALFAYATLQPLIRYFQTQSLIIPMLISSFAILLFHIPLCWILVFKSG  214

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             L + G ALAI +SYW NVILL +Y+K+SS+C K+R  +  + F  +GEFFR A+PSA M 
Sbjct  215   LDNLGGALAISISYWLNVILLGLYMKFSSACSKTRAPISKEIFQGIGEFFRFAVPSAIMI  274

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW+FE++ILL GLLPNP +ETSVLS+CL   S  + IP+  GA ASTR+SNELGAGN
Sbjct  275   CLEWWSFELLILLSGLLPNPALETSVLSVCLQTISTLYAIPYGFGAAASTRVSNELGAGN  334

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
                AR+A      + + E  +    L + R+V GY FSNE EV+DY+  M PLV L ++ 
Sbjct  335   PQGARVATCAAMFLAVTETSIITTTLFACRNVFGYTFSNEKEVIDYVTTMAPLVCLSVIL  394

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D + G+LSG+ARG+GWQH+GAY+NLGA+YL G P A  + F   LRG GLW+G+ + S V
Sbjct  395   DSLQGVLSGIARGTGWQHIGAYINLGAFYLCGIPVAATMAFWVQLRGRGLWIGIQVGSFV  454

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNGGC  161
             Q ++L+ +T  T+W+KQ SKA+ER+  +  PP + NG C
Sbjct  455   QTILLSFVTSCTNWEKQASKARERIF-EGRPPEL-NGLC  491



>ref|XP_008339593.1| PREDICTED: MATE efflux family protein 8-like [Malus domestica]
Length=495

 Score =   513 bits (1320),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 258/486 (53%), Positives = 344/486 (71%), Gaps = 2/486 (0%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
             + LLP+   E          + ++   F  E+K+L  IA PM+ V + Q ++ F+S MM+
Sbjct  4     SLLLPKRREEEQQQRRYGTTSILTWTSFFEEVKRLGCIAGPMVAVILSQNLLQFISMMMV  63

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL+LS  A+A S +NVTG S+  GMASALETLCGQAYGA QY KLG  TY AI SL
Sbjct  64    GHLGELALSSTAIAISLSNVTGLSVFLGMASALETLCGQAYGAEQYQKLGLQTYTAIFSL  123

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +V +P+S++W++M+K LIF+GQDP+IS EAGK+++WLI A+F YA LQ  +RY Q QSL
Sbjct  124   NLVCLPLSLIWIYMEKLLIFMGQDPVISREAGKFTIWLIPALFAYATLQPFIRYFQTQSL  183

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
             I+PML+SS  +L FHIP+CW L F+SGL + G ALAI +SYW NVILL +Y+K+S++C K
Sbjct  184   IIPMLISSCSTLLFHIPLCWLLVFKSGLNNLGGALAISISYWVNVILLALYMKFSAACSK  243

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +R  +  + F  +GEFFR AIPSA M CLEWW+FE++ILL GLLPNP +ETSVLS+CL  
Sbjct  244   TRAPISVEIFHGIGEFFRFAIPSAIMICLEWWSFELLILLSGLLPNPALETSVLSVCLQT  303

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              S  + IP+  GA ASTR+SNELGAGN   AR+A +    + + E  +    L + R+V 
Sbjct  304   ISTLYGIPYGFGAAASTRVSNELGAGNPQGARIATFAAMFLAVTEASIITTTLFACRNVF  363

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY FSNE EV+DY+  M PLV L +  D + G+LSG+ARG+GWQH+GAY+NLGA+YL G 
Sbjct  364   GYTFSNEKEVIDYVTTMAPLVCLSVTLDSLQGVLSGIARGTGWQHIGAYINLGAFYLCGI  423

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPA  179
             P A  L F   LRG GLW+G+ + + VQ ++L+L+T  T+W+KQ S A+ER+   S PP 
Sbjct  424   PVAATLAFWVQLRGRGLWIGIQVGAFVQTMMLSLVTSCTNWEKQASMARERIFEGS-PPQ  482

Query  178   VDNGGC  161
             V NG C
Sbjct  483   V-NGLC  487



>ref|XP_003518636.1| PREDICTED: MATE efflux family protein DTX1 isoform 2 [Glycine 
max]
Length=475

 Score =   512 bits (1318),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 246/452 (54%), Positives = 329/452 (73%), Gaps = 1/452 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             ELKK+  IA PM V +V Q ++  VS +M+GH+++LSLS  A+ATS TNV+GFS++ GMA
Sbjct  17    ELKKVGTIAAPMAVSSVLQYLLPVVSLVMVGHLNQLSLSSVAIATSLTNVSGFSVLSGMA  76

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
               LETLCGQA+GAGQY K G YTY AI+SL++V  PI+ILW+F DK L  +GQDP IS E
Sbjct  77    GGLETLCGQAFGAGQYEKFGLYTYTAIISLSLVCFPITILWIFNDKILTLLGQDPTISLE  136

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
               KY++WLI A+F  AIL+ L R+ Q QSLI PM+L+SA++LCFH+  CW L F+ GLG 
Sbjct  137   VRKYAIWLIPALFGSAILKPLTRFFQTQSLISPMILTSAIALCFHVVTCWTLVFKLGLGH  196

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
              G A++  L  WFNVI+L+ +V+YSS+CEK+R+    ++   VGEFFR A+P+A M CL+
Sbjct  197   VGAAISFSLCVWFNVIMLLSFVRYSSACEKTRISFSKNALVGVGEFFRFAVPAAVMVCLK  256

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW  EI++LL GL PNP++ETSVLSICL I +LHF IP+  GA ASTR+SNELGAGN   
Sbjct  257   WWACEILVLLAGLFPNPKLETSVLSICLTISTLHFTIPYGFGAAASTRVSNELGAGNPQA  316

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
               +AV     + + E  + +  L   R ++GYA+S++  VV Y+  MIPL+ L + +D +
Sbjct  317   VHVAVSATMFLAVTEGFIVSATLFGCRHILGYAYSDDRMVVHYVAVMIPLLCLSIFTDSL  376

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
              G+LSGVARGSGWQHLGAYVNLGA+YLVG P   +LGF+   R  GLW+G+   S+VQ++
Sbjct  377   QGVLSGVARGSGWQHLGAYVNLGAFYLVGIPVGILLGFVAHFRAKGLWIGIVTGSIVQSI  436

Query  268   VLALITIFTDWKKQESKAQERLLNDSHPPAVD  173
             +L+LIT  T+WKKQ   A+ER+  D+ PP V+
Sbjct  437   LLSLITALTNWKKQAIMARERVF-DAKPPDVN  467



>ref|XP_006383382.1| hypothetical protein POPTR_0005s15050g [Populus trichocarpa]
 gb|ERP61179.1| hypothetical protein POPTR_0005s15050g [Populus trichocarpa]
Length=479

 Score =   511 bits (1317),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 256/470 (54%), Positives = 346/470 (74%), Gaps = 4/470 (1%)
 Frame = -2

Query  1576  SEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVA  1397
              EKR    ++ D F+ EL++++ +A PM+VV+V   ++  VS +M GH+SELSLSG ++A
Sbjct  12    EEKR--WVLTWDAFVEELRRVSCLAAPMMVVSVTLYLLQVVSMIMAGHLSELSLSGVSMA  69

Query  1396  TSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFM  1217
             TSFTNVTGFSL+ G +  LETLCGQ YGA QY K G+YTY AI+SL VV+IP+S+LW F 
Sbjct  70    TSFTNVTGFSLLAGFSGGLETLCGQTYGAEQYKKFGSYTYCAIISLIVVSIPVSVLWTFT  129

Query  1216  DKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCF  1037
             D+ LI VG D  IS  A KY++WLI A+F +AILQ L+RY Q QSLI P+L+S+  +LCF
Sbjct  130   DRLLIAVGIDSEISTVACKYAIWLIPALFAFAILQPLLRYFQSQSLIYPLLVSTCAALCF  189

Query  1036  HIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVG  857
             HIP+CWAL ++  LG+ G ALAIG+SYW NVILLV+Y+ +SSSCEK+R   W+D F+ + 
Sbjct  190   HIPLCWALVYKWELGNIGGALAIGVSYWLNVILLVLYMVFSSSCEKTRRLYWDDIFSSIN  249

Query  856   EFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAG  677
             +FFR A PSA M CLEWWT+E+VILL GLLP+P+++TSVLSICL   +LH+Y+ + IGA 
Sbjct  250   KFFRFAFPSAVMICLEWWTYELVILLAGLLPDPKLQTSVLSICLATATLHYYVQYGIGAA  309

Query  676   ASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYI  497
              STR+SNELGAGN   A++AV  V I+ ++E+V  +++L   R + GYAFS+E  VVDY+
Sbjct  310   GSTRVSNELGAGNPQAAQVAVQVVLIMSLVEVVTVSLILFFCRHIFGYAFSSEKRVVDYV  369

Query  496   KKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRG  317
              ++ PL+ L ++ +G+  +LSG+ARG GWQH+GA++NLGAYYLV  P A +L F+  L  
Sbjct  370   AELAPLMCLSIIMEGLQAVLSGIARGCGWQHIGAFINLGAYYLVATPLAVVLCFVLHLGS  429

Query  316   MGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
              GLWMGL +   VQ +  A IT  T W+KQ ++A+ER+L  S     DNG
Sbjct  430   RGLWMGLLIGKTVQALCFASITALTKWQKQATEAKERILGRS--LLADNG  477



>ref|XP_011099511.1| PREDICTED: MATE efflux family protein 5-like [Sesamum indicum]
Length=472

 Score =   511 bits (1316),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 251/453 (55%), Positives = 339/453 (75%), Gaps = 3/453 (1%)
 Frame = -2

Query  1543  DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSL  1364
             D F  EL ++  IA+PM+V TV Q ++      MLGH++ELSLS  ++ATS  NVTGFS+
Sbjct  22    DAFALELSRVNWIALPMIVATVSQYLLRVSPMFMLGHLNELSLSSASIATSLCNVTGFSV  81

Query  1363  IFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDP  1184
             +FGMASALETLCGQAYGA QY K+GTY+ GAI  L VV IP+S+L++  +K L+ +GQDP
Sbjct  82    LFGMASALETLCGQAYGAEQYKKVGTYSIGAIFCLFVVCIPLSLLFMLTEKLLVLMGQDP  141

Query  1183  LISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFR  1004
             LI+AEAGK+++ LI  +FPYAILQCLVRYLQ QSLI+PM+ SS +SL F + +CWA  F+
Sbjct  142   LIAAEAGKFAILLIPTLFPYAILQCLVRYLQCQSLILPMVWSSLVSLGFQLFLCWAFIFK  201

Query  1003  SGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSAS  824
               LG+AG AL+IG++YWFNVILL++YVKYS +C+++       S   + EFF+LAIPS++
Sbjct  202   FELGNAGAALSIGVAYWFNVILLLLYVKYSPACDRTHASF---SMETLREFFQLAIPSSA  258

Query  823   MACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGA  644
             M CLEWW+FE+++LL G+LPNPQ+ETSV SIC  I  LH  IP+S GA AST ISNELGA
Sbjct  259   MVCLEWWSFELILLLSGVLPNPQLETSVFSICFTISYLHGLIPYSFGAAASTLISNELGA  318

Query  643   GNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLML  464
             G  + A++ ++ V  + + E +VA+  L+    ++GYAFS E EVVDY+KKM P +S++L
Sbjct  319   GKPEAAQVTLYTVLALSIAEFLVASFGLVICSPILGYAFSEEKEVVDYVKKMAPFLSVLL  378

Query  463   VSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLAS  284
               DG+  + SGVARGSGWQ++GAYVNLGAYYLVG P A ++ F+  L+G GLW GL + +
Sbjct  379   TMDGLQEVFSGVARGSGWQYIGAYVNLGAYYLVGVPVALLMAFVADLKGAGLWCGLIVGA  438

Query  283   LVQNVVLALITIFTDWKKQESKAQERLLNDSHP  185
              VQ++ L+ IT FT+W+KQ   A++R+ +   P
Sbjct  439   TVQSIALSFITGFTNWEKQAMVARQRIYSGQIP  471



>ref|XP_008229282.1| PREDICTED: MATE efflux family protein 5 [Prunus mume]
Length=473

 Score =   511 bits (1315),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 258/446 (58%), Positives = 339/446 (76%), Gaps = 0/446 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             ELKK+ ++A PM+VVT+ Q ++  +S MM+GH+ ELSLSG A+ATSF+ VTGFSL+ GMA
Sbjct  21    ELKKVMKMAAPMVVVTLSQYLLQVISMMMVGHLGELSLSGVAIATSFSIVTGFSLLSGMA  80

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
               LETLCGQAYGA QY +LGTYTY AI+SLT+V +P+S+LW+FM+K LI +GQDPLI+ E
Sbjct  81    GGLETLCGQAYGAKQYQQLGTYTYCAIISLTLVCLPVSLLWIFMEKLLILLGQDPLIAQE  140

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             AG+Y++WLI ++F YA+LQ LVR+   Q LI PMLLSS+L L  HIP+CWAL F  GLG+
Sbjct  141   AGRYAIWLIPSLFAYAVLQSLVRFFLAQGLIFPMLLSSSLVLLLHIPLCWALVFHLGLGN  200

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
              G AL+ GL  W N I+L+ Y+KYSS+CEK+RV    D F  + +FF LAIPSA M CLE
Sbjct  201   IGAALSTGLCNWLNTIILLTYLKYSSTCEKTRVHFSTDVFLSIKKFFVLAIPSAVMVCLE  260

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW+FE++ILL GLLPN ++ETSVLSICL   SLH++IP+S+GA AS RISNELGA N  +
Sbjct  261   WWSFELLILLSGLLPNSKLETSVLSICLTTTSLHYFIPYSVGAAASNRISNELGAHNPHV  320

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
             AR+ VW   ++ + E V+ + +L+   SV GY +SN+ EVV+Y+K++ PL+SL L +D +
Sbjct  321   ARVVVWAAMVLAVTEAVIVSTILLCCCSVWGYVYSNDMEVVNYVKRLAPLLSLSLFADSL  380

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
               +LSGVARG G Q +GAY+NLGAYY+ G P A +LGFL  LRG GLW+G+   S VQ +
Sbjct  381   QAVLSGVARGCGMQRIGAYINLGAYYIAGIPVAVVLGFLLHLRGTGLWIGMMTGSSVQAL  440

Query  268   VLALITIFTDWKKQESKAQERLLNDS  191
             +  LIT F +W KQ +KA+ER+  DS
Sbjct  441   LFILITSFINWPKQATKARERIFKDS  466



>ref|XP_006357807.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=471

 Score =   510 bits (1314),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 250/466 (54%), Positives = 331/466 (71%), Gaps = 0/466 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             M+ E+P   +      IS D    ELKK +RI  PM+ VTV Q ++  VS +M+GH+ +L
Sbjct  1     MEEELPQSLKLEKKWQISWDALSQELKKTSRIVAPMVAVTVFQYLLQVVSIIMVGHLGKL  60

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+ATS TNVTGFSL+ G+   LETLCGQAYGA QYHKL TYTY AI+SL +V +P
Sbjct  61    ALSSVAIATSLTNVTGFSLLSGLVGGLETLCGQAYGAKQYHKLSTYTYTAIISLFLVCLP  120

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             I +LW FMDK LI +GQD  IS EA KY++W I A+F  AI + LVRYLQ QSLI+PMLL
Sbjct  121   ICVLWFFMDKLLILIGQDHEISIEARKYALWAIPALFGGAISKPLVRYLQTQSLILPMLL  180

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS   LC H+P+ W   F+  LG+ G A+A  +S W  V+ L ++V +SSSCEK+R    
Sbjct  181   SSLAVLCLHLPISWGFIFKLELGNIGAAIAFSVSTWLYVLFLALHVSFSSSCEKTRTPFS  240

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              D F  + EFFRLA+PSA M CL+WW+ E++ LL GLLPNP +E SVLSICL I +LHF 
Sbjct  241   MDVFLGIKEFFRLAVPSAVMVCLKWWSLEVLTLLSGLLPNPTLEASVLSICLTISTLHFT  300

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+  GA ASTR+SNELGAGN   ARMAV  V  + +IE VV +  +   R ++G AFSN
Sbjct  301   IPYGFGAAASTRVSNELGAGNPQRARMAVQVVMFLAVIETVVLSTSMFGSRYILGRAFSN  360

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E +VVDYI  M PL+ L +++D +  ++SG+ARGSGWQH+GAY+NLGA+YL+  P A +L
Sbjct  361   EKQVVDYIASMTPLLCLSIITDSLQAVISGIARGSGWQHIGAYINLGAFYLIAIPLAVVL  420

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             GF   ++  GLW+G+ + S +Q+++L+++T FTDW+KQ  KA+ER+
Sbjct  421   GFTLHMKAKGLWIGIVVGSTIQSIILSIVTCFTDWEKQAKKARERI  466



>ref|XP_006482189.1| PREDICTED: MATE efflux family protein 5-like [Citrus sinensis]
Length=479

 Score =   510 bits (1313),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 245/471 (52%), Positives = 342/471 (73%), Gaps = 3/471 (1%)
 Frame = -2

Query  1591  EVPLLSEKRPAAA---ISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             E PLL E R       +++  F+ ELKKL+ +A PM+ VTV Q ++  VS MM GH+ EL
Sbjct  2     EEPLLGESREEETKWVVTRGAFVEELKKLSFLAAPMVGVTVSQYLLPAVSLMMAGHLGEL  61

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +L+  A+ATSFTNVTG   +FG A ALETLCGQAYGA QY ++GTYTY A+     +  P
Sbjct  62    TLASVAIATSFTNVTGIIPLFGFACALETLCGQAYGAKQYQQIGTYTYSAMFFCIAICFP  121

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             IS+LW+FMDK LI +GQDP I+ EA  +S+ LI A+  +A+L+ L+  LQ QSLI+P+ L
Sbjct  122   ISVLWIFMDKVLILLGQDPEIATEACNFSISLIPALLAFAVLRPLIHNLQSQSLILPLFL  181

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             S+  +LCFHI +CW L F++     G ALAIGLSY  N ++L +Y++YSSSCEK+RV ++
Sbjct  182   SACATLCFHILLCWYLVFKANFRIVGAALAIGLSYCLNAVILALYMRYSSSCEKTRVFIF  241

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
             +D F+ + EFF  A+P+  M CLEWW+FEI+ILL GLLPN ++ETSVLSICL I S H++
Sbjct  242   SDIFSCIKEFFSFALPTVVMFCLEWWSFEILILLSGLLPNSKLETSVLSICLTISSTHYF  301

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+ IGA ASTR+SNELGAGN   A++A   V ++ + E V+   +L   R V+ YAF++
Sbjct  302   IPYGIGAAASTRVSNELGAGNPQAAQLAACVVMVLAVTEAVIVGTILFCCRYVLAYAFNS  361

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             + +VV+Y+ +++PL+S  ++ D +  +LSGVARG+GWQH+GAYVNLGAYY+VG P A +L
Sbjct  362   DKDVVNYVSELVPLLSFSIIMDSLQSVLSGVARGTGWQHIGAYVNLGAYYIVGIPLASVL  421

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
              F+ +LRG GLW+G+ + S VQ +VLA+IT+ T+W+KQ   A+ER+   ++
Sbjct  422   CFVLNLRGKGLWIGIMIGSAVQAIVLAIITVTTNWRKQARMARERIFEGTY  472



>ref|XP_011099516.1| PREDICTED: MATE efflux family protein 5-like isoform X3 [Sesamum 
indicum]
Length=439

 Score =   508 bits (1308),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 253/475 (53%), Positives = 336/475 (71%), Gaps = 45/475 (9%)
 Frame = -2

Query  1600  MDAEVPLL--SEKRPAAAISK-DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHI  1430
             M+AEVPLL  S +   +   +      EL ++  IA+PM+VVT+ Q ++      MLGH+
Sbjct  1     MEAEVPLLTGSNRDSESGFRRWGTISRELNRVNFIALPMIVVTISQYLLRTSPIFMLGHL  60

Query  1429  SELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVV  1250
              ELSLS  ++ATS  NVTGFS++FGMASALETLCGQAYGAGQY ++GT+TYGAI+ L +V
Sbjct  61    DELSLSSASIATSLCNVTGFSVLFGMASALETLCGQAYGAGQYLRVGTFTYGAILCLFLV  120

Query  1249  AIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVP  1070
              IP+S+LW++ +K LIF GQDPLISAEAGK+++WLI  +FPYAILQ LVRYLQ QS+I+P
Sbjct  121   CIPVSLLWIYTEKLLIFFGQDPLISAEAGKFAIWLIPTLFPYAILQSLVRYLQTQSVIIP  180

Query  1069  MLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRV  890
             ML SS +SLCF + +CWA  F+  LG+AG AL+IG+SYW NVILLV+YV+YS++C+K+R 
Sbjct  181   MLWSSLVSLCFQLALCWAFIFKLNLGNAGAALSIGISYWVNVILLVLYVRYSTNCKKTRS  240

Query  889   CLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSL  710
                 D F  + EFF+ AIPSA M CLEWW+FE+VILL G+LPNPQ+ETSVLSICL I SL
Sbjct  241   SFSKDVFVIMREFFQFAIPSAVMVCLEWWSFELVILLSGVLPNPQLETSVLSICLTITSL  300

Query  709   HFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYA  530
             H++IP+S GA A                                          S++GYA
Sbjct  301   HYHIPYSFGAAA------------------------------------------SIMGYA  318

Query  529   FSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAA  350
             FS+E EVV+++++M+P + + ++ D +  +LSGVARGSGWQH+GAYVNLGAYYLVG P A
Sbjct  319   FSDEKEVVNHVQEMVPFLCISIIMDSLQAVLSGVARGSGWQHIGAYVNLGAYYLVGIPVA  378

Query  349   GMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHP  185
              +LGF+  L+G GLW GL   + VQ++ L+LIT  T+W+KQ  +A+ER+  +  P
Sbjct  379   LLLGFVLHLKGEGLWSGLVAGATVQSLSLSLITGLTNWEKQAREARERIFAEKSP  433



>ref|XP_007021414.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY12939.1| MATE efflux family protein [Theobroma cacao]
Length=616

 Score =   514 bits (1324),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 270/510 (53%), Positives = 356/510 (70%), Gaps = 10/510 (2%)
 Frame = -2

Query  1714  ESDSPLAHSAYIF--RCFPHPFSSKGAGGGDQRVNFLLPEMDAEVPLLSEKRPAAAISKD  1541
             ++ SP+A  A ++   C       +G   G   +NF+  E  AE+    E++   A+S  
Sbjct  112   QNPSPIAGYANLYGEHCV------RGNLFGVASINFIQGEAMAEMVETEERK--CAMSWG  163

Query  1540  VFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLI  1361
              ++ ELKK +RIA PM+ VTV Q ++  VS +M+GH+ +LSL+  A+ATS TNVTGFSL+
Sbjct  164   GYVEELKKASRIAAPMVAVTVLQYLLQVVSVIMVGHLGQLSLASVAIATSITNVTGFSLL  223

Query  1360  FGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPL  1181
              GMA  LETLCGQAYG+ QY KLG YTY A++SL +V  PI ILW+FMDK    VGQD L
Sbjct  224   SGMAGGLETLCGQAYGSRQYKKLGVYTYSAVISLILVCPPICILWIFMDKLFPLVGQDTL  283

Query  1180  ISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRS  1001
             IS +A +YS+WLI A+F  AIL+ L RYLQ QSLI+PMLL++   LCFH+PVCW L F+ 
Sbjct  284   ISRKARQYSLWLIPALFASAILKPLTRYLQTQSLILPMLLTAFFILCFHVPVCWTLVFKL  343

Query  1000  GLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASM  821
              LG  G A+A  LS W NVILL +YVKYSSSCEK+R  L  D+F  V EFFRL +P+A M
Sbjct  344   DLGDLGAAIAFSLSTWLNVILLGIYVKYSSSCEKTRSPLSKDAFLGVSEFFRLGVPAAIM  403

Query  820   ACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAG  641
              CL+WW+ E++ LL GLLPNP++ETSVLSICL + +LHF IP+  GA  STR+SNELGAG
Sbjct  404   VCLKWWSMELLTLLSGLLPNPKLETSVLSICLTLSTLHFTIPYGFGAATSTRVSNELGAG  463

Query  640   NTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLV  461
             N +LARMAV     +   E V+ +  L   R ++GYA+  E  VV  +  M PL+ + LV
Sbjct  464   NPELARMAVKVGMSMATTEAVIVSTALFFSRHIIGYAYCKEKPVVHEVAVMAPLLCISLV  523

Query  460   SDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASL  281
             +D +  +LSGVA+G GWQH+GAYVNLGA+YL+G P   MLGF+ +L+G GLW+G+   S+
Sbjct  524   TDSMQVVLSGVAKGCGWQHIGAYVNLGAFYLIGLPVGIMLGFVANLKGRGLWIGIVAGSI  583

Query  280   VQNVVLALITIFTDWKKQESKAQERLLNDS  191
             VQ ++L+L  IFT+WKKQ +KA+ER+   S
Sbjct  584   VQTILLSLFAIFTNWKKQVAKAKERIGRSS  613



>gb|KDO63183.1| hypothetical protein CISIN_1g011678mg [Citrus sinensis]
Length=479

 Score =   509 bits (1311),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 245/471 (52%), Positives = 341/471 (72%), Gaps = 3/471 (1%)
 Frame = -2

Query  1591  EVPLLSEKRPAAA---ISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             E PLL E R       +++  F+ ELKKL+ +A PM+ VTV Q ++  VS MM GH+ EL
Sbjct  2     EEPLLGESREEETKWVVTRGAFVEELKKLSFLAAPMVGVTVSQYLLPAVSLMMAGHLGEL  61

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +L+  A+ATSFTNVTG   +FG A ALETLCGQAYGA QY ++GTYTY A+     +  P
Sbjct  62    TLASVAIATSFTNVTGIIPLFGFACALETLCGQAYGAKQYQQIGTYTYSAMFFCIAICFP  121

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             IS+LW+FMDK LI +GQDP I+ EA  +S+ LI A+  +A+L+ L+  LQ QSLI+P+ L
Sbjct  122   ISVLWIFMDKVLILLGQDPEIATEACNFSISLIPALLAFAVLRPLIHNLQSQSLILPLFL  181

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             S+  +LCFHI +CW L F++     G ALAIGLSY  N ++L +Y++YSSSCEK+RV ++
Sbjct  182   SACATLCFHILLCWYLVFKANFRIVGAALAIGLSYCLNAVILALYMRYSSSCEKTRVFIF  241

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
             +D F+ + EFF  A+P+  M CLEWW+FEI+ILL GLLPN ++ETSVLSICL I S H++
Sbjct  242   SDIFSCIKEFFSFALPTVVMFCLEWWSFEILILLSGLLPNSKLETSVLSICLTISSTHYF  301

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+ IGA ASTR+SNELGAGN   A++A   V ++ + E V+   +L   R V+ YAF++
Sbjct  302   IPYGIGAAASTRVSNELGAGNPQAAQLAACVVMVLAVTEAVIVGTILFCCRYVLAYAFNS  361

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             + +VV+Y+ +++PL+S  ++ D +  +LSGVARG+GWQH+GAYVNLGAYY+VG P A +L
Sbjct  362   DKDVVNYVSELVPLLSFSIIMDSLQSVLSGVARGTGWQHIGAYVNLGAYYIVGIPLASVL  421

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
              F+ +LRG GLW+G+   S VQ +VLA+IT+ T+W+KQ   A+ER+   ++
Sbjct  422   CFVLNLRGKGLWIGIMTGSAVQAIVLAIITVTTNWRKQARMARERIFEGTY  472



>ref|XP_009357500.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=495

 Score =   509 bits (1312),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 252/480 (53%), Positives = 338/480 (70%), Gaps = 0/480 (0%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
             + LLP+   E          + ++   F  E+K+L  IA PM+ V + Q ++  +S MM+
Sbjct  4     SLLLPKRREEDQQQRRYSTTSILTWTSFFEEVKRLGCIAGPMVAVILSQNLLQVISMMMV  63

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL+LS  A+A S +NVTG S+  GMASALETLCGQAYGA QY KLG  TY AI SL
Sbjct  64    GHLGELALSSTAIAISLSNVTGLSVFLGMASALETLCGQAYGAEQYQKLGLQTYTAIFSL  123

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +V +P+S++W++M+K LIF+GQDP+IS EAGK+++WLI A+F YA LQ  +RY Q QSL
Sbjct  124   NLVCLPLSLIWIYMEKLLIFMGQDPVISREAGKFTIWLIPALFAYATLQPFIRYFQTQSL  183

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
             I+PML+SS  +L FHIP+CW L F+SGL + G ALAI +SYW NVILL +Y+K+S++C K
Sbjct  184   IIPMLVSSCATLLFHIPLCWLLVFKSGLNNLGGALAISISYWVNVILLALYMKFSAACSK  243

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +R  +  + F  +GEFF  AIPSA M CLEWW+FE++ILL GLLPNP +ETSVLS+CL  
Sbjct  244   TRAPISVEIFHGIGEFFHFAIPSAIMICLEWWSFELLILLSGLLPNPALETSVLSVCLQT  303

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              S  + IP+  GA ASTR+SNELGAGN   AR+A +    + + E  +    L + R+V 
Sbjct  304   ISTLYGIPYGFGAAASTRVSNELGAGNPQGARIATFAAMFLAVTEASIITTTLFACRNVF  363

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY FSNE EV+DY+  M PLV L +  D + G+LSG+ARG+GWQH+GAY+NLGA+YL G 
Sbjct  364   GYTFSNEKEVIDYVTTMAPLVCLSVTLDSLQGVLSGIARGTGWQHIGAYINLGAFYLCGI  423

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPA  179
             P A  L F   LRG GLW+G+ + + VQ ++L+L+T  T+W+KQ S A+ER+   S P A
Sbjct  424   PVAATLAFWVQLRGRGLWIGIQVGAFVQTMMLSLVTSCTNWEKQASMARERIFEGSPPQA  483



>ref|XP_010044144.1| PREDICTED: MATE efflux family protein 8-like [Eucalyptus grandis]
Length=489

 Score =   509 bits (1310),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 251/468 (54%), Positives = 334/468 (71%), Gaps = 2/468 (0%)
 Frame = -2

Query  1570  KRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATS  1391
             +R +  ++      E+K++  IA PM+VVT  Q ++  +   M+GH+ ELSLS  A+A S
Sbjct  21    ERKSDGLTCGGVTEEVKRVGSIAAPMVVVTSSQYLLQMICVTMVGHLGELSLSSTAIAIS  80

Query  1390  FTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDK  1211
                V+GFSL+ GMA+ALETLCGQAYGA QY KLGT TY AI SLT+V +P+S LW  M K
Sbjct  81    LAGVSGFSLLLGMATALETLCGQAYGAQQYQKLGTQTYTAIFSLTLVCVPLSFLWFNMGK  140

Query  1210  FLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHI  1031
              L+ +GQDPLIS EAG++  WL+ A+  YA LQ LVRY Q QSL  PML+ S+ +LC H+
Sbjct  141   LLLLMGQDPLISREAGRFIAWLVPALLAYATLQPLVRYFQTQSLTTPMLIGSSATLCLHV  200

Query  1030  PVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEF  851
             P+CW L F+SGL + G ALA+G+SYW NV  L +Y+ +SS+C+K+R  +  + F  + EF
Sbjct  201   PLCWVLVFKSGLHNVGAALALGISYWLNVTFLGLYMTFSSACQKTRAPVSMEIFRGIQEF  260

Query  850   FRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGAS  671
             FR A+PSA M CLEWW+FE++ILL GLLPNPQ+ETSVLS+CL   S  + IPF+IGA  S
Sbjct  261   FRFAVPSAVMICLEWWSFELLILLSGLLPNPQLETSVLSVCLSTTSTLYAIPFAIGAAGS  320

Query  670   TRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKK  491
             TR+SNELGAGN   AR+AV+ V +I + E  + + VL + R V GY FSNE EVVDY+ K
Sbjct  321   TRVSNELGAGNAQAARVAVYAVLLIAITETSITSAVLFATRKVFGYTFSNEKEVVDYVTK  380

Query  490   MIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMG  311
             M PLV L ++ D + G+LSG+ARG GWQH+GAYVNLGA+YL G P A  LGF   LRG+G
Sbjct  381   MSPLVCLSVIVDSLQGVLSGIARGCGWQHIGAYVNLGAFYLCGIPVAATLGFWVGLRGVG  440

Query  310   LWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             LW+G+   ++VQ  +L+++T  T+W+K   KA+ER+ + S   + DNG
Sbjct  441   LWIGIQAGAIVQTSLLSIVTCCTNWEKLAKKARERIFDGSF--SADNG  486



>ref|XP_004232020.1| PREDICTED: MATE efflux family protein 5-like [Solanum lycopersicum]
Length=471

 Score =   508 bits (1309),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 249/470 (53%), Positives = 330/470 (70%), Gaps = 0/470 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             M+ E+P   +      IS D    ELKK  RI  PM+ VTV Q ++  VS +M+GH+ +L
Sbjct  1     MEEELPQSLKLEKKWQISWDALSQELKKTNRIVAPMVAVTVFQYLLQVVSIIMVGHLGQL  60

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+ATS TNVTGFSL+ G+   LETLCGQAYGA QYHKL TYTY AI+SL +V +P
Sbjct  61    ALSSVAIATSLTNVTGFSLLSGLVGGLETLCGQAYGAKQYHKLSTYTYTAIISLFLVCLP  120

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             I +LW FMDK LI +GQD  IS EA KY++W I A+F  AI + LVRYLQ QSLI+PMLL
Sbjct  121   ICVLWFFMDKLLILIGQDHEISIEARKYALWAIPALFGGAISKPLVRYLQTQSLILPMLL  180

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS   LC H+P+ W   F+  LG+ G A+A  +S W  V+ L ++V +S+SCEK+R    
Sbjct  181   SSLAVLCLHLPISWGFIFKLELGNIGAAIAFSVSTWLYVLFLALHVSFSTSCEKTRTPFS  240

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              D F  + EFFRLA+PSA M CL+WW+ E++ LL GLLPNP +E SVLSICL I +LHF 
Sbjct  241   MDVFLGINEFFRLAVPSAVMVCLKWWSLEVLTLLSGLLPNPTLEASVLSICLTISTLHFT  300

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+  GA ASTR+SNELGAGN   ARMAV  V  + +IE VV +  +   R ++G  FSN
Sbjct  301   IPYGFGAAASTRVSNELGAGNPKRARMAVQVVMFLAVIETVVLSTSMFGSRHILGRGFSN  360

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E +VV+YI  M PL+ L +++D +  ++SG+ARGSGWQH+GAY+NLGA+YLV  P A +L
Sbjct  361   EKQVVEYIASMTPLLCLSIITDSLQAVISGIARGSGWQHIGAYINLGAFYLVAIPLAVVL  420

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             GF   ++  GLW+G+ + S +Q+++L+++T FTDW KQ  KA+ER+L  +
Sbjct  421   GFTLHMKAKGLWIGIVVGSTIQSIILSIVTCFTDWDKQAKKARERILEGT  470



>gb|EYU44602.1| hypothetical protein MIMGU_mgv1a022553mg [Erythranthe guttata]
Length=457

 Score =   508 bits (1307),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 252/474 (53%), Positives = 337/474 (71%), Gaps = 25/474 (5%)
 Frame = -2

Query  1600  MDAEVPLL--SEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHIS  1427
             M+ EVPLL   E R    I+      E  ++  IA+PM+VVTV Q ++      MLGH+S
Sbjct  1     MEKEVPLLKGEENRRWGPIA-----GEFNRVNFIALPMIVVTVSQFLLRVSPMFMLGHVS  55

Query  1426  ELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVA  1247
             +LSLSG ++ATS  NVTGFSL+                  QY ++GTYTYGA + L +V 
Sbjct  56    KLSLSGASIATSLCNVTGFSLL------------------QYRRVGTYTYGATLCLFLVC  97

Query  1246  IPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPM  1067
             +P+SILW++ +K LIF+GQDPLISAEAGK+++ LI  +FPYA+LQ LVRYLQ QSLI+PM
Sbjct  98    VPVSILWIYTEKILIFMGQDPLISAEAGKFAIQLIPTLFPYAVLQSLVRYLQTQSLILPM  157

Query  1066  LLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVC  887
             L SS  SLC  +P+CWA  F+  LGS G AL+IG+SYWFN+++LV+YVK SS+C+K+R  
Sbjct  158   LWSSLASLCLQLPLCWAFVFKFDLGSGGAALSIGISYWFNIVVLVLYVKCSSTCKKTRSS  217

Query  886   LWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLH  707
             L  D FA   EFFR A+PSA M CLEWW+FE+VILL G+LPNPQ+ETSVLSICL I SLH
Sbjct  218   LSRDVFATTREFFRFAVPSAVMVCLEWWSFELVILLSGMLPNPQLETSVLSICLTITSLH  277

Query  706   FYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAF  527
             ++IP+S GA AST ISNELG G  + A++A+  V ++ + E +VA+  +   R+++G+AF
Sbjct  278   YHIPYSFGAAASTLISNELGPGKPEAAKVALGAVLVLAVAEFLVASTTIYICRTILGFAF  337

Query  526   SNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAG  347
             S E EVV+ +++MIP + L ++ D +  +LSGVARGSGWQH+GAYVNLGAYYLVG P A 
Sbjct  338   SQEMEVVNGVEQMIPFLCLSIIMDSLQSVLSGVARGSGWQHIGAYVNLGAYYLVGIPVAL  397

Query  346   MLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHP  185
             +LGF+  L+G GLW GL   + VQ++   LIT  T+W+KQ  +A+ R+  +  P
Sbjct  398   LLGFVLKLKGEGLWSGLVAGATVQSLSFCLITALTNWEKQAEEARRRIFTEKFP  451



>ref|XP_006448326.1| hypothetical protein CICLE_v10015035mg [Citrus clementina]
 gb|ESR61566.1| hypothetical protein CICLE_v10015035mg [Citrus clementina]
Length=489

 Score =   509 bits (1310),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 243/474 (51%), Positives = 332/474 (70%), Gaps = 0/474 (0%)
 Frame = -2

Query  1624  RVNFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTM  1445
             R N     M+  + +  E   +++ +  V   E+KK   IA PM+ VT+ Q ++  VS M
Sbjct  2     RGNETEKNMEESLLIPKESLSSSSTTWGVLSGEVKKQGYIAAPMVAVTLSQYLLQVVSMM  61

Query  1444  MLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIM  1265
             M+GH+ +L+LS  A+A S  +VTGFS++ GMASALETLCGQAYGA QY ++GT TY AI 
Sbjct  62    MVGHLGQLALSSTAMAISLASVTGFSVLLGMASALETLCGQAYGAQQYQRIGTQTYTAIF  121

Query  1264  SLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQ  1085
              L +V  P+S LW++  K L+ +GQDPLIS E GK+ +WL+ A+F YA +Q L+RY Q Q
Sbjct  122   CLFLVCFPLSFLWIYAGKLLVLIGQDPLISHEVGKFMIWLLPALFAYATMQPLIRYFQSQ  181

Query  1084  SLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSC  905
             SLI+PM LSS  +LC HIP+CW+L ++SGLG+ G ALAIG+S W NV  L +Y+K+S++C
Sbjct  182   SLIIPMFLSSCAALCLHIPICWSLVYKSGLGNLGGALAIGISNWLNVTFLAIYMKFSTAC  241

Query  904   EKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICL  725
              +SRV +  + F  +GEFF  AIPSA M CLEWW+FE++IL+ GLLPNPQ+ETSVLS+CL
Sbjct  242   AESRVPISMELFQGIGEFFHFAIPSAVMICLEWWSFELLILMSGLLPNPQLETSVLSVCL  301

Query  724   MICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRS  545
                   + IP+ +GA  STR+SNELGAGN   AR+AV+ V  + + E +V +  L + R 
Sbjct  302   NTIQTLYAIPYGLGAAVSTRVSNELGAGNVQKARVAVYAVVFMAVTETIVVSATLFASRR  361

Query  544   VVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLV  365
             V GY FSNE +VVDY+  M PLV L ++ D + G+ SGVARG GWQ++ A+VNLGA+YL 
Sbjct  362   VFGYVFSNEKQVVDYVTTMAPLVCLSVIMDSLQGVFSGVARGCGWQNIAAFVNLGAFYLC  421

Query  364   GAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             G P A +LGF    RG GLW+G+   +  Q ++L +IT  T+W+KQ SKA+ER+
Sbjct  422   GIPTAAILGFWLKFRGRGLWIGIQAGAFTQTLLLGIITTCTNWEKQASKARERI  475



>gb|KCW86181.1| hypothetical protein EUGRSUZ_B02871 [Eucalyptus grandis]
Length=481

 Score =   508 bits (1308),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 251/468 (54%), Positives = 334/468 (71%), Gaps = 2/468 (0%)
 Frame = -2

Query  1570  KRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATS  1391
             +R +  ++      E+K++  IA PM+VVT  Q ++  +   M+GH+ ELSLS  A+A S
Sbjct  13    ERKSDGLTCGGVTEEVKRVGSIAAPMVVVTSSQYLLQMICVTMVGHLGELSLSSTAIAIS  72

Query  1390  FTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDK  1211
                V+GFSL+ GMA+ALETLCGQAYGA QY KLGT TY AI SLT+V +P+S LW  M K
Sbjct  73    LAGVSGFSLLLGMATALETLCGQAYGAQQYQKLGTQTYTAIFSLTLVCVPLSFLWFNMGK  132

Query  1210  FLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHI  1031
              L+ +GQDPLIS EAG++  WL+ A+  YA LQ LVRY Q QSL  PML+ S+ +LC H+
Sbjct  133   LLLLMGQDPLISREAGRFIAWLVPALLAYATLQPLVRYFQTQSLTTPMLIGSSATLCLHV  192

Query  1030  PVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEF  851
             P+CW L F+SGL + G ALA+G+SYW NV  L +Y+ +SS+C+K+R  +  + F  + EF
Sbjct  193   PLCWVLVFKSGLHNVGAALALGISYWLNVTFLGLYMTFSSACQKTRAPVSMEIFRGIQEF  252

Query  850   FRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGAS  671
             FR A+PSA M CLEWW+FE++ILL GLLPNPQ+ETSVLS+CL   S  + IPF+IGA  S
Sbjct  253   FRFAVPSAVMICLEWWSFELLILLSGLLPNPQLETSVLSVCLSTTSTLYAIPFAIGAAGS  312

Query  670   TRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKK  491
             TR+SNELGAGN   AR+AV+ V +I + E  + + VL + R V GY FSNE EVVDY+ K
Sbjct  313   TRVSNELGAGNAQAARVAVYAVLLIAITETSITSAVLFATRKVFGYTFSNEKEVVDYVTK  372

Query  490   MIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMG  311
             M PLV L ++ D + G+LSG+ARG GWQH+GAYVNLGA+YL G P A  LGF   LRG+G
Sbjct  373   MSPLVCLSVIVDSLQGVLSGIARGCGWQHIGAYVNLGAFYLCGIPVAATLGFWVGLRGVG  432

Query  310   LWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             LW+G+   ++VQ  +L+++T  T+W+K   KA+ER+ + S   + DNG
Sbjct  433   LWIGIQAGAIVQTSLLSIVTCCTNWEKLAKKARERIFDGSF--SADNG  478



>ref|XP_008389238.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Malus 
domestica]
Length=489

 Score =   508 bits (1308),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 255/477 (53%), Positives = 339/477 (71%), Gaps = 3/477 (1%)
 Frame = -2

Query  1588  VPLLSEKRPAAAI-SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLS  1412
             +P   E+R   +I +   F  E+K+L  IA PM+ V + Q ++  +S MM+GH+ EL+LS
Sbjct  7     LPKYGEERSNTSILTWSSFFEEVKRLGCIAGPMVAVVLSQYLLQVISMMMVGHLGELALS  66

Query  1411  GGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISI  1232
               A+A S + VTGFSL  GMASALETLCGQAYGA QY KLG  TY AI SL +V +P+S+
Sbjct  67    STAIAISLSGVTGFSLFLGMASALETLCGQAYGAEQYQKLGLQTYTAIFSLNLVCLPLSL  126

Query  1231  LWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSA  1052
             +W++M+K LIF+GQDP+IS EAGK+++WL+ A+F YA LQ L+RY Q QSL+ PML+SS 
Sbjct  127   IWIYMEKLLIFMGQDPVISREAGKFTIWLLPALFAYATLQPLIRYFQTQSLVXPMLISSC  186

Query  1051  LSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDS  872
              +L FHIP+CW L F+SG  + G ALAI +SYW NVIL  +Y+K+S +C K+RV +  + 
Sbjct  187   ATLLFHIPLCWLLVFKSGXNNLGGALAISISYWVNVILXALYMKFSDACSKTRVPISXEI  246

Query  871   FARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPF  692
             F  +GEFFR AIPSA M CLEWW+FE++ILL GLLPNP +ETSVLS+CL   S  + IP+
Sbjct  247   FHGIGEFFRFAIPSAIMICLEWWSFELLILLSGLLPNPALETSVLSVCLQTISTLYAIPY  306

Query  691   SIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETE  512
               GA ASTR+SNELGAGN   AR+A +    + + E  +    L + R+V GY FSNE E
Sbjct  307   GFGAAASTRVSNELGAGNPQGARIATFAAMFLAVAETSIITTTLFACRNVFGYTFSNEKE  366

Query  511   VVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFL  332
             V+DY+  M PLV L +  D   G+LSG+ARG+GWQH+GAY+NLGA+YL G P A  L F 
Sbjct  367   VIDYVXXMAPLVCLSVTLDSFQGVLSGIARGTGWQHIGAYINLGAFYLCGIPVAATLAFW  426

Query  331   TSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNGGC  161
               LRG GLW+G+ + + VQ ++L+L+T  T+W+KQ SKA+ER+  +  P  V NG C
Sbjct  427   VQLRGRGLWIGIQVGAFVQTMMLSLVTSCTNWEKQASKARERIF-EGRPQQV-NGLC  481



>ref|XP_007033147.1| MATE efflux family protein, putative [Theobroma cacao]
 gb|EOY04073.1| MATE efflux family protein, putative [Theobroma cacao]
Length=477

 Score =   507 bits (1306),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 246/478 (51%), Positives = 338/478 (71%), Gaps = 3/478 (1%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             MD  +    E R    I+ +    E KK++ +A P + V + Q ++  VS MM GH+ EL
Sbjct  1     MDEALLPKKEGRIWEIITWEALGEEFKKVSFVAAPFVAVALSQYLLQVVSMMMAGHLGEL  60

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LSG A+ATSF NVTGFSL++G+  ALETL GQAYGA QY KLG+YTY AI+S   + +P
Sbjct  61    ALSGAAIATSFCNVTGFSLLWGLCGALETLNGQAYGAMQYQKLGSYTYCAIISTLPICLP  120

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             + +LW++MDK L+ +GQDP  +  A +YS+WLI A+F YAILQ  VR+ Q QSL++PML 
Sbjct  121   VCLLWMYMDKLLVLIGQDPQAAVVACRYSMWLIPALFAYAILQSQVRFFQSQSLVLPMLF  180

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
              S  +LCFHIPVCW L F+SGLG+ G A+AI  SYWFNVILL +Y++YSSSCEK+R+   
Sbjct  181   ISLATLCFHIPVCWVLVFKSGLGNTGAAMAISFSYWFNVILLGLYMRYSSSCEKTRILYL  240

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
             ND    V EFF+ AIPSA MACLEWW+FEI++L+ GLLPN ++ETSVLSICL   SLH+ 
Sbjct  241   NDVILSVKEFFQFAIPSAVMACLEWWSFEILVLMSGLLPNSKLETSVLSICLSSTSLHYN  300

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             +PF I   ASTRI+NELGAGN   A++  + V  + ++E V+A+ +L   R + GYA+SN
Sbjct  301   VPFGISVAASTRIANELGAGNPLTAQINSFIVVALTVVETVIASTILFCCRHIFGYAYSN  360

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E +VV+ + +++PL+ L +++DG+  +  G+ RG GWQH+GAY NL AYYL+G PA  + 
Sbjct  361   EKDVVNKVTEIVPLMCLSIITDGLHAVACGIVRGIGWQHIGAYANLAAYYLIGIPAGVLC  420

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             GF+  LRG GLW+G+   S VQ ++LA +  FT+WKKQ   A++R+   ++    +NG
Sbjct  421   GFVLHLRGQGLWVGMLTGSSVQGILLAFVIAFTNWKKQAIGARKRVFQGTYA---ENG  475



>ref|XP_009357535.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=495

 Score =   507 bits (1306),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 252/482 (52%), Positives = 339/482 (70%), Gaps = 0/482 (0%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
             + LLP+   E          + ++   F  E+K L  IA PM+ V + Q ++  +S MM+
Sbjct  4     SLLLPKRREEEQQQRRNSTTSILTWTSFFEEVKWLGCIAGPMVAVILSQSLLPVISMMMV  63

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL+LS  AVA S +NVTGFSL  GMASALETLCGQAYGA QY KLG +TY AI SL
Sbjct  64    GHLGELALSSSAVAISLSNVTGFSLFLGMASALETLCGQAYGAEQYQKLGLHTYTAIFSL  123

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +V +P+S++W++M+K LIF+GQDP+IS EAGK+++WLI A+F YA +Q L+RY Q QSL
Sbjct  124   NLVCLPLSLIWIYMEKLLIFMGQDPVISREAGKFTIWLIPALFAYATIQPLIRYFQTQSL  183

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
             I+PML+SS  +L FHIP+CW L F+SGL + G ALAI +SYW N ILL +Y+K+S++C K
Sbjct  184   IIPMLISSCATLLFHIPLCWLLVFKSGLNNLGGALAISISYWVNAILLGLYMKFSATCSK  243

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +R  +  + F  +GEFFR AIPSA M CL+WW++E++ILL GLL NP  ETSVLS+CL  
Sbjct  244   TRAPISMEVFHGIGEFFRFAIPSAIMICLQWWSYELIILLSGLLSNPAFETSVLSVCLQT  303

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              S  + +P+   A ASTR+SNELGAGN   AR+A + V  + + E+ +  + L + R+V 
Sbjct  304   ISTLYAMPYGFAAAASTRVSNELGAGNPQGARIATFSVMFLAVAEISITTMTLFACRNVF  363

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY FSNE EV+DY+  M PLV L    D + G+LSG+ARG+GWQH+GAY+NLGA YL G 
Sbjct  364   GYTFSNEKEVIDYVTTMAPLVCLAAALDSLQGVLSGIARGTGWQHIGAYINLGACYLCGI  423

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPA  179
             P A  L F   LRG GLW+G+ + + VQ V+L+ +TI T+W+KQ +KA+ER+   S P  
Sbjct  424   PVAATLAFWVQLRGRGLWIGIQVGAFVQTVMLSFVTIGTNWEKQATKARERIFEGSSPQV  483

Query  178   VD  173
              D
Sbjct  484   ND  485



>ref|XP_006468794.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Citrus 
sinensis]
Length=491

 Score =   506 bits (1304),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 242/474 (51%), Positives = 331/474 (70%), Gaps = 0/474 (0%)
 Frame = -2

Query  1624  RVNFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTM  1445
             R N     M+  + +  E   +++ +  V   E+KK   IA PM+ VT+ Q ++  VS M
Sbjct  2     RGNETEKNMEESLLIPKESLSSSSTTWGVLSGEVKKQGYIAAPMVAVTLSQYLLQVVSMM  61

Query  1444  MLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIM  1265
             M+GH+ +L+LS  A+A S  +VTGFS++ GMASALETLCGQAYGA QY ++GT TY AI 
Sbjct  62    MVGHLGQLALSSTAMAISLASVTGFSVLLGMASALETLCGQAYGAQQYQRIGTQTYTAIF  121

Query  1264  SLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQ  1085
              L +V  P+S LW++  K L+ +GQDPLIS E GK+ +WL+ A+F YA +Q L+RY Q Q
Sbjct  122   CLFLVCFPLSFLWIYAGKLLVLIGQDPLISHEVGKFMIWLLPALFAYATMQPLIRYFQSQ  181

Query  1084  SLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSC  905
             SLI+PM LSS  +LC HIP+CW+L ++SGLG+ G ALAIG+S W NV  L +Y+K+S++C
Sbjct  182   SLIIPMFLSSCAALCLHIPICWSLVYKSGLGNLGGALAIGISNWLNVTFLAIYMKFSTAC  241

Query  904   EKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICL  725
              +SRV +  + F  +GEFF  AIPSA M CLEWW+FE++IL+ GLLPNPQ+ETSVLS+CL
Sbjct  242   AESRVPISMELFQGIGEFFHFAIPSAVMICLEWWSFELLILMSGLLPNPQLETSVLSVCL  301

Query  724   MICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRS  545
                   + IP+ +GA  STR+SNELGAGN    R+AV+ V  + + E +V +  L + R 
Sbjct  302   NTIQTLYAIPYGLGAAVSTRVSNELGAGNVQKTRVAVYAVVFMAVTETMVVSATLFASRR  361

Query  544   VVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLV  365
             V GY FSNE +VVDY+  M PLV L ++ D + G+ SGVARG GWQ++ A+VNLGA+YL 
Sbjct  362   VFGYVFSNEKQVVDYVTTMAPLVCLSVIMDSLQGVFSGVARGCGWQNIAAFVNLGAFYLC  421

Query  364   GAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             G P A +LGF    RG GLW+G+   +  Q ++L +IT  T+W+KQ SKA+ER+
Sbjct  422   GIPTAAILGFWLKFRGRGLWIGIQAGAFTQTLLLGIITTCTNWEKQASKARERI  475



>gb|KDO64763.1| hypothetical protein CISIN_1g011296mg [Citrus sinensis]
Length=489

 Score =   506 bits (1304),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 242/474 (51%), Positives = 331/474 (70%), Gaps = 0/474 (0%)
 Frame = -2

Query  1624  RVNFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTM  1445
             R N     M+  + +  E   +++ +  V   E+KK   IA PM+ VT+ Q ++  VS M
Sbjct  2     RGNETEKNMEESLLIPKESLSSSSTTWGVLSGEVKKQGYIAAPMVAVTLSQYLLQVVSMM  61

Query  1444  MLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIM  1265
             M+GH+ +L+LS  A+A S  +VTGFS++ GMASALETLCGQAYGA QY ++GT TY AI 
Sbjct  62    MVGHLGQLALSSTAMAISLASVTGFSVLLGMASALETLCGQAYGAQQYQRIGTQTYTAIF  121

Query  1264  SLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQ  1085
              L +V  P+S LW++  K L+ +GQDP IS E GK+ +WL+ A+F YA +Q L+RY Q Q
Sbjct  122   CLFLVCFPLSFLWIYAGKLLVLIGQDPQISHEVGKFMIWLLPALFAYATMQPLIRYFQSQ  181

Query  1084  SLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSC  905
             SLI+PM LSS  +LC HIP+CW+L ++SGLG+ G ALAIG+S W NV  L +Y+K+S++C
Sbjct  182   SLIIPMFLSSCAALCLHIPICWSLVYKSGLGNLGGALAIGISNWLNVTFLAIYMKFSTAC  241

Query  904   EKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICL  725
              +SRV +  + F  +GEFF  AIPSA M CLEWW+FE++IL+ GLLPNPQ+ETSVLS+CL
Sbjct  242   AESRVPISMELFQGIGEFFHFAIPSAVMICLEWWSFELLILMSGLLPNPQLETSVLSVCL  301

Query  724   MICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRS  545
                   + IP+ +GA  STR+SNELGAGN   AR+AV+ V  + + E +V +  L + R 
Sbjct  302   NTIQTLYAIPYGLGAAVSTRVSNELGAGNVQKARVAVYAVIFMAVTETIVVSATLFASRR  361

Query  544   VVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLV  365
             V GY FSNE +VVDY+  M PLV L ++ D + G+ SGVARG GWQ++ A+VNLGA+YL 
Sbjct  362   VFGYVFSNEKQVVDYVTTMAPLVCLSVIMDSLQGVFSGVARGCGWQNIAAFVNLGAFYLC  421

Query  364   GAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             G P A +LGF    RG GLW+G+   +  Q ++L +IT  T+W+KQ SKA+ER+
Sbjct  422   GIPTAAILGFWLKFRGRGLWIGIQAGAFTQTLLLGIITTCTNWEKQASKARERI  475



>ref|XP_011021312.1| PREDICTED: MATE efflux family protein 6-like isoform X2 [Populus 
euphratica]
Length=479

 Score =   505 bits (1301),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 257/482 (53%), Positives = 348/482 (72%), Gaps = 9/482 (2%)
 Frame = -2

Query  1612  LLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             LLP+   E     EKR   A++ D  + EL++++ +A PM VV+V   ++  VS +M GH
Sbjct  5     LLPKSTTE-----EKR--WALTWDALVEELRRVSCLAAPMTVVSVTLYLLQVVSMIMAGH  57

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
             +SELSLSG ++ATSFTNVTGFSL+ G +  LETLCGQ YGA QY K G+YTY AI+SL V
Sbjct  58    LSELSLSGVSMATSFTNVTGFSLLAGFSGGLETLCGQTYGAEQYKKFGSYTYCAIISLIV  117

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
              +IP+S+LW FMD+ LI VG D  IS  A KY++WLI A+F +AILQ L+RY Q QSLI 
Sbjct  118   TSIPVSVLWTFMDRLLIAVGIDSEISTVACKYAIWLIPALFAFAILQPLLRYFQTQSLIY  177

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             P+L+S+  +LCFHIP+CWAL ++  LG+ G ALAIG+SYW NVILLV+Y+ +SSSCEK+R
Sbjct  178   PILVSTCAALCFHIPLCWALVYKWELGNIGGALAIGVSYWLNVILLVLYMVFSSSCEKTR  237

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
                W+D F+ + +FFR A PSA M CLEWWT+E+VILL GLLP+P+++TSVLSICL   +
Sbjct  238   RLYWDDIFSSINKFFRFAFPSAVMICLEWWTYELVILLAGLLPDPKLQTSVLSICLATTT  297

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
             LHFY+ + I A  STR+SNELGAGN   A++AV  V I+ ++E+V  +++L   R + GY
Sbjct  298   LHFYVQYGIAASGSTRVSNELGAGNPQAAQVAVQVVLIMSLVEVVTVSLILFFFRHIFGY  357

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             AFS+E  VVD + ++ PL+ L ++ +G+  +LSG+ARG GWQH+GA++NLGAYYLV  P 
Sbjct  358   AFSSEKRVVDCVAELAPLMCLSIIIEGLQAVLSGIARGCGWQHIGAFINLGAYYLVATPV  417

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVD  173
             A +L F+  L   GLWMGL +   VQ +  + IT  T+W+KQ ++A+E +L  S     D
Sbjct  418   AVVLCFVLHLGSRGLWMGLLIGKTVQALCFSSITALTNWQKQATEAKETILGRSL--LAD  475

Query  172   NG  167
             NG
Sbjct  476   NG  477



>ref|XP_011099515.1| PREDICTED: MATE efflux family protein 9-like isoform X2 [Sesamum 
indicum]
Length=446

 Score =   503 bits (1296),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 252/475 (53%), Positives = 339/475 (71%), Gaps = 38/475 (8%)
 Frame = -2

Query  1600  MDAEVPLL--SEKRPAAAISK-DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHI  1430
             M+AEVPLL  S +   +   +      EL ++  IA+PM+VVT+ Q ++      MLGH+
Sbjct  1     MEAEVPLLTGSNRDSESGFRRWGTISRELNRVNFIALPMIVVTISQYLLRTSPIFMLGHL  60

Query  1429  SELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVV  1250
              ELSLS  ++ATS  NVTGFS++FGMASALETLCGQAYGAGQY ++GT+TYGAI+ L +V
Sbjct  61    DELSLSSASIATSLCNVTGFSVLFGMASALETLCGQAYGAGQYLRVGTFTYGAILCLFLV  120

Query  1249  AIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVP  1070
              IP+S+LW++ +K LIF GQDPLISAEAGK+++WLI  +FPYAILQ LVRYLQ QS+I+P
Sbjct  121   CIPVSLLWIYTEKLLIFFGQDPLISAEAGKFAIWLIPTLFPYAILQSLVRYLQTQSVIIP  180

Query  1069  MLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRV  890
             ML SS +SLCF + +CWA  F+  LG+AG AL+IG+SYW NVILLV+YV           
Sbjct  181   MLWSSLVSLCFQLALCWAFIFKLNLGNAGAALSIGISYWVNVILLVLYVS----------  230

Query  889   CLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSL  710
                                      LEWW+FE+VILL G+LPNPQ+ETSVLSICL I SL
Sbjct  231   -------------------------LEWWSFELVILLSGVLPNPQLETSVLSICLTITSL  265

Query  709   HFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYA  530
             H++IP+S GA AST +SNELGAG    AR+A+  V ++ + E ++A++ +   RS++GYA
Sbjct  266   HYHIPYSFGAAASTLVSNELGAGKPQAARLALCSVLVLSVAEFLIASITIYICRSIMGYA  325

Query  529   FSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAA  350
             FS+E EVV+++++M+P + + ++ D +  +LSGVARGSGWQH+GAYVNLGAYYLVG P A
Sbjct  326   FSDEKEVVNHVQEMVPFLCISIIMDSLQAVLSGVARGSGWQHIGAYVNLGAYYLVGIPVA  385

Query  349   GMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHP  185
              +LGF+  L+G GLW GL   + VQ++ L+LIT  T+W+KQ  +A+ER+  +  P
Sbjct  386   LLLGFVLHLKGEGLWSGLVAGATVQSLSLSLITGLTNWEKQAREARERIFAEKSP  440



>ref|XP_007033156.1| MATE efflux family protein, putative [Theobroma cacao]
 gb|EOY04082.1| MATE efflux family protein, putative [Theobroma cacao]
Length=477

 Score =   504 bits (1299),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 247/451 (55%), Positives = 324/451 (72%), Gaps = 0/451 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F  ELK ++ IA+PM+ V V Q +   +  MM+GH+ EL+LSG A+A+S TNVTGFS + 
Sbjct  21    FWEELKMVSYIAVPMVAVMVSQYLSQVILLMMVGHLGELALSGIAIASSVTNVTGFSFVV  80

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
              MA ALETLCGQAYGA QY KLGTYT  +++S+  V IPI  LW+FMD+ L+ +GQD  +
Sbjct  81    IMAGALETLCGQAYGAQQYQKLGTYTNCSMVSIIPVCIPICFLWIFMDQLLVLLGQDFEV  140

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             +  A  YS+WLI  +F Y  LQ L+RY   Q LI PM LSS  +LC HIPVCW L  ++ 
Sbjct  141   AMVACSYSIWLIPGLFAYPFLQSLIRYFHCQGLIPPMFLSSCAALCLHIPVCWILLHKTN  200

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             LG  G AL+ GLS+WFNV+LL +Y++YSSSCEKSR  ++ND F  + EFF  A+PSA M 
Sbjct  201   LGIIGAALSTGLSFWFNVVLLGIYMRYSSSCEKSRALIFNDIFLSIKEFFSFALPSAVMF  260

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW+FE++ILL GLLP+  +ETSVLSICL   S H+ +P+ I A ASTR+SNELGAGN
Sbjct  261   CLEWWSFEVLILLSGLLPDSVLETSVLSICLTTTSFHYLVPYGISAAASTRVSNELGAGN  320

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
                AR++V    ++  IE ++ A+ L   R V GY FSNE EVV+Y+++MIPL+ + ++ 
Sbjct  321   PQAARLSVSAAMVLAAIEPIMVAITLFCCRYVYGYLFSNEKEVVNYVREMIPLLCISVIM  380

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D +  +LSGVARG+GWQH+GAYVNLGAYYL+G P A +L F  +LRG GLW+G+   S V
Sbjct  381   DSVQAVLSGVARGTGWQHIGAYVNLGAYYLLGVPVAVVLCFALNLRGKGLWIGILAGSTV  440

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDSHP  185
             Q  +LAL+T  T+W+KQ S A+ER+L  S P
Sbjct  441   QASLLALVTGLTNWQKQASNARERMLEGSVP  471



>ref|XP_002887351.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63610.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=481

 Score =   504 bits (1299),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 253/470 (54%), Positives = 335/470 (71%), Gaps = 1/470 (0%)
 Frame = -2

Query  1600  MD-AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             MD AE  LL          KD FL E+K+L  IA PM+ V     ++  +S MM+GH+ E
Sbjct  1     MDSAEKGLLVVSHGEEVNKKDGFLREMKRLGYIAGPMIAVNSSMYVLQVISIMMVGHLGE  60

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+A SF +VTGFS++FG+ASALETLCGQA GA Q+ KLG +TY  I+SL +V I
Sbjct  61    LFLSSTAIAVSFCSVTGFSVVFGLASALETLCGQANGAKQFEKLGVHTYTGIVSLFLVCI  120

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW +M   L  +GQDP+++ +AGK++ WLI A+F YAILQ LVR+ Q QSLI+P++
Sbjct  121   PLSVLWSYMGDILSLIGQDPMVAQQAGKFATWLIPALFGYAILQPLVRFFQAQSLILPLI  180

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  SLC H+ +CW+L F+ GLGS G A+AIG+SYW NVI+L +Y+ +SSSC KSR  +
Sbjct  181   MSSVSSLCVHVVLCWSLVFKFGLGSVGAAIAIGVSYWLNVIVLGLYMTFSSSCSKSRATI  240

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                 F  +GEFFR  IPSASM CLEWW+FE ++LL G+LPNP++E SVLS+CL   +  +
Sbjct  241   SMSLFEGMGEFFRFGIPSASMICLEWWSFEFLVLLSGILPNPKLEASVLSVCLSTQASLY  300

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
              IP S+GA ASTR++NELGAGN   AR AV+ V +I  +E ++   ++   R+V GY FS
Sbjct  301   QIPESLGAAASTRVANELGAGNPKQARKAVYTVMVITSVESIMVGAIVFGARNVFGYLFS  360

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +ETEVVDY+K M PLVSL ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +
Sbjct  361   SETEVVDYVKTMAPLVSLSVIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLFGIPTAII  420

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             L F   + G GLW+G+ + S VQ V+L LI I T+WKKQ  KA+ER++ D
Sbjct  421   LAFGFKMIGRGLWIGITVGSFVQAVLLGLIVILTNWKKQARKARERVMGD  470



>ref|XP_011022869.1| PREDICTED: MATE efflux family protein 5-like [Populus euphratica]
 ref|XP_011022874.1| PREDICTED: MATE efflux family protein 5-like [Populus euphratica]
Length=492

 Score =   505 bits (1300),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 246/475 (52%), Positives = 336/475 (71%), Gaps = 5/475 (1%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
               LLPE  ++     E R   A +   F  E K+LA IA PM+V T    +++ +S MM+
Sbjct  12    RLLLPEKRSK-----EGREGIAQTWREFTQEAKRLAYIAGPMVVTTTALNLLLVISNMMV  66

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL+LS  A+A S  NVTG SL+ GMASALETLCGQAYGA QY K+G  TYGA+ SL
Sbjct  67    GHLGELALSSSAIAISLCNVTGISLLNGMASALETLCGQAYGAQQYRKVGNQTYGAMFSL  126

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +VA+ +S++W+ M+K LI +GQDP+I+ EAG++++WLI  IF YA  Q L RYLQ+QS+
Sbjct  127   ILVALVVSLVWINMEKLLILIGQDPIIAHEAGQFTLWLIPTIFAYATFQPLSRYLQVQSI  186

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
              +PML+SS ++L  HIP+CW L F+SGL + G ALA+G+SYW N I L++YVK S +C K
Sbjct  187   TIPMLVSSCVTLLLHIPLCWLLVFKSGLRNLGGALAVGISYWLNAIFLILYVKNSPACAK  246

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +RV +  + F  +GEF R AIPSA M CL+WW++EIVILL GLL NP++ETSVLS+CL  
Sbjct  247   TRVPISIELFQGIGEFVRFAIPSAMMICLQWWSYEIVILLSGLLSNPRLETSVLSVCLTT  306

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
                 + IP+ + A ASTR+SNELGAG    AR+A + V I+ +IEL + +  L + R + 
Sbjct  307   IGTLYSIPYGLSAAASTRVSNELGAGRPQAARIAAYSVMILAIIELFIVSGTLFATRHIF  366

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY+FSNE EVVDY+  M PLV L ++ DG+ G+LSGVARG GWQH+GA VNL A YL G 
Sbjct  367   GYSFSNEREVVDYVSNMAPLVCLSVIIDGLQGVLSGVARGCGWQHIGASVNLAALYLCGV  426

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             P A +LG+   L+  GLW+G+   +++Q V+L+L+T  T+W+KQ  +A+ER+  +
Sbjct  427   PVAAILGYWLQLKARGLWIGIQAGAILQTVLLSLVTSCTNWEKQARQARERVFEE  481



>ref|XP_006478384.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Citrus 
sinensis]
Length=448

 Score =   503 bits (1295),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 247/452 (55%), Positives = 323/452 (71%), Gaps = 20/452 (4%)
 Frame = -2

Query  1540  VFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLI  1361
             V L E+KK++ IA PM+ VTV Q ++  VS +M+GH+ ELSLSG ++ATSFT+VTGFSL+
Sbjct  7     VSLKEIKKVSSIAAPMVAVTVLQYLLQVVSVIMVGHLDELSLSGASIATSFTSVTGFSLL  66

Query  1360  FGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPL  1181
             FGMASALETLCGQAYGA Q+ KLG YT+ +I+SL +V  PIS+LW+F DK LI VGQDP 
Sbjct  67    FGMASALETLCGQAYGAEQFQKLGIYTHCSIISLIIVCFPISLLWIFTDKLLILVGQDPS  126

Query  1180  ISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRS  1001
             IS  A KY+++LI  +F YA+LQ  +R+ Q+QSLI+PML SS L+LCFHIP+CWAL F+ 
Sbjct  127   ISRIAKKYAIFLIPNLFSYAVLQSFIRFFQVQSLILPMLYSSVLTLCFHIPLCWALVFKI  186

Query  1000  GLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASM  821
              LGS G ALA+GLSYWFNV+LL  Y+K SS CEK+R     D F+ + EF R A+PSA M
Sbjct  187   KLGSNGAALAVGLSYWFNVLLLGFYIKCSSECEKTRASFSIDVFSSIKEFIRFAVPSAVM  246

Query  820   ACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAG  641
              C EWW++E++ILL GLLPNP++E SV S+C                   TR+SNELGAG
Sbjct  247   VCFEWWSYEVLILLSGLLPNPKLEASVFSLC-------------------TRVSNELGAG  287

Query  640   NTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLV  461
             N   A+MAV  + I+   E+V  ++VL+  R ++GYA S+  ++V  +  M+P + L ++
Sbjct  288   NPKAAKMAVCAIIILAAAEMVTVSIVLLFCRHILGYALSSSEDIVHRLADMVPFICLSII  347

Query  460   SDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASL  281
              D +  +LSGVARGSGWQ +GA+VNLGAYYLVG P A +L F+  L+G GL +GL   S 
Sbjct  348   MDSLQAVLSGVARGSGWQKIGAFVNLGAYYLVGIPIAAVLAFVFQLKGKGLLIGLATGSF  407

Query  280   VQNVVLALITIFTDWKKQESKAQERLLN-DSH  188
             VQ  +LAL  +FTDW KQ SKA+ER+   DS 
Sbjct  408   VQAALLALKIVFTDWGKQASKARERIFEGDSQ  439



>gb|KDO63185.1| hypothetical protein CISIN_1g011678mg [Citrus sinensis]
Length=474

 Score =   504 bits (1297),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 244/469 (52%), Positives = 337/469 (72%), Gaps = 3/469 (1%)
 Frame = -2

Query  1591  EVPLLSEKRPAAA---ISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             E PLL E R       +++  F+ ELKKL+ +A PM+ VTV Q ++  VS MM GH+ EL
Sbjct  2     EEPLLGESREEETKWVVTRGAFVEELKKLSFLAAPMVGVTVSQYLLPAVSLMMAGHLGEL  61

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +L+  A+ATSFTNVTG   +FG A ALETLCGQAYGA QY ++GTYTY A+     +  P
Sbjct  62    TLASVAIATSFTNVTGIIPLFGFACALETLCGQAYGAKQYQQIGTYTYSAMFFCIAICFP  121

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             IS+LW+FMDK LI +GQDP I+ EA  +S+ LI A+  +A+L+ L+  LQ QSLI+P+ L
Sbjct  122   ISVLWIFMDKVLILLGQDPEIATEACNFSISLIPALLAFAVLRPLIHNLQSQSLILPLFL  181

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             S+  +LCFHI +CW L F++     G ALAIGLSY  N ++L +Y++YSSSCEK+RV ++
Sbjct  182   SACATLCFHILLCWYLVFKANFRIVGAALAIGLSYCLNAVILALYMRYSSSCEKTRVFIF  241

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
             +D F+ + EFF  A+P+  M CLEWW+FEI+ILL GLLPN ++ETSVLSICL I S H++
Sbjct  242   SDIFSCIKEFFSFALPTVVMFCLEWWSFEILILLSGLLPNSKLETSVLSICLTISSTHYF  301

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+ IGA ASTR+SNELGAGN   A++A   V ++ + E V+   +L   R V+ YAF++
Sbjct  302   IPYGIGAAASTRVSNELGAGNPQAAQLAACVVMVLAVTEAVIVGTILFCCRYVLAYAFNS  361

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             + +VV+Y+ +++PL+S  ++ D +  +LSGVARG+GWQH+GAYVNLGAYY+VG P A +L
Sbjct  362   DKDVVNYVSELVPLLSFSIIMDSLQSVLSGVARGTGWQHIGAYVNLGAYYIVGIPLASVL  421

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
              F+ +LRG GLW+G+   S VQ +VLA+IT+ T+W+KQ S +     N 
Sbjct  422   CFVLNLRGKGLWIGIMTGSAVQAIVLAIITVTTNWRKQVSSSFHSFFNK  470



>emb|CBI26941.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   503 bits (1294),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 246/436 (56%), Positives = 324/436 (74%), Gaps = 0/436 (0%)
 Frame = -2

Query  1495  MLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAY  1316
             M+ V + Q +V  VS MM+GH+ EL+LS  A+A S + V+GFSL+ GMASALETLCGQAY
Sbjct  1     MVAVVLSQYLVQVVSVMMVGHLGELALSSTAIAISLSGVSGFSLLLGMASALETLCGQAY  60

Query  1315  GAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISA  1136
             GA QY KLGT TY AI SL +V +P+S++W++M K L F+GQDPLIS EAGK+++WL+ A
Sbjct  61    GAKQYSKLGTQTYTAIFSLFLVCLPLSVIWIYMGKLLTFMGQDPLISYEAGKFTMWLVPA  120

Query  1135  IFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSY  956
             +F YA LQ LVRY Q QSL +PMLLSS  +LCFH+P+CW L F+SGLG+ G ALAI +SY
Sbjct  121   LFAYATLQPLVRYFQTQSLTMPMLLSSCAALCFHMPLCWVLVFKSGLGNLGAALAISISY  180

Query  955   WFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLG  776
             W N I LV+Y+KYSS+CEK+RV +  + F  +GEFFR AIPSA M CLEWW+FE++ILL 
Sbjct  181   WLNAIFLVLYMKYSSACEKTRVPVSMEVFQGMGEFFRFAIPSAVMICLEWWSFELLILLS  240

Query  775   GLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTII  596
             GLLPNP++ETSVLS+CL   S  + IP+ +GA  STR+SNELGAGN   AR+AV+ +  +
Sbjct  241   GLLPNPELETSVLSVCLNTISTLYTIPYGLGAAGSTRVSNELGAGNPQKARLAVYALMFL  300

Query  595   GMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGS  416
              + E  + +  L + R V GY FSNE EVVDY+  M PLV L ++ D + G+LSGVARG 
Sbjct  301   AVTETALVSTTLFASRRVFGYLFSNEKEVVDYVTNMSPLVCLSVILDSMQGVLSGVARGC  360

Query  415   GWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDW  236
             GWQH+GA++NLGA+YL G P A  L F   LRG GLW+G+   +L+Q  +L ++T FT+W
Sbjct  361   GWQHIGAFINLGAFYLCGIPVAATLAFWLQLRGRGLWIGIQTGALLQTTLLCVMTGFTNW  420

Query  235   KKQESKAQERLLNDSH  188
             +K  +KA++R+    +
Sbjct  421   EKLATKARQRIFEGRY  436



>ref|XP_006603046.1| PREDICTED: MATE efflux family protein DTX1-like [Glycine max]
Length=480

 Score =   504 bits (1297),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 242/449 (54%), Positives = 327/449 (73%), Gaps = 1/449 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             ELKK+  IA PM+V +V Q ++  VS +M+GH+++LSLS  A+A S TNV+GFS++ GMA
Sbjct  22    ELKKVGTIAAPMVVASVLQYLLQVVSLVMVGHLNQLSLSSVAIAISLTNVSGFSVLSGMA  81

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
               LETLCGQA+GAGQY K G YTY A++SL+++  PI+ILW FMDK L  +GQDP IS E
Sbjct  82    GGLETLCGQAFGAGQYEKFGQYTYTAVISLSLICFPITILWTFMDKILTLLGQDPTISLE  141

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             A KY++WLI A+F  AIL+ L R+ Q QSLI PM+L+SA++LCFH   CW L F+  LG 
Sbjct  142   ARKYAIWLIPALFGSAILKPLTRFFQTQSLISPMILTSAIALCFHGATCWTLVFKLELGH  201

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
              G A++  L  WFNV+LL+ +V+YSS+CEK+R+    ++   VG FFR A+P+A M CL+
Sbjct  202   VGAAISFSLCVWFNVMLLLSFVRYSSACEKTRIPFSKNALVGVGVFFRFAVPAAVMVCLK  261

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW  EI++LL GL PNP++ETSVLSICL I +LHF IP+  GA ASTR+SNELGAGN   
Sbjct  262   WWACEILVLLAGLFPNPKLETSVLSICLTISTLHFTIPYGFGAAASTRVSNELGAGNPQA  321

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
              R+AV     + + E ++ +  L   R ++GYA+S++  VV Y+  M PL+ L + +D +
Sbjct  322   VRVAVSATMFLAVTEGLIVSATLFGCRHLLGYAYSDDRMVVHYVAVMTPLLCLSIFTDSL  381

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
              G+LSGVARGSGWQHLGAYVNLGA+YLVG P   +LGF+  LR  GLW+G+   S+VQ++
Sbjct  382   QGVLSGVARGSGWQHLGAYVNLGAFYLVGIPVGIVLGFVAHLRAKGLWIGIVTGSIVQSI  441

Query  268   VLALITIFTDWKKQESKAQERLLNDSHPP  182
             +L+L+T  T+WKKQ   A+ER+  D+ PP
Sbjct  442   LLSLVTALTNWKKQAMMARERIF-DAKPP  469



>ref|XP_006430697.1| hypothetical protein CICLE_v10011623mg [Citrus clementina]
 gb|ESR43937.1| hypothetical protein CICLE_v10011623mg [Citrus clementina]
Length=479

 Score =   504 bits (1297),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 244/471 (52%), Positives = 340/471 (72%), Gaps = 3/471 (1%)
 Frame = -2

Query  1591  EVPLLSEKRPAAA---ISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             E PLL E R       +++  F+ ELKKL+ +A PM+ VTV Q ++  VS MM GH+ EL
Sbjct  2     EEPLLGEIREEETKWVVTRGAFVEELKKLSFLAAPMVGVTVSQYLLPAVSLMMAGHLGEL  61

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +L+  A+ATSFTNVTG   +FG A ALETLCGQAYGA QY ++GTYTY A+     +  P
Sbjct  62    TLASVAIATSFTNVTGIIPLFGFACALETLCGQAYGAKQYQQIGTYTYSAMFFCIAICFP  121

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             IS+LW+FMDK LI +GQDP I+  A  +S+ LI A+  +A+L+ L+  LQ QSLI+P+ L
Sbjct  122   ISVLWIFMDKVLILLGQDPEIATGACNFSISLIPALLAFAVLRPLIHNLQSQSLILPLFL  181

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             S+  +LCFHI +CW L F++     G ALAIGLSY  N ++L +Y++YSSSCEK+RV ++
Sbjct  182   SACATLCFHILLCWYLVFKANFRIVGAALAIGLSYCLNAVILALYMRYSSSCEKTRVFIF  241

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
             +D F+ + EFF  A+P+  M CLEWW+FEI+ILL GLLPN ++ETSVLSICL I S H++
Sbjct  242   SDIFSCIKEFFSFALPTVVMFCLEWWSFEILILLSGLLPNSKLETSVLSICLTISSTHYF  301

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+ IGA ASTR+SNELGAGN   A++A   V ++ + E V+ + +L   R V+ YAF++
Sbjct  302   IPYGIGAAASTRVSNELGAGNPQAAQLAACVVMVLAVTEAVIVSTILFCCRYVLAYAFNS  361

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             + +VV+Y+ +++PL+S  ++ D +  +LSGVARG+GWQH+GAYVNLGAYY+VG P A +L
Sbjct  362   DKDVVNYVSELVPLLSFSIIMDSLQSVLSGVARGTGWQHIGAYVNLGAYYIVGIPLASVL  421

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
              F+ +LRG GLW+G+   S VQ +VLA+IT+ T+W+KQ   A+ER+    +
Sbjct  422   CFVLNLRGKGLWIGIMTGSAVQAIVLAIITVTTNWRKQVRMARERIFEGPY  472



>emb|CDP05513.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   504 bits (1299),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 261/507 (51%), Positives = 339/507 (67%), Gaps = 35/507 (7%)
 Frame = -2

Query  1612  LLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             LLPE D E       R A   +  +++ ELK++  IA+PM+V  V Q ++      MLGH
Sbjct  5     LLPENDKET---GSTRVA---TWKIYVEELKRVNGIALPMMVAVVGQYLLRVSPIFMLGH  58

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
             + +L LSG ++ATSF+NVTGFS++FGM+SALETLCGQA+GA QY +LGTYTYGAI+ L  
Sbjct  59    LGQLQLSGASIATSFSNVTGFSVLFGMSSALETLCGQAFGAEQYQRLGTYTYGAIICLFT  118

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
             V IPIS+LW+F DK LI  GQDP I+ EAGKY +WLI  +FPYAILQ LV +LQ QSL+ 
Sbjct  119   VCIPISLLWMFTDKLLILTGQDPAIATEAGKYLIWLIPTLFPYAILQSLVCFLQTQSLVF  178

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             PMLLS+  S+   +P+CW L F+S LG+AG AL+IG+SYW N ILLV+YVKYSSS  K+R
Sbjct  179   PMLLSTVASVSLQLPLCWVLVFKSKLGNAGAALSIGISYWLNSILLVLYVKYSSSSRKTR  238

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
             V    D+   +G FFR AIPS  M CLEWW +E+V+LL GL PNP++ETSVLSICL I S
Sbjct  239   VPFSMDALQTMGGFFRFAIPSTVMTCLEWWAYELVVLLSGLSPNPKLETSVLSICLTITS  298

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
             LH+ I +S G  ASTRI NELGAGN   AR+A+  V +  + +  +A++ L   RS++GY
Sbjct  299   LHYLIAYSFGVAASTRILNELGAGNPVAARIALCMVLLKSVSDFFLASITLFLCRSMLGY  358

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSG--------------------------  431
              FS+E +V++Y+K M  L+ + ++ D    +LS                           
Sbjct  359   VFSDEKDVINYVKHMTSLLCMSMIMDSTQAVLSDGTKKIEVVKNTIIISLKLMKRQCHLL  418

Query  430   ---VARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLA  260
                VARGSGWQHLGAYVNLGAYYLVG P A +LGF   LRGMGLW GL   + VQ+++L 
Sbjct  419   APEVARGSGWQHLGAYVNLGAYYLVGIPVALILGFALHLRGMGLWSGLVAGATVQSLLLC  478

Query  259   LITIFTDWKKQESKAQERLLNDSHPPA  179
             +IT  T+W+K   +A+ R+       A
Sbjct  479   IITGLTNWEKHVIEARRRIYEGEEEKA  505



>ref|XP_003526375.1| PREDICTED: MATE efflux family protein DTX1-like [Glycine max]
Length=480

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 242/449 (54%), Positives = 327/449 (73%), Gaps = 1/449 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             ELKK+  IA PM+V +V Q ++  VS +M+GH+++LSLS  A+ATS TNV+GFS++ GMA
Sbjct  22    ELKKVGTIAAPMVVASVLQYLLQVVSLVMVGHLNQLSLSTVAIATSLTNVSGFSVLSGMA  81

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
               LETL GQA+GAGQY K G YTY A++SL+++  PI+ILW FMDK L  +GQDP IS E
Sbjct  82    GGLETLGGQAFGAGQYEKFGQYTYTAVISLSLICFPITILWTFMDKILTLLGQDPTISLE  141

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             A KY++WLI A+F  AIL+ L R+ Q QSLI PM+L+SA++LCFH   CW L F+  LG 
Sbjct  142   ARKYAIWLIPALFGSAILKPLTRFFQTQSLISPMILTSAIALCFHGATCWTLVFKLELGH  201

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
              G A++  L  WFNV+LL+ +V+YSS+CEK+R+    ++   VG+FFR A+P+A M CL+
Sbjct  202   VGAAISFSLCVWFNVMLLLSFVRYSSACEKTRIPFSKNALVGVGDFFRFAVPAAVMVCLK  261

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW  EI++LL GL PNP++ETSVLSICL I +LHF IP+  GA ASTR+SNELGAGN   
Sbjct  262   WWACEILVLLAGLFPNPKLETSVLSICLTISTLHFTIPYGFGAAASTRVSNELGAGNPQA  321

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
              R+AV     + + E ++ +  L   R ++GYA+S++  VV Y+  M PL+ L + +D +
Sbjct  322   VRVAVSATMFLAVTEGLIVSATLFGCRHILGYAYSDDRMVVHYVAVMTPLLCLSIFTDSL  381

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
              G+LSGVARGSGWQHLGAYVNLGA+YLVG P   +LGF+  LR  GLW+G+   S+VQ++
Sbjct  382   QGVLSGVARGSGWQHLGAYVNLGAFYLVGIPVGIVLGFVAHLRAKGLWIGIVTGSIVQSI  441

Query  268   VLALITIFTDWKKQESKAQERLLNDSHPP  182
             +L+L+T  T+WKKQ   A+ER+  D  PP
Sbjct  442   LLSLVTALTNWKKQAMMARERIF-DVKPP  469



>ref|NP_177270.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAG51691.1|AC016972_10 hypothetical protein; 49518-51504 [Arabidopsis thaliana]
 gb|AEE35165.1| MATE efflux family protein [Arabidopsis thaliana]
Length=485

 Score =   502 bits (1293),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 254/470 (54%), Positives = 332/470 (71%), Gaps = 1/470 (0%)
 Frame = -2

Query  1600  MD-AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             MD AE  LL          KD FL E KKL+ IA PM+ V     ++  +S MM+GH+ E
Sbjct  1     MDSAEKGLLVVSDREEVNKKDGFLRETKKLSYIAGPMIAVNSSMYVLQVISIMMVGHLGE  60

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+A SF +VTGFS++FG+ASALETLCGQA GA QY KLG +TY  I+SL +V I
Sbjct  61    LFLSSTAIAVSFCSVTGFSVVFGLASALETLCGQANGAKQYEKLGVHTYTGIVSLFLVCI  120

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW ++   L  +GQD +++ EAGK++ WLI A+F YA LQ LVR+ Q QSLI+P++
Sbjct  121   PLSLLWTYIGDILSLIGQDAMVAQEAGKFATWLIPALFGYATLQPLVRFFQAQSLILPLV  180

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  SLC HI +CW+L F+ GLGS G A+AIG+SYW NV +L +Y+ +SSSC KSR  +
Sbjct  181   MSSVSSLCIHIVLCWSLVFKFGLGSLGAAIAIGVSYWLNVTVLGLYMTFSSSCSKSRATI  240

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                 F  +GEFFR  IPSASM CLEWW+FE ++LL G+LPNP++E SVLS+CL   S  +
Sbjct  241   SMSLFEGMGEFFRFGIPSASMICLEWWSFEFLVLLSGILPNPKLEASVLSVCLSTQSSLY  300

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
              IP S+GA ASTR++NELGAGN   ARMAV+   +I  +E ++   ++   R+V GY FS
Sbjct  301   QIPESLGAAASTRVANELGAGNPKQARMAVYTAMVITGVESIMVGAIVFGARNVFGYLFS  360

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +ETEVVDY+K M PL+SL ++ D +   LSGVARGSG Q +GAYVNL AYYL G P A +
Sbjct  361   SETEVVDYVKSMAPLLSLSVIFDALHAALSGVARGSGRQDIGAYVNLAAYYLFGIPTAIL  420

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             L F   +RG GLW+G+ + S VQ V+L LI I T+WKKQ  KA+ER++ D
Sbjct  421   LAFGFKMRGRGLWIGITVGSCVQAVLLGLIVILTNWKKQARKARERVMGD  470



>ref|XP_004497008.1| PREDICTED: MATE efflux family protein 9-like [Cicer arietinum]
Length=479

 Score =   502 bits (1292),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 245/470 (52%), Positives = 339/470 (72%), Gaps = 3/470 (1%)
 Frame = -2

Query  1591  EVPLLSEKRPAAA---ISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             E  LL ++R   +   I+  VF  E+K +  +A+PM+ VT+ Q  +  +S  M+GH+ +L
Sbjct  2     EKGLLEKEREGDSSVIITWGVFAQEVKDVGFLALPMVTVTLSQYFLQIISMTMVGHLGKL  61

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+A S   VTGFSL+FGM+ ALET CGQAYGA QY K G   Y AI+SL +  +P
Sbjct  62    ALSSTAIAISLCGVTGFSLLFGMSCALETQCGQAYGAKQYRKFGVQVYTAIVSLIIACLP  121

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             +S+LW+++ K L  +GQDPLIS EAGK++V +I A+F Y  LQ LVRY  MQSLIVP+++
Sbjct  122   LSLLWIYLGKLLTLLGQDPLISQEAGKFAVCMIPALFAYGTLQALVRYFLMQSLIVPLVI  181

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS+++LCFH+P CW L F+SGLG  G A +IG SYW NVI+L +Y+K+S+ CEK+RV + 
Sbjct  182   SSSVTLCFHVPFCWLLVFKSGLGGLGAAFSIGTSYWLNVIILGLYMKFSAHCEKTRVPIS  241

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              ++F  +GEFFR AIPSA M CLEWW+FE++ILL G LPNPQ+ETSVLSICL I S  + 
Sbjct  242   MEAFLGIGEFFRYAIPSAGMVCLEWWSFELLILLSGFLPNPQLETSVLSICLSIISTIYT  301

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP + G+ AST++SN LGAG +  AR++V+    I + E V+ +  + + R V+GY FS+
Sbjct  302   IPEATGSAASTKVSNALGAGCSQAARLSVYAAMTIAVSEAVLVSSTIFASRRVLGYIFSD  361

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E +VVDY+ +M+PL+SL ++ D + G LSG+ARG GWQ+LGAYVNLG+YY+ G P A +L
Sbjct  362   EQDVVDYVTEMVPLISLSVIIDSLHGTLSGIARGCGWQNLGAYVNLGSYYVFGIPIAVIL  421

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             GF   LRG GLW+G+ + +  Q ++L LIT FT+W+KQ  KA+ER+   S
Sbjct  422   GFWLELRGKGLWIGILVGAFCQALLLFLITSFTNWEKQAIKARERIFQGS  471



>ref|XP_009606970.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Nicotiana 
tomentosiformis]
Length=470

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 252/466 (54%), Positives = 330/466 (71%), Gaps = 1/466 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             M  E+P  S K     I+ D    ELKK +R   PM+ VTV Q ++  VS MM+GH+ EL
Sbjct  1     MVEELPQ-SLKEKKWQINWDAVSQELKKTSRFMAPMVAVTVFQYLLQVVSVMMVGHLGEL  59

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+ATS TNVTGFSL+ G+   +ETLCGQAYGA QYHKL TYTY AI+SL +V IP
Sbjct  60    ALSSVAIATSLTNVTGFSLLTGLVGGMETLCGQAYGAQQYHKLSTYTYTAIISLFLVCIP  119

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             I +LW FMDK LI  GQD  IS EA KYS+W+I AIF  AI + L RYLQ QSLI+PMLL
Sbjct  120   ICVLWCFMDKLLILTGQDHSISVEARKYSLWVIPAIFGGAISKPLSRYLQAQSLILPMLL  179

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS   LCFH+P+ WAL F+  LG+ G A+A  +S W  V+ L  YVK SSSCEK+R    
Sbjct  180   SSFAVLCFHLPISWALIFKLELGNIGAAIAFSISSWLYVLFLASYVKLSSSCEKTRAPFS  239

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              ++F  + +FFRLA+PSA M CL+WW+FE++ L+ GLLPNP++ETSV+SIC+ I  LHF 
Sbjct  240   MEAFLCIRQFFRLAVPSAVMVCLKWWSFEVLALVSGLLPNPKLETSVMSICITISQLHFS  299

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+  GA ASTR+SNELGAGN   ARMAV  V  + ++E +V    L   R V+G AFSN
Sbjct  300   IPYGFGAAASTRVSNELGAGNPQKARMAVQVVMFLTVVETLVFNTSLFGSRHVLGKAFSN  359

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E +VVDYI  M P + L +V+D +  +++G+ARGSGWQH+GAY+NL  +Y++  P A +L
Sbjct  360   EKQVVDYIAAMTPFLCLSIVTDSLQIVITGIARGSGWQHIGAYINLVVFYVIAIPLAVVL  419

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             GF+  L+  GLW+G+ +   +Q++VL+++T FTDW+KQ  KA+ER+
Sbjct  420   GFVLHLKAKGLWIGIVVGCAIQSIVLSIVTGFTDWEKQAKKARERV  465



>ref|XP_009606973.1| PREDICTED: MATE efflux family protein 7-like [Nicotiana tomentosiformis]
Length=477

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 248/447 (55%), Positives = 324/447 (72%), Gaps = 0/447 (0%)
 Frame = -2

Query  1543  DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSL  1364
             D +  ELKKL  IA PM+ V+V Q ++  VS MM+GH+ ++SLS  A+ATS TNVTGFSL
Sbjct  21    DTYYEELKKLTSIAAPMVAVSVLQYLLQVVSVMMVGHLDQISLSSVAIATSITNVTGFSL  80

Query  1363  IFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDP  1184
             + G+   LETLCGQAYGA Q+ K+GTYTY A++SL +V IPISILW+FMDK LI +GQDP
Sbjct  81    LSGLVGGLETLCGQAYGAQQWQKVGTYTYSAVISLLLVCIPISILWLFMDKLLILMGQDP  140

Query  1183  LISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFR  1004
              IS EA KYS+WLI A+F  AIL+ L RYLQ+QSLI+PMLLS+ L LC HI +CW   F 
Sbjct  141   AISVEASKYSMWLIPALFGGAILRPLFRYLQIQSLILPMLLSAFLVLCLHISLCWLFIFH  200

Query  1003  SGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSAS  824
              GLG +G A+A   S W  V LLV Y+K SSSCE++R  L  ++F  +G+FFR A PSA 
Sbjct  201   LGLGKSGAAIAFSFSIWTFVALLVSYIKRSSSCERTRTPLNKEAFLAIGQFFRYATPSAL  260

Query  823   MACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGA  644
             M CL+WW+ E++ILL GLLPNP++ETSVLSICL I +LHF IPF +GAGASTR+SNELG+
Sbjct  261   MVCLKWWSLEVLILLSGLLPNPKLETSVLSICLTISALHFSIPFGLGAGASTRVSNELGS  320

Query  643   GNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLML  464
              N   A +AV     + + E +V + V    R V+G A+SN+ +VVDY+  + P + L +
Sbjct  321   ANPQKALVAVRVAMFLAVAETLVVSTVTFLCRRVLGKAYSNDQQVVDYVAAITPFLCLSI  380

Query  463   VSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLAS  284
             ++D +  ++SG+ARGSGWQ +GAYVNLGA+YLVG P + +L FL  LR  GLW+GL + S
Sbjct  381   ITDSLQAVISGIARGSGWQIIGAYVNLGAFYLVGIPVSAILCFLIHLRAKGLWIGLLVGS  440

Query  283   LVQNVVLALITIFTDWKKQESKAQERL  203
              +Q   L+ I  F DW+KQ  KA++R+
Sbjct  441   AIQATTLSSILSFIDWQKQAIKAKKRI  467



>ref|XP_011021311.1| PREDICTED: MATE efflux family protein 6-like isoform X1 [Populus 
euphratica]
Length=480

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 257/483 (53%), Positives = 348/483 (72%), Gaps = 10/483 (2%)
 Frame = -2

Query  1612  LLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             LLP+   E     EKR   A++ D  + EL++++ +A PM VV+V   ++  VS +M GH
Sbjct  5     LLPKSTTE-----EKR--WALTWDALVEELRRVSCLAAPMTVVSVTLYLLQVVSMIMAGH  57

Query  1432  ISELSLSGGAVATSFTNVTGFSLI-FGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLT  1256
             +SELSLSG ++ATSFTNVTGFSL+  G +  LETLCGQ YGA QY K G+YTY AI+SL 
Sbjct  58    LSELSLSGVSMATSFTNVTGFSLLQAGFSGGLETLCGQTYGAEQYKKFGSYTYCAIISLI  117

Query  1255  VVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLI  1076
             V +IP+S+LW FMD+ LI VG D  IS  A KY++WLI A+F +AILQ L+RY Q QSLI
Sbjct  118   VTSIPVSVLWTFMDRLLIAVGIDSEISTVACKYAIWLIPALFAFAILQPLLRYFQTQSLI  177

Query  1075  VPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKS  896
              P+L+S+  +LCFHIP+CWAL ++  LG+ G ALAIG+SYW NVILLV+Y+ +SSSCEK+
Sbjct  178   YPILVSTCAALCFHIPLCWALVYKWELGNIGGALAIGVSYWLNVILLVLYMVFSSSCEKT  237

Query  895   RVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMIC  716
             R   W+D F+ + +FFR A PSA M CLEWWT+E+VILL GLLP+P+++TSVLSICL   
Sbjct  238   RRLYWDDIFSSINKFFRFAFPSAVMICLEWWTYELVILLAGLLPDPKLQTSVLSICLATT  297

Query  715   SLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVG  536
             +LHFY+ + I A  STR+SNELGAGN   A++AV  V I+ ++E+V  +++L   R + G
Sbjct  298   TLHFYVQYGIAASGSTRVSNELGAGNPQAAQVAVQVVLIMSLVEVVTVSLILFFFRHIFG  357

Query  535   YAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAP  356
             YAFS+E  VVD + ++ PL+ L ++ +G+  +LSG+ARG GWQH+GA++NLGAYYLV  P
Sbjct  358   YAFSSEKRVVDCVAELAPLMCLSIIIEGLQAVLSGIARGCGWQHIGAFINLGAYYLVATP  417

Query  355   AAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAV  176
              A +L F+  L   GLWMGL +   VQ +  + IT  T+W+KQ ++A+E +L  S     
Sbjct  418   VAVVLCFVLHLGSRGLWMGLLIGKTVQALCFSSITALTNWQKQATEAKETILGRSL--LA  475

Query  175   DNG  167
             DNG
Sbjct  476   DNG  478



>ref|XP_010415814.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=482

 Score =   501 bits (1290),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 244/460 (53%), Positives = 334/460 (73%), Gaps = 1/460 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
              KD FL E+++L  IA PM+ +     +++ +STMM+GH+ EL LS  A+A SF +VTGF
Sbjct  20    KKDGFLREMQRLGYIAGPMIAINSSMYVLLVISTMMVGHLGELYLSSTAIAISFCSVTGF  79

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             SL+FG+ASALETLCGQA GA Q+ KLG +TY  I+SL +V IP+S+LW +M   L  +GQ
Sbjct  80    SLVFGLASALETLCGQANGAKQFEKLGVHTYTGIVSLFLVCIPLSLLWSYMGDILSAIGQ  139

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DP+++ EAGK++ WLI A+F YA LQ LVR+ Q QSLI+P+++SS  ++C H+ +CW+L 
Sbjct  140   DPMVAQEAGKFATWLIPALFGYATLQPLVRFFQAQSLILPLIMSSISAVCVHVVLCWSLV  199

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+ GLGS G A+AIG+SYW NV +L +Y+ +SSSC KSR  +    F  +GEFFR  IPS
Sbjct  200   FKFGLGSLGAAIAIGVSYWLNVTVLGLYMTFSSSCSKSRAPISMSLFEGMGEFFRFGIPS  259

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             ASM CLEWW+FE +++L G+LPNP++ETSVLS+CL   S  + IP S+GA ASTR++NEL
Sbjct  260   ASMICLEWWSFEFLVMLSGILPNPKLETSVLSVCLSTISSLYQIPESLGAAASTRVANEL  319

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN   ARMAV+ V +I  +E ++ + ++ + R+V GY FS+E EVVDY++ M PLV+L
Sbjct  320   GAGNPKQARMAVYTVMVITGVESIMVSAIVFAARNVFGYLFSSEIEVVDYVRSMAPLVAL  379

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +L F   + G GLW+G+ +
Sbjct  380   SVIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLCGIPTAVLLAFRFKMGGRGLWIGITV  439

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
              S VQ V+L LI I T+WK+Q  KA+ER++ D      DN
Sbjct  440   GSFVQAVLLGLIVILTNWKQQARKARERVMGDEFEEK-DN  478



>ref|XP_010471122.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=482

 Score =   501 bits (1290),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 243/460 (53%), Positives = 334/460 (73%), Gaps = 1/460 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
              KD FL E+++L  IA PM+ +     +++ +STMM+GH+ EL LS  A+A SF +VTGF
Sbjct  20    KKDGFLREMQRLGYIAGPMIAINSSMYVLLVISTMMVGHLGELYLSSTAIAISFCSVTGF  79

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             SL+FG+ASALETLCGQA GA Q+ KLG +TY  I+SL +V IP+S+LW +M   L  +GQ
Sbjct  80    SLVFGLASALETLCGQANGAKQFEKLGVHTYTGIVSLFLVCIPLSLLWSYMGDILFAIGQ  139

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DP+++ EAGK++ WLI A+F YA LQ LVR+ Q QSLI+P+++SS  ++C H+ +CW+L 
Sbjct  140   DPMVAQEAGKFATWLIPALFGYATLQPLVRFFQAQSLILPLIMSSISAVCVHVVLCWSLV  199

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+ GLGS G A+AIG+SYW NV +L +Y+ +SSSC KSR  +    F  +GEFFR  IPS
Sbjct  200   FKFGLGSLGAAIAIGVSYWLNVTVLGLYMTFSSSCSKSRAPISMSLFEGMGEFFRFGIPS  259

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             ASM CLEWW+FE +++L G+LPNP++ETS+LS+CL   S  + IP S+GA ASTR++NEL
Sbjct  260   ASMICLEWWSFEFLVMLSGILPNPKLETSILSVCLSTISSLYQIPESLGAAASTRVANEL  319

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN   ARMAV+ V +I  +E ++ + ++ + R+V GY FS+E EVVDY++ M PLV+L
Sbjct  320   GAGNPKQARMAVYTVMVITGVESIMVSAIVFAARNVFGYLFSSEIEVVDYVRSMAPLVAL  379

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +L F   + G GLW+G+ +
Sbjct  380   SVIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLCGIPTAVLLAFRFKMGGRGLWIGITV  439

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
              S VQ V+L LI I T+WK+Q  KA+ER++ D      DN
Sbjct  440   GSFVQAVLLGLIVILTNWKQQARKARERVMGDEFEEK-DN  478



>gb|KHN13924.1| MATE efflux family protein DTX1 [Glycine soja]
Length=480

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 241/449 (54%), Positives = 327/449 (73%), Gaps = 1/449 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             ELKK+  IA PM+V +V Q ++  VS +M+GH+++LSLS  A+A S TNV+GFS++ GMA
Sbjct  22    ELKKVGTIAAPMVVASVLQYLLQVVSLVMVGHLNQLSLSSVAIAISLTNVSGFSVLSGMA  81

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
               LETL GQA+GAGQY K G YTY A++SL+++  PI+ILW FMDK L  +GQDP IS E
Sbjct  82    GGLETLGGQAFGAGQYEKFGQYTYTAVISLSLICFPITILWTFMDKILTLLGQDPTISLE  141

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             A KY++WLI A+F  AIL+ L R+ Q QSLI PM+L+SA++LCFH   CW L F+  LG 
Sbjct  142   ARKYAIWLIPALFGSAILKPLTRFFQTQSLISPMILTSAIALCFHGATCWTLVFKLELGH  201

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
              G A++  L  WFNV+LL+ +V+YSS+CEK+R+    ++   VG+FFR A+P+A M CL+
Sbjct  202   VGAAISFSLCVWFNVMLLLSFVRYSSACEKTRIPFSKNALVGVGDFFRFAVPAAVMVCLK  261

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW  EI++LL GL PNP++ETSVLSICL I +LHF IP+  GA ASTR+SNELGAGN   
Sbjct  262   WWACEILVLLAGLFPNPKLETSVLSICLTISTLHFTIPYGFGAAASTRVSNELGAGNPQA  321

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
              R+AV     + + E ++ +  L   R ++GYA+S++  VV Y+  M PL+ L + +D +
Sbjct  322   VRVAVSATMFLAVTEGLIVSATLFGCRHLLGYAYSDDRMVVHYVAVMTPLLCLSIFTDSL  381

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
              G+LSGVARGSGWQHLGAYVNLGA+YLVG P   +LGF+  LR  GLW+G+   S+VQ++
Sbjct  382   QGVLSGVARGSGWQHLGAYVNLGAFYLVGIPVGIVLGFVAHLRAKGLWIGIVTGSIVQSI  441

Query  268   VLALITIFTDWKKQESKAQERLLNDSHPP  182
             +L+L+T  T+WKKQ   A+ER+  D+ PP
Sbjct  442   LLSLVTALTNWKKQAMMARERIF-DAKPP  469



>gb|AHI48501.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=481

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 250/453 (55%), Positives = 330/453 (73%), Gaps = 0/453 (0%)
 Frame = -2

Query  1555  AISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVT  1376
             +I+  V   E+K+L  IA PM+ VT+ Q ++  +STMM+GH+ EL+LS  A+ATS + VT
Sbjct  19    SITWGVLAEEMKRLGPIAAPMVAVTLTQDLLQVISTMMVGHLGELALSSTAIATSISGVT  78

Query  1375  GFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFV  1196
             G+S + GMA ALETLCGQAYGA QY K+GT TY AI SL +V +P+SILW+ M K L F+
Sbjct  79    GYSFLLGMACALETLCGQAYGAQQYRKIGTQTYTAIFSLIIVCLPLSILWMNMGKVLSFI  138

Query  1195  GQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWA  1016
             G DPLIS EAGK++ WL+ ++F YAILQ LV Y QMQSL +PML+SS ++L FH+P+CW 
Sbjct  139   GLDPLISHEAGKFTKWLVPSLFAYAILQPLVPYFQMQSLTLPMLISSCITLAFHVPLCWV  198

Query  1015  LSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAI  836
             L F+SGL + G ALA+ +S W NVI LV+Y++YSS+C K+R  +  D    VGEFF  A+
Sbjct  199   LVFKSGLDNLGGALAVDISIWLNVIFLVLYMRYSSTCAKTRAPISMDVLRGVGEFFSFAV  258

Query  835   PSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISN  656
             PS  M CLEWW+FE++ILL GLLPNP++ETSVLS+CL   +    IP+  GA ASTRISN
Sbjct  259   PSTVMICLEWWSFELLILLSGLLPNPELETSVLSVCLNTIATLCSIPYGFGAAASTRISN  318

Query  655   ELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLV  476
             ELGAGN   AR+  + V I+ ++E  + +  L + R + GY FSNE E VDY+  M PLV
Sbjct  319   ELGAGNPQGARVTTFAVMILAVVETTIVSATLFATRRIFGYTFSNEKEFVDYVTAMAPLV  378

Query  475   SLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGL  296
              L ++ DG+  +LSGVARG GWQH+GAYVNLGA+YLVG P A +LGF   LRG GLW+G+
Sbjct  379   CLSVIMDGLQCVLSGVARGCGWQHIGAYVNLGAFYLVGIPVAVLLGFWLQLRGKGLWIGI  438

Query  295   NLASLVQNVVLALITIFTDWKKQESKAQERLLN  197
                ++VQ ++L++IT  T+W KQ +KA+ERL  
Sbjct  439   LAGAIVQTILLSIITNCTNWDKQATKARERLFE  471



>ref|XP_002532233.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
 gb|EEF30164.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
Length=477

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 245/454 (54%), Positives = 326/454 (72%), Gaps = 0/454 (0%)
 Frame = -2

Query  1552  ISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTG  1373
             IS  V   E+KK+  IA PM+ V V    +  +S MM+GH+ ELSLS  A+A SF  VTG
Sbjct  15    ISWRVLREEVKKMGYIAGPMVAVNVSHYFLQVMSVMMVGHLGELSLSSTAIAISFCAVTG  74

Query  1372  FSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVG  1193
             FSL+FGM+SALETLCGQAYGA QY + G   Y A+ SL +V +P+ ILW++M K L+ +G
Sbjct  75    FSLVFGMSSALETLCGQAYGAKQYRQFGIRVYTAVFSLNLVCVPLCILWIYMGKILVLIG  134

Query  1192  QDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWAL  1013
             QDP+IS EA K++  L+ A+F YA LQ +VRY QMQSLI P++++S  + CFHI +CW L
Sbjct  135   QDPVISQEAAKFATCLVPALFGYATLQAVVRYFQMQSLIFPLIITSLFATCFHILLCWIL  194

Query  1012  SFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIP  833
              F SGLG  G A++IG+SYW NVILL VY+ +SSSC ++RV +  + F  +G+F  LAIP
Sbjct  195   VFNSGLGKLGAAISIGISYWLNVILLGVYMVFSSSCAETRVPISMELFKGIGQFIGLAIP  254

Query  832   SASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNE  653
             SA M CLEWW+FE++ +L GLLPNP++ETSVLS+CL   +  + IP  +GA ASTR+SNE
Sbjct  255   SAVMICLEWWSFELLTMLSGLLPNPRLETSVLSVCLATITTLYTIPDGVGAAASTRVSNE  314

Query  652   LGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVS  473
             LGAGN   A +AVW   ++  I+ +  + +L+  R V GY FSNE EVVDY+  M PLVS
Sbjct  315   LGAGNAKAAYVAVWCAMVVATIQSIAVSAILLVTRHVFGYVFSNEKEVVDYVTAMAPLVS  374

Query  472   LMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLN  293
             L ++ D + G LSG+ARG GWQ+LGAYVNL AYY+ G P A +LGF  +LRG GLW+G+ 
Sbjct  375   LSVILDSLQGTLSGIARGCGWQNLGAYVNLVAYYICGIPVAAVLGFWLNLRGKGLWIGIQ  434

Query  292   LASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             + S VQ V+LA+IT  T+W++Q  KA+ER+L  +
Sbjct  435   VGSFVQIVLLAIITRSTNWEQQAMKAKERVLEGT  468



>gb|KHN42770.1| MATE efflux family protein DTX1 [Glycine soja]
Length=480

 Score =   500 bits (1287),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 241/449 (54%), Positives = 326/449 (73%), Gaps = 1/449 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             ELKK+  IA PM+V +V Q ++  VS +M+GH+++LSLS  A+ATS TNV+GFS++  MA
Sbjct  22    ELKKVGTIAAPMVVASVLQYLLQVVSLVMVGHLNQLSLSTVAIATSLTNVSGFSVLVRMA  81

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
               LETL GQA+GAGQY K G YTY A++SL+++  PI+ILW FMDK L  +GQDP IS E
Sbjct  82    GGLETLGGQAFGAGQYEKFGQYTYTAVISLSLICFPITILWTFMDKILTLLGQDPTISLE  141

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             A KY++WLI A+F  AIL+ L R+ Q QSLI PM+L+SA++LCFH   CW L F+  LG 
Sbjct  142   ARKYAIWLIPALFGSAILKPLTRFFQTQSLISPMILTSAIALCFHGATCWTLVFKLELGH  201

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
              G A++  L  WFNV+LL+ +V+YSS+CEK+R+    ++   VG+FFR A+P+A M CL+
Sbjct  202   VGAAISFSLCVWFNVMLLLSFVRYSSACEKTRIPFSKNALVGVGDFFRFAVPAAVMVCLK  261

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW  EI++LL GL PNP++ETSVLSICL I +LHF IP+  GA ASTR+SNELGAGN   
Sbjct  262   WWACEILVLLAGLFPNPKLETSVLSICLTISTLHFTIPYGFGAAASTRVSNELGAGNPQA  321

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
              R+AV     + + E ++ +  L   R ++GYA+S++  VV Y+  M PL+ L + +D +
Sbjct  322   VRVAVSATMFLAVTEGLIVSATLFGCRHLLGYAYSDDRMVVHYVAVMTPLLCLSIFTDSL  381

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
              G+LSGVARGSGWQHLGAYVNLGA+YLVG P   +LGF+  LR  GLW+G+   S+VQ++
Sbjct  382   QGVLSGVARGSGWQHLGAYVNLGAFYLVGIPVGIVLGFVAHLRAKGLWIGIVTGSIVQSI  441

Query  268   VLALITIFTDWKKQESKAQERLLNDSHPP  182
             +L+L+T  T+WKKQ   A+ER+  D  PP
Sbjct  442   LLSLVTALTNWKKQAMMARERIF-DVKPP  469



>ref|XP_010046534.1| PREDICTED: MATE efflux family protein 8-like [Eucalyptus grandis]
Length=473

 Score =   499 bits (1286),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 256/482 (53%), Positives = 337/482 (70%), Gaps = 20/482 (4%)
 Frame = -2

Query  1606  PEMDAEVPLLSEK--RPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             P+M+  +    E+  R +  I+      E+K++  IA PM+VVT  Q  +  V  MM+GH
Sbjct  7     PKMEERLLARREEGGRKSDGITWGGVTEEVKRVGSIAAPMVVVTSSQYFLQMVCVMMVGH  66

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
             + ELSLS  A+A S   V+GFSL+ GMA+ALETLCGQAYGA QY KLGT TY AI SLT+
Sbjct  67    LGELSLSSTAIAISLAGVSGFSLLLGMATALETLCGQAYGARQYQKLGTQTYTAIFSLTL  126

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
             V +P+S LW  M K L+ +GQDPLIS EAG++ VWL+ A+  YA LQ LVRY Q QSL  
Sbjct  127   VCVPLSFLWFNMGKLLLLMGQDPLISREAGRFIVWLVPALLAYAALQPLVRYFQTQSLTT  186

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             PML+ S+ +LC H+P+CW L F+SGL + G ALA+G+SYW NV  LV+Y+ +SS+C+K+R
Sbjct  187   PMLIGSSATLCLHVPLCWVLVFKSGLHNLGAALALGISYWLNVTFLVLYMTFSSACQKTR  246

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
                              A+PSA M CLEWW+FE++ILL GLLPNPQ+ETSVLS+CL   S
Sbjct  247   ----------------FAVPSAVMICLEWWSFELLILLSGLLPNPQLETSVLSVCLGTIS  290

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
               + IPF+IGA  STR+SNELGAGN   AR+AV+ V +I + E  + + VL + R V GY
Sbjct  291   SLYAIPFAIGAAGSTRVSNELGAGNAQAARVAVYAVLLIAVTETSITSTVLFATRKVFGY  350

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             AFSNE EVVDY+ KM PLV L ++ D + G+LSG+ARG GWQH+GAYVNLGA+YL G P 
Sbjct  351   AFSNEKEVVDYVTKMSPLVCLSVIIDSLQGVLSGIARGCGWQHIGAYVNLGAFYLCGIPV  410

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVD  173
             A  LGF   LRG+GLW+G+ + ++VQ  +L+++T  T+W+K  SKA+ER+ + S   + D
Sbjct  411   AATLGFWVGLRGVGLWIGIQVGAIVQTSLLSIVTCCTNWEKLASKARERIFDGSF--SAD  468

Query  172   NG  167
             NG
Sbjct  469   NG  470



>ref|XP_010681703.1| PREDICTED: MATE efflux family protein 6-like [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   500 bits (1287),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 247/442 (56%), Positives = 332/442 (75%), Gaps = 0/442 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             E+K+++ +A PM+VV + Q ++  +S MM+GH+ EL LS  A+A S   VTGFSL+ GMA
Sbjct  31    EMKRVSWLACPMVVVIMSQYLLQVISIMMVGHLGELYLSSTAIAVSLAGVTGFSLMLGMA  90

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
             SALET+ GQAYGA QY K+GT TY AI SLT+V IP+S+LW++M+K L+F+GQDP IS E
Sbjct  91    SALETISGQAYGAQQYKKIGTQTYTAIFSLTLVCIPLSVLWIYMEKILVFIGQDPSISHE  150

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             AGK+S++L+ A+F YAILQ +VR+ Q QSL++PM+ SS ++LC HIP+CWAL F+SGL +
Sbjct  151   AGKFSIYLLPALFGYAILQAIVRFFQSQSLVMPMVASSCVTLCLHIPICWALVFKSGLQN  210

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
              G A+A+G+SYW NV+ L +Y+K+SSSC  +R  +  + F  +GEFFR AIPSA M CLE
Sbjct  211   LGAAIAMGISYWLNVLFLALYMKFSSSCAATRSPISMELFHGIGEFFRFAIPSAVMICLE  270

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW+FE++ILL GLLPNPQ+ETS+LSICL   S  + IP  +GA ASTR+SNELGAGN   
Sbjct  271   WWSFELLILLSGLLPNPQLETSILSICLTTSSTLYAIPCGVGAAASTRVSNELGAGNPQG  330

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
             AR A  GV  IGM   +V + VL + R V GY FSNE EVV+Y+  M PL+ + ++ D +
Sbjct  331   ARRAACGVVAIGMANGLVISSVLFATRRVFGYTFSNEKEVVNYVTVMAPLICVSVIIDSL  390

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
              G+LSGVARG GWQH+GAYVNLGA+Y+ G P A +LGF   ++G GLW+G+ L + VQ  
Sbjct  391   QGVLSGVARGCGWQHIGAYVNLGAFYIFGIPIAALLGFWVDMKGRGLWIGILLGAFVQTT  450

Query  268   VLALITIFTDWKKQESKAQERL  203
             +LA+ITI T+W++   KA +R+
Sbjct  451   LLAIITISTNWEEAARKALQRI  472



>emb|CDY67968.1| BnaAnng25760D [Brassica napus]
Length=484

 Score =   500 bits (1287),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 242/452 (54%), Positives = 331/452 (73%), Gaps = 0/452 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
             ++D FL E+++L+ IA PM+ V      +  +S MM+GH+ EL LS  A+A SF +VTGF
Sbjct  21    TRDRFLREMRRLSYIAGPMIAVNSSMYFLQVISIMMVGHLGELYLSSTAIAVSFCSVTGF  80

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             SL+FG+ASALETLCGQA GA Q+ KLG +TY  I SL +V+IP+S+LW +M + L F+GQ
Sbjct  81    SLVFGLASALETLCGQANGAKQFEKLGEHTYTGIFSLFIVSIPLSVLWSYMGEILSFIGQ  140

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DPL+S EAGK++  LI A+F YA LQ LVR+ Q QSL++P+++SS  +LC H+ +CW+L 
Sbjct  141   DPLVSQEAGKFATRLIPALFAYATLQPLVRFFQAQSLVLPLIMSSMSALCCHVVLCWSLV  200

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+ GLGS G A+AI +SYW N  +L +Y+ +SS+C K+R  +    F  + EFFR  +PS
Sbjct  201   FKFGLGSLGAAIAISVSYWLNATVLGLYMTFSSTCSKTRGKISMSVFKGMKEFFRFGVPS  260

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             ASM CLEWW+FE +++L G+LPNP++ETSVLS+CL   S  + IP S+GA ASTR++NEL
Sbjct  261   ASMICLEWWSFEFLVMLSGILPNPKLETSVLSVCLSTISSLYQIPESLGAAASTRVANEL  320

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN   ARMAV+ V +I  +E ++ + ++ + R+V GY FS+ETEVVDY+K M PLVSL
Sbjct  321   GAGNPKKARMAVYTVMVITGVEALMVSAIVFAARNVFGYLFSSETEVVDYVKTMAPLVSL  380

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +LGF   +RG GLW+G+ +
Sbjct  381   SVIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLFGIPTAVVLGFTFKMRGRGLWIGITV  440

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLND  194
              S VQ V+L LI   T+WK+Q  KA+ERL+ D
Sbjct  441   GSCVQAVLLGLIVSLTNWKQQVRKARERLMGD  472



>ref|XP_010427939.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Camelina 
sativa]
Length=477

 Score =   499 bits (1286),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 247/471 (52%), Positives = 336/471 (71%), Gaps = 1/471 (0%)
 Frame = -2

Query  1600  MD-AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             MD AE  LL++        KD F+ E+++LA IA PM+ V +    +  +S +M+GH+ E
Sbjct  1     MDSAEKGLLAKSDKEEVNKKDGFIQEMRRLAYIAGPMVAVNLSMDFLQVISVVMIGHLGE  60

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+A SF + TGFSL+FG+ASALETLCGQAYGA QY KLG +TY  I+SL +V I
Sbjct  61    LFLSSTAIAVSFCSATGFSLVFGLASALETLCGQAYGAKQYEKLGVHTYTTILSLYLVCI  120

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW +M   L  +GQDPL++ EAGK++ WLI A+F YA LQ LV++ Q QSLI P++
Sbjct  121   PLSVLWNYMGAILSLIGQDPLVAQEAGKFATWLIPALFAYATLQPLVQFFQAQSLIFPLI  180

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  +LC H+ +CW+L F+ GLGS G A+AIG+SYW NVI+L +Y+K+SSSC KSR  +
Sbjct  181   ISSLSALCCHLVLCWSLVFKFGLGSVGAAIAIGVSYWLNVIVLGLYMKFSSSCSKSRATI  240

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                 F  + EFF L IPSASM CLEWW+FE ++LL G+LPN  +ETSVLS+CL   S  +
Sbjct  241   SMSVFRGMKEFFWLGIPSASMICLEWWSFEFLVLLSGILPNSTLETSVLSVCLSTISFAY  300

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
             +IP S+GA ASTR++NELGAGN   ARMAV+ V +I  +E ++ + ++   R+V GY FS
Sbjct  301   HIPESLGAAASTRVANELGAGNPKQARMAVYTVMVIAGVESILVSAIVFGSRNVFGYLFS  360

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +ETEVVDY++ M PLVSL+++ D +   LSGVARG+G Q +GAYVNL AYYL G P A +
Sbjct  361   SETEVVDYVRSMAPLVSLLVILDALHTTLSGVARGAGRQDIGAYVNLAAYYLCGTPTAII  420

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             L F   + G GLW+G+ + S VQ  +L LI I T+W+++   A+ERL+ + 
Sbjct  421   LAFGFKMAGRGLWIGITVGSFVQAFLLGLIVILTNWEQEAKNARERLMAEE  471



>ref|XP_009357510.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
 ref|XP_009357518.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
 ref|XP_009357526.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=495

 Score =   500 bits (1287),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 259/486 (53%), Positives = 345/486 (71%), Gaps = 2/486 (0%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
             + LLP+   E          + ++   F  E+K+L  IA PM+ V + Q +++ +S MM+
Sbjct  4     SLLLPKRREEEQQQRRNSTTSILTWTSFFEEVKRLGCIAGPMVAVILSQSLLLVISMMMV  63

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL+LS  ++A S +NVTGFSL  GMASALETLCGQAYGA QY KLG  TY AI SL
Sbjct  64    GHLGELALSSSSIAISLSNVTGFSLFLGMASALETLCGQAYGAEQYQKLGLQTYTAIFSL  123

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +V +P+S++W++M+K L+F+GQDP+IS EAGK+++WLI A+F YA LQ L+RY Q QSL
Sbjct  124   NLVCLPLSLIWIYMEKLLVFMGQDPVISHEAGKFTIWLIPALFAYATLQPLIRYFQTQSL  183

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
             I PML+SS ++L FHIP+CW L F+SGL + G ALAI +SYW NVILL +Y+K+S +C K
Sbjct  184   ITPMLISSCVTLVFHIPLCWLLVFKSGLNNLGGALAISISYWVNVILLALYMKFSVACSK  243

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +RV +  + F  +GEFFR AIPSA M CLEWW+FE++ILL GLLPNP +ETSVLS+CL  
Sbjct  244   TRVPISMEVFHGIGEFFRFAIPSAIMICLEWWSFELLILLSGLLPNPALETSVLSVCLQT  303

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              S  + IPF   A ASTR+SNELGAGN   A++A +    + + E  +    L + R+V 
Sbjct  304   ISTLYAIPFGFAAAASTRVSNELGAGNPQGAQIATFAAMFLAVTETTITTTTLFACRNVF  363

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY FS+E EV+DY+  M PLV L +  D + G+LSG+ARG+GWQH+GAY+NLGAYYL G 
Sbjct  364   GYTFSDEKEVIDYVTIMAPLVCLAVTLDSLHGVLSGIARGTGWQHVGAYINLGAYYLCGI  423

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPA  179
             P A  L F   LRG GLW+G+ + S VQ ++L+LITI T+W+KQ SKA+ER+   +  P 
Sbjct  424   PVAATLAFWVQLRGRGLWIGIQVGSFVQIILLSLITIGTNWEKQASKARERIFEGT--PQ  481

Query  178   VDNGGC  161
               NG C
Sbjct  482   QVNGLC  487



>ref|XP_009776774.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Nicotiana 
sylvestris]
Length=470

 Score =   499 bits (1284),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 251/466 (54%), Positives = 327/466 (70%), Gaps = 1/466 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             M  E+P  S K     I+ D    ELKK +R   PM+ VTV Q ++  VS MM+GH+ EL
Sbjct  1     MVEELPQ-SLKEKKWQINWDAVSQELKKTSRFMAPMVAVTVFQYLLQVVSVMMVGHLGEL  59

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+ATS TNVTGFSL+ G+   +ETLCGQAYGA QYHKL TYTY AI+SL +V IP
Sbjct  60    ALSSVAIATSLTNVTGFSLLTGLVGGMETLCGQAYGAQQYHKLSTYTYTAIISLFLVCIP  119

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             I +LW FMDK LI  GQD  IS EA KYS+W+I AIF  AI + L RYLQ QSLI PMLL
Sbjct  120   ICVLWCFMDKLLILTGQDHSISVEARKYSLWVIPAIFGGAISKPLTRYLQAQSLIFPMLL  179

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS   LC H+P+ WA  F+  LG+ G A+A  +S W  V+ L  YVK SSSCEK+R    
Sbjct  180   SSFAVLCLHLPISWAFIFKLELGNIGAAIAFSISSWLYVLFLASYVKLSSSCEKTRAPFS  239

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              ++F  + +FFRLAIPSA M CL+WW+FE++ L+ GLLPNP++ETSV+SIC+ I  LHF 
Sbjct  240   MEAFLGIRQFFRLAIPSAVMVCLKWWSFEVLALVSGLLPNPKLETSVMSICITISQLHFS  299

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+  GA ASTR+SNELGAGN   ARMAV  +  + +IE +V    L   R V+G AFSN
Sbjct  300   IPYGFGAAASTRVSNELGAGNPQKARMAVQVIMFLTVIETLVFNTSLFGSRHVLGKAFSN  359

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E +VVDYI  M P + L +V+D +  +++G+ARGSGWQH+GAY+NL  +Y++  P A +L
Sbjct  360   EKQVVDYIAAMTPFLCLSIVTDSLQIVITGIARGSGWQHIGAYINLVVFYVIAIPLAVVL  419

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             GF+  L+  GLW+G+ +   +Q++VL+++T FTDW+KQ  KA+ER+
Sbjct  420   GFVVHLKAKGLWIGIVVGCAIQSIVLSIVTGFTDWEKQAKKARERV  465



>ref|XP_003555117.1| PREDICTED: MATE efflux family protein 5 [Glycine max]
Length=498

 Score =   500 bits (1287),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 236/457 (52%), Positives = 331/457 (72%), Gaps = 1/457 (0%)
 Frame = -2

Query  1558  AAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL-SLSGGAVATSFTN  1382
             A+ S+  F  ELK+++ +A PM+ VTV Q ++  VS MM+GH   L S SG A+ATSF  
Sbjct  37    ASSSESTFCQELKRVSSMAAPMVAVTVSQYLLQVVSLMMVGHFGILVSFSGVAIATSFAE  96

Query  1381  VTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLI  1202
             VTGFS++ GM+ ALETLCGQ YGA +Y K G YT+ AI++LT+V +PIS++W+F DK L+
Sbjct  97    VTGFSVLLGMSGALETLCGQTYGAEEYRKFGNYTWCAIVTLTLVCLPISLVWIFTDKILL  156

Query  1201  FVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVC  1022
                QDP IS  A +Y ++LI A+F +A+LQ L RY Q QS+I PM+ SS  +LC H+P+C
Sbjct  157   LFSQDPEISHAAREYCIYLIPALFGHAVLQALTRYFQTQSMIFPMVFSSITALCLHVPIC  216

Query  1021  WALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRL  842
             W L F+ GLG  G ALAIG+SYW NV+ L +Y+ YS +C+K+++   +++   + EF +L
Sbjct  217   WGLVFKLGLGHVGAALAIGVSYWLNVVWLAIYMIYSPACQKTKIVFSSNALLSIPEFLKL  276

Query  841   AIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRI  662
             AIPS  M C EWW+FE++ LL G+LPNPQ+ET+VLSICL   +LH++IP+++GA ASTR+
Sbjct  277   AIPSGLMFCFEWWSFEVLTLLAGILPNPQLETAVLSICLNTTTLHYFIPYAVGASASTRV  336

Query  661   SNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIP  482
             SNELGAGN   A+ AV  V I+G+ E  + + V +S R V+GYA+SN+ EV+DY+ +M P
Sbjct  337   SNELGAGNPKTAKGAVRVVVILGVAEAAIVSTVFISCRHVLGYAYSNDKEVIDYVAEMAP  396

Query  481   LVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWM  302
             L+ + + +D + G LSG+ARG G+Q +GAYVNLGAYYLVG P   +LGF   LR  GLWM
Sbjct  397   LLCVSVTADSLIGALSGIARGGGFQEIGAYVNLGAYYLVGIPMGLLLGFHLQLRAKGLWM  456

Query  301   GLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             G    SL Q ++LA++T   DW+K+ +KA+ER++ +S
Sbjct  457   GTLSGSLTQVIILAIVTALIDWQKEATKARERVVENS  493



>emb|CAQ51477.1| putative MATE transporter [Nicotiana tabacum]
Length=470

 Score =   498 bits (1283),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 251/466 (54%), Positives = 329/466 (71%), Gaps = 1/466 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             M  E+P  S K     I+ D    ELKK +R   PM+ VTV Q ++  VS MM+GH+ EL
Sbjct  1     MVEELPQ-SLKEKKWQINWDAVSQELKKTSRFMAPMVAVTVFQYLLQVVSVMMVGHLGEL  59

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+ATS TNVTGFSL+ G+   +ETLCGQAYGA QYHKL TYTY AI+SL +V IP
Sbjct  60    ALSSVAIATSLTNVTGFSLLTGLVGGMETLCGQAYGAQQYHKLSTYTYTAIISLFLVCIP  119

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             I +LW FMDK LI  GQD  IS EA KYS+W+I AIF  AI + L RY Q QSLI+PMLL
Sbjct  120   ICVLWCFMDKLLILTGQDHSISVEARKYSLWVIPAIFGGAISKPLSRYSQAQSLILPMLL  179

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS   LCFH+P+ WAL F+  LG+ G A+A  +S W  V+ L  YVK SSSCEK+R    
Sbjct  180   SSFAVLCFHLPISWALIFKLELGNIGAAIAFSISSWLYVLFLASYVKLSSSCEKTRAPFS  239

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              ++F  + +FFRLA+PSA M CL+WW+FE++ L+ GLLPNP++ETSV+SIC+ I  LHF 
Sbjct  240   MEAFLCIRQFFRLAVPSAVMVCLKWWSFEVLALVSGLLPNPKLETSVMSICITISQLHFS  299

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP+  GA ASTR+SNELGAGN   ARMAV  V  + ++E +V    L   R V+G AFSN
Sbjct  300   IPYGFGAAASTRVSNELGAGNPQKARMAVQVVMFLTVVETLVFNTSLFGSRHVLGKAFSN  359

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E +VVDYI  M P + L +V+D +  +++G+ARGSGWQH+GAY+NL  +Y++  P A +L
Sbjct  360   EKQVVDYIAAMTPFLCLSIVTDSLQIVITGIARGSGWQHIGAYINLVVFYVIAIPLAVVL  419

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             GF+  L+  GLW+G+ +   +Q++VL+++T FTDW+KQ  KA+ER+
Sbjct  420   GFVLHLKAKGLWIGIVVGCAIQSIVLSIVTGFTDWEKQAKKARERV  465



>ref|XP_010317186.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Solanum 
lycopersicum]
Length=423

 Score =   496 bits (1278),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 234/390 (60%), Positives = 296/390 (76%), Gaps = 0/390 (0%)
 Frame = -2

Query  1360  FGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPL  1181
             FGM SALETLCGQAYGAGQY KLGT+TY AI+ L +V IP+S+LW+F DK LI  GQDP 
Sbjct  12    FGMCSALETLCGQAYGAGQYRKLGTFTYSAIICLFLVCIPVSVLWIFTDKLLILTGQDPS  71

Query  1180  ISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRS  1001
             I+ EAGKY++WLI  +FPYAILQ LVRYLQ QSLI PMLLS+ +SLCF + +CWA  F+ 
Sbjct  72    IATEAGKYAIWLIPTLFPYAILQSLVRYLQAQSLIQPMLLSAVVSLCFQVTICWAFIFKL  131

Query  1000  GLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASM  821
              LG AG AL+I LSYW NVILL++YVKYSS CEK+R     D F   G+FFR AIPSA M
Sbjct  132   NLGIAGAALSISLSYWLNVILLILYVKYSSVCEKTRASFSTDFFLTTGDFFRFAIPSAVM  191

Query  820   ACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAG  641
              CLEWW FE++ILL GL PNP +ETSVLSIC  I ++H++IP+S GA ASTRISNELGAG
Sbjct  192   VCLEWWAFELIILLSGLFPNPMLETSVLSICFTITTVHYHIPYSFGAAASTRISNELGAG  251

Query  640   NTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLV  461
                 A++A+  V ++   E V+A++ L  +R+V GYAFS E EVV Y+ ++ P++ + ++
Sbjct  252   RPQAAKIALAAVIVLSATEFVLASITLFVVRNVWGYAFSYEKEVVTYVAEITPILCISII  311

Query  460   SDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASL  281
              DGI  +LSGVARGSGWQH+GAYVNLGAYYLVG PA  +LGF+  L+G GLW GL   + 
Sbjct  312   MDGIQAVLSGVARGSGWQHIGAYVNLGAYYLVGIPAVLLLGFVFHLKGKGLWSGLVAGTT  371

Query  280   VQNVVLALITIFTDWKKQESKAQERLLNDS  191
             VQ + L+L+T FT+W+KQ  +A+ R+ ++ 
Sbjct  372   VQCISLSLVTGFTNWEKQAIEARRRIFSEK  401



>ref|XP_003518634.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=476

 Score =   498 bits (1283),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 248/470 (53%), Positives = 336/470 (71%), Gaps = 6/470 (1%)
 Frame = -2

Query  1612  LLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             LLP+ +  V L + K      S   F+ ELK ++ +A PM+VV+V Q ++  VS MM GH
Sbjct  5     LLPKENKRVTLTNSK------SSSGFVQELKNVSLMAAPMVVVSVSQFLLQVVSLMMAGH  58

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
             + ELSL+G A+ATSF +VTGFS++ GMA ALET CGQ++GA Q+HKLG Y + AI+SL +
Sbjct  59    LGELSLAGVALATSFADVTGFSILMGMAGALETQCGQSFGAEQFHKLGNYVFCAILSLIL  118

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
              ++PISI+W+FMDK LI +GQD  IS  AG Y +WLI A+F YA+LQ LVRY Q QSLI 
Sbjct  119   SSVPISIIWIFMDKLLILLGQDHAISLIAGNYCIWLIPALFGYAVLQALVRYFQTQSLIF  178

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             PML++S + L  HIP+CW L F  GLG  G A++IG+SYW +V+LL++Y KY  SC+K++
Sbjct  179   PMLVTSVVVLVLHIPICWVLVFGLGLGQNGAAISIGISYWLSVMLLLIYTKYYPSCQKTK  238

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
             + L +++   + EFF LAIPSA M C EWW+FE+V++L GLLPNP++ETSVLSICL IC+
Sbjct  239   IALGSNALRSIKEFFFLAIPSALMICFEWWSFELVVILAGLLPNPKLETSVLSICLNICT  298

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
             LH++IP+  GA  STR+SNELGA     AR AV+ V ++   + VV + VL   R V+G+
Sbjct  299   LHYFIPYGTGAAVSTRVSNELGARRPQAAREAVFAVIVLAFTDAVVFSSVLFCFRHVLGF  358

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             AFSNE EVV Y+ K++P++ L  + DG  G+L G+ RGSGWQ +GA  NL AYY VG P 
Sbjct  359   AFSNEMEVVHYVAKIVPVLCLSFMVDGFLGVLCGIVRGSGWQKIGAITNLVAYYAVGIPV  418

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             + + GF  +  G GLW+G+   S +Q ++LAL+T FT+W+KQ S A ERL
Sbjct  419   SLLFGFGLNFNGKGLWIGILTGSTLQTIILALLTAFTNWEKQASLAIERL  468



>gb|ACU24630.1| unknown [Glycine max]
Length=476

 Score =   498 bits (1282),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 248/470 (53%), Positives = 335/470 (71%), Gaps = 6/470 (1%)
 Frame = -2

Query  1612  LLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             LLP+ +  V L + K      S   F+ ELK ++ +A PM+VV+V Q ++  VS MM GH
Sbjct  5     LLPKENKRVTLTNSK------SSSGFVQELKNVSLMAAPMVVVSVSQFLLQVVSLMMAGH  58

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
             + ELSL+G A+ATSF +VTGFS++ GMA ALET CGQ++GA Q+HKLG Y + AI+SL +
Sbjct  59    LGELSLAGVALATSFADVTGFSILMGMAGALETQCGQSFGAEQFHKLGNYVFCAILSLIL  118

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
               +PISI+W+FMDK LI +GQD  IS  AG Y +WLI A+F YA+LQ LVRY Q QSLI 
Sbjct  119   SGVPISIIWIFMDKLLILLGQDHAISLIAGNYCIWLIPALFGYAVLQALVRYFQTQSLIF  178

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             PML++S + L  HIP+CW L F  GLG  G A++IG+SYW +V+LL++Y KY  SC+K++
Sbjct  179   PMLVTSVVVLVLHIPICWVLVFGLGLGQNGAAISIGISYWLSVMLLLIYTKYYPSCQKTK  238

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
             + L +++   + EFF LAIPSA M C EWW+FE+V++L GLLPNP++ETSVLSICL IC+
Sbjct  239   IALGSNALRSIKEFFFLAIPSALMICFEWWSFELVVILAGLLPNPKLETSVLSICLNICT  298

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
             LH++IP+  GA  STR+SNELGA     AR AV+ V ++   + VV + VL   R V+G+
Sbjct  299   LHYFIPYGTGAAVSTRVSNELGARRPQAAREAVFAVIVLAFTDAVVFSSVLFCFRHVLGF  358

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             AFSNE EVV Y+ K++P++ L  + DG  G+L G+ RGSGWQ +GA  NL AYY VG P 
Sbjct  359   AFSNEMEVVHYVAKIVPVLCLSFMVDGFLGVLCGIVRGSGWQKIGAITNLVAYYAVGIPV  418

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             + + GF  +  G GLW+G+   S +Q ++LAL+T FT+W+KQ S A ERL
Sbjct  419   SLLFGFGLNFNGKGLWIGILTGSTLQTIILALLTAFTNWEKQASLAIERL  468



>ref|XP_008389240.1| PREDICTED: MATE efflux family protein 8-like [Malus domestica]
Length=495

 Score =   498 bits (1283),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 246/459 (54%), Positives = 325/459 (71%), Gaps = 2/459 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F  E+K+L  IA PM+ V + Q M+ F+S MM+GH+ EL+LS  ++A S   VTGFSL  
Sbjct  33    FFEEVKRLGCIAGPMVAVVLSQYMLRFISMMMVGHLGELALSSSSIAISLAGVTGFSLFL  92

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             GMASALETLCGQAYGA QY KLG  TY AI SL +V +P+S++W++ ++ LIF GQDP I
Sbjct  93    GMASALETLCGQAYGAEQYQKLGLLTYTAIFSLNMVCLPLSLIWIYTEEILIFTGQDPAI  152

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAGKY++ LI  +F YA LQ L+RY Q QSL++PML++S ++  FHIP+CW L F+SG
Sbjct  153   SREAGKYTILLIPGLFAYATLQPLIRYFQTQSLVMPMLVTSFVTFLFHIPLCWILIFKSG  212

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             L   G ALAIG+SYW NVI L +Y+K+S +C K+R  +  D F  +GEFFR A+PSA M 
Sbjct  213   LKHLGGALAIGISYWLNVIFLXLYMKFSPACSKTRAPISKDIFHGIGEFFRFALPSAVMQ  272

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW+FE++I L GLLPNP +ETSVLS CL+  S  + IP++ GA  STR+SNELGAGN
Sbjct  273   CLEWWSFELLIFLSGLLPNPALETSVLSACLLAISXIYAIPYAFGAAVSTRVSNELGAGN  332

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
                AR+A +    + + E  +    L + R V GY FSNE EV+DY+  M+PL  L ++ 
Sbjct  333   PQRARIATFAAMXLAVAETSITTTXLFACRKVFGYTFSNEKEVIDYVTIMVPLXCLSVIL  392

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D + G+L+G+ARG+GWQH+GAY+NLGAYYL G P A  L F   LRG GLW+G+ + + V
Sbjct  393   DSMHGVLTGIARGTGWQHIGAYINLGAYYLCGIPVAIALAFWVQLRGRGLWIGIQVGAFV  452

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNGGC  161
             Q  +LAL+T  T+W+KQ SKA+ER+ + S  P   N  C
Sbjct  453   QVSLLALVTCCTNWEKQASKARERIFDRS--PLEVNALC  489



>ref|XP_006494150.1| PREDICTED: MATE efflux family protein 8-like [Citrus sinensis]
Length=491

 Score =   498 bits (1283),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 241/476 (51%), Positives = 325/476 (68%), Gaps = 2/476 (0%)
 Frame = -2

Query  1624  RVNFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTM  1445
             R N     M+  + +  E   + + + D+   E+KK   IA PM+ VT+ Q ++  VS M
Sbjct  2     RDNDTEKNMEKSLLIPKESLSSTSTTWDLLSGEVKKQGYIAAPMVAVTLSQYLLQVVSMM  61

Query  1444  MLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIM  1265
             M+GH+ +L+LS  A+A S  +VTGFS++ GMASALETLCGQAYGA QY ++GT  Y AI 
Sbjct  62    MVGHLGQLALSSTAMAISLASVTGFSVLLGMASALETLCGQAYGAQQYQRIGTQIYTAIF  121

Query  1264  SLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQ  1085
              L +V  P+S LW++M + L+ VGQDP IS E GK+ +WL+ A+F YA +Q L+RY Q Q
Sbjct  122   CLFLVCFPLSFLWIYMGRLLVLVGQDPRISHEVGKFIIWLLPALFAYAAMQALIRYFQSQ  181

Query  1084  SLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSC  905
             SLI+PM LSS  +LC HIP+CW L F+SGLG  G  LAIG+SYW N+  L +Y+K+S++ 
Sbjct  182   SLIIPMFLSSYAALCLHIPICWGLVFKSGLGKLGGTLAIGISYWLNLTFLAIYMKFSTAS  241

Query  904   EKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICL  725
              +SR  +  + F  +GEFF  AIPSA M CLEWW+FE++IL+ GLLPNPQ+ETSVLS CL
Sbjct  242   AESRAPISMELFRGIGEFFHFAIPSAVMVCLEWWSFELLILMSGLLPNPQLETSVLSACL  301

Query  724   MICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRS  545
                     IP+ +GA  STR+SNELGAGN   AR+AV+ V  + ++E ++ +  L + R 
Sbjct  302   STIQTLSAIPYGLGAAVSTRVSNELGAGNVQRARVAVYAVVFMAVMETIIVSASLFASRR  361

Query  544   VVGYAFSNETEVVDYIKK--MIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYY  371
             V GY FSNE +VVDY+    M PLV   ++ D + G+ SGVARG GWQ++ A+VNLGAYY
Sbjct  362   VFGYVFSNEGQVVDYVTSTTMAPLVCFSVIMDSLQGVFSGVARGCGWQNIAAFVNLGAYY  421

Query  370   LVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             L G P A +LGF    RG GLW+G+   +  Q  +L +IT FTDW+KQ SKA++RL
Sbjct  422   LCGVPTAAILGFWLKFRGRGLWIGIQAGAFTQTRLLGIITTFTDWEKQASKARKRL  477



>ref|XP_009127851.1| PREDICTED: MATE efflux family protein 5-like isoform X3 [Brassica 
rapa]
Length=484

 Score =   498 bits (1281),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 240/453 (53%), Positives = 331/453 (73%), Gaps = 0/453 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
             ++D FL E+++L+ IA PM+ V      +  +S MM+GH+ EL LS  A+A SF +VTGF
Sbjct  21    TRDRFLREMRRLSYIAGPMIAVNSSMYFLQVISIMMVGHLGELYLSSTAIAVSFCSVTGF  80

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             SL+FG+ASALETLCGQA GA Q+ KLG +TY  I SL +V+IP+S+LW +M + L F+GQ
Sbjct  81    SLVFGLASALETLCGQANGAKQFEKLGEHTYTGIFSLFIVSIPLSVLWSYMGEILSFIGQ  140

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DPL+S EAGK++  LI ++F YA LQ LVR+ Q QSL++P+++SS  +LC H+ +CW+L 
Sbjct  141   DPLVSQEAGKFATRLIPSLFAYATLQPLVRFFQAQSLVLPLIMSSMSALCCHVVLCWSLV  200

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+ GLGS G A+AI +SYW N  +L +Y+ +SS+C K+R  +    F  + EFFR  +PS
Sbjct  201   FKFGLGSLGAAIAISVSYWLNATVLGLYMTFSSTCSKTRGKISMSVFKGMKEFFRFGVPS  260

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             ASM CLEWW+FE +++L G+LPNP++ETSVLS+CL   S  + IP S+GA ASTR++NEL
Sbjct  261   ASMICLEWWSFEFLVMLSGILPNPKLETSVLSVCLSTISSLYQIPESLGAAASTRVANEL  320

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN   ARMAV+ V +I  +E ++ + ++ + R+V GY FS+ETEVVDY++ M PLVSL
Sbjct  321   GAGNPKKARMAVYTVMVITGVEALMVSAIVFAARNVFGYLFSSETEVVDYVRTMAPLVSL  380

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +LGF   +RG GLW+G+ +
Sbjct  381   SVIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLFGIPTAVVLGFTFKMRGRGLWIGITV  440

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              S VQ V+L LI   T+WK+Q  KA+ERL+ D 
Sbjct  441   GSCVQAVLLGLIVSLTNWKQQVRKARERLMGDE  473



>ref|XP_003592589.1| Protein TRANSPARENT TESTA [Medicago truncatula]
 gb|AES62840.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK33501.1| unknown [Medicago truncatula]
Length=495

 Score =   498 bits (1282),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 238/460 (52%), Positives = 331/460 (72%), Gaps = 0/460 (0%)
 Frame = -2

Query  1576  SEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVA  1397
              E+R    IS D++  ELK++  ++ PM+ VT  Q ++  VS M++GH+ EL LS  A+A
Sbjct  26    EEERKNREISWDIYRKELKRICYLSGPMVAVTSSQYLLQVVSIMIVGHLGELYLSSAALA  85

Query  1396  TSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFM  1217
              SF  VTGFS + GMAS LET CGQAYGA QY ++G  TY +I SL +V +P+S +W+ +
Sbjct  86    ISFAGVTGFSFLMGMASGLETTCGQAYGAKQYQRIGIQTYTSIFSLILVCLPLSFIWINI  145

Query  1216  DKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCF  1037
             +  L+F GQDPLI+ EAG++++WL+ A+F YAILQ LVRY Q+QSL++PMLLSS ++LC 
Sbjct  146   ESILVFTGQDPLIAHEAGRFTIWLLPALFAYAILQPLVRYFQIQSLLIPMLLSSCVTLCI  205

Query  1036  HIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVG  857
             HIP+CWAL F++GL + G A+A+ +S W NVI L +Y++YSSSC K+R  +  + F  + 
Sbjct  206   HIPLCWALVFKTGLNNIGGAIAMSISIWLNVIFLGLYMRYSSSCAKTRAPISMELFQGIW  265

Query  856   EFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAG  677
             EFFR AIPSA M CLEWW++E+++LL GLLPNPQ+ETSVLS+CL   +  + IPF IGA 
Sbjct  266   EFFRFAIPSAVMVCLEWWSYELIVLLSGLLPNPQLETSVLSVCLNTIATLYTIPFGIGAA  325

Query  676   ASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYI  497
             ASTR+SNELGAGN   AR+AV     +G+ E  + +  L + R V GY FS++TEVV Y+
Sbjct  326   ASTRVSNELGAGNPFEARVAVLAAMSLGLTEASIVSATLFACRHVYGYIFSSDTEVVKYV  385

Query  496   KKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRG  317
               + PLVS+ ++ D I G+L+GVARG GWQH+G YVNLGA+YL G P A  L F   + G
Sbjct  386   TVLAPLVSISVILDSIQGVLAGVARGCGWQHIGVYVNLGAFYLCGIPVAAALAFWVQVGG  445

Query  316   MGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLN  197
              GLW+G+ + + VQ V+L++IT   +W++  SKA++RL +
Sbjct  446   KGLWIGIQVGAFVQCVLLSIITCCINWEQLASKARQRLFD  485



>ref|XP_009127850.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Brassica 
rapa]
Length=484

 Score =   498 bits (1281),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 240/452 (53%), Positives = 331/452 (73%), Gaps = 0/452 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
             ++D FL E+++L+ IA PM+ V      +  +S MM+GH+ EL LS  A+A SF +VTGF
Sbjct  21    TRDRFLREMRRLSYIAGPMIAVNSSMYFLQVISIMMVGHLGELYLSSTAIAVSFCSVTGF  80

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             SL+FG+ASALETLCGQA GA Q+ KLG +TY  I SL +V+IP+S+LW +M + L F+GQ
Sbjct  81    SLVFGLASALETLCGQANGAKQFEKLGEHTYTGIFSLFIVSIPLSVLWSYMGEILSFIGQ  140

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DPL+S EAGK++  LI ++F YA LQ LVR+ Q QSL++P+++SS  +LC H+ +CW+L 
Sbjct  141   DPLVSQEAGKFATRLIPSLFAYATLQPLVRFFQAQSLVLPLIMSSMSALCCHVVLCWSLV  200

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+ GLGS G A+AI +SYW N  +L +Y+ +SS+C K+R  +    F  + EFFR  +PS
Sbjct  201   FKFGLGSLGAAIAISVSYWLNATVLGLYMTFSSTCSKTRGKISMSVFKGMKEFFRFGVPS  260

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             ASM CLEWW+FE +++L G+LPNP++ETSVLS+CL   S  + IP S+GA ASTR++NEL
Sbjct  261   ASMICLEWWSFEFLVMLSGILPNPKLETSVLSVCLSTISSLYQIPESLGAAASTRVANEL  320

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN   ARMAV+ V +I  +E ++ + ++ + R+V GY FS+ETEVVDY++ M PLVSL
Sbjct  321   GAGNPKKARMAVYTVMVITGVEALMVSAIVFAARNVFGYLFSSETEVVDYVRTMAPLVSL  380

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +LGF   +RG GLW+G+ +
Sbjct  381   SVIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLFGIPTAVVLGFTFKMRGRGLWIGITV  440

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLND  194
              S VQ V+L LI   T+WK+Q  KA+ERL+ D
Sbjct  441   GSCVQAVLLGLIVSLTNWKQQVRKARERLMGD  472



>ref|XP_009105783.1| PREDICTED: MATE efflux family protein 5-like [Brassica rapa]
Length=490

 Score =   498 bits (1281),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 242/461 (52%), Positives = 332/461 (72%), Gaps = 0/461 (0%)
 Frame = -2

Query  1573  EKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVAT  1394
             E+       ++ F  E+++L  IA PM+ V      +  +S MM+GH+ EL LS  A+A 
Sbjct  15    EEEDEQVNMREGFFQEMRRLGYIAGPMVAVNSSMYFLQVISIMMVGHLGELFLSSTAIAV  74

Query  1393  SFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMD  1214
             SF +VTGFSL+FG+A+ALETLCGQA GA Q+ KLG +TY  I +L +V+IP+SILW +M 
Sbjct  75    SFCSVTGFSLVFGLATALETLCGQANGAKQFEKLGEHTYTGIFALFIVSIPLSILWSYMG  134

Query  1213  KFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFH  1034
             + L F+GQDPL+S EAGK++ WLI A+F YA LQ LVR+ Q QSLI+P+++SS  +LC H
Sbjct  135   EILCFIGQDPLVSQEAGKFATWLIPALFAYATLQPLVRFFQAQSLILPLIMSSISALCCH  194

Query  1033  IPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGE  854
             + +CW L F+ GLGS G ALAI +SYW NVI+L +Y+ +SSSC KSR  +  + F  + E
Sbjct  195   VVLCWCLVFKFGLGSLGAALAISVSYWLNVIVLGLYMVFSSSCGKSRAKISMNVFKGMRE  254

Query  853   FFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGA  674
             FFR  IPSASM CLEWW+FE +++L G+LPNP++ETSVLS+CL   S  + IP S+GA A
Sbjct  255   FFRFGIPSASMICLEWWSFEFLVMLSGILPNPRLETSVLSVCLSTISTLYQIPESLGAAA  314

Query  673   STRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIK  494
             STR++NELGAGN+  ARMAV+ V +I  +E ++   ++ + R+V GY FS+E EVVDY++
Sbjct  315   STRVANELGAGNSKKARMAVYTVMVIAGVESILVGALVFAARNVFGYLFSSEPEVVDYVR  374

Query  493   KMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGM  314
              M PLV+L ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +LGF   +RG 
Sbjct  375   SMAPLVALSVIFDALHAVLSGVARGSGRQDVGAYVNLAAYYLFGIPTAVLLGFRFKMRGR  434

Query  313   GLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             GLW+G+ + S VQ ++L LI   T+WK+Q  KA+ER++ + 
Sbjct  435   GLWIGITVGSFVQALLLGLIVSLTNWKQQVRKARERVMGEE  475



>ref|XP_010427935.1| PREDICTED: MATE efflux family protein 5-like isoform X3 [Camelina 
sativa]
 ref|XP_010427936.1| PREDICTED: MATE efflux family protein 5-like isoform X4 [Camelina 
sativa]
Length=502

 Score =   498 bits (1282),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 243/483 (50%), Positives = 338/483 (70%), Gaps = 0/483 (0%)
 Frame = -2

Query  1648  KGAGGGDQRVNFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQ  1469
             K    G ++   +  + +    ++S  R      KDVFL E+ ++  IA PM+ +     
Sbjct  4     KEIDSGSKKQKEMDSDEEGRFLVVSHSREEEVNKKDVFLKEMTRIGYIAGPMIAINSSMY  63

Query  1468  MVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLG  1289
             +++ +S MM+GH+ E+ LS  A+A SF NVTGFS+IFG+ASALETL GQA+GA Q+ KLG
Sbjct  64    VLLAISMMMVGHLGEVFLSSTAIAISFCNVTGFSVIFGVASALETLSGQAHGAKQFEKLG  123

Query  1288  TYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQC  1109
              +TY  I SL ++ IP+S+LW +M   L+F GQDPL+S EAGK++ WLI A+F YA LQ 
Sbjct  124   VHTYTGIFSLYLMCIPLSVLWSYMGDILVFTGQDPLVSQEAGKFATWLIPALFAYATLQP  183

Query  1108  LVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVV  929
             L+R+ Q QSLI+PM++SS  SLC H+ +CW+L F+ GLGS G A+A+G+SYW NV +L +
Sbjct  184   LIRFFQAQSLILPMIMSSISSLCVHVVLCWSLVFKFGLGSLGAAIAVGISYWLNVTVLGL  243

Query  928   YVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVE  749
             Y+ +SSSC KSR  +    F  +GEFFR  IPSASM CLE W+FEI++LL G+LPNP++E
Sbjct  244   YMTFSSSCSKSRAHISMSMFKGMGEFFRFGIPSASMICLELWSFEILVLLSGILPNPKLE  303

Query  748   TSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAA  569
              SVLS+CL    + + I  SIGA ASTR++NELGAGN   AR+AV+ V +I  +E ++ +
Sbjct  304   ASVLSVCLSTTIILYQIAESIGAAASTRVANELGAGNPKQARIAVYTVMVITCVESLMVS  363

Query  568   VVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYV  389
              ++   R+V GY FS+ETEVVDY++ M  LV+  ++ D +  +L+GVARGSG Q +GAYV
Sbjct  364   AMVFGARNVFGYLFSSETEVVDYVRSMALLVAFTVIFDALHAVLAGVARGSGRQDIGAYV  423

Query  388   NLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQE  209
             NL AYYL G P A +L F   + G GLW+G+ + S VQ V+L L+ IFT+WK+Q  KA+E
Sbjct  424   NLAAYYLCGIPTAVLLAFRFKMGGRGLWIGITVGSFVQAVLLGLVVIFTNWKQQTRKARE  483

Query  208   RLL  200
             RL+
Sbjct  484   RLM  486



>emb|CDX72778.1| BnaC06g32260D [Brassica napus]
Length=491

 Score =   498 bits (1281),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 241/462 (52%), Positives = 332/462 (72%), Gaps = 0/462 (0%)
 Frame = -2

Query  1576  SEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVA  1397
              E+       ++ F  E+++L  IA PM+ V      +  +S MM+GH+ EL LS  A+A
Sbjct  15    EEEEDEQVNMREGFFQEMRRLGYIAGPMVAVNSSMYFLQVISIMMVGHLGELFLSSTAIA  74

Query  1396  TSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFM  1217
              SF +VTGFSL+FG+A+ALETLCGQA GA Q+ KLG +TY  I +L +V+IP+SILW +M
Sbjct  75    VSFCSVTGFSLVFGLATALETLCGQANGAKQFEKLGEHTYTGIFALFIVSIPLSILWSYM  134

Query  1216  DKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCF  1037
              + L F+GQDPL+S EAGK++ WLI A+F YA LQ LVR+ Q QSLI+P+++SS  +LC 
Sbjct  135   GEILCFIGQDPLVSQEAGKFATWLIPALFAYATLQPLVRFFQAQSLILPLIMSSISALCC  194

Query  1036  HIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVG  857
             H+ +CW L F+ GLGS G ALAI +SYW NVI+L +Y+ +SSSC KSR  +  + F  + 
Sbjct  195   HVVLCWCLVFKFGLGSLGAALAISVSYWLNVIVLGLYMMFSSSCGKSRAKISMNVFKGMR  254

Query  856   EFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAG  677
             EFFR  +PSASM CLEWW+FE +++L G+LPNP++ETSVLS+CL   S  + IP S+GA 
Sbjct  255   EFFRFGVPSASMICLEWWSFEFLVMLSGILPNPRLETSVLSVCLSTISTLYQIPESLGAA  314

Query  676   ASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYI  497
             ASTR++NELGAGN   ARMAV+ V +I  +E ++   ++ + R+V GY FS+E EVVDY+
Sbjct  315   ASTRVANELGAGNPKKARMAVYTVMVIAGVESILVGALVFAARNVFGYLFSSEPEVVDYV  374

Query  496   KKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRG  317
             + M PLV+L ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +LGF+  +RG
Sbjct  375   RSMAPLVALSVIFDALHAVLSGVARGSGRQDVGAYVNLAAYYLFGIPTAILLGFMFEMRG  434

Query  316   MGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              GLW+G+ + S VQ ++L LI   T+WK+Q  KA+ER++ + 
Sbjct  435   RGLWIGITVGSFVQALLLGLIVSLTNWKQQVRKARERVMGEE  476



>ref|XP_008339598.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
Length=495

 Score =   498 bits (1281),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 253/483 (52%), Positives = 341/483 (71%), Gaps = 1/483 (0%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
             + LLP+   E          + ++   F  E+K+L  IA PM+ V + Q +++ +S MM+
Sbjct  4     SLLLPKRREEEQQQRRNSTTSILTWTSFFEEVKRLGCIAGPMVAVILSQSLLLVISMMMV  63

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL+LS  A+A S +NVTGFSL  GMASALETLCGQAYGA QY KLG +TY AI SL
Sbjct  64    GHLGELALSSSAIAISLSNVTGFSLFLGMASALETLCGQAYGAEQYQKLGLHTYTAIFSL  123

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +V +P+S++W++M+K LIF+GQDP+IS EAGK+++WLI A+F YA  Q L+RY Q QSL
Sbjct  124   NLVCLPLSLIWIYMEKLLIFMGQDPVISXEAGKFTIWLIPALFAYATJQPLIRYFQTQSL  183

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
             I PML+SS  +L FHIP+CW L F+SGL + G ALAI +SYW N ILL +Y+K+S++C K
Sbjct  184   IXPMLISSCXTLXFHIPLCWJLVFKSGLNNLGGALAISISYWVNAILLGLYMKFSATCSK  243

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +R  +  + F  +GEFFR AIPSA M CL+WW++E++ILL GLL NP  ETSVLS+CL  
Sbjct  244   TRAPISMEVFHGIGEFFRFAIPSAIMICLQWWSYELLILLSGLLSNPAFETSVLSVCLQT  303

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              S  + IP+   A ASTR+SNELGAGN   AR+A + V  + + E+ +    L + R+V 
Sbjct  304   ISTLYAIPYGFAAAASTRVSNELGAGNPQGARIATFSVMFLAVAEISIITTTLFACRNVF  363

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY FSNE EV+DY+  M PLV L    D + G+LSG+ARG+GWQH+GAY+NLGA YL G 
Sbjct  364   GYTFSNEKEVIDYVTTMAPLVCLAAALDSLQGVLSGIARGTGWQHIGAYINLGACYLCGI  423

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPA  179
             P A  L F   LRG GLW+G+ + + VQ V+L+ +TI T+W+KQ +KA+ER+   S PP 
Sbjct  424   PVAATLAFWIQLRGRGLWIGIQVGAFVQTVMLSFVTISTNWEKQATKARERIFEGS-PPQ  482

Query  178   VDN  170
             V++
Sbjct  483   VND  485



>ref|XP_010471123.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=482

 Score =   497 bits (1279),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 245/471 (52%), Positives = 335/471 (71%), Gaps = 2/471 (0%)
 Frame = -2

Query  1600  MDA--EVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHIS  1427
             MD+  E  L++  R      KDVFL E+K++  IA PM+ +     +++ +S MM+GH+ 
Sbjct  1     MDSAEEGLLVASHRDEEVNKKDVFLLEMKRIGYIAGPMIAINSSMYVLLAISMMMVGHLG  60

Query  1426  ELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVA  1247
             EL LS  A+A SF NVTGFS+IFGMASALETL GQA+GA Q+ KLG +TY  I SL +V 
Sbjct  61    ELYLSSTAIAISFCNVTGFSVIFGMASALETLSGQAHGAKQFEKLGVHTYTGIFSLYLVC  120

Query  1246  IPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPM  1067
             IP+S+LW +MD  L F GQDPL+S EAGK+++WLI A+F YA LQ L+R+ Q QSLI+PM
Sbjct  121   IPLSVLWSYMDDILSFTGQDPLVSQEAGKFAIWLIPALFGYATLQPLIRFFQAQSLILPM  180

Query  1066  LLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVC  887
             ++SS  ++C H+ +CW+L F+ GLGS G A+A+G++YW NV +L +Y+ +SSSC KSR  
Sbjct  181   IISSISAVCVHVSLCWSLVFKFGLGSLGAAIAVGVAYWLNVTVLGLYMTFSSSCSKSRAP  240

Query  886   LWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLH  707
             +    F  +GEFFR  IPSASM CLE W+FE+++LL G+LPNP++E SVLS+CL    + 
Sbjct  241   ISMSLFKGMGEFFRFGIPSASMTCLELWSFEVLVLLSGILPNPKLEASVLSVCLSTTIIL  300

Query  706   FYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAF  527
             + I  S+GA ASTR++NELGAGN   AR+AV+ V +I  +E ++A+      R+V GY F
Sbjct  301   YQIAESLGAAASTRVANELGAGNPKQARIAVYTVMVITCVESLMASATFFGARNVFGYLF  360

Query  526   SNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAG  347
             S E EVVDY+K M  LV+L ++ D +  +L+GVARGSG Q +GAYVNL AYYL G P A 
Sbjct  361   SAEAEVVDYVKSMALLVALTVIFDALHAVLAGVARGSGRQDIGAYVNLVAYYLCGVPTAV  420

Query  346   MLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             +L F   + G GLW+G+ + S VQ V+L L+ IFT+WK+Q  K +ERL+ +
Sbjct  421   LLAFRFKMGGRGLWIGITVGSFVQAVLLGLVVIFTNWKQQTRKVRERLMVE  471



>ref|XP_002265933.2| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
Length=494

 Score =   497 bits (1280),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 254/468 (54%), Positives = 346/468 (74%), Gaps = 2/468 (0%)
 Frame = -2

Query  1573  EKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVAT  1394
             E++    ++   F  ELKK+  +A PM+V TV Q ++   S +M+GH+ ++SLS  A+AT
Sbjct  12    EEKRCEEVTWGGFAGELKKVGCLAAPMVVATVSQYLLQVASVVMVGHLGQVSLSAVAIAT  71

Query  1393  SFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMD  1214
             + TNVTGFSL+ G+A  LETLCGQAYGA QY KLG YTY A +SL  V +PI +LW+FMD
Sbjct  72    ALTNVTGFSLLSGLAGGLETLCGQAYGAHQYGKLGIYTYSATISLAFVCLPICLLWIFMD  131

Query  1213  KFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFH  1034
             K LI +GQDPLI+ EA  YS+WLI  ++  AIL+ LVRYLQ QSLI PML+SS + L  H
Sbjct  132   KLLILIGQDPLIAHEARNYSIWLIPGLYGSAILKPLVRYLQTQSLIFPMLISSLIILGLH  191

Query  1033  IPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGE  854
             IP+CW+L F+  LG+ G A+AI +S W NV+LLV+YVKYSS+CEK+R+    D+F  +GE
Sbjct  192   IPICWSLVFKLELGNVGAAVAISISSWLNVVLLVLYVKYSSACEKTRMSFSKDAFFVMGE  251

Query  853   FFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGA  674
             FF  A+P+A M CL+WW+ E++ LL GLLPNP++E+S+L+ICL I +LHF IP+ +GA A
Sbjct  252   FFHFAVPAAVMVCLKWWSCELLTLLSGLLPNPKLESSILAICLTITTLHFTIPYGLGAVA  311

Query  673   STRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIK  494
             STR+SNELGAGN   AR+AVW V  + +IE  V +  L   R V+GYA+S++ ++VD + 
Sbjct  312   STRVSNELGAGNPQAARVAVWAVMFLAIIETTVVSTTLFCCRYVLGYAYSSDKQIVDNVA  371

Query  493   KMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGM  314
              M PL+ L +V D I G+LSGVARGSGWQH+GAY+NLGA+Y+VG P A +LGF+  L+  
Sbjct  372   VMAPLICLSIVMDSIQGVLSGVARGSGWQHIGAYINLGAFYVVGLPVAIILGFVVHLKAK  431

Query  313   GLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
             GLW+G+   S+VQ+ +L++IT FT+WKKQ +KA+ER+     P +V+N
Sbjct  432   GLWIGIVTGSVVQSTLLSIITGFTNWKKQANKARERIFEG--PSSVEN  477



>ref|XP_008339594.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
 ref|XP_008339595.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
 ref|XP_008339596.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
 ref|XP_008339597.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
Length=495

 Score =   497 bits (1280),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 258/486 (53%), Positives = 345/486 (71%), Gaps = 2/486 (0%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
             + LLP+   +          + ++   F  E+K+L  IA PM+ V + Q +++ +S MM+
Sbjct  4     SLLLPKRREDEQQQRRNSTTSILTWTSFFEEVKRLGCIAGPMVAVILSQSLLLVISMMMV  63

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL+LS  ++A S +NVTGFSL  GMASALETLCGQAYGA QY KLG  TY AI SL
Sbjct  64    GHLGELALSSSSIAISLSNVTGFSLFLGMASALETLCGQAYGAEQYQKLGLQTYTAIFSL  123

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +V +P+S++W++M+K LIF+GQDP+IS EAGK+++WLI A+F YA LQ L+RY Q QSL
Sbjct  124   NLVCLPLSLIWIYMEKLLIFMGQDPVISHEAGKFTIWLIPALFAYATLQPLIRYFQTQSL  183

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
             I PML+SS ++L FHIP+CW L F+SGL + G ALAI +SYW NVILL +Y+K+S++C K
Sbjct  184   ITPMLISSCVTLVFHIPLCWILVFKSGLNNLGGALAISISYWVNVILLALYMKFSAACSK  243

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +RV +  + F  + EFFR AIPSA M CLEWW+FE++ILL GLLPNP +ETSVLS+CL  
Sbjct  244   TRVPISMEVFHGIREFFRFAIPSAIMICLEWWSFELLILLSGLLPNPALETSVLSVCLQT  303

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              S  + IPF   A ASTR+SNELGAGN   AR+A +    + + E  +    L + R+V 
Sbjct  304   ISTLYAIPFGFAAAASTRVSNELGAGNPQGARIATFAAMFLAVTETTITTTTLFACRNVF  363

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY FSNE EV+DY+  M PLV L +  D + G+LSG+ARG+GWQH+GA +NLGAYYL G 
Sbjct  364   GYTFSNEKEVIDYVTTMAPLVCLAVTLDSLHGVLSGIARGTGWQHVGACINLGAYYLCGI  423

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPA  179
             P A  L F   L+G GLW+G+ + S VQ ++L+ ITI T+W+KQ SKA++R+   + PP 
Sbjct  424   PVAATLAFWVQLKGRGLWIGIQVGSFVQIILLSSITIGTNWEKQASKARKRIFEGT-PPQ  482

Query  178   VDNGGC  161
             V NG C
Sbjct  483   V-NGLC  487



>ref|XP_004299021.1| PREDICTED: MATE efflux family protein 9-like [Fragaria vesca 
subsp. vesca]
Length=491

 Score =   497 bits (1280),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 249/459 (54%), Positives = 323/459 (70%), Gaps = 2/459 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F  E+KKL  IA PM+ V + Q ++  VS MM+GH+ E++LS  A+A S   VTGFSL  
Sbjct  34    FFEEVKKLGCIAGPMVAVILSQYLLQIVSMMMVGHLGEVALSSTAIAISLAGVTGFSLFL  93

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             GMASALETLCGQAYGA QY KLG  TY AI SL +V +PIS +W +++  LIF+GQDP I
Sbjct  94    GMASALETLCGQAYGAKQYQKLGLQTYTAIFSLNLVCLPISFIWFYVEDLLIFMGQDPAI  153

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAGK+++WLI A+F YA LQ L+RY Q QSL++PM +SS  +L FHIP+CW L F+SG
Sbjct  154   SHEAGKFTIWLIPALFAYATLQPLIRYFQTQSLVIPMFISSCATLLFHIPLCWVLVFKSG  213

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             LG+ G ALAI +SYW N I+L  Y+K+SS+C K+R  +  + F   GEFF  A+PSA M 
Sbjct  214   LGNLGGALAISISYWVNAIILGAYMKFSSACSKTRAPISMEVFRGTGEFFSFAVPSAVMI  273

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW++E+++LL GLLPNP +ETSVLS+CL   S  + IP+  GA ASTR+SNELGAGN
Sbjct  274   CLEWWSYELLVLLSGLLPNPALETSVLSVCLQTISTLYAIPYGFGAAASTRVSNELGAGN  333

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
              + AR+A      + + E  +    L   R V GY FSNE EV+DY++ M PL  L ++ 
Sbjct  334   PEGARIATCAAMFLAVTETTIVTTTLFCCRHVFGYLFSNEEEVIDYVRTMAPLACLSVLL  393

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D + G+LSGVARG GWQH+GAY+NLGA+YL G P A  L FL  LRG GLW+G+ + + V
Sbjct  394   DSLQGVLSGVARGCGWQHIGAYINLGAFYLCGIPVAATLAFLVQLRGRGLWIGIQVGAFV  453

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNGGC  161
             Q  +LA +T  T+W+ Q SKA+ER+   S P  V+NG C
Sbjct  454   QTTLLAFVTTCTNWETQASKARERIFEGSSP--VNNGLC  490



>ref|XP_007044135.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOX99966.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=476

 Score =   496 bits (1277),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 248/467 (53%), Positives = 334/467 (72%), Gaps = 0/467 (0%)
 Frame = -2

Query  1591  EVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLS  1412
             E  +  E   ++  +  VF+ E+K+L  +A PM+ VT+ Q ++  +STMM+GH+ EL+LS
Sbjct  9     EKQVRPESNSSSTCTWVVFIEEVKRLGYLAGPMVAVTISQYLLQVISTMMVGHLGELALS  68

Query  1411  GGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISI  1232
               A+A S + VTGFSL+ GMA ALETLCGQAYGA QY K+GT+TY AI  L +V IP+SI
Sbjct  69    SSAIAISLSGVTGFSLLLGMACALETLCGQAYGAQQYRKVGTHTYTAIFCLILVCIPLSI  128

Query  1231  LWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSA  1052
             LW++M + L+F+GQDPLIS EAGK+ +WLI A+F YA  Q LVRY Q QSLI PML+ S 
Sbjct  129   LWIYMGRLLVFIGQDPLISHEAGKFILWLIPALFAYATFQPLVRYFQTQSLITPMLICSC  188

Query  1051  LSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDS  872
              SL  HIP+CWAL F+S LG+ G A+AI +S W NVI L +Y+ YS +C K+RV +  + 
Sbjct  189   ASLLIHIPLCWALVFKSELGNLGGAVAISISNWLNVIFLALYMWYSPTCAKTRVPITMEL  248

Query  871   FARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPF  692
             F  + EFF  AIPSA M CLEWW+FE++ILL G+LPNP++ETSVLS+CL   +  + IP+
Sbjct  249   FQGIREFFGFAIPSAVMVCLEWWSFELLILLSGILPNPELETSVLSVCLNTIATLYAIPY  308

Query  691   SIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETE  512
              +GA ASTR+SNELGAGN   AR+AV+    + ++E +V +  L + R V GY +SNE E
Sbjct  309   GLGAAASTRVSNELGAGNPQAARVAVYAGMFLAVLETLVVSGTLFASRHVFGYVYSNEKE  368

Query  511   VVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFL  332
             VVDY+  M PLV + ++ D + G+LSG+ARG GWQH+GAY+NLGA+YL G P A  L F 
Sbjct  369   VVDYVTTMAPLVCVSVILDSLQGVLSGIARGCGWQHIGAYINLGAFYLCGIPVAATLAFW  428

Query  331   TSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
               LRGMGLW+G+   +  Q ++LA++T   +W+ Q SKA+ERL+  S
Sbjct  429   LKLRGMGLWIGIQSGAFTQTILLAIVTSCINWENQASKARERLVQGS  475



>ref|XP_010427938.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=482

 Score =   496 bits (1278),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 241/453 (53%), Positives = 331/453 (73%), Gaps = 0/453 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
              KD FL E+++L  IA PM+ +     +++ +STMM+GH+ EL LS  A+A SF +VTGF
Sbjct  20    KKDGFLREMQRLGYIAGPMIAINSSMYVLLVISTMMVGHLGELYLSSTAIAISFCSVTGF  79

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             SL+FG+ASALETLCGQA GA Q+ KLG +TY  I+SL +V IP+S+LW +M   L  +GQ
Sbjct  80    SLVFGLASALETLCGQANGAKQFEKLGVHTYTGIVSLFLVCIPLSLLWSYMGDILSAIGQ  139

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DP+++ EAGK++ WLI A+F YA LQ LVR+ Q QSLI+P+++SS  ++C H+ +CW+L 
Sbjct  140   DPMVAQEAGKFATWLIPALFGYATLQPLVRFFQAQSLILPLIMSSISAVCVHVVLCWSLV  199

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+ GLGS G A+AIG+SYW NV +L +Y+ +SSSC KSR  +    F  +GEFFR  IPS
Sbjct  200   FKFGLGSLGAAIAIGVSYWLNVTVLGLYMTFSSSCSKSRAPISMSLFEGMGEFFRFGIPS  259

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             ASM CLEWW+FE +++L G+LPNP++ETSVLS+CL   S  + IP S+GA ASTR++NEL
Sbjct  260   ASMICLEWWSFEFLVMLSGILPNPKLETSVLSVCLSTISSLYQIPESLGAAASTRVANEL  319

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN   ARMAV+ V +I  +E ++ + ++ + R+V+GY FS+E EVVDY++ M PLV+L
Sbjct  320   GAGNPKQARMAVYTVMVITGVESIMVSAIVFAARNVIGYLFSSEIEVVDYVRSMAPLVAL  379

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              ++ D +  +LSGVARGS  Q +GAYVNL AYYL G P A +L F   + G GLW+G+ +
Sbjct  380   SVIFDALHAVLSGVARGSRRQDIGAYVNLAAYYLCGIPTAILLAFRFKMGGRGLWIGITV  439

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              S VQ V L LI I T+WK+Q  KA+ER++ D 
Sbjct  440   GSFVQAVWLGLIVILTNWKQQARKARERVMGDE  472



>ref|XP_007217833.1| hypothetical protein PRUPE_ppa026002mg [Prunus persica]
 gb|EMJ19032.1| hypothetical protein PRUPE_ppa026002mg [Prunus persica]
Length=478

 Score =   496 bits (1277),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 254/469 (54%), Positives = 324/469 (69%), Gaps = 0/469 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             MD E+    E      ++   F  ELKK   IA PM+ V+V Q ++ FVS +M+GH+ +L
Sbjct  1     MDKEIAETVEDEKTWEVTWGTFGRELKKEGSIAAPMVAVSVLQYLLQFVSMIMVGHLDQL  60

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             SLS  A+A S TNVTGFSL+ GMA  LETLCGQA+GAGQYHKLGTYT  A++SL +V  P
Sbjct  61    SLSSVAIAISLTNVTGFSLLSGMAGGLETLCGQAFGAGQYHKLGTYTCTAMLSLLLVCPP  120

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             I +LW+F DK L  VGQDPLIS EA KYSVWLI A+F  AIL+ L RYLQ QS I PMLL
Sbjct  121   ICVLWIFFDKLLPLVGQDPLISLEARKYSVWLIPALFAGAILKPLTRYLQSQSSIFPMLL  180

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS   L FHI   W   ++ GLGS G A+A  +S W  VILL+ Y   SS+ EK+R+   
Sbjct  181   SSFAILLFHILASWGFVYKVGLGSKGAAIAFSMSTWLYVILLLFYALISSAFEKTRITFS  240

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              +S   + +FFRLA+PSA M CL+WW+ E++ILL GLLPNP++ETSVLSICL I +LHF 
Sbjct  241   MESLLHIRQFFRLAVPSAVMVCLKWWSCELIILLSGLLPNPKLETSVLSICLTISTLHFT  300

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             I +  GA AS R+SNELGA N   AR+AVW    + + E V+ +  L   R V+G+ FS+
Sbjct  301   ISYGFGAAASIRVSNELGADNPQAARVAVWAAMFLSVTEAVIVSTTLFFCRHVLGHVFSS  360

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E  VVDYI  M PL+ L +  D +  +LSG+ARGSGWQ +GAYVNLGA+YLVG P   +L
Sbjct  361   EKPVVDYIAVMAPLICLSVFMDSLQAVLSGIARGSGWQSIGAYVNLGAFYLVGLPVGVVL  420

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             GF   LRG GLW+G+   S+VQ+ +LAL+T FT+W KQ ++A+ER+  +
Sbjct  421   GFPLRLRGKGLWIGIVAGSIVQSALLALVTGFTNWSKQATRARERVFVE  469



>ref|XP_011097157.1| PREDICTED: MATE efflux family protein DTX1-like [Sesamum indicum]
Length=478

 Score =   496 bits (1277),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 240/455 (53%), Positives = 331/455 (73%), Gaps = 0/455 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
              + ELK+++ IA PM+ V+V Q ++  VS +M+GH+ +L+LS  A+ATS TNVTGFSL+ 
Sbjct  24    LVQELKRVSYIAAPMVTVSVLQYLLQVVSVIMVGHLGQLTLSSVAIATSLTNVTGFSLLS  83

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             G+   LETLCGQAYGA QY KL  YTY AI SL +V IP+ +LW+FM+K L+ + QDPL+
Sbjct  84    GLVCGLETLCGQAYGAKQYDKLRIYTYSAIFSLALVCIPVCVLWLFMEKLLVLMRQDPLV  143

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             + EA KYS+WLI A+F  AI + L+RYLQ QSLI+PMLLSS + LC H+P  WAL +R  
Sbjct  144   ALEAQKYSLWLIPALFGGAISKPLIRYLQTQSLILPMLLSSFVVLCCHVPTSWALIYRLH  203

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             +GS G A+A  +S W  VI+LV+Y+K+S+SC+ +R+    D+F  +  FFRLA+PSA M 
Sbjct  204   MGSTGAAVATSISNWLYVIVLVLYIKFSTSCKYTRLVFSVDAFRAMRPFFRLALPSAVMV  263

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CL+WW+ EI++LL GLLPNP++ETSVL+ICL I +LH  I +  GA ASTR+SNELGAGN
Sbjct  264   CLKWWSLEILVLLSGLLPNPELETSVLAICLTISTLHLTISYGFGAAASTRVSNELGAGN  323

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
                AR AV  V  + +IE +  ++VL S R ++G A+SNE +VV+Y+  M PL+    V+
Sbjct  324   PHKARRAVLAVIFLSIIETISTSIVLFSCRHILGRAYSNEKQVVNYVAVMTPLICASTVT  383

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D +   +SGVARGSGWQH+GAYVNLGA+YLVG P A +LGF+  L+  G W+G+ + S++
Sbjct  384   DSLQAAISGVARGSGWQHIGAYVNLGAFYLVGIPVALLLGFVEHLKAKGFWIGIVIGSIL  443

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDSHPPAVD  173
             Q+ +L++IT  TDW+KQ ++A+ER+       A D
Sbjct  444   QSAILSVITGCTDWQKQATRARERITEGGSSEAND  478



>emb|CDX96304.1| BnaA07g29150D [Brassica napus]
Length=489

 Score =   496 bits (1277),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 243/458 (53%), Positives = 331/458 (72%), Gaps = 0/458 (0%)
 Frame = -2

Query  1573  EKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVAT  1394
             E+       ++ F  E+++L  IA PM+ V      +  +S MM+GH+ EL LS  A+A 
Sbjct  15    EEEDEQVNMREGFFQEMRRLGYIAGPMVAVNSSMYFLQVISIMMVGHLGELFLSSTAIAV  74

Query  1393  SFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMD  1214
             SF +VTGFSL+FG+A+ALETLCGQA GA Q+ KLG +TY  I +L +V+IP+SILW +M 
Sbjct  75    SFCSVTGFSLVFGLATALETLCGQANGAKQFEKLGEHTYTGIFALFIVSIPLSILWSYMG  134

Query  1213  KFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFH  1034
             + L F+GQDPL+S EAGK++ WLI A+F YA LQ LVR+ Q QSLI+P+++SS  +LC H
Sbjct  135   EILCFIGQDPLVSQEAGKFATWLIPALFAYATLQPLVRFFQAQSLILPLIMSSISALCCH  194

Query  1033  IPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGE  854
             I +CW L F+ GLGS G ALAI +SYW NVI+L +Y+ +SSSC KSR  +  + F  + E
Sbjct  195   IVLCWCLVFKFGLGSLGAALAISVSYWLNVIVLGLYMVFSSSCGKSRAKISMNVFKGMRE  254

Query  853   FFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGA  674
             FFR  IPSASM CLEWW+FE +++L G+LPNP++ETSVLS+CL   S  + IP S+GA A
Sbjct  255   FFRFGIPSASMICLEWWSFEFLVMLSGILPNPRLETSVLSVCLSTISTLYQIPESLGAAA  314

Query  673   STRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIK  494
             STR++NELGAGN+  ARMAV+ V +I  +E ++   ++ + R+V GY FS+E EVVDY++
Sbjct  315   STRVANELGAGNSKKARMAVYTVMVIAGVESILVGALVFAARNVFGYLFSSEPEVVDYVR  374

Query  493   KMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGM  314
              M PLV+L ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +LGF   +RG 
Sbjct  375   SMAPLVALSVIFDALHAVLSGVARGSGRQDVGAYVNLAAYYLFGIPTAVLLGFRFKMRGR  434

Query  313   GLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
             GLW+G+ + S VQ ++L LI   T+WK+Q  KA+ER++
Sbjct  435   GLWIGITVGSFVQALLLGLIVSLTNWKQQVRKARERVM  472



>ref|XP_009619851.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana tomentosiformis]
Length=472

 Score =   496 bits (1276),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 252/455 (55%), Positives = 336/455 (74%), Gaps = 1/455 (0%)
 Frame = -2

Query  1552  ISKDV-FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVT  1376
             ISK V F  E+K+++R+AIPM+V T+CQ ++ +   +MLGH+SELSLS  ++ATS+  VT
Sbjct  13    ISKRVVFKEEVKEVSRLAIPMIVGTMCQYLLRYAPMVMLGHLSELSLSSASIATSYCTVT  72

Query  1375  GFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFV  1196
             GF+++FGMAS LETLCGQAYGA QY K+GT TY A++ L    +PIS+LW++ +  L+++
Sbjct  73    GFAILFGMASGLETLCGQAYGARQYQKVGTITYAALIFLLFFCLPISLLWIYTENLLLWI  132

Query  1195  GQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWA  1016
             GQDP IS EAGKYS+WLI  +FPYAILQ L  Y Q QSLI+P+L SS +SLCF+IP+ WA
Sbjct  133   GQDPSISVEAGKYSIWLIPTLFPYAILQSLFCYFQAQSLILPILWSSIVSLCFNIPLSWA  192

Query  1015  LSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAI  836
               F+   G+ G A+AIGLSYW NVILLV+Y+KYSS+C+K+R     D F  + EFF+ A 
Sbjct  193   FIFKFNFGTIGAAIAIGLSYWLNVILLVIYLKYSSTCKKTRPFFSKDVFHVMPEFFQFAF  252

Query  835   PSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISN  656
             PSA M  L WW  EI+ LLGGLLPNPQ+ETSVLSICL   S+HF +PFS GA AS RISN
Sbjct  253   PSAGMVGLRWWAVEIITLLGGLLPNPQLETSVLSICLTTSSIHFNLPFSFGAAASIRISN  312

Query  655   ELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLV  476
             ELGAGN   AR++++ V  +   E ++A+ +L SLR+V GYAF+++ EVVD I ++ PL+
Sbjct  313   ELGAGNPKAARVSIYAVFTLAAAEFLLASGILFSLRNVWGYAFTHDQEVVDLITEITPLL  372

Query  475   SLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGL  296
              L ++      +LS VARGSGWQ LGAYVNLG+YYLVG PA+ ++GF+ + +  GLW GL
Sbjct  373   CLSIIVYSTVTVLSEVARGSGWQKLGAYVNLGSYYLVGIPASLLMGFVWNWKAKGLWCGL  432

Query  295   NLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              + S VQ ++L +IT  TDW+K   +A+ERL +  
Sbjct  433   LMGSTVQAILLCIITGLTDWEKLAKEARERLFDRK  467



>ref|XP_007150880.1| hypothetical protein PHAVU_004G001900g [Phaseolus vulgaris]
 gb|ESW22874.1| hypothetical protein PHAVU_004G001900g [Phaseolus vulgaris]
Length=489

 Score =   496 bits (1277),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 332/476 (70%), Gaps = 5/476 (1%)
 Frame = -2

Query  1603  EMDAEV--PLLSE--KRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLG  1436
             EM  EV  PLL++  +   A+  +  F  ELK ++ +A PM+ VTV Q ++  VS MM+G
Sbjct  6     EMSKEVAAPLLTKSGEEEVASPDETTFCQELKTISSMAAPMVAVTVSQYLLQVVSLMMVG  65

Query  1435  HISEL-SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             H+  L S SG A+A SF  VTGFS++ GM+ ALETLCGQ YGA +Y K G YT+ A ++L
Sbjct  66    HLGVLVSFSGVAIAISFAEVTGFSVLLGMSGALETLCGQMYGAEEYRKFGNYTWCATVTL  125

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +V +PIS++W+F DK L+   QDP IS  A +Y ++LI A+F +A+LQ L RY Q QS+
Sbjct  126   ILVCLPISLVWIFTDKILLLFSQDPQISRAACEYCIYLIPALFGHAVLQALTRYFQTQSM  185

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
             I PM+ SS  SLC HIP+CW L F  GLG  G ALAIG+SYW N + L +Y+ YS +C+K
Sbjct  186   IFPMVFSSITSLCLHIPICWGLVFTLGLGHVGAALAIGVSYWLNAVWLAIYMLYSPACQK  245

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +R+   + +   + EF +LAIPS  M C EWW+FE++ LL GLLPNPQ+ET+VLS+CL  
Sbjct  246   TRIVFSSSALISIPEFLKLAIPSGLMFCFEWWSFEVLTLLAGLLPNPQLETAVLSVCLNT  305

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              SLH+++P+++GA ASTR+SNELGAGN   A+  V  V I+G+ E V+ + V MS R ++
Sbjct  306   TSLHYFVPYAVGASASTRVSNELGAGNPKTAKGVVRVVLILGVAEAVIVSTVFMSCRHIL  365

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GYA+SN+ EVVDY+  M PL+ + +  D + G LSG+ARG G+Q +GAYVNLGAYYLVG 
Sbjct  366   GYAYSNDMEVVDYVASMAPLLCVSVSVDSLIGALSGIARGGGFQQIGAYVNLGAYYLVGI  425

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             P     GF   L+  GLWMG    S++Q ++LAL+T  TDWKK+ SKA+ER++ +S
Sbjct  426   PMGLCFGFYLQLKAKGLWMGTLSGSVLQVIILALVTALTDWKKEASKARERVVENS  481



>ref|XP_007139193.1| hypothetical protein PHAVU_008G009000g [Phaseolus vulgaris]
 gb|ESW11187.1| hypothetical protein PHAVU_008G009000g [Phaseolus vulgaris]
Length=477

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/448 (54%), Positives = 325/448 (73%), Gaps = 0/448 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             E+KK+ RIA PM+V TV Q ++  VS +M+GH+++L+LS  A+ATS TNV GFS++ GMA
Sbjct  20    EMKKVGRIAAPMVVATVLQYLLPVVSLIMVGHLNQLALSSVAIATSLTNVFGFSVLSGMA  79

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
               LETLCGQA+GA QY K G YTY AI+SL +V+IPI+ILW+FMDK LI + QDP+IS +
Sbjct  80    GGLETLCGQAFGAKQYEKFGLYTYTAIISLLLVSIPITILWIFMDKILILLHQDPIISLQ  139

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             A KY++ LI A+F  AIL+ L R+ Q QSLI PM+L+SAL LCFH+  CW L F+  LG 
Sbjct  140   ARKYALCLIPALFGSAILKPLTRFFQTQSLIFPMILTSALVLCFHVVTCWILVFKLELGH  199

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
              G A+A     W NV+LL+ +V++SS+C K+R+   + +   VGE+FR A+PSA M CL+
Sbjct  200   VGAAIAFSFCVWLNVMLLLSFVRFSSACHKTRIPFSSKALLGVGEYFRFAVPSAVMVCLK  259

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW  EI++LL G+LPNP++ETSVLSICL I +LHF +P+  GA  STR+SNELGAGN+  
Sbjct  260   WWACEILVLLAGVLPNPKLETSVLSICLTISTLHFTLPYGFGAAVSTRVSNELGAGNSAA  319

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
              R+AV    +I + E ++   VL S R V+GYA+SN+  VV Y+  M PL+ L + +D +
Sbjct  320   VRVAVSATMLIAVTEGLIVCAVLYSCRHVLGYAYSNDHVVVHYVAVMTPLLCLSIFTDSL  379

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
               +LSGVARGSGWQHLGAYVNLGA+YLVG P   +LGF+   R  GLW+G+   S++Q+ 
Sbjct  380   QSVLSGVARGSGWQHLGAYVNLGAFYLVGIPVGVLLGFVAHYRAKGLWIGIVTGSILQSF  439

Query  268   VLALITIFTDWKKQESKAQERLLNDSHP  185
             +L+LIT  T+WKKQ   A+ER+ +   P
Sbjct  440   LLSLITALTNWKKQAMMARERIFDARAP  467



>gb|KDP34994.1| hypothetical protein JCGZ_09282 [Jatropha curcas]
Length=443

 Score =   494 bits (1271),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 243/433 (56%), Positives = 319/433 (74%), Gaps = 0/433 (0%)
 Frame = -2

Query  1495  MLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAY  1316
             M+ V + Q ++   S MM+GH+ EL+LS  A+A S + VTGFSL+ GM SALETLCGQAY
Sbjct  1     MVAVVLSQYLLQVFSMMMVGHLGELALSSTAIAISLSGVTGFSLLLGMGSALETLCGQAY  60

Query  1315  GAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISA  1136
             GA QY KLG +T  AI  L +V IP+S++W+FM K L+ VGQ+PLIS EAGK+ VWL+ A
Sbjct  61    GAKQYKKLGVHTQTAIFCLVLVCIPLSLIWIFMGKILVLVGQNPLISHEAGKFIVWLVPA  120

Query  1135  IFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSY  956
             +F YA LQ LVRY Q QSLI+PMLLSS  +LCFHIP+CW L F+SGL + G ALAI +S 
Sbjct  121   LFAYAALQPLVRYFQTQSLILPMLLSSCATLCFHIPLCWVLVFKSGLQNVGAALAISISN  180

Query  955   WFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLG  776
             W NVI LV+Y+KYSS+C K+R  +  + F  +GEFFR AIPSA M CLEWW+FE+++LL 
Sbjct  181   WLNVIFLVLYMKYSSACAKTRSPISMELFNGIGEFFRFAIPSAIMICLEWWSFELLVLLS  240

Query  775   GLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTII  596
             GLLPNPQ+ETSVLS+CL   S  + IP+ +GA  STR+SNELGAGN   AR+AV+ +  +
Sbjct  241   GLLPNPQLETSVLSVCLTTISTLYAIPYGLGAAGSTRVSNELGAGNPQGARLAVYALLFL  300

Query  595   GMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGS  416
              ++E  + +  L + R V GY FS+E EVVDY+  M PLV L ++ D + G+LSGVARG 
Sbjct  301   AVVETAIVSSTLFATRHVFGYTFSDEKEVVDYVTTMAPLVCLSVIFDSLQGVLSGVARGC  360

Query  415   GWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDW  236
             GWQH+GAY+NLGA+YL G P A +LGF   LRG GLW+G+ + +  Q ++L+++T   +W
Sbjct  361   GWQHIGAYINLGAFYLCGIPVASVLGFWLKLRGKGLWIGIQVGAFTQTLLLSIVTSCINW  420

Query  235   KKQESKAQERLLN  197
             +KQ SKA+ER+  
Sbjct  421   EKQASKARERIFE  433



>gb|EYU40798.1| hypothetical protein MIMGU_mgv1a018157mg [Erythranthe guttata]
Length=462

 Score =   494 bits (1271),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 247/458 (54%), Positives = 331/458 (72%), Gaps = 2/458 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             MD  + LL E+       +++   E+KKL  +A PM+ VT+   ++  +S MM+GH+ EL
Sbjct  1     MDENL-LLKERESLPERWREI-AGEMKKLGYLAGPMVAVTLSHYLLQVISLMMVGHLGEL  58

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             SLS  A+A S   V+GFSL+ GMASALET+ GQA+GA QY K+GT TY AI SL +V IP
Sbjct  59    SLSSTAIAISLAGVSGFSLLLGMASALETISGQAFGAEQYEKIGTQTYTAIFSLVIVCIP  118

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             +SILW++M   L FVGQDP IS EAGK+++WL+ A+F YA LQ L+RY Q+QSLI+PML+
Sbjct  119   LSILWIYMGNVLEFVGQDPQISQEAGKFTMWLVPALFAYATLQPLIRYYQIQSLILPMLI  178

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS  +LCFH+PVCWAL F+SGL + G A+AIGLS W NV +L +Y+ +S SC K+R    
Sbjct  179   SSCFTLCFHVPVCWALVFKSGLHNLGGAVAIGLSMWLNVTILTLYMIFSPSCAKTRAPFS  238

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
                F  + EFFR A+PSA M CLEWW+FE++ILL G+LPNPQ+ETSVLS+CL   S  + 
Sbjct  239   MKIFQGITEFFRFAVPSAVMICLEWWSFELLILLSGILPNPQLETSVLSVCLNTISTLYA  298

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IPF +GA ASTRISN+LGAG  + AR+++  + ++  I+ +V +  + + R+V GY FSN
Sbjct  299   IPFGLGAAASTRISNQLGAGKPEGARLSLIALMLLAAIDAIVISASVFASRNVFGYIFSN  358

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E EVVDY+  M PLV L ++ D I G+LSGVARG GWQH+GAYVNLGA+YL G P A  L
Sbjct  359   EKEVVDYVTIMAPLVCLSIIIDSIQGVLSGVARGCGWQHIGAYVNLGAFYLFGIPIAASL  418

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQ  227
             GF  +LRG GLW+G+   + +Q ++L++IT  T+W+KQ
Sbjct  419   GFWLNLRGKGLWIGILCGATLQMIMLSIITSCTNWEKQ  456



>ref|XP_011097156.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein DTX1-like 
[Sesamum indicum]
Length=477

 Score =   494 bits (1272),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 331/452 (73%), Gaps = 1/452 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             ELKK++ IA PM+ V+V Q ++  VS +M+GH+ +L+LS  A+ATS TN+TGFSL+ G+A
Sbjct  27    ELKKVSYIAAPMITVSVLQYLLQVVSVIMVGHLGQLTLSSVAIATSLTNITGFSLLSGLA  86

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
               LETLCGQAYGA QY+KLG YTY AI SL +V IP+ +LW+FM+K L+ + QD  ++ E
Sbjct  87    GGLETLCGQAYGAKQYYKLGIYTYSAIFSLALVCIPVCVLWLFMEKLLVLMRQDLSVALE  146

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             A KYS+WLI A+F  AI + LVRYLQ QSLI+PML+SS + LC H+   WAL + S +GS
Sbjct  147   AQKYSLWLIPALF-XAISKPLVRYLQTQSLILPMLVSSFVVLCCHVLTSWALIYMSHMGS  205

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
              G A+A  +S W  VI+L +Y+K+SSSC+ +R+    D+F  +  FFRLA+PSA M CL+
Sbjct  206   KGAAIATCISNWIYVIVLALYIKFSSSCKHTRLAFSVDAFRAMRRFFRLALPSAVMVCLK  265

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW+ E+++LL GLLPNP++ETSVLSICL I +LHF I + +GA ASTR+SNELGAGN   
Sbjct  266   WWSLEVLVLLSGLLPNPELETSVLSICLTISTLHFTISYGLGAAASTRVSNELGAGNPHK  325

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
             AR AV  V  + + EL+  ++VL S R ++G A+SNE +VV+Y+  M PL+    V+D +
Sbjct  326   ARTAVLAVMFLSITELISTSIVLFSCRHILGRAYSNEKQVVNYVAVMTPLICASTVTDSL  385

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
                +SG+ARGSGWQH+GAYVNLGA+YLVG P A +LGF+  L+  G W+G+ + S++Q+ 
Sbjct  386   QAAISGIARGSGWQHIGAYVNLGAFYLVGIPVAVLLGFVVHLKAKGFWIGIVIGSILQSA  445

Query  268   VLALITIFTDWKKQESKAQERLLNDSHPPAVD  173
             +L++IT FTDW+KQ  KA+ER+       A D
Sbjct  446   ILSVITGFTDWQKQAIKARERISGGGSSEAND  477



>ref|XP_010471119.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Camelina 
sativa]
Length=479

 Score =   494 bits (1272),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 244/473 (52%), Positives = 336/473 (71%), Gaps = 3/473 (1%)
 Frame = -2

Query  1600  MD-AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHIS-  1427
             MD AE  LL++        KD +  E+K+L  IA PM+ V +    +  +S +M+GH+  
Sbjct  1     MDSAEKGLLAKSDEEEVKKKDGYFREMKRLGYIAGPMVAVNLSMDFLQVISIVMIGHLGD  60

Query  1426  -ELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVV  1250
              EL LS  A+A SF + TGFSL+FG+ASA+ETLCGQAYGA QY KLG +TY  I+SL +V
Sbjct  61    GELFLSSTAIAVSFCSATGFSLVFGLASAMETLCGQAYGAKQYEKLGVHTYTTILSLYLV  120

Query  1249  AIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVP  1070
              IP+S+LW +M   L  +GQDPL++ EAGK++ WLI A+F YA LQ LV++LQ QSLI P
Sbjct  121   CIPLSVLWSYMGAILSLIGQDPLVAQEAGKFATWLIPALFAYATLQPLVQFLQAQSLIFP  180

Query  1069  MLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRV  890
             +++SS  ++C H+ +CW+L F+ GLG  G A+AIG+SYW NV++L +Y+K+SSSC KSR 
Sbjct  181   LIISSLSAVCVHVSLCWSLVFKFGLGIRGAAIAIGVSYWVNVVVLGLYMKFSSSCSKSRA  240

Query  889   CLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSL  710
              +    F  + EFF L IPSASM CLEWW+FE ++LL G+LPN  +ETSVLS+CL   S 
Sbjct  241   TISMSVFKGMKEFFWLGIPSASMICLEWWSFEFLVLLSGILPNSTLETSVLSVCLSTISF  300

Query  709   HFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYA  530
              ++IP S+GA ASTR++NELGAGN   ARMAV+ V +I  +E ++ + ++   R+V GY 
Sbjct  301   AYHIPESLGAAASTRVANELGAGNPKQARMAVYTVMVIAGVESILVSAIVFGSRNVFGYL  360

Query  529   FSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAA  350
             FS+ETEVVDY++ M PLVSL+++ D +  +LSGVARG+G Q  GAYVNL AYYL G P A
Sbjct  361   FSSETEVVDYVRSMAPLVSLLVIFDALHTVLSGVARGAGRQDKGAYVNLAAYYLCGTPTA  420

Query  349   GMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              +L F   +RG GLW+G+ + S VQ  +L LI +FT+W+++   A+ERL+ + 
Sbjct  421   IILAFGFKMRGRGLWIGITVGSFVQAFLLGLIVMFTNWEQEAKNARERLMAEE  473



>emb|CAN69572.1| hypothetical protein VITISV_044050 [Vitis vinifera]
Length=489

 Score =   494 bits (1273),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 253/468 (54%), Positives = 345/468 (74%), Gaps = 2/468 (0%)
 Frame = -2

Query  1573  EKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVAT  1394
             E++    ++   F  ELKK+  +A PM+V TV Q ++   S +M+GH+ ++SLS  A+AT
Sbjct  7     EEKRCEEVTWGGFAGELKKVGCLAAPMVVATVSQYLLQVASVVMVGHLGQVSLSAVAIAT  66

Query  1393  SFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMD  1214
             + TNVTGFSL+ G+A  LETLCGQAYGA QY KLG YTY A +SL  V +PI +LW+FMD
Sbjct  67    ALTNVTGFSLLSGLAGGLETLCGQAYGAHQYGKLGIYTYSATISLAFVCLPICLLWIFMD  126

Query  1213  KFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFH  1034
             K LI +GQDPLI+ EA  YS+WLI  ++  AIL+ LVRYLQ QSLI PML+SS + L  H
Sbjct  127   KLLILIGQDPLIAHEARNYSIWLIPGLYGSAILKPLVRYLQTQSLIFPMLISSLIILGLH  186

Query  1033  IPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGE  854
             IP+CW+L F+  LG+ G A+AI +S W NV+LLV+YVKYSS+CEK+R+    D+F  +GE
Sbjct  187   IPICWSLVFKLELGNVGAAVAISISSWLNVVLLVLYVKYSSACEKTRMSFSKDAFFVMGE  246

Query  853   FFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGA  674
             FF  A+P+A M CL+WW+ E++ LL GLLPNP++E+S+L+ICL I +LHF IP+ +GA A
Sbjct  247   FFHFAVPAAVMVCLKWWSCELLTLLSGLLPNPKLESSILAICLTITTLHFTIPYGLGAVA  306

Query  673   STRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIK  494
             STR+SNELGAGN   AR+AVW V  + +IE  V +  L   R V+GYA+S++ ++VD + 
Sbjct  307   STRVSNELGAGNPQAARVAVWAVMFLAIIETTVVSTTLFCCRYVLGYAYSSDKQIVDNVA  366

Query  493   KMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGM  314
              M PL+ L +V D I G+LSGVARGSGWQH+GAY+NLGA+Y+VG P A +LGF+  L+  
Sbjct  367   VMAPLICLSIVMDSIQGVLSGVARGSGWQHIGAYINLGAFYVVGLPVAIILGFVVHLKAK  426

Query  313   GLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
             GLW+G+   S+VQ+ +L++IT  T+WKKQ +KA+ER+     P +V+N
Sbjct  427   GLWIGIVTGSVVQSTLLSIITGXTNWKKQANKARERIFEG--PSSVEN  472



>ref|XP_011075977.1| PREDICTED: MATE efflux family protein 5-like [Sesamum indicum]
Length=477

 Score =   494 bits (1271),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 242/464 (52%), Positives = 326/464 (70%), Gaps = 0/464 (0%)
 Frame = -2

Query  1582  LLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGA  1403
             LL E+     +       E+K+L  +A PM+ VT+   ++  +S MM+GH+ ELSLS  A
Sbjct  6     LLKERVSERRVRWGEIGEEMKRLGYLAGPMVAVTLSHYLLQVISLMMVGHLGELSLSSTA  65

Query  1402  VATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWV  1223
             +A S   VTGFSL+ GMA ALET+ GQA+GA QY KLGT TY AI SL +V IP+S+LW 
Sbjct  66    IAISLAGVTGFSLLLGMAGALETISGQAFGAQQYEKLGTQTYTAIFSLIIVCIPLSVLWT  125

Query  1222  FMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSL  1043
              M   L FVGQDP IS EAGK+ +WL+ A+F YA+LQ L+RY QMQSLI+PML+SS ++L
Sbjct  126   NMGTLLKFVGQDPQISHEAGKFMMWLVPALFGYAVLQPLIRYYQMQSLILPMLISSCVTL  185

Query  1042  CFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFAR  863
             CFH+PVCWAL F+SGL + G A+A+ LS W NV +L +Y+KYS +C K+R  +    F  
Sbjct  186   CFHVPVCWALVFKSGLENLGGAVAMSLSMWLNVTILSLYMKYSQACAKTRSQISMKIFEG  245

Query  862   VGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIG  683
             + EFFR AIPSA M CLEWW+FE++ILL G+LPNPQ+ETSVLS+CL   +  + IP+ + 
Sbjct  246   IKEFFRFAIPSAVMICLEWWSFELLILLSGILPNPQLETSVLSVCLNTIATLYAIPYGLA  305

Query  682   AGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVD  503
             + ASTRISNELGAG  + AR +V  + +I  +  ++ +  + + ++V GY FSNE EVVD
Sbjct  306   SAASTRISNELGAGRPEEARTSVIALMLIAAVNAIIVSTGVFASQNVFGYIFSNEKEVVD  365

Query  502   YIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSL  323
             Y+ KM PLV L ++ D + G LSGVARG GWQH+GAY+NL A+YL G P A  L F    
Sbjct  366   YVTKMAPLVCLSVIVDSLQGALSGVARGCGWQHIGAYINLAAFYLFGIPIAATLAFWLDF  425

Query  322   RGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             RG GLW+G+   + +Q ++L++IT  T+W+KQ +KA+ERL  + 
Sbjct  426   RGKGLWIGILSGATLQTIMLSIITSCTNWEKQAAKARERLFEEK  469



>ref|XP_002532229.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
 gb|EEF30160.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
Length=476

 Score =   493 bits (1268),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 250/456 (55%), Positives = 322/456 (71%), Gaps = 0/456 (0%)
 Frame = -2

Query  1591  EVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLS  1412
             E  LL +     A++  VF  E+KKL  IA PM+ V + Q ++  +S MM+GH+ EL+LS
Sbjct  10    EESLLLKDDSRTALTWPVFTQEVKKLGYIAGPMVAVILSQYLLQVISLMMVGHLGELALS  69

Query  1411  GGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISI  1232
               A+ATS   VTGFS + GMASALETLCGQAYGA QY KLG  T  AI  L +V IP+SI
Sbjct  70    STAIATSLAGVTGFSFLLGMASALETLCGQAYGAKQYKKLGIQTQTAIFCLILVCIPLSI  129

Query  1231  LWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSA  1052
             +W FM K L+ +GQDP IS EAGKY +WL+ ++F YA LQ LVRY QMQSLI PMLLSS 
Sbjct  130   IWTFMGKLLVSIGQDPAISHEAGKYMMWLVPSLFAYAALQPLVRYFQMQSLITPMLLSSC  189

Query  1051  LSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDS  872
              +LCFH+P+CW L+F SGL + G ALA+ +S W NVI L +Y+ YSS+C K+R  +  + 
Sbjct  190   ATLCFHMPLCWVLTFHSGLENLGAALAMDISIWLNVIFLGLYMSYSSACAKTRAPISVEL  249

Query  871   FARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPF  692
             F  +GEFFR AI SA M CLEWW+FE+++LL GLLPNPQ+ETSVLS+CL   S  + IP+
Sbjct  250   FHGIGEFFRFAIFSAVMICLEWWSFELLVLLSGLLPNPQLETSVLSVCLQTISTLYSIPY  309

Query  691   SIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETE  512
               GA  STR+SNELGAG    AR+AV+ V  + ++E  + +  L + R V GY FSNE E
Sbjct  310   GFGAAVSTRVSNELGAGKPQAARIAVFAVLFLAVVETAIVSSALFACRHVFGYLFSNEKE  369

Query  511   VVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFL  332
             VVDY+  M PLV+L ++ D + G+LSGVARG GWQH+GAYVNLGA+YL G P A +LGF 
Sbjct  370   VVDYVTTMSPLVALSVIMDSLQGVLSGVARGCGWQHIGAYVNLGAFYLCGIPVAAVLGFW  429

Query  331   TSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQE  224
               LRGMGLW+G+ + +  Q V+L+++T   +W  Q 
Sbjct  430   LKLRGMGLWIGIQVGAFTQTVLLSIVTSRVNWDNQN  465



>ref|XP_002532232.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
 gb|EEF30163.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
Length=490

 Score =   493 bits (1269),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 254/483 (53%), Positives = 344/483 (71%), Gaps = 7/483 (1%)
 Frame = -2

Query  1603  EMDAEVPLLSEKRPA-----AAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
             +++ E  LLSEKR       A IS D+F+ E K+L  IA PM+ VT+   ++  +S MM+
Sbjct  7     KINMEEKLLSEKREGEREGLALISWDIFIEEGKRLGCIAGPMVAVTLSSYLINVISMMMV  66

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL+LS  A+A S + VTGFS++ GM+SALETLCGQAYGA QY KLG  TY  I SL
Sbjct  67    GHLGELALSSSAIAISLSAVTGFSVLSGMSSALETLCGQAYGAEQYRKLGNQTYSGIFSL  126

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +VAI +SI+W+ M+K LI +GQDP+I+ EAGK++  L+ A+F YAI Q L RY Q QSL
Sbjct  127   ILVAITLSIVWINMEKLLILIGQDPVIAHEAGKFTRLLVPALFAYAISQPLTRYYQTQSL  186

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
               PML+S++++L  HIP+CW L F+SGL + G ALAI +S W N + L++Y+KYSS C K
Sbjct  187   TKPMLISTSVTLSLHIPLCWVLVFKSGLRNLGGALAISISNWLNAVFLLLYMKYSSVCAK  246

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +RV +  + F  VGEFFR AIPS  M CL+WW++E VILL GLLPNPQ+ETSVLS+CL  
Sbjct  247   TRVPISMELFQGVGEFFRFAIPSVVMICLQWWSYEFVILLSGLLPNPQLETSVLSVCLTT  306

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              +  + IP+ + A  STR+SNELGAGN  +A+ AV+ V  I + EL++ +  L + R V 
Sbjct  307   IATLYAIPYGLSAAVSTRVSNELGAGNPRVAKNAVYSVMFITVAELILVSGTLFTTRHVF  366

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY FSNE EVVD +  M PLV L ++ DG+ G+LSGVARG GWQH+GAYVNLGA YL G 
Sbjct  367   GYTFSNEKEVVDSVSTMAPLVCLSVIVDGLQGVLSGVARGCGWQHIGAYVNLGALYLCGV  426

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPA  179
             PAA +LGF   L+G GLW+G+ + +++Q V+L ++T  T+WK+Q +KA++R+       +
Sbjct  427   PAAAILGFWLQLKGRGLWIGICIGAILQTVLLYVVTCHTNWKEQANKARKRIFEGRS--S  484

Query  178   VDN  170
             V+N
Sbjct  485   VEN  487



>ref|XP_008446676.1| PREDICTED: MATE efflux family protein 7-like [Cucumis melo]
Length=485

 Score =   493 bits (1268),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 232/470 (49%), Positives = 336/470 (71%), Gaps = 2/470 (0%)
 Frame = -2

Query  1603  EMDAEVPLLSEKRPA--AAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHI  1430
             +   E  LL++++    ++ S  V+L E++++  +A P+++VT  Q M+  ++ MM+GH+
Sbjct  6     DCSMEETLLAKQKENNLSSTSTGVYLEEMRRVGFLAAPLVIVTFSQFMLQIITMMMVGHL  65

Query  1429  SELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVV  1250
               L+LS  A+A S + VTGFS++ G++SALETLCGQAYGA QY K+G  TY AI  + ++
Sbjct  66    GALALSSTAIAVSISAVTGFSVLLGLSSALETLCGQAYGAQQYQKVGIQTYTAIFCIFLI  125

Query  1249  AIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVP  1070
               P+S++W+F++K L+FVGQDPLIS EAGK+ VWLI  +F  A LQ LVRY Q QSL++P
Sbjct  126   CFPLSLVWLFLEKLLLFVGQDPLISHEAGKFIVWLIPGLFACAFLQPLVRYFQAQSLVIP  185

Query  1069  MLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRV  890
             M++ S ++LCFHIP+CW + +++GL + G AL++  SYW NVILL +Y+K+S  CEK+R 
Sbjct  186   MVIFSCITLCFHIPICWFMVYKTGLRNLGGALSMSFSYWLNVILLALYMKFSPKCEKTRG  245

Query  889   CLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSL  710
              +  + F  + +FF LA+PSA M CLEWW+FE++ILL GLLPNP++ETSVLS+CL   + 
Sbjct  246   VISMELFQGIRDFFSLAVPSAVMVCLEWWSFELIILLSGLLPNPELETSVLSVCLQTIAS  305

Query  709   HFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYA  530
              + I + +GA  STR+SNELGAGN   AR A   V  + ++E ++ +  L +LR + GY 
Sbjct  306   LYSIAYGLGAAGSTRVSNELGAGNPQAARRATRVVLFLAILETLILSTTLFALRHIFGYT  365

Query  529   FSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAA  350
             FSNE +VVDY+  M PL+ + ++ DGI G+LSG+ARG GWQHLGAYVN G++YL G P A
Sbjct  366   FSNEKDVVDYVASMAPLICISVLLDGIQGVLSGIARGCGWQHLGAYVNFGSFYLCGIPVA  425

Query  349   GMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
              +LGFL  L+G GLW+G+ + + VQ  +L+ IT   +W++Q   A ERLL
Sbjct  426   ALLGFLVHLKGRGLWIGIQIGAFVQASLLSFITSRINWEEQARMASERLL  475



>ref|XP_006843971.1| hypothetical protein AMTR_s00006p00119970 [Amborella trichopoda]
 gb|ERN05646.1| hypothetical protein AMTR_s00006p00119970 [Amborella trichopoda]
Length=475

 Score =   491 bits (1265),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 249/456 (55%), Positives = 336/456 (74%), Gaps = 3/456 (1%)
 Frame = -2

Query  1540  VFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLI  1361
             V + E+KK+  IA PM+VV + Q ++  VS M++GH+ ELSLSG A+ATS   V+GFSL+
Sbjct  19    VVVDEIKKICVIAGPMIVVNMTQYLLQVVSVMVVGHLGELSLSGAAIATSLAGVSGFSLL  78

Query  1360  FGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPL  1181
              GMASALETLCGQAYGA QY ++G YT  A ++L++V IP+S +W  M K L  +GQDP 
Sbjct  79    IGMASALETLCGQAYGAEQYQEVGIYTQRAAITLSLVCIPMSFIWASMSKILSLIGQDPA  138

Query  1180  ISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRS  1001
             ISAEAG+Y VWLI  +F +A+LQ LV++LQ QS+ +PMLLSS  +LC H+P+CWAL F  
Sbjct  139   ISAEAGRYIVWLIPGLFAFALLQPLVKFLQAQSITMPMLLSSTATLCLHVPLCWALVFPC  198

Query  1000  GLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASM  821
              LGS G A+++ ++ W NV++L  Y+K+S  C+++   L  ++F  +GEFFRLA PSA+M
Sbjct  199   QLGSIGAAMSMSITTWANVLMLGCYIKFSPKCKRTLAPLSKEAFRGLGEFFRLAFPSATM  258

Query  820   ACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAG  641
              CLE+W+FE+++LL GLLPNP++ETSVLSICL   SL + IP+ +GA ASTRISNELGAG
Sbjct  259   ICLEYWSFELLVLLSGLLPNPKLETSVLSICLSTLSLLYSIPYGLGAAASTRISNELGAG  318

Query  640   NTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLV  461
                 A + V  V  I + E +  +V++   R ++GYAFSNE EVV Y+ +M PL S    
Sbjct  319   CPQEAALVVRVVMAITLTEALSMSVIVFVARYLLGYAFSNEEEVVKYVARMAPLFSASTF  378

Query  460   SDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASL  281
              DGI G+LSGVARG GWQH+GAY+NLGA+YLVG PAA +LGF+  +RGMGLW+G+   + 
Sbjct  379   MDGIQGVLSGVARGCGWQHIGAYINLGAFYLVGIPAALVLGFIVQMRGMGLWIGILCGAT  438

Query  280   VQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVD  173
             VQ V+LALIT+FT+W+ Q +KA+ER+  +   PA D
Sbjct  439   VQTVLLALITLFTNWQHQANKARERVFQN---PAAD  471



>gb|KHG10126.1| MATE efflux family protein 9 [Gossypium arboreum]
Length=489

 Score =   492 bits (1267),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 246/464 (53%), Positives = 328/464 (71%), Gaps = 0/464 (0%)
 Frame = -2

Query  1582  LLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGA  1403
             L +E++    +S   F+ E+K+   +A PM+ VT+ Q ++  +STMM+GH+ EL+LS  A
Sbjct  18    LENEEKSTRWLSWAAFVEEIKRAGYLAGPMVAVTLSQYLLQVISTMMVGHLGELALSSSA  77

Query  1402  VATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWV  1223
             +A S   VTGFS + GMA ALETLCGQAYGA QY KLG +TY AI  L +V IP+SILW+
Sbjct  78    IAISLAGVTGFSFLLGMACALETLCGQAYGAQQYRKLGIHTYTAIFCLILVCIPLSILWL  137

Query  1222  FMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSL  1043
             +M + L+F+GQDPLIS EAGK+ +WLI ++F YA  Q LVRY Q QSLI PML+ S  SL
Sbjct  138   YMGRLLVFIGQDPLISQEAGKFILWLIPSLFAYATFQPLVRYFQTQSLITPMLICSCASL  197

Query  1042  CFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFAR  863
               HIP+CWAL F+SGL S G A+AI +S W NVI L +Y+ YS +C K+R  +  + F  
Sbjct  198   VVHIPLCWALVFKSGLESIGGAIAISISNWLNVIFLALYMLYSPTCTKTRAPITMELFQG  257

Query  862   VGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIG  683
             + EFFR AIPSA M CLEWW++E++ILL GLLPNP++ETSVLS+CL   S  + IP+ +G
Sbjct  258   IREFFRFAIPSAVMICLEWWSYELLILLSGLLPNPELETSVLSVCLNTISTLYAIPYGLG  317

Query  682   AGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVD  503
             A ASTR+SNELGAG    AR+AV+    I ++E ++    L + R V GY +SNE EVVD
Sbjct  318   AAASTRVSNELGAGKPQAARVAVYAAMAIAVLETLIVTGALFASRRVFGYIYSNEKEVVD  377

Query  502   YIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSL  323
             Y+  M PLV + +V D + G+LSG+ARG GWQH+GAYVNLGA+YLVG P A  L F   L
Sbjct  378   YVTTMAPLVCVSVVLDSLQGVLSGIARGCGWQHIGAYVNLGAFYLVGIPVAATLAFWLQL  437

Query  322   RGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             RG+GLW+G+   +  Q ++LA++T   +W+KQ  +A+ER+   S
Sbjct  438   RGVGLWIGIQFGAFTQTILLAIVTSCINWEKQAIEARERVFQGS  481



>ref|XP_010415818.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=500

 Score =   493 bits (1268),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 241/468 (51%), Positives = 329/468 (70%), Gaps = 0/468 (0%)
 Frame = -2

Query  1603  EMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             + D E   L          KDVFL E+ ++  IA PM+ +     +++ +S MM+GH+ E
Sbjct  17    DSDEEGRFLVVSDREEVNKKDVFLKEMTRIGYIAGPMIAINSSMYVLLAISMMMVGHLGE  76

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             + LS  A+A SF NVTGFS+IFGMASALETL GQA+GA Q+ KLG +TY  I SL +V I
Sbjct  77    VFLSSTAIAISFCNVTGFSVIFGMASALETLSGQAHGAKQFEKLGVHTYTGIFSLYLVCI  136

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW +MD  L F GQDPL++ EAGK++ WLI A+F YA LQ L+R+ Q QSLI+PM+
Sbjct  137   PMSVLWSYMDDILSFTGQDPLVAQEAGKFATWLIPALFAYATLQPLIRFFQAQSLILPMI  196

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  SLC H+ +CW+L F+ GLGS G A+A+G+SYW NV +L +Y+ +SSSC KSR  +
Sbjct  197   MSSISSLCVHVVLCWSLVFKFGLGSLGAAIAVGVSYWLNVTVLGLYMTFSSSCSKSRAHI  256

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                 F  +GEFFR  IPSASM CLE W+FEI++LL G+LPNP++E S+LS+CL    + +
Sbjct  257   SMSMFKGMGEFFRFGIPSASMICLELWSFEILVLLSGILPNPKLEASILSVCLSTTVILY  316

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
              I  S+GA ASTR++NELGAGN   AR+AV+ V +I  +E ++ + ++   R+V GY FS
Sbjct  317   QIAESLGAAASTRVANELGAGNPKKARIAVYTVMVITCVESLMVSAMVFGARNVFGYLFS  376

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
              E EVVDY++ M  LV+  ++ D +  +L+GVARGSG Q +GAYVNL AYYL G P A +
Sbjct  377   AEAEVVDYVRSMALLVAFTVIFDALHAVLAGVARGSGRQDIGAYVNLAAYYLCGIPTAVL  436

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
             L F   + G GLW+G+ + S VQ V+L L+ IFT+WK+Q  KA+ERL+
Sbjct  437   LAFRFKMGGRGLWIGITVGSFVQAVLLGLVVIFTNWKQQTRKARERLM  484



>ref|XP_010427944.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=484

 Score =   492 bits (1266),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 241/450 (54%), Positives = 325/450 (72%), Gaps = 0/450 (0%)
 Frame = -2

Query  1546  KDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFS  1367
             KD FL E+K+L  IA PM+ V     ++  +S MM+GH+ EL LS  A+A SF +VTGFS
Sbjct  20    KDGFLKEMKRLGYIAGPMVAVNSSTYVLQVISIMMVGHLGELYLSSTAIAVSFCSVTGFS  79

Query  1366  LIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQD  1187
             L+FG+ASALETLCGQAYGA Q+ KLG +TY  I SL +V IP+S+LW +M   L  +GQD
Sbjct  80    LVFGLASALETLCGQAYGARQFEKLGVHTYTGIFSLYLVCIPLSVLWSYMSAILSLIGQD  139

Query  1186  PLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSF  1007
             PL++ +AGK++ WLI A+F YA LQ LVR+ Q QS I+P+++SS  +LC H+ +CW+L F
Sbjct  140   PLVAQQAGKFATWLIPALFGYATLQSLVRFYQAQSQILPLIMSSISALCVHVVLCWSLVF  199

Query  1006  RSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSA  827
             + GLGS G A+AIG+SYWFNV +L +Y+ +SSSC K+R  +    F  +GEFFR  IPSA
Sbjct  200   KFGLGSLGAAIAIGVSYWFNVTVLGLYMTFSSSCSKTRAPISMSVFKGMGEFFRFGIPSA  259

Query  826   SMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELG  647
             SM CLEWW+FE ++LL G+LPNP++E SVLS+CL   S  + IP S+GA ASTR++NELG
Sbjct  260   SMICLEWWSFEFLLLLSGILPNPKLEASVLSVCLSTQSSLYQIPESLGAAASTRVANELG  319

Query  646   AGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLM  467
             AG    AR AV+ V +I  +E ++  V++ + R+V GY FS+E EVVDY++ M PLV+L 
Sbjct  320   AGKPKQARTAVYTVMVITGVESIMVGVIVFAARNVFGYLFSSEIEVVDYVRSMAPLVALS  379

Query  466   LVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLA  287
             ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +L F   + G GLW+G+ + 
Sbjct  380   VIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLCGIPTAILLAFRFKMGGRGLWIGITVG  439

Query  286   SLVQNVVLALITIFTDWKKQESKAQERLLN  197
             S VQ V+L LI I T+WK+Q  KA+ R++ 
Sbjct  440   SFVQAVLLGLIVILTNWKQQAGKARLRVMG  469



>gb|KHN47243.1| MATE efflux family protein 7 [Glycine soja]
Length=479

 Score =   491 bits (1265),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 243/462 (53%), Positives = 331/462 (72%), Gaps = 6/462 (1%)
 Frame = -2

Query  1612  LLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             LLP+ +  V L + K      S   F+ ELK ++ +A PM+VV+V Q ++  VS MM GH
Sbjct  5     LLPKENKRVTLTNSK------SSSGFVQELKNVSLMAAPMVVVSVSQFLLQVVSLMMAGH  58

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
             + ELSL+G A+ATSF +VTGFS++ GMA ALET CGQ++GA Q+HKLG Y + AI+SL +
Sbjct  59    LGELSLAGVALATSFADVTGFSILMGMAGALETQCGQSFGAEQFHKLGNYVFCAILSLIL  118

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
              ++PISI+W+FMDK LI +GQD  IS  AG Y +WLI A+F YA+LQ LVRY Q QSLI 
Sbjct  119   SSVPISIIWIFMDKLLILLGQDHAISLIAGNYCIWLIPALFGYAVLQALVRYFQTQSLIF  178

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             PML++S + L  HIP+CW L F  GLG  G A++IG+SYW +V+LL++Y KY  SC+K++
Sbjct  179   PMLVTSVVVLVLHIPICWVLVFGLGLGQNGAAISIGISYWLSVMLLLIYTKYYPSCQKTK  238

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
             + L +++   + EFF LAIPSA M C EWW+FE+V++L GLLPNP++ETSVLSICL IC+
Sbjct  239   IALGSNALRSIKEFFFLAIPSALMICFEWWSFELVVILAGLLPNPKLETSVLSICLNICT  298

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
             LH++IP+  GA  STR+SNELGA     AR AV+ V ++   + VV + VL   R V+G+
Sbjct  299   LHYFIPYGTGAAVSTRVSNELGARRPQAAREAVFAVIVLAFTDAVVFSSVLFCFRHVLGF  358

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             AFSNE EVV Y+ K++P++ L  + DG  G+L G+ RGSGWQ +GA  NL AYY VG P 
Sbjct  359   AFSNEMEVVHYVAKIVPVLCLSFMVDGFLGVLCGIVRGSGWQKIGAITNLVAYYAVGIPV  418

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQ  227
             + + GF  +  G GLW+G+   S +Q ++LAL+T FT+W+KQ
Sbjct  419   SLLFGFGLNFNGKGLWIGILTGSTLQTIILALLTAFTNWEKQ  460



>ref|XP_002280189.2| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
Length=481

 Score =   491 bits (1265),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 246/454 (54%), Positives = 330/454 (73%), Gaps = 2/454 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             E+K+L  +A PM+ V + Q ++  +S MM+GH+ EL+LS  A+A S + VTGFS + GMA
Sbjct  27    EVKRLGCLAAPMVAVILSQYLLQVISLMMVGHLGELALSSTAIAISLSGVTGFSFLLGMA  86

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
             SALETLCGQAYGA QYHKLGT TY AI+SL +V +P++++W++M K L F+GQDP+IS E
Sbjct  87    SALETLCGQAYGAEQYHKLGTQTYTAIVSLLLVCLPLAVIWLYMSKLLTFIGQDPVISHE  146

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             AG++S+WL+ A+F YA LQ LVRYLQ QSLI+P+LL+S   L FHIP+CWAL F+SGLGS
Sbjct  147   AGQFSIWLVPALFGYATLQALVRYLQTQSLIMPLLLTSCAILGFHIPLCWALVFKSGLGS  206

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
              G ALAIG+SYW NVI L +Y+KYS +CEK+RV +  +    +GEFFR AIPSA M CLE
Sbjct  207   LGGALAIGISYWLNVIFLGLYIKYSPACEKTRVPVSMEILGGIGEFFRFAIPSAVMICLE  266

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW+FE++ILL GLLPNP++E SVLS+CL   S  + IP  +G+  STR+SNELGAGN   
Sbjct  267   WWSFELLILLSGLLPNPELEASVLSVCLNTVSTLYAIPHGLGSAGSTRVSNELGAGNPQK  326

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
             AR+AV     + + E +V +  L   R V GY FS E EVVDY+  + P + L ++ D +
Sbjct  327   ARLAVHAAVCLAVTEAIVISTTLFVSRRVFGYVFSEEEEVVDYVTNIAPFLCLSVILDSV  386

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
              G LSGV RG G Q +GA++NLGA+YL G P A +L F+  LRG GLW+GL   SL+Q  
Sbjct  387   QGTLSGVVRGCGRQRIGAFINLGAFYLCGIPVAVILAFVVHLRGKGLWVGLQTGSLLQTS  446

Query  268   VLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             +L +IT  T+W++Q +KA++R+   +   +V+NG
Sbjct  447   LLLIITGCTNWEEQATKARQRIFEGTS--SVENG  478



>emb|CDX68324.1| BnaA07g23640D [Brassica napus]
Length=487

 Score =   491 bits (1265),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 242/469 (52%), Positives = 334/469 (71%), Gaps = 1/469 (0%)
 Frame = -2

Query  1600  MD-AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             MD AE  LL         +KDV L E+ +L+ IA PM+ V      +  +S MM+GH+ E
Sbjct  1     MDSAEKGLLVRGEEEDVNTKDVLLREMGRLSYIAGPMVAVNSSMYFLQVISIMMVGHLGE  60

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+A SF +VTGFSL+FG+ASALETLCGQAYGA Q+ KLG +TY  +++L VV+I
Sbjct  61    LYLSSTAIAVSFCSVTGFSLVFGLASALETLCGQAYGAKQFEKLGEHTYTGMLALFVVSI  120

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW FM + L F+GQDP ++ EAGK++ WLI A+F YA +Q LV++ Q QSLI+P++
Sbjct  121   PLSVLWSFMGEILSFIGQDPQVAQEAGKFATWLIPALFGYATMQPLVKFFQAQSLILPLM  180

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             LSS  ++C H+ +CW L F+ GLGS G A+AI +SYW NV++L +Y+ +SS+C KSR  +
Sbjct  181   LSSVSAVCCHVVLCWCLVFKFGLGSIGAAIAISVSYWLNVVVLGLYMAFSSTCSKSRGKI  240

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                 F  + EFF+  +PSASM CLEWW+FE +++L G+LPNP++E SVLS+CL      +
Sbjct  241   SMSVFEGMREFFQFGVPSASMICLEWWSFEFLVMLSGILPNPKLEASVLSVCLSTIFTLY  300

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
              IP S+GA ASTR++NELGAGN   ARMAV+ V ++  +E V+   ++ + R+V GY FS
Sbjct  301   QIPESLGAAASTRVANELGAGNPKKARMAVYTVMVMTGVESVMVGAIVFAARNVFGYLFS  360

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +ETEVVDY++ + PLVSL ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +
Sbjct  361   SETEVVDYVRSIAPLVSLSVIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLFGIPTAVI  420

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLN  197
             L F   +RG GLW+G+ + S VQ V+L LI   T+WK+Q  KA+ER++ 
Sbjct  421   LAFKFDMRGRGLWIGITVGSFVQTVLLGLIVSLTNWKQQAKKARERVMG  469



>ref|XP_003536654.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=475

 Score =   491 bits (1264),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 241/463 (52%), Positives = 334/463 (72%), Gaps = 0/463 (0%)
 Frame = -2

Query  1579  LSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAV  1400
             L +K     ++  V+  E++++  IA PM+ V   Q ++  VSTM++GH+ EL LS  A+
Sbjct  5     LVKKHEQERVTWGVYSEEMRRVCHIAGPMVAVVSSQYLLQVVSTMIVGHLGELYLSSAAL  64

Query  1399  ATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVF  1220
             A S + VTGFSL+ GMAS LET+CGQAYG  QY ++G  TY AI SL +V+IP+S+LW+ 
Sbjct  65    AISLSGVTGFSLLMGMASGLETICGQAYGGQQYQRIGIQTYTAIFSLILVSIPVSLLWIN  124

Query  1219  MDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLC  1040
             M+  L+F+GQDPLIS EAGK+++WL+ A+F YAILQ LVRY Q+QSL++PM  SS ++L 
Sbjct  125   METILVFIGQDPLISHEAGKFTIWLVPALFAYAILQPLVRYFQIQSLLLPMFASSCVTLI  184

Query  1039  FHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARV  860
              H+P+CWAL F++ L + G ALA+ +S W NVI LV+Y++YSS+C K+R  +  + F  +
Sbjct  185   IHVPLCWALVFKTSLSNVGGALAVSISIWSNVIFLVLYMRYSSACAKTRAPISMELFKGM  244

Query  859   GEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGA  680
              EFFR AIPSA M CLEWW++E+++LL GLLPNPQ+ETSVLS+CL   +  + IPF IGA
Sbjct  245   WEFFRFAIPSAVMVCLEWWSYELLVLLSGLLPNPQLETSVLSVCLNTIATLYTIPFGIGA  304

Query  679   GASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDY  500
              ASTR+SNELGAGN+  AR+AV     + +IE  + +  L + R+V GY FSNE EVVDY
Sbjct  305   AASTRVSNELGAGNSHAARVAVLAAMSLAVIETSIVSATLFACRNVFGYIFSNEKEVVDY  364

Query  499   IKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLR  320
             +  M PLV + ++ D I G+L+G+ARG GWQHLG YVNLGA+YL G P A +L FL  L 
Sbjct  365   VTAMAPLVCISVILDSIQGVLTGIARGCGWQHLGVYVNLGAFYLCGIPMAALLAFLVRLG  424

Query  319   GMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             G GLW+G+   + VQ ++L++IT   +W+KQ  KA++RL ++ 
Sbjct  425   GKGLWIGIQSGAFVQCILLSIITGCINWEKQAIKARKRLFDEK  467



>ref|XP_004299022.1| PREDICTED: MATE efflux family protein 9-like [Fragaria vesca 
subsp. vesca]
Length=480

 Score =   491 bits (1264),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 254/474 (54%), Positives = 327/474 (69%), Gaps = 2/474 (0%)
 Frame = -2

Query  1582  LLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGA  1403
             LL   +     S   F  E+K+L+ IA PM+ V + Q ++  VS MM+GH+  L+LS  A
Sbjct  8     LLPRGKDQRKGSWQSFFQEVKRLSCIAGPMVAVNLSQLLLQIVSMMMVGHLGGLALSSTA  67

Query  1402  VATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWV  1223
             +ATS   VTGFSL  G+ASALETLCGQAYGA QY K G  TY AI SL +V +PIS +W 
Sbjct  68    IATSLAAVTGFSLFSGLASALETLCGQAYGAEQYQKHGIQTYTAIFSLNLVCLPISFIWF  127

Query  1222  FMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSL  1043
             +M   LIF+GQDP IS +AGK+ V LI A+F  A LQ L+RY Q QSLI+PMLL S ++ 
Sbjct  128   YMKDLLIFMGQDPSISHQAGKFIVLLIPALFACATLQPLIRYFQTQSLIMPMLLCSCVTF  187

Query  1042  CFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFAR  863
              FHIP+CW L F+SGL + G ALAI +SYW N ILL +Y+K+SS+C K+R  +  + F  
Sbjct  188   MFHIPLCWVLVFKSGLDNLGGALAISISYWLNTILLGLYMKFSSACSKTRAPISREVFQG  247

Query  862   VGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIG  683
             +GEFFR A+PSA M CL+WW+FE++ILL GLLPNP +ETSVLS+CL   S  + IP  IG
Sbjct  248   IGEFFRFAVPSAVMLCLQWWSFELLILLSGLLPNPTLETSVLSVCLQTLSTLYSIPNGIG  307

Query  682   AGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVD  503
             A ASTR+SNELGAGN + AR A      + + E    A+ L   R V GY F+NE EV+D
Sbjct  308   AAASTRVSNELGAGNPEGARRATSAAMFLTIAETSTVAITLFCCRHVFGYLFTNEEEVID  367

Query  502   YIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSL  323
             Y++ M PL+ L ++ D + G+LSG++RG GWQH+GAY+NLGAYYL G P A  L FL  L
Sbjct  368   YVRIMAPLLCLSVILDSLQGVLSGISRGCGWQHIGAYINLGAYYLCGIPVAATLAFLVLL  427

Query  322   RGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNGGC  161
             RG GLW+G+ + + VQ  +LAL+T  T+W+ Q SKA+ER+   S P  VDNG C
Sbjct  428   RGRGLWIGIQVGAFVQTTLLALVTCCTNWEMQASKARERIFEGSSP--VDNGLC  479



>ref|XP_006579797.1| PREDICTED: MATE efflux family protein 8-like [Glycine max]
Length=486

 Score =   491 bits (1264),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 231/453 (51%), Positives = 327/453 (72%), Gaps = 1/453 (0%)
 Frame = -2

Query  1546  KDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL-SLSGGAVATSFTNVTGF  1370
             +  F  E K+++ +A PM+ VTV Q ++  VS MM+GH+  L S SG A+ATSF  VTGF
Sbjct  27    ESTFCQEFKRVSSMAAPMVAVTVSQYLLQVVSLMMVGHLGILVSFSGVAIATSFAEVTGF  86

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             S++ GM+ ALETLCGQ YGA +Y K G Y + AI++LT+V +PIS++W+F DK L+   Q
Sbjct  87    SVLLGMSGALETLCGQTYGAEEYRKFGNYIWCAIVTLTLVCLPISLVWIFTDKILMLFSQ  146

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DP IS  A +Y ++LI A+F +A+LQ L RY Q QS+I PM+ SS  +LC H+P+CW L 
Sbjct  147   DPEISHAAREYCIYLIPALFGHAVLQALTRYFQTQSMIFPMVFSSITALCLHVPICWGLV  206

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+ GL   G ALAIG+SYW NV+ L +Y+ +S +C+K+++   +++   + EF +LAIPS
Sbjct  207   FKLGLRHIGAALAIGVSYWLNVVWLAIYMIFSPACQKTKIVFSSNALLSIPEFLKLAIPS  266

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
               M C EWW+FE++ LL G+LPNPQ+ET+VLS+CL   +LH++IP+++GA ASTR+SNEL
Sbjct  267   GLMFCFEWWSFEVLTLLAGILPNPQLETAVLSVCLNTTTLHYFIPYAVGASASTRVSNEL  326

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN   A+ AV  V I+G+ E V+ + V +S R V+GYA+SN+ EV+DY+ +M PL+ +
Sbjct  327   GAGNPKTAKGAVRVVVILGVAEAVIVSSVFISCRHVLGYAYSNDKEVIDYVAEMAPLLCV  386

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              + +D + G LSG+ARG G+Q +GAYVNLGAYYLVG P   +LGF   LR  GLWMG   
Sbjct  387   SVTADSLIGALSGIARGGGFQEIGAYVNLGAYYLVGIPMGLLLGFHLQLRAKGLWMGTLS  446

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              SL Q ++LA++T  TDW K+ +KA+ER++ +S
Sbjct  447   GSLTQVIILAIVTALTDWHKEATKARERVVENS  479



>ref|XP_006430703.1| hypothetical protein CICLE_v10013438mg [Citrus clementina]
 gb|ESR43943.1| hypothetical protein CICLE_v10013438mg [Citrus clementina]
Length=462

 Score =   490 bits (1261),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 252/470 (54%), Positives = 327/470 (70%), Gaps = 12/470 (3%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             MD EV    EKR   AI+   F+ ELKK  RIA PM+ V+V Q ++  VST+M+GH+S+L
Sbjct  1     MDMEVGESQEKR--WAITWGGFMEELKKTGRIAAPMVAVSVLQYLLQVVSTVMVGHLSQL  58

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+ATS TNVTGFSL+ GMA  LETLCGQAYGA Q+ KLG +TY AI+SL +V   
Sbjct  59    ALSSVAIATSLTNVTGFSLLSGMAGGLETLCGQAYGAAQFRKLGVHTYTAIISLILVCPL  118

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             + +LW+FMDK L  +GQDP+IS EA KYS+WLI A+F  AIL+ L RY Q QSLI+PM  
Sbjct  119   VCLLWIFMDKLLPLIGQDPVISHEARKYSMWLIPALFGSAILKPLTRYFQTQSLILPMFA  178

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS L LCFHIP CW L F+  LGS G ALA  LS W NVILL +Y+ YSS+CEK+R  + 
Sbjct  179   SSFLILCFHIPACWTLVFKLELGSMGAALAFSLSTWLNVILLGLYMMYSSACEKTRAPVS  238

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              +S   +G+FFRLAIPSA M CL+WW+ EI+ILL GLLPNP++ETSVLSICL I +LHF 
Sbjct  239   KESLLAIGQFFRLAIPSAIMVCLKWWSMEILILLSGLLPNPKLETSVLSICLTISTLHFT  298

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP++ G  ASTR+SNELGAGN   AR+AVW  T   ++E V+   +L   R  +GYA++ 
Sbjct  299   IPYAFGVAASTRVSNELGAGNLQAARVAVWAATSYAVVEAVIVGTILFCCRYFLGYAYTK  358

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             + +VV Y+  M PL+ L +++D +  + S             Y+NLGA+YLVG P   +L
Sbjct  359   DNQVVHYVVVMAPLICLSVITDSLQAVFSAYR---------VYINLGAFYLVGLPVGAVL  409

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             GF+  LRG GLW+G+   S+VQ+ +L+L T FT+WKKQ  +   ++LN  
Sbjct  410   GFVAHLRGKGLWIGIVAGSVVQSTLLSLATTFTNWKKQ-MRIYVKILNKK  458



>ref|XP_002528064.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
 gb|EEF34314.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
Length=472

 Score =   490 bits (1262),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 242/477 (51%), Positives = 332/477 (70%), Gaps = 10/477 (2%)
 Frame = -2

Query  1600  MDAEVPLLSEKR-PAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             M+  VP + EK  PA          EL+KL+ +A PM+VV+V Q ++  VS MM GH+  
Sbjct  1     MEETVPNIEEKAWPAQ---------ELRKLSFMAAPMVVVSVSQYLLPTVSLMMAGHLGS  51

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LSG +VA+SFTN TGF+L+ G++ ALETLCGQAYGAGQY K G+Y Y AI+SL  + +
Sbjct  52    LPLSGVSVASSFTNATGFALLIGLSGALETLCGQAYGAGQYKKFGSYLYCAIISLLPICL  111

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P SILW+FMD+ LI +G DP IS EA +YS+ LI A+F +AILQ LVRY Q QSLI+PML
Sbjct  112   PASILWIFMDRILISIGLDPKISMEACRYSIGLIPALFGFAILQSLVRYFQTQSLILPML  171

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  +L  HIP+CWAL F+   G+ G A++IGLSYW NVI L  Y+++SSSCEK+RV  
Sbjct  172   ISSCATLSAHIPLCWALVFKWEFGAIGGAMSIGLSYWLNVIFLACYMRWSSSCEKTRVLC  231

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
             W D F+ + EF+R A+PSA M CLEWWTFE++ LL G LPN ++ETSVLSIC+   ++++
Sbjct  232   WKDVFSSISEFWRFALPSAVMVCLEWWTFELLTLLAGFLPNSKLETSVLSICITTTTVNY  291

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
             Y+ + +GA ASTR+SNELG+GN   AR  V  +  + + E V+ +  L   R + GYA+S
Sbjct  292   YVQYGLGAAASTRVSNELGSGNPQKARSVVRVILAVSITEAVIVSTALFCCRRIFGYAYS  351

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             N+ EVV+Y+ ++ PL+ L ++ D +  +LSG+ARG GWQ  GA +N  AY  VG P + +
Sbjct  352   NDKEVVNYVTEIAPLLCLSVIMDSLQAVLSGIARGCGWQRTGAVINFSAYNFVGVPVSVV  411

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVD  173
             L F+  L+G GLW+G+   S+VQ  +LAL+T  TDW+KQ + A+ER+        +D
Sbjct  412   LCFVVHLKGKGLWIGVLTGSVVQVALLALMTASTDWQKQATMAKERMFKRQLEQTMD  468



>ref|XP_004497007.1| PREDICTED: MATE efflux family protein 5-like [Cicer arietinum]
Length=481

 Score =   491 bits (1263),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 245/476 (51%), Positives = 337/476 (71%), Gaps = 2/476 (0%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
             + L  ++D +     E+R    IS DV++ E+K +   ++PM+ V   Q ++  VS M++
Sbjct  4     SLLSKKIDGKTESDLEERKR--ISWDVYMKEMKTICHTSVPMVAVISSQYLLQVVSIMIV  61

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ EL LS  A++ SF  VTGFS + GMA  LET CGQAYGA QY ++G  TY AI SL
Sbjct  62    GHLGELYLSSAALSISFAGVTGFSFLMGMACGLETTCGQAYGAKQYKRIGMQTYTAIFSL  121

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +V IP+S LW++++  L+F GQDPLI+ EAG++++WLI A+F Y ILQ LVRY QMQSL
Sbjct  122   ILVCIPLSFLWIYIENILVFTGQDPLIAHEAGRFTIWLIPALFAYGILQPLVRYFQMQSL  181

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
             ++PMLLSS ++LC HIP+CWAL F++GL + G A+A+ +S W NVI L +Y++YSSSC K
Sbjct  182   LLPMLLSSCVTLCIHIPLCWALVFKTGLNNVGGAIAMSISIWLNVIFLGLYMRYSSSCAK  241

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +R  +  + F  + EFFR AIPSA M CLEWW++E+++LL GLLPNPQ+ETSVLS+CL  
Sbjct  242   TRAPISMELFHGIWEFFRFAIPSAVMVCLEWWSYELMVLLSGLLPNPQLETSVLSVCLNT  301

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              +  + IPF IGA ASTR+SNELGAGN   AR+AVWG   + +IE  +A+  L + R V 
Sbjct  302   IATLYTIPFGIGAAASTRVSNELGAGNPFEARVAVWGAMSLALIEASIASATLFACRHVY  361

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY FSN+ EVVDY+  M PLVS+ ++ D I G L+G++RG GWQHLG YVNLGA+YL G 
Sbjct  362   GYVFSNDKEVVDYVTIMAPLVSISVILDSIQGTLAGISRGCGWQHLGVYVNLGAFYLCGI  421

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             P A  L F   + G GLW+G+ + ++VQ V+L++IT   +W++Q  KA+ RL +  
Sbjct  422   PVAAALAFWVQVGGKGLWIGIQVGAVVQCVLLSIITSCINWEQQAMKARHRLFDSQ  477



>ref|XP_008243313.1| PREDICTED: MATE efflux family protein 9-like [Prunus mume]
Length=474

 Score =   490 bits (1262),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 245/471 (52%), Positives = 331/471 (70%), Gaps = 2/471 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISK-DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             MD  + L+ E      + +  +F+AE+K+L  IA PM+ V + Q  +  +S MM+GH+ +
Sbjct  1     MDKSL-LIEEGEDRGGVERCGLFVAEVKRLGYIAGPMVAVNLSQYFLQIISIMMVGHLGQ  59

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             LSLS  A+A SF  V+GFSL+FGMA ALETL GQAYGA QY +LG     AI SL +V +
Sbjct  60    LSLSSTAIAISFCAVSGFSLLFGMACALETLSGQAYGAQQYKQLGLQINTAIFSLLLVCL  119

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S++W++M + LIF+GQDPLIS EAGK++  L+ A+F YA LQ L +YLQ QSLI+P+L
Sbjct  120   PVSLVWIYMGEILIFMGQDPLISLEAGKFARMLLPALFAYATLQPLCKYLQTQSLIIPLL  179

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +    SLCFHIP CWA+ F+SGLG  G ALAIG+SYW NVILL++YV YS++C ++RV +
Sbjct  180   VCGCASLCFHIPFCWAMVFKSGLGHLGAALAIGMSYWLNVILLILYVTYSTACARTRVPI  239

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
               + F  + EF R AIPSA M CLEWW+FE++ILL G LPNP++ETSVLSICL   S  +
Sbjct  240   SLELFQGIREFLRFAIPSAVMICLEWWSFELLILLAGFLPNPELETSVLSICLSTISSLY  299

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
              IP  +GA  STR+SNELGAGN   AR+AV  V  + +  +V+ + ++ + RSV GY FS
Sbjct  300   TIPEGLGAAGSTRVSNELGAGNPQAARLAVGAVMFLTVSGVVIISSIVFASRSVFGYIFS  359

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
              + EVVDY+  M PL+ L ++SD + G+LSG+ARG GWQ LG YVNLGAYYLVG P A  
Sbjct  360   KDKEVVDYVTSMAPLICLSVISDNLHGVLSGIARGCGWQDLGVYVNLGAYYLVGIPVAAT  419

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             L F   LRG GLW+G+ + S +Q  + ++IT  T+W+ +  K +ER+  + 
Sbjct  420   LCFWLDLRGRGLWIGIQVGSFLQAFLYSVITTCTNWEDKARKTRERIFVEK  470



>ref|XP_010415819.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Camelina 
sativa]
Length=481

 Score =   491 bits (1263),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 242/469 (52%), Positives = 332/469 (71%), Gaps = 2/469 (0%)
 Frame = -2

Query  1600  MDA--EVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHIS  1427
             MD+  E  L+   R      KDVFL E+K+LA IA PM+ +     +++ +S MM+GH+ 
Sbjct  1     MDSSEEGLLVVSHREEEVNKKDVFLKEMKRLAYIAAPMIAINSSMYVLLVISIMMVGHLG  60

Query  1426  ELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVA  1247
             EL LS  A+A SF NVTGFS+IFG+ASALETLCGQA GA Q+ KLG +TY  I SL +V 
Sbjct  61    ELYLSSTAIAISFCNVTGFSVIFGLASALETLCGQANGARQFEKLGVHTYTGIFSLYIVC  120

Query  1246  IPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPM  1067
             +P+S+LW +M   L   GQDPL++ EAGK++ WLI A+F YA LQ LVR+ Q QSLI+P+
Sbjct  121   VPLSVLWSYMGDILSLTGQDPLVAKEAGKFATWLIPALFAYATLQPLVRFFQAQSLILPL  180

Query  1066  LLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVC  887
             ++SS  ++C H+ +CW+L+F+ GLG+ G A+AIG++YW NV +L +Y+ +SSSC +SR  
Sbjct  181   VMSSISAVCVHVVLCWSLAFKFGLGNLGAAIAIGVAYWLNVTVLGLYMTFSSSCSESRAP  240

Query  886   LWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLH  707
             +    F  +GEFFR  IPSASM CLEWW+FE ++LL G+LPNP++E SVLS+CL    + 
Sbjct  241   ISMSVFKGMGEFFRFGIPSASMICLEWWSFEFLVLLSGILPNPKLEASVLSVCLSTTVIV  300

Query  706   FYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAF  527
             + I  S+GA ASTR++NELGAGN   AR+AV  V +I  +E ++ +  +   R V GY F
Sbjct  301   YQIAESLGAAASTRVANELGAGNPKQARIAVNTVMVITCVESMMVSATVFGTRDVFGYLF  360

Query  526   SNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAG  347
             S+ETEVV Y++ M PLV+L ++ D + G+LSGVARGSG Q +GA  NL AYYL G P A 
Sbjct  361   SSETEVVAYVRSMAPLVALSVIFDALHGVLSGVARGSGRQDIGACANLAAYYLCGIPTAI  420

Query  346   MLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
             +L F   LRG GLW+G+ + S VQ  +L+LI I T+WK++  KA++RL+
Sbjct  421   ILAFGFKLRGRGLWIGITVGSFVQAFLLSLIVILTNWKQESKKARKRLM  469



>ref|XP_010471124.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=500

 Score =   491 bits (1264),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 242/473 (51%), Positives = 335/473 (71%), Gaps = 6/473 (1%)
 Frame = -2

Query  1606  PEMDAEVP----LLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
              EMD++      ++S++       KDVFL E+ ++  IA PM+ +     +++ +S MM+
Sbjct  14    KEMDSDEEGRFLVVSDREEVN--KKDVFLKEMTRIGYIAGPMIAINSSMYVLLAISMMMV  71

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+SEL LS  A+A SF NVTGFS+IFGMASALETL GQA+GA Q+ KLG +TY  I SL
Sbjct  72    GHLSELFLSSTAIAISFCNVTGFSVIFGMASALETLSGQAHGAKQFEKLGVHTYTGIFSL  131

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              ++ IP+S+LW +M   L   GQDPL+S EAGK++ WLI A+F YA LQ L+R+ Q QSL
Sbjct  132   YLMCIPLSVLWSYMGDILFLTGQDPLVSQEAGKFATWLIPALFAYATLQPLIRFFQAQSL  191

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
             I+PM++SS  SLC H+ +CW+L F+ GLGS G A+A+G+SYW NV +L +Y+ +SSSC K
Sbjct  192   ILPMIMSSISSLCVHVVLCWSLVFKFGLGSLGAAIAVGVSYWLNVTVLGLYMTFSSSCSK  251

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             SR  +    F  +GEFFR  IPSASM CLE W+FE ++LL G+LPNP++E SVLS+CL  
Sbjct  252   SRAHISMSMFKGMGEFFRFGIPSASMICLELWSFEFLLLLSGILPNPKLEASVLSVCLST  311

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
               + + I  SIGA ASTR++NELGAGN+  A++AV+ V +I ++E ++ + ++   R+V 
Sbjct  312   TVILYQIAESIGAAASTRVANELGAGNSKQAQIAVYTVMVITIVESLMVSAMVFGARNVF  371

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY FS E EVVDY++ M  LV+  ++ D +  +L+GVARGSG Q +GAYVNL AYYL G 
Sbjct  372   GYLFSAEAEVVDYVRSMALLVAFTVIFDALHAVLAGVARGSGRQDIGAYVNLAAYYLCGI  431

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
             P A +L F   + G GLW+G+ + S VQ V+L L+ IFT+WK+Q  KA+ERL+
Sbjct  432   PTAVLLAFRFKMGGRGLWIGITVGSFVQAVLLGLVVIFTNWKQQTRKARERLM  484



>ref|XP_010427932.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Camelina 
sativa]
 ref|XP_010427933.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Camelina 
sativa]
Length=510

 Score =   491 bits (1265),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 243/491 (49%), Positives = 340/491 (69%), Gaps = 8/491 (2%)
 Frame = -2

Query  1648  KGAGGGDQRVNFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQ  1469
             K    G ++   +  + +    ++S  R      KDVFL E+ ++  IA PM+ +     
Sbjct  4     KEIDSGSKKQKEMDSDEEGRFLVVSHSREEEVNKKDVFLKEMTRIGYIAGPMIAINSSMY  63

Query  1468  MVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLG  1289
             +++ +S MM+GH+ E+ LS  A+A SF NVTGFS+IFG+ASALETL GQA+GA Q+ KLG
Sbjct  64    VLLAISMMMVGHLGEVFLSSTAIAISFCNVTGFSVIFGVASALETLSGQAHGAKQFEKLG  123

Query  1288  TYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQC  1109
              +TY  I SL ++ IP+S+LW +M   L+F GQDPL+S EAGK++ WLI A+F YA LQ 
Sbjct  124   VHTYTGIFSLYLMCIPLSVLWSYMGDILVFTGQDPLVSQEAGKFATWLIPALFAYATLQP  183

Query  1108  LVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVV  929
             L+R+ Q QSLI+PM++SS  SLC H+ +CW+L F+ GLGS G A+A+G+SYW NV +L +
Sbjct  184   LIRFFQAQSLILPMIMSSISSLCVHVVLCWSLVFKFGLGSLGAAIAVGISYWLNVTVLGL  243

Query  928   YVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVE  749
             Y+ +SSSC KSR  +    F  +GEFFR  IPSASM CLE W+FEI++LL G+LPNP++E
Sbjct  244   YMTFSSSCSKSRAHISMSMFKGMGEFFRFGIPSASMICLELWSFEILVLLSGILPNPKLE  303

Query  748   TSVLSI-CLMICS-------LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIG  593
              SVLS+ C ++C        + + I  SIGA ASTR++NELGAGN   AR+AV+ V +I 
Sbjct  304   ASVLSVCCFLLCYNSLSTTIILYQIAESIGAAASTRVANELGAGNPKQARIAVYTVMVIT  363

Query  592   MIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSG  413
              +E ++ + ++   R+V GY FS+ETEVVDY++ M  LV+  ++ D +  +L+GVARGSG
Sbjct  364   CVESLMVSAMVFGARNVFGYLFSSETEVVDYVRSMALLVAFTVIFDALHAVLAGVARGSG  423

Query  412   WQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWK  233
              Q +GAYVNL AYYL G P A +L F   + G GLW+G+ + S VQ V+L L+ IFT+WK
Sbjct  424   RQDIGAYVNLAAYYLCGIPTAVLLAFRFKMGGRGLWIGITVGSFVQAVLLGLVVIFTNWK  483

Query  232   KQESKAQERLL  200
             +Q  KA+ERL+
Sbjct  484   QQTRKARERLM  494



>gb|KEH24739.1| MATE efflux family protein [Medicago truncatula]
Length=480

 Score =   490 bits (1261),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 244/473 (52%), Positives = 333/473 (70%), Gaps = 6/473 (1%)
 Frame = -2

Query  1600  MDAEV--PLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHIS  1427
             M  EV  PL+   R +    +  F+ ELKK++ +A PM+ VTV Q ++  VS MM+GH+ 
Sbjct  1     MSKEVTTPLI---RKSDHEIESTFVQELKKVSFVAAPMVAVTVSQYLLQVVSLMMVGHLG  57

Query  1426  EL-SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVV  1250
              L S SG ++A SF  VTGFS++ GMA ALETLCGQ +GA +Y KLG YT  AI++LTVV
Sbjct  58    ILVSFSGVSIAMSFAEVTGFSVLLGMAGALETLCGQTFGAEEYGKLGNYTCCAILTLTVV  117

Query  1249  AIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVP  1070
               PIS++W+F DK L+F  QDP +S  A +Y ++LI A+F YA+LQ L+RY Q Q +I P
Sbjct  118   CFPISLVWIFTDKILMFFSQDPGMSHVAREYCIYLIPALFGYALLQALIRYFQTQGMIFP  177

Query  1069  MLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRV  890
             M+ SS  +L  HIP+CW L F+ GLG  G ALAIG+SYW NVI L VY+KYS SCEK+++
Sbjct  178   MVFSSVSALFLHIPICWILVFKLGLGHIGAALAIGISYWLNVIWLWVYIKYSPSCEKTKI  237

Query  889   CLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSL  710
                  +   + EF + AIPS  M C EWW+FEI+IL+ GLLPNPQ+ETSVLS+CL   SL
Sbjct  238   VFSTHALHNLPEFCKYAIPSGLMFCFEWWSFEILILIAGLLPNPQLETSVLSVCLNTTSL  297

Query  709   HFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYA  530
             HF+IP++IGA ASTR+SNELGAGN   A+ AV  V IIG+ E ++ +   +  R+++GYA
Sbjct  298   HFFIPYAIGASASTRVSNELGAGNPKTAKGAVRVVVIIGIAEAIIVSTFFLCFRNILGYA  357

Query  529   FSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAA  350
             +SN+ +VV+YI  M+PL+ + + +D + G LSGVARG G+Q +GAYVNLGAYY+VG P  
Sbjct  358   YSNDEQVVNYIADMVPLLCVSVSADSLIGALSGVARGGGFQEMGAYVNLGAYYIVGIPVG  417

Query  349   GMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              + GF   L   GLWMG    S++  ++L+++T  TDW+K+ +KA+ER++  S
Sbjct  418   LLFGFHLKLNAKGLWMGTLSGSVLNVIILSIVTALTDWQKEATKARERIIEQS  470



>ref|XP_006390799.1| hypothetical protein EUTSA_v10018467mg [Eutrema salsugineum]
 gb|ESQ28085.1| hypothetical protein EUTSA_v10018467mg [Eutrema salsugineum]
Length=483

 Score =   490 bits (1261),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 247/469 (53%), Positives = 332/469 (71%), Gaps = 4/469 (1%)
 Frame = -2

Query  1600  MD-AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             MD AE  LL E+       KD F  E+++L  IA PM+ V      +  +S MM+GH+ E
Sbjct  1     MDSAEKGLLGEEEVN---RKDDFFREMRRLGYIAGPMVAVNSSMYFLQVISIMMVGHLGE  57

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+A SF +VTGFSL+FG+ASALETLCGQA GA Q+ KLG +TY  I SL +V I
Sbjct  58    LFLSSTAIAVSFCSVTGFSLVFGLASALETLCGQANGAKQFEKLGEHTYTGIFSLFIVCI  117

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW +M + L  +GQDPL+S EAGK++ WLI A+F YA LQ LVR+ Q QSLI+P++
Sbjct  118   PLSVLWSYMGEILSLIGQDPLVSQEAGKFATWLIPALFAYATLQPLVRFFQAQSLILPLI  177

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  +LC H+ +CW+L F+ GLGS G A+AI +SYW NV +L +Y+ +SSSC KSR  +
Sbjct  178   MSSISALCCHVVLCWSLVFKFGLGSLGAAIAISVSYWLNVTVLGLYMTFSSSCSKSRAPI  237

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                 F+ + EFFR  IPSASM CLEWW+FE +++L G+LPNP++ETSVLS+CL   S  +
Sbjct  238   SMSVFSGMREFFRFGIPSASMICLEWWSFEFLVMLSGILPNPKLETSVLSVCLSTISSLY  297

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
              IP S+GA ASTR++NELGAG    ARMAV+ V I+  +E +V + ++ + R+V GY FS
Sbjct  298   QIPESLGAAASTRVANELGAGKPKKARMAVYTVMIMTGVESIVVSAIVFAARNVFGYLFS  357

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +E EVVDY++ M PLV+L ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +
Sbjct  358   SEIEVVDYVRSMAPLVALSVIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLFGIPTAVI  417

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLN  197
             LGF   + G GLW+G+ + S VQ  +L LI   T+WK+Q  KA+ER++ 
Sbjct  418   LGFRFKMGGRGLWIGITVGSFVQAGLLGLIVGLTNWKQQARKARERVMG  466



>ref|XP_002887348.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63607.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   490 bits (1261),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 240/470 (51%), Positives = 333/470 (71%), Gaps = 0/470 (0%)
 Frame = -2

Query  1603  EMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             E +AE    +E       +KD FL E KKL+ IA PM+ V+    ++  +S MM+GH+ E
Sbjct  17    EEEAERMDSAENDGEQVNTKDGFLRETKKLSYIAGPMIAVSSSMYVLQVISIMMVGHLGE  76

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+A SF  VTG S++FG+ASALETLCGQA+GA Q+ KLG +TY  I+SL +V I
Sbjct  77    LFLSSTAIAVSFCGVTGLSVVFGLASALETLCGQAHGAKQFEKLGYHTYTGIVSLFLVCI  136

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW +M   L  +GQDP+++ +AGK++ WLI A+F YA LQ LVR+ Q QSLI+P++
Sbjct  137   PLSVLWSYMGDILSLIGQDPMVAQQAGKFATWLIPALFGYATLQPLVRFFQAQSLILPLI  196

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  SLC H+ +CW+L F+ GLGS G A+A+ +SYW NVI+L +Y+ +SSSC KSR  +
Sbjct  197   MSSVSSLCVHVVLCWSLVFKFGLGSLGAAIALDVSYWLNVIVLGLYMTFSSSCSKSRATI  256

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                 F  +GEFFR  +PSA M CLEWW+FEI++LL G+LPNP++E SVLSICL   ++ +
Sbjct  257   SMSVFKGMGEFFRFGVPSALMICLEWWSFEILLLLSGILPNPKLEASVLSICLSTINIVY  316

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
              I  S+GA ASTR++NELGAG    ARMAV+ V +I  +E ++ + ++ S R+V GY FS
Sbjct  317   QIAASLGAAASTRVANELGAGKPKQARMAVYTVMVITGVESIMVSAIVFSARNVYGYLFS  376

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +ETEVVDY + M+PLV+L ++ D    +L+GV RGSG Q +GAYVNL AYYL G P A +
Sbjct  377   SETEVVDYERSMVPLVALSVIFDAFHAVLAGVTRGSGRQDIGAYVNLAAYYLFGIPTAII  436

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             L F   +RG G+W+G+ + S VQ V+L  + I T+WK+Q   A+ERL+ +
Sbjct  437   LAFRFKMRGRGIWIGITVGSFVQAVLLGFLVILTNWKQQARDARERLMGE  486



>ref|XP_009776773.1| PREDICTED: MATE efflux family protein 7-like [Nicotiana sylvestris]
Length=478

 Score =   489 bits (1259),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 245/448 (55%), Positives = 326/448 (73%), Gaps = 1/448 (0%)
 Frame = -2

Query  1543  DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL-SLSGGAVATSFTNVTGFS  1367
             D +  ELKKL RIA PM+ V+V Q ++  VS MM+GH+ ++ SLS  A+ATS TNVTGFS
Sbjct  21    DTYYEELKKLTRIAAPMVAVSVLQYLLQVVSVMMVGHLDQIISLSTVAIATSITNVTGFS  80

Query  1366  LIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQD  1187
             L+ G+   LETLCGQAYGA ++ K+GTYTY A++SL +V +PISI+W+FMDK LI +GQD
Sbjct  81    LLSGLVGGLETLCGQAYGAQEWQKVGTYTYSAVISLLLVCLPISIMWLFMDKLLILMGQD  140

Query  1186  PLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSF  1007
             P+IS EA K S+WLI A+F  AIL+ + RYLQ+QSLI+PMLLS+ + LC HI +C+   F
Sbjct  141   PVISVEASKCSMWLIPALFGGAILRPIFRYLQIQSLILPMLLSAFVVLCLHISLCYLFIF  200

Query  1006  RSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSA  827
             + G+G +G A+A   S W  V LLV Y+K SSSCE++R  L  D+F  + +FFR A PSA
Sbjct  201   KLGVGKSGAAIAFSFSIWTFVALLVSYIKRSSSCERTRTPLNKDAFLAIRKFFRYATPSA  260

Query  826   SMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELG  647
              M CL+WW+ E++ILL GLLPNP++ETSVLSICL I +LHF IPF +GAGASTR+SNELG
Sbjct  261   LMVCLKWWSLEVLILLSGLLPNPKLETSVLSICLTISALHFSIPFGLGAGASTRVSNELG  320

Query  646   AGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLM  467
             +GN   A +AV     + + E VV + V    R V+G A+SN+ +VVDY+  + P + L 
Sbjct  321   SGNPQKALVAVRVAMSLAVAETVVVSTVTFLCRGVLGKAYSNDQQVVDYVAAITPFLCLS  380

Query  466   LVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLA  287
             +V+D +  ++SG+ARGSGWQ +GAYVNLGA+YLVG P A +L FL  LR  GLW+GL + 
Sbjct  381   IVTDSLQAVISGIARGSGWQIIGAYVNLGAFYLVGIPVAVILCFLIHLRAKGLWIGLLVG  440

Query  286   SLVQNVVLALITIFTDWKKQESKAQERL  203
             S +Q   L+ I  F DW+KQ  KA++R+
Sbjct  441   SAIQAATLSFILGFIDWQKQAIKAKKRI  468



>gb|AFK37009.1| unknown [Medicago truncatula]
Length=485

 Score =   489 bits (1260),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 232/453 (51%), Positives = 325/453 (72%), Gaps = 0/453 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
             ++   + ELKK+  IA+PM+  +V Q ++  VS MM+GH+++LSLS  A+ATS TNV+GF
Sbjct  20    TRTTLMEELKKMGTIAVPMVATSVLQYLLQVVSVMMVGHLNQLSLSSVAIATSLTNVSGF  79

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             S++ GMA  LETLCGQAYGAG Y K G YTY A++SLT+V  PI+I+W FMDK LI +GQ
Sbjct  80    SILSGMAGGLETLCGQAYGAGHYEKHGIYTYTAVISLTMVCAPITIIWTFMDKILILIGQ  139

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DP IS +A  +++WLI A+F  AIL+ L R+ Q QSLI PM++SS + LCFH  +CW L 
Sbjct  140   DPTISLQARTFALWLIPALFASAILKPLTRFFQTQSLIFPMIISSFIVLCFHGVMCWTLV  199

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+ GLG  G A++  L  W NV++L+ +VKYSSSCEK+RV     +F  + EFF LA+PS
Sbjct  200   FKLGLGHVGAAISFSLGTWLNVLILLSFVKYSSSCEKTRVPFSMKAFLGIREFFGLAVPS  259

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             A+M CL+WW  E+++LL GL P+P++ETSVLSICL+I +LHF I + +GA ASTRISNEL
Sbjct  260   AAMVCLKWWACELLVLLAGLFPDPKLETSVLSICLIISTLHFTISYGLGAAASTRISNEL  319

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN    R ++     +   E ++   +L+  R V+GYA++N++ VV Y+  M PL+ +
Sbjct  320   GAGNPKAVRFSICTAMFLATTEALIITAILLGCRCVLGYAYTNDSMVVHYVAVMTPLLCV  379

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              + +D +  +LSGVARGSGWQ++GAYVNLGA+YLVG P   +LGF+   +  GLW+G+  
Sbjct  380   SIFTDSLQAVLSGVARGSGWQYVGAYVNLGAFYLVGIPIGVVLGFIAHFKAKGLWIGIVA  439

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              S+VQ + L++IT  T+WKKQ   A+ER+ + +
Sbjct  440   GSIVQTIFLSIITSLTNWKKQAIMARERIFDAT  472



>ref|XP_003624403.1| Protein TRANSPARENT TESTA [Medicago truncatula]
 gb|AES80621.1| MATE efflux family protein [Medicago truncatula]
Length=479

 Score =   489 bits (1258),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 232/453 (51%), Positives = 324/453 (72%), Gaps = 0/453 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
             ++   + ELKK+  IA+PM+  +V Q ++  VS MM+GH+++LSLS  A+ATS TNV+GF
Sbjct  14    TRTTLMEELKKMGTIAVPMVATSVLQYLLQVVSVMMVGHLNQLSLSSVAIATSLTNVSGF  73

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             S++ GMA  LETLCGQAYGAG Y K G YTY A++SLT+V  PI+I+W FMDK LI +GQ
Sbjct  74    SILSGMAGGLETLCGQAYGAGHYEKHGIYTYTAVISLTMVCAPITIIWTFMDKILILIGQ  133

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DP IS +A  +++WLI A+F  AIL+ L R+ Q QSLI PM++SS + LCFH  +CW L 
Sbjct  134   DPTISLQARTFALWLIPALFASAILKPLTRFFQTQSLIFPMIISSFIVLCFHGVMCWTLV  193

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+ GLG  G A++  L  W NV++L+ +VKYSSSCEK+RV     +F  + EFF LA+PS
Sbjct  194   FKLGLGHVGAAISFSLGTWLNVLILLSFVKYSSSCEKTRVPFSMKAFLGIREFFGLAVPS  253

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             A+M CL+WW  E+++LL GL P+P++ETSVLSICL I +LHF I + +GA ASTRISNEL
Sbjct  254   AAMVCLKWWACELLVLLAGLFPDPKLETSVLSICLTISTLHFTISYGLGAAASTRISNEL  313

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN    R ++     +   E ++   +L+  R V+GYA++N++ VV Y+  M PL+ +
Sbjct  314   GAGNPKAVRFSICTAMFLATTEALIITAILLGCRCVLGYAYTNDSMVVHYVAVMTPLLCV  373

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              + +D +  +LSGVARGSGWQ++GAYVNLGA+YLVG P   +LGF+   +  GLW+G+  
Sbjct  374   SIFTDSLQAVLSGVARGSGWQYVGAYVNLGAFYLVGIPIGVVLGFIAHFKAKGLWIGIVA  433

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              S+VQ + L++IT  T+WKKQ   A+ER+ + +
Sbjct  434   GSIVQTIFLSIITSLTNWKKQAIMARERIFDAT  466



>ref|XP_011021314.1| PREDICTED: MATE efflux family protein 7-like [Populus euphratica]
Length=475

 Score =   489 bits (1258),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 255/470 (54%), Positives = 339/470 (72%), Gaps = 5/470 (1%)
 Frame = -2

Query  1576  SEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVA  1397
             +E+R  A+ +    + ELKK++ +A P++VV V   ++  VS MM GH+ ELSLS  +V 
Sbjct  9     TEERTWASTT---LVEELKKVSCMAAPVVVVMVSLYLLQVVSLMMAGHLGELSLSAVSVG  65

Query  1396  TSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFM  1217
              SF  VTGFSL+FG+   LETLCGQAYGA QY KLGTYTY AI+SL  + IPIS+LW+FM
Sbjct  66    GSFATVTGFSLLFGLTGGLETLCGQAYGAEQYQKLGTYTYCAIISLIPICIPISVLWIFM  125

Query  1216  DKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCF  1037
             D+ LI +GQDP IS  A +Y++ LI A+F YAILQ L+RY Q  +LI+PMLLS++++L F
Sbjct  126   DRVLIEIGQDPEISTAACQYAICLIPALFAYAILQSLLRYFQSMNLILPMLLSTSVTLFF  185

Query  1036  HIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVG  857
             HIP+CWAL F+  LG  G ALAI +SYW NVI L +Y+ +SSSC+K+RV  WND F+ + 
Sbjct  186   HIPLCWALIFKWKLGIKGAALAIDVSYWLNVIFLGLYMGFSSSCQKTRVINWNDIFSSIK  245

Query  856   EFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAG  677
             EFF  A+PSA M CLEWWTFE++ILL GLLPN ++ETSVLSICL   SLHFY+   I A 
Sbjct  246   EFFCFALPSAVMVCLEWWTFELLILLAGLLPNSELETSVLSICLTTISLHFYLQSGIAAA  305

Query  676   ASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYI  497
              S ++SN+LGAGN +  ++ +  V  I +IE V+ + +L   R+V GYAFSNE  VVDY+
Sbjct  306   GSAQVSNKLGAGNHEAVQVVIRAVLKISLIEAVIVSTILFFCRNVFGYAFSNERVVVDYV  365

Query  496   KKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRG  317
              ++ PL+ L +V+D +  +LSG+ARG GWQH+GAY+NLGAYY VG P A +L F+  L G
Sbjct  366   TELAPLLCLSIVADSLQTVLSGIARGCGWQHIGAYINLGAYYFVGIPVAVLLCFILHLEG  425

Query  316   MGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
              GLW+G    ++VQ  +LALIT  TDW+KQ +KA+ER+   +   + DNG
Sbjct  426   KGLWIGTLTGNIVQATLLALITGLTDWEKQATKARERIFERTF--SADNG  473



>ref|XP_003555931.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
 gb|KHN42405.1| MATE efflux family protein 7 [Glycine soja]
Length=476

 Score =   489 bits (1258),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 244/474 (51%), Positives = 336/474 (71%), Gaps = 2/474 (0%)
 Frame = -2

Query  1591  EVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLS  1412
             E  L+ +      +   V+  E++++  IA PM+ V   Q ++  VSTM++GH+ EL LS
Sbjct  2     EESLVKKHEEDRVVRWGVYSEEMRRICEIAGPMVAVVSSQYLLQVVSTMIVGHLGELYLS  61

Query  1411  GGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISI  1232
               A+A S + VTGFSL  GMAS LET+CGQAYGA QY ++G  TY AI SL +V+IP+SI
Sbjct  62    SAALAISLSGVTGFSLHMGMASGLETICGQAYGAQQYQRIGMQTYTAIFSLILVSIPVSI  121

Query  1231  LWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSA  1052
             LW+ M+  L+F+GQDPLIS EAGK+++WL+ A+F YAILQ LVRY Q+QSL++PM  SS 
Sbjct  122   LWINMESILVFIGQDPLISHEAGKFTIWLVPALFAYAILQPLVRYFQVQSLLLPMFASSC  181

Query  1051  LSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDS  872
             ++L  H+P+CWAL F++ L + G ALA+ +S W NVI L +Y++YSS+C K+R  +  + 
Sbjct  182   VTLIIHVPLCWALVFKTRLSNVGGALAVSISIWSNVIFLGLYMRYSSACAKTRAPISMEL  241

Query  871   FARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPF  692
             F  + EFFR AIPSA M CLEWW++E+++LL GLLPNPQ+ETSVLS+CL   S  + IPF
Sbjct  242   FKGMWEFFRFAIPSAVMVCLEWWSYELLVLLSGLLPNPQLETSVLSVCLNTISTLYMIPF  301

Query  691   SIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETE  512
              IGA ASTR+SNELGAGN+  AR+AV     + +IE  + +  L + R+V GY FSNE E
Sbjct  302   GIGAAASTRVSNELGAGNSHAARVAVLAAMSLAVIETSIVSATLFACRNVYGYIFSNEKE  361

Query  511   VVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFL  332
             V+DY+  M PLV + ++ D I G+L+G+ARG GWQHLG +VNLGA+YL G P A +L FL
Sbjct  362   VIDYVTVMAPLVCISIILDSIQGVLTGIARGCGWQHLGVFVNLGAFYLCGIPMAALLAFL  421

Query  331   TSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
               L G GLW+G+   + VQ ++L++IT   +W+KQ  KA++RL +D    + DN
Sbjct  422   VRLGGQGLWIGIQSGAFVQTLLLSIITGCINWEKQAIKARKRLFDDQF--SADN  473



>ref|XP_002532231.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
 gb|EEF30162.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
Length=508

 Score =   489 bits (1260),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 241/466 (52%), Positives = 332/466 (71%), Gaps = 6/466 (1%)
 Frame = -2

Query  1573  EKRPAA------AISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLS  1412
             EKR  A      A++  +F  E+KK   +A PM+ V + Q ++  +S M+ GH+ +L+LS
Sbjct  13    EKREDAGGSSGTALTWPIFTQEMKKQGYLAGPMVAVILSQYLLQVISLMIAGHLGQLALS  72

Query  1411  GGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISI  1232
               A+A S   VTGFS++ G+ASALETL GQAYGA QY K+G  T  AI  L + +IP+SI
Sbjct  73    STAIAISLAGVTGFSVLMGLASALETLSGQAYGAKQYQKVGIQTQTAIFCLILASIPLSI  132

Query  1231  LWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSA  1052
             LW+FM K L+ +GQDP IS EAGK+  WL+ ++F Y  +Q LVRY QMQSLI PML+SS 
Sbjct  133   LWIFMGKILVLIGQDPAISHEAGKFLTWLVPSLFAYTAIQGLVRYFQMQSLITPMLISSC  192

Query  1051  LSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDS  872
              +LCFHIPVCW L+  SGL + G ALA+ +S W  VI+L +Y+KYSS+C+++R  +  + 
Sbjct  193   ATLCFHIPVCWVLTLHSGLENLGAALAMDISNWLFVIILGLYMKYSSACDQTRAPISMEL  252

Query  871   FARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPF  692
             F  +GEFFRLAIPSA M+CLEWW+FE+V+LL GLLPNP++ETSVLSIC+   S  + I +
Sbjct  253   FHGIGEFFRLAIPSAVMSCLEWWSFELVVLLSGLLPNPRLETSVLSICITTISTIYCIAY  312

Query  691   SIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETE  512
              +GA ASTR+SNELGAGN   AR+AV+ V  +G++E  + +  L + R V GYAFSN  E
Sbjct  313   GLGAAASTRVSNELGAGNPQAARIAVYAVLFLGIVESTLVSGTLFASRHVFGYAFSNSKE  372

Query  511   VVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFL  332
             VVDY+  + PL+SL ++ D + G+LSGVARG GWQH+GAYVNL A+Y+ G P A +LGF 
Sbjct  373   VVDYVTTISPLISLSVIMDCLQGVLSGVARGCGWQHVGAYVNLVAFYICGIPVAVLLGFW  432

Query  331   TSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
                RG+GLW+G+ +  ++Q V+LA++T   +W+KQ+ K +E   ++
Sbjct  433   LKFRGIGLWIGIQVGEVIQVVLLAIVTGCINWEKQQEKQKESRRDE  478



>ref|XP_010415815.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=482

 Score =   489 bits (1258),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 239/471 (51%), Positives = 335/471 (71%), Gaps = 2/471 (0%)
 Frame = -2

Query  1600  MDA--EVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHIS  1427
             MD+  E  L++  R      KDVFL E+K++  IA PM+ +     +++ +S MM+GH+ 
Sbjct  1     MDSAEEGLLVASHRDEEVHKKDVFLLEMKRIGYIAGPMIAINSSMYVLLAISMMMVGHLG  60

Query  1426  ELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVA  1247
             EL LS  A+A SF NVTGFS+IFGMASALETL GQA+GA Q+ KLG +TY  + SL +V 
Sbjct  61    ELYLSSTAIAISFCNVTGFSVIFGMASALETLSGQAHGAKQFEKLGVHTYTGVFSLYLVC  120

Query  1246  IPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPM  1067
             IP+S+LW +MD  L   GQDPL++ EAGK+++WLI A+F YA LQ L+R+ Q QSLI+PM
Sbjct  121   IPLSVLWSYMDDILSLTGQDPLVAQEAGKFAIWLIPALFGYATLQPLIRFFQAQSLILPM  180

Query  1066  LLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVC  887
             ++SS  ++C H+ +CW+L F+ GLG+ G A+A+G++YW NV +L +Y+ +SSSC KSR  
Sbjct  181   IISSISAVCVHVSLCWSLVFKFGLGNLGAAIAVGVAYWLNVTVLGLYMTFSSSCSKSRAP  240

Query  886   LWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLH  707
             +    F  +GEFFR  IPSASM CLE W+FE+++LL G+LPNP++E SVLS+CL    + 
Sbjct  241   ISMSLFKGMGEFFRFGIPSASMTCLELWSFEVLVLLSGILPNPKLEASVLSVCLSTTIIL  300

Query  706   FYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAF  527
             + I  S+GA ASTR++NELGAGN   AR+AV+ V +I  +E ++ + ++   R+V GY F
Sbjct  301   YQIAESLGAAASTRVANELGAGNPKQARIAVYTVMVITCVESLMVSAMVFGTRNVFGYLF  360

Query  526   SNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAG  347
             S E EVVDY++ M  LV+  ++ D +  +L+GVARGSG Q +GAYVNL AYYL G P A 
Sbjct  361   SAEAEVVDYVRSMALLVAFTVIFDALHAVLAGVARGSGRQDIGAYVNLAAYYLCGIPTAV  420

Query  346   MLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             +L F   + G GLW+G+ + S VQ V+L L+ IFT+WK+Q  KA+ERL+ +
Sbjct  421   LLAFWFKMGGKGLWIGITVGSFVQAVLLGLVVIFTNWKQQTIKARERLMVE  471



>ref|XP_010415810.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Camelina 
sativa]
Length=484

 Score =   489 bits (1258),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 239/450 (53%), Positives = 325/450 (72%), Gaps = 0/450 (0%)
 Frame = -2

Query  1546  KDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFS  1367
             KD FL E+K+L  IA PM+ V     ++  +S MM+GH+ EL LS  A+A SF +VTGFS
Sbjct  20    KDGFLKEMKRLGYIAGPMVAVNSSTYVLQVISIMMVGHLGELYLSSTAIAVSFCSVTGFS  79

Query  1366  LIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQD  1187
             L+FG+ASALETLCGQAYGA Q+ KLG +TY  I+SL +V IP+S+LW +M   L  +GQD
Sbjct  80    LVFGLASALETLCGQAYGAKQFEKLGVHTYTGILSLYIVCIPLSVLWSYMGDILSLIGQD  139

Query  1186  PLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSF  1007
             PL++ +AGK++ WLI A+F YA LQ LVR+ Q QSLI+P+++SS  +LC H+ +CW+L F
Sbjct  140   PLVAQQAGKFATWLIPALFGYATLQSLVRFYQAQSLILPLIMSSISALCVHVVLCWSLVF  199

Query  1006  RSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSA  827
             + GLGS G A+AIG+SYWFNV +L +Y+ +SSS  K+R  +    F  +GEFFR  IPSA
Sbjct  200   KFGLGSLGAAIAIGVSYWFNVTVLGLYMTFSSSGSKTRAPISMSVFKGMGEFFRFGIPSA  259

Query  826   SMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELG  647
             SM CLEWW+FE +++L G+LPNP++E SVLS+CL   S  + IP S+ A ASTR++NELG
Sbjct  260   SMICLEWWSFEFLLILSGILPNPKLEASVLSVCLSTQSSLYQIPESLSAAASTRVANELG  319

Query  646   AGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLM  467
             AG    ARMAV+ V +I  +E ++  V++   R+V GY FS+E EVVDY++ M PL++L 
Sbjct  320   AGKPKQARMAVYTVMVITGVESIMVGVIVFGARNVFGYLFSSENEVVDYVRSMAPLLALS  379

Query  466   LVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLA  287
             ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +L F   + G GLW+G+ + 
Sbjct  380   VIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLCGIPTAILLAFRFKMGGRGLWIGITVG  439

Query  286   SLVQNVVLALITIFTDWKKQESKAQERLLN  197
             S VQ V+L LI I T+WK+Q  KA+ R++ 
Sbjct  440   SFVQAVLLGLIVILTNWKEQAGKARLRVMG  469



>ref|XP_010427937.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=483

 Score =   488 bits (1257),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 242/472 (51%), Positives = 333/472 (71%), Gaps = 3/472 (1%)
 Frame = -2

Query  1600  MD-AEVPLL--SEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHI  1430
             MD AE  LL  S  R      KDVFL E+K++  IA PM+ +     +++ +S MM+GH+
Sbjct  1     MDSAEEGLLVASHSREEEGNKKDVFLMEMKRIGYIAGPMIAINSSMYVLLAISMMMVGHL  60

Query  1429  SELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVV  1250
              EL LS  A+A SF NVTGF +IFGMASALETL GQA+GA Q+ KLG +TY  + SL +V
Sbjct  61    GELYLSSTAIAISFCNVTGFCVIFGMASALETLSGQAHGAKQFEKLGVHTYTGVFSLYLV  120

Query  1249  AIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVP  1070
              IP+S+LW ++   L F GQDP++S EAGK+++WLI A+F YA LQ L+R+ Q QSLI+P
Sbjct  121   CIPLSVLWSYVGDILSFTGQDPMVSQEAGKFAIWLIPALFGYATLQPLIRFFQSQSLILP  180

Query  1069  MLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRV  890
             M++SS  ++C H+ +CW+L F+ GLGS G A+A+G++YW NV +L +Y+ +SSSC KSR 
Sbjct  181   MIISSISAVCVHVSLCWSLVFKFGLGSLGAAIAVGVAYWLNVTILGLYMTFSSSCSKSRA  240

Query  889   CLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSL  710
              +    F  +GEFFR  +PSASM CLE W+FEI++LL G+LPNP++E SVLS+CL    +
Sbjct  241   PISMSVFKGMGEFFRFGVPSASMTCLELWSFEILVLLSGILPNPKLEASVLSVCLSTTII  300

Query  709   HFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYA  530
              + I  S+GA ASTR++NELGAGN   AR+AV+ V +I  +E ++A+      R+V GY 
Sbjct  301   LYQIAESLGAAASTRVANELGAGNPKQARIAVYTVMVITCVESLMASATFFGARNVFGYL  360

Query  529   FSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAA  350
             FS E EVVDY++ M  LV+L ++ D +  +L+GVARGSG Q +GAYVNL AYYL G P A
Sbjct  361   FSAEAEVVDYVRSMALLVALTVIFDALHAVLAGVARGSGRQDIGAYVNLAAYYLCGIPTA  420

Query  349   GMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
              +L F   + G GLW+G+ + S VQ  +L L+ IFT+WK+Q  KA+ERL+ +
Sbjct  421   VLLAFRFKMGGRGLWIGITVGSFVQAFLLGLVVIFTNWKQQTRKARERLMVE  472



>ref|XP_004300943.1| PREDICTED: MATE efflux family protein 5-like [Fragaria vesca 
subsp. vesca]
Length=489

 Score =   488 bits (1257),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 242/447 (54%), Positives = 321/447 (72%), Gaps = 0/447 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F  E+K+   IA PM+ V + Q +   VS MM+GH+ EL+LS  ++A S + VTGFS+  
Sbjct  32    FFIEVKRQCYIAGPMVAVILSQNLFRVVSMMMVGHLGELALSSTSIAISLSGVTGFSVFI  91

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             GMAS LET+CGQAYGA QY KLG  TY AI+SL +V +P+S+LW++M+  LIF+GQDPLI
Sbjct  92    GMASGLETICGQAYGAKQYQKLGLQTYTAIISLNLVCLPLSLLWIYMEDLLIFMGQDPLI  151

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAGK+++WLI A+F YA LQ L+RY Q QSLI PMLLSS  +L FHIP+CW L F+SG
Sbjct  152   SREAGKFTIWLIPALFAYATLQPLIRYFQTQSLITPMLLSSCATLLFHIPLCWVLVFKSG  211

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             L + G ALAI +SYW NVILLV+Y+KYSS+C  +R  +  + F  + EFF  AIPS  M 
Sbjct  212   LDNLGGALAISISYWLNVILLVLYMKYSSACSLTRAPVTMEVFHGMREFFYFAIPSTVMI  271

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             C+EWW+FE++ILL GLLPNP +ETSVLS+CL   S  + IP+  GA ASTR++NE+GAGN
Sbjct  272   CVEWWSFELLILLSGLLPNPALETSVLSVCLQTISTLYAIPYGFGAAASTRVANEMGAGN  331

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
             ++ AR+A     ++ + E  +    L +LR   GY FSNE +V+DY+  M PLV L L  
Sbjct  332   SEGARIAAQVALLLAVTETSIETTTLFALRHSYGYTFSNEKQVIDYVISMAPLVCLSLSL  391

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D + G+L+G+ARG GWQH+GAY+NLG++YL G P A +L F   LRG GLW+G+ L SLV
Sbjct  392   DSLQGVLTGIARGCGWQHIGAYINLGSFYLCGIPVAAILAFWLELRGRGLWIGIQLGSLV  451

Query  277   QNVVLALITIFTDWKKQESKAQERLLN  197
             Q + L+ +T  T+W+ Q SKA+ER+  
Sbjct  452   QTIFLSFVTTCTNWEMQASKARERVFQ  478



>ref|XP_002528061.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
 gb|EEF34311.1| TRANSPARENT TESTA 12 protein, putative [Ricinus communis]
Length=470

 Score =   487 bits (1254),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 253/453 (56%), Positives = 327/453 (72%), Gaps = 2/453 (0%)
 Frame = -2

Query  1555  AISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVT  1376
             AI+   F+ ELKK + IA PM+VV+V Q ++  VS MM+GH+ EL+LS  A+ATS TN  
Sbjct  19    AITWGGFMEELKKESYIAAPMVVVSVLQYLLQVVSVMMVGHLGELALSSVAIATSLTNAV  78

Query  1375  GFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFV  1196
             GFSL+ GMA  +ETLCGQAYGA QYHKLGTYT+ AI+SL +V  PI +LW+FMD+ L  +
Sbjct  79    GFSLLSGMAGGVETLCGQAYGAQQYHKLGTYTFSAIISLVMVCPPICLLWIFMDRLLPLI  138

Query  1195  GQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWA  1016
             GQD  IS +A KYS+WLI A+F  AIL+ + R+LQ QS+I PMLLSS   L FH   CW 
Sbjct  139   GQDSEISNQACKYSIWLIPALFGSAILKPVTRFLQTQSVIFPMLLSSLFILFFHTLACWT  198

Query  1015  LSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAI  836
               ++  LG  GPALA  LS W NVILL  Y+KYSS+C K+R  L   +F  VGEFFRL +
Sbjct  199   FVYKLELGYKGPALAFSLSVWLNVILLGFYIKYSSACNKTRSPLSKHAFYGVGEFFRLGV  258

Query  835   PSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISN  656
             PSA M CL+WW+ E++ LL GLLPNP++ETSVLSICL I +LHF IP+  GA ASTR+SN
Sbjct  259   PSAVMVCLKWWSMELLTLLSGLLPNPKLETSVLSICLTISTLHFTIPYGFGAAASTRVSN  318

Query  655   ELGAGNTDLARMAVW-GVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPL  479
             ELGAGN   AR+AV   + + G    +V+A V  S R V+GYA+SN  +VV+Y+  M PL
Sbjct  319   ELGAGNPQSARLAVMVAICLAGAEAAIVSATVFFS-RHVLGYAYSNNKQVVNYVAIMAPL  377

Query  478   VSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMG  299
             + L  + D +  +LSGVARG GWQ +GAY+NLGA+YLVG P   +LGF++ L+G GLW+G
Sbjct  378   ICLSFILDSLQAVLSGVARGCGWQKIGAYINLGAFYLVGLPVGAVLGFVSHLKGKGLWIG  437

Query  298   LNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
             +   S+VQ+ +L+LIT  T+WKKQ +KA+ER+ 
Sbjct  438   IIAGSIVQSTLLSLITGSTNWKKQVTKARERIF  470



>ref|XP_004961296.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Setaria 
italica]
Length=497

 Score =   488 bits (1257),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 249/496 (50%), Positives = 343/496 (69%), Gaps = 11/496 (2%)
 Frame = -2

Query  1630  DQRVNFLLPEMDAEVPLLSEKRPAAAISKDVFLAELK----KLARIAIPMLVVTVCQQMV  1463
             + R   LLP+      L  EK   A    + +  +L     K+  +A+PM  V+V Q  V
Sbjct  2     EDRAPLLLPQYT----LREEKCGGAGTGDERWRRDLAREAGKVGYVALPMAAVSVSQYAV  57

Query  1462  IFVSTMMLGHISE-LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGT  1286
                S MM+GH+   L LS  AVATS  +V+GFSL+ GMAS LETLCGQAYGA  Y KL  
Sbjct  58    QVASNMMVGHLPGVLPLSASAVATSLASVSGFSLLIGMASGLETLCGQAYGAKLYDKLAM  117

Query  1285  YTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCL  1106
             +TY AI++L  V+IPIS+LWVF+ K LI +GQDPLIS EAG+Y VWLI  +F YAI Q L
Sbjct  118   HTYRAIVTLVFVSIPISLLWVFIGKLLILIGQDPLISKEAGRYIVWLIPGLFAYAISQPL  177

Query  1105  VRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVY  926
              ++LQ QSLI+PML SS  +L  HIP+CW L F++ LG  G +LAI LSYW NVI+L  Y
Sbjct  178   TKFLQSQSLIIPMLWSSIATLLLHIPLCWLLVFKTSLGYIGASLAISLSYWLNVIMLAAY  237

Query  925   VKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVET  746
             + YS+SC+++R     ++F  VG F RLA+PSA M C EWW+FEI+ILL G+LPNP+++T
Sbjct  238   IGYSNSCKETRSPPTIEAFKGVGVFLRLALPSALMLCFEWWSFEILILLSGILPNPELQT  297

Query  745   SVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAV  566
             SVLSICL   +L + IP+  GA ASTR++NELG GN + AR AV  V  I ++E  +  +
Sbjct  298   SVLSICLTTITLMYTIPYGFGAAASTRVANELGGGNPEGARSAVRVVMCIAVMEAAIVTI  357

Query  565   VLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVN  386
             +L++ + ++GYA+S++ EVV Y+  M+P V + + +D + G+LSG+ARG GWQHLGAYVN
Sbjct  358   ILLASQHILGYAYSSDKEVVAYVNAMVPFVCVSVAADSLQGVLSGIARGCGWQHLGAYVN  417

Query  385   LGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQER  206
             LG++YLVG P A +LGF+  + G GLWMG++  S+VQ ++LA+IT F++W+    KA++R
Sbjct  418   LGSFYLVGIPTALLLGFVLKMEGKGLWMGISCGSIVQFLLLAVITFFSNWQNMSDKARDR  477

Query  205   LLND--SHPPAVDNGG  164
             + +D  S    +++GG
Sbjct  478   VFSDEPSDKEPLESGG  493



>ref|XP_009104925.1| PREDICTED: MATE efflux family protein 5-like [Brassica rapa]
Length=487

 Score =   488 bits (1255),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 240/469 (51%), Positives = 334/469 (71%), Gaps = 1/469 (0%)
 Frame = -2

Query  1600  MD-AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             MD AE  LL         +KDV L E+ +L+ IA PM+ V      +  +S MM+GH+ E
Sbjct  1     MDSAEKGLLVRGEEEEVDTKDVLLREMGRLSYIAGPMVAVNSSMYFLQVISIMMVGHLGE  60

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+A SF +VTGFSL+FG+ASALETLCGQAYGA Q+ KLG +TY  +++L VV+I
Sbjct  61    LYLSSTAIAVSFCSVTGFSLVFGLASALETLCGQAYGAKQFEKLGEHTYTGMLALFVVSI  120

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW +M + L F+GQDP ++ EAGK++ WLI A+F YA +Q LV++ Q QSLI+P++
Sbjct  121   PLSVLWSYMGEILSFIGQDPQVAQEAGKFATWLIPALFGYATMQPLVKFFQAQSLILPLM  180

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  ++C H+ +CW+L F+ GLGS G A+AI +SYW NV++L +Y+ +SS+C KSR  +
Sbjct  181   ISSVSAVCCHVVLCWSLVFKFGLGSIGAAIAISVSYWLNVVVLGLYMAFSSTCGKSRGKI  240

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                 F  + EFF+  +PSASM CLEWW+FE +++L G+LPNP++E SVLS+CL      +
Sbjct  241   SMSVFDGMREFFQFGVPSASMICLEWWSFEFLVMLSGILPNPKLEASVLSVCLSTIFTLY  300

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
              IP S+GA ASTR++NELGAGN   ARMAV+ V ++  +E V+    + + R+V GY FS
Sbjct  301   QIPESLGAAASTRVANELGAGNPKKARMAVYTVMVMTGVESVLVGATVFAARNVFGYLFS  360

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +ETEVVDY++ + PLVSL ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +
Sbjct  361   SETEVVDYVRSIAPLVSLSVIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLFGIPTAII  420

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLN  197
             L F   +RG GLW+G+ + S VQ V+L LI   T+WK+Q  KA+ER++ 
Sbjct  421   LAFKFDMRGRGLWIGITVGSFVQAVLLGLIVSLTNWKQQAKKARERVMG  469



>ref|XP_006302179.1| hypothetical protein CARUB_v10020189mg, partial [Capsella rubella]
 gb|EOA35077.1| hypothetical protein CARUB_v10020189mg, partial [Capsella rubella]
Length=492

 Score =   488 bits (1255),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 231/452 (51%), Positives = 328/452 (73%), Gaps = 0/452 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
              KDVFL E+K+L  IA PM+ V +    ++ +S MM+GH+ EL LS  A+A SF +VTGF
Sbjct  33    KKDVFLREMKRLGYIAGPMVAVNLSTYALLVISIMMVGHLGELFLSSTAIAISFCSVTGF  92

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             S++FG+ASALETLCGQA+GA Q+ KLG +TY  I SL +V+IP+S+LW +M   L F GQ
Sbjct  93    SVVFGLASALETLCGQAHGAKQFEKLGVHTYTGIFSLLLVSIPLSVLWSYMGDILAFTGQ  152

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DPL+S EAGK++ WLI A+F YA LQ L+R+ Q QSLI P+++SS  +LC H+ +CW+L 
Sbjct  153   DPLVSQEAGKFATWLIPALFAYATLQPLIRFFQTQSLIFPLIMSSVSALCCHVVLCWSLV  212

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+ GLG+ G A++I +SYW NV +L +Y+ +SS+C K+R  +    F  +GEFFR  IPS
Sbjct  213   FKFGLGNLGAAISISVSYWLNVTVLGLYMTFSSNCSKNRAPITMSLFKGMGEFFRFGIPS  272

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             A+M C+EWW+FE ++LL GLLPNP++E SVLS+CL   ++ +    S+GA ASTR++NEL
Sbjct  273   AAMICIEWWSFEFLVLLSGLLPNPKLEASVLSVCLSTMAVLYQTVESLGAAASTRVANEL  332

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN   AR+AV+ V +I  +E V+ +  +   R+V GY FS+ETEVVDY+  M PL++L
Sbjct  333   GAGNPKQARIAVYTVMVITCVESVMVSSTVYGTRNVFGYIFSSETEVVDYVSSMAPLIAL  392

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P + +L F+  +RG GLW+G+ +
Sbjct  393   SVIFDAVRAVLSGVARGSGRQDIGAYVNLAAYYLCGIPTSIILAFVFKMRGRGLWIGITV  452

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLND  194
              S VQ  +L +I + T+W+++  KA++RL+ +
Sbjct  453   GSFVQAFLLGVIVVLTNWEQEAKKARQRLMCE  484



>ref|XP_010415812.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Camelina 
sativa]
Length=477

 Score =   487 bits (1254),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 240/471 (51%), Positives = 332/471 (70%), Gaps = 1/471 (0%)
 Frame = -2

Query  1600  MD-AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             MD AE  LL++        KD +  E+K+L  IA PM+ V +    +  +S +M+GH+ E
Sbjct  1     MDSAEKGLLAKSEEEEVKKKDGYFQEMKRLGYIAGPMVAVNLSMDFLQVISIVMIGHLGE  60

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+A SF + TGFSL+FG+ASA+ETLCGQAYGA QY KLG +TY  I+SL +V I
Sbjct  61    LFLSSTAIAVSFCSATGFSLVFGLASAMETLCGQAYGAKQYEKLGVHTYTTILSLYLVCI  120

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW +M   L  +GQDP+++ EAGK++ WLI A+  YA LQ LV++ Q QSLI P++
Sbjct  121   PLSVLWSYMGAILSLIGQDPVVAQEAGKFATWLIPALLAYATLQPLVQFFQAQSLIFPLI  180

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  ++C H+ +CW+L F+ G G  G A+AIG+SYW NV++L +Y+K+SSSC KSR  +
Sbjct  181   ISSISAVCVHVSLCWSLVFKFGFGIRGAAIAIGVSYWVNVVVLGLYMKFSSSCSKSRATI  240

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                    + EFF L IPSASM CLEWW+FE ++LL G+LPN  +ETSVLS+CL   S  +
Sbjct  241   SMSVVKGMKEFFWLGIPSASMICLEWWSFEFLVLLSGILPNSTLETSVLSVCLSTISFAY  300

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
             +IP S+GA ASTR++NELGAGN   ARMAV+ V +I  +E ++ + ++   R+V GY FS
Sbjct  301   HIPESLGAAASTRVANELGAGNPKQARMAVYTVMVIACVESILVSAIVFGSRNVFGYLFS  360

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +ETEVVDY++ M PLVSL+++ D +  +LSGVARG+G Q  GAYVNL AYYL G P A +
Sbjct  361   SETEVVDYVRSMAPLVSLLVILDALHTVLSGVARGAGRQDRGAYVNLAAYYLCGTPTAII  420

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             L F   +RG GLW+G+ + S VQ  +L LI IFT+W+++   A+ERL+ + 
Sbjct  421   LAFGFKMRGRGLWIGITVGSFVQAFLLVLIVIFTNWEQEAKNARERLMAEE  471



>ref|XP_006301245.1| hypothetical protein CARUB_v10021645mg [Capsella rubella]
 gb|EOA34143.1| hypothetical protein CARUB_v10021645mg [Capsella rubella]
Length=485

 Score =   487 bits (1254),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 240/470 (51%), Positives = 327/470 (70%), Gaps = 1/470 (0%)
 Frame = -2

Query  1600  MD-AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             MD AE  LL   R      KDVF  E+KKL  IA PM+ +     +++ +S MM+GH+ E
Sbjct  1     MDSAEEGLLVVSRGEEVNKKDVFFMEMKKLGYIAGPMIAINSSMYVLLVISIMMVGHLGE  60

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+A SF NVTGFS+IFG+ASALETLCGQA GA Q+ KLG +TY  I SL +V I
Sbjct  61    LFLSSTAIAISFCNVTGFSIIFGLASALETLCGQANGAKQFEKLGVHTYTGIFSLFLVCI  120

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW +M   L   GQDPL+S EAGK++ WLI A+F YA LQ L+R+ Q QSLI+PM+
Sbjct  121   PLSVLWSYMGDVLTLTGQDPLVSQEAGKFATWLIPALFAYATLQPLIRFFQAQSLILPMI  180

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  ++C H+ +CW+L F+ GLG+ G A++I +SYW NV +L +Y+ +SSSC KSR  +
Sbjct  181   MSSMSAVCVHVVLCWSLVFKFGLGNLGAAISISVSYWLNVTVLGLYMTFSSSCSKSRATI  240

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                 F  + EFF   IPSASM CLEWW+FE +ILL G+LPNP++E S+LS+C+   ++ +
Sbjct  241   SMSVFKGMKEFFLFGIPSASMICLEWWSFEFLILLSGILPNPKLEASILSVCMSTTAIVY  300

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
              I  S+GA ASTR++NELGAGN   AR+AV+ V +I  +E ++ +  +   R V GY FS
Sbjct  301   QIAESLGAAASTRVANELGAGNPKQARVAVYTVMVITCVESIMVSATVFGTRDVFGYLFS  360

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +ETEVV Y++ M PLV+L ++ D +  +L+GVARGSG Q +GAYVNL AYYL G P A +
Sbjct  361   SETEVVAYVRSMAPLVALSVIFDALHAVLAGVARGSGRQDIGAYVNLAAYYLFGIPTAMI  420

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             L F   + G GLW+G+ + S VQ  +L L+ I T+W++Q  KA+ERL+  
Sbjct  421   LAFRFKMEGRGLWIGITVGSFVQAFLLGLVVILTNWEQQMRKARERLMGK  470



>ref|XP_009102405.1| PREDICTED: MATE efflux family protein 9 [Brassica rapa]
Length=483

 Score =   486 bits (1250),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 245/474 (52%), Positives = 328/474 (69%), Gaps = 3/474 (1%)
 Frame = -2

Query  1612  LLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             LLPE DA+       +P      D F AELK ++R+A PM  VTV Q ++  +S M+ GH
Sbjct  5     LLPE-DAQCTT-GNPKPTQTWRMD-FTAELKNVSRMAAPMATVTVAQFLLPLISVMVAGH  61

Query  1432  ISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
               EL LSG A+ATSF NV+GFS++FG+  ALETLCGQAYGA QY KLGT+TY AI S   
Sbjct  62    RGELQLSGVALATSFANVSGFSIMFGLVGALETLCGQAYGAKQYSKLGTFTYSAIASNVP  121

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
             + + ISILW++MDK LI +GQD  IS  AG Y+VWLI  +F  A+ Q + R+LQ Q L++
Sbjct  122   ICVLISILWIYMDKLLISIGQDHDISKVAGSYAVWLIPGLFAQAVQQPVTRFLQTQGLVL  181

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             P+L  +  +L FHIPVCW L +  GLGS G ALAI LSYWFNV+ L  YV++SSSCEK+R
Sbjct  182   PLLYCALSTLLFHIPVCWILVYTFGLGSNGAALAISLSYWFNVLSLACYVRFSSSCEKTR  241

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
               + +D  + V +FF+  IPSA+M CLEWW FE++IL  GLLPNP++ETSVLS+CL   S
Sbjct  242   GFVSDDFVSGVKQFFQYGIPSAAMTCLEWWLFELLILSSGLLPNPKLETSVLSVCLSTGS  301

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
             LH+ IP  I A  STRI+NELGAGN ++AR+AV+    + ++E  + + +L   R++ GY
Sbjct  302   LHYVIPMGIAAAVSTRIANELGAGNPEVARLAVFAGICLWLLEAAICSTILFISRNIFGY  361

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             AFSN  EVVDY+ ++ PL+ L  + DG S +L GVARGSGWQH+GA+ N+ AYYL+GAP 
Sbjct  362   AFSNSKEVVDYVTELAPLLCLSFIVDGFSAVLGGVARGSGWQHIGAWANVVAYYLIGAPV  421

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
                L F   + G GLW+G+   S  Q ++LA++T    W +Q SKA++R++  +
Sbjct  422   GLFLAFWCHMNGKGLWIGVIFGSSSQGIILAIVTACMSWNEQASKARKRIVEGT  475



>ref|XP_009394476.1| PREDICTED: MATE efflux family protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=488

 Score =   486 bits (1250),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 242/451 (54%), Positives = 330/451 (73%), Gaps = 0/451 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
              + E ++L  +A PM+ VT+ Q +V  VS+MM+GH+ +L L+  A+ATS T+VTGFSL+ 
Sbjct  32    LMEEARRLGYVAAPMVAVTMSQFLVQVVSSMMVGHLGKLDLASAAIATSLTSVTGFSLLL  91

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             GMAS LETLCGQAYGA QYH L  +TY AI SL VV +PIS++W  M K L  +GQDPLI
Sbjct  92    GMASGLETLCGQAYGAEQYHMLSIHTYRAIFSLLVVCLPISLVWASMGKLLQLIGQDPLI  151

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAGKY+VW+I  +F YAI Q L+++L  QSLI+PMLLSS ++LC HIP+CW L F+SG
Sbjct  152   SQEAGKYAVWMIPGLFAYAIAQPLMKFLLSQSLILPMLLSSLMTLCLHIPLCWVLVFKSG  211

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             L + G AL+I +SYW NV +L +Y++YS+SC  +R  +  ++F  V EF RLA+PSA M 
Sbjct  212   LRNVGAALSISISYWLNVFILGMYIRYSASCRATRAPISKEAFRGVNEFLRLALPSALMI  271

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW+FE++ILL GLLPNPQ+ETSVLSICL   +L +  P+ +G  ASTR+SNELGA N
Sbjct  272   CLEWWSFELLILLSGLLPNPQLETSVLSICLNSITLLYCFPYGLGCAASTRVSNELGAWN  331

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
                A++ V     + + E V+ +  L ++R ++GYA+SNE EV++Y+  M+PLV   +V 
Sbjct  332   PKGAQLVVRVAMFLAISEAVLVSGTLFAMRRILGYAYSNEEEVMNYVTDMVPLVCFSVVF  391

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D + G+LSG+ARG GWQHLGAYVNLG++YL G P A +LGFL  + G GLW+G+   S  
Sbjct  392   DSLQGVLSGIARGCGWQHLGAYVNLGSFYLFGIPIAVVLGFLLHIGGKGLWIGIVCGSTT  451

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDSHP  185
             Q ++L+LITIFT+W+ Q + A+ER+ ++  P
Sbjct  452   QTILLSLITIFTNWQNQATMARERIFHERLP  482



>gb|KHN06720.1| MATE efflux family protein 7 [Glycine soja]
Length=453

 Score =   484 bits (1246),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 237/445 (53%), Positives = 326/445 (73%), Gaps = 0/445 (0%)
 Frame = -2

Query  1525  LKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMAS  1346
             ++++  IA PM+ V   Q ++  VSTM++GH+ EL LS  A+A S + VTGFSL+ GMAS
Sbjct  1     MRRICHIAGPMVAVVSSQYLLQVVSTMIVGHLGELYLSSAALAISLSGVTGFSLLMGMAS  60

Query  1345  ALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEA  1166
              LET+CGQAYG  QY ++G  TY AI SL +V+IP+S+LW+ M+  L+F+GQDPLIS EA
Sbjct  61    GLETICGQAYGGQQYQRIGIQTYTAIFSLILVSIPVSLLWINMETILVFIGQDPLISHEA  120

Query  1165  GKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSA  986
             GK+++WL+ A+F YAILQ LVRY Q+QSL++PM  SS ++L  H+P+CWAL F++ L + 
Sbjct  121   GKFTIWLVPALFAYAILQPLVRYFQIQSLLLPMFASSCVTLIIHVPLCWALVFKTSLSNV  180

Query  985   GPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEW  806
             G ALA+ +S W NVI LV+Y++YSS+C K+R  +  + F  + EFFR AIPSA M CLEW
Sbjct  181   GGALAVSISIWSNVIFLVLYMRYSSACAKTRAPISMELFKGMWEFFRFAIPSAVMVCLEW  240

Query  805   WTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLA  626
             W++E+++LL GLLPNPQ+ETSVLS+CL   +  + IPF IGA ASTR+SNELGAGN+  A
Sbjct  241   WSYELLVLLSGLLPNPQLETSVLSVCLNTIATLYTIPFGIGAAASTRVSNELGAGNSHAA  300

Query  625   RMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGIS  446
             R+AV     + +IE  + +  L + R+V GY FSNE EVVDY+  M PLV + ++ D I 
Sbjct  301   RVAVLAAMSLAVIETSIVSATLFACRNVFGYIFSNEKEVVDYVTAMAPLVCISVILDSIQ  360

Query  445   GLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVV  266
             G+L+G+ARG GWQHLG YVNLGA+YL G P A +L FL  L G GLW+G+   + VQ ++
Sbjct  361   GVLTGIARGCGWQHLGVYVNLGAFYLCGIPMAALLAFLVRLGGKGLWIGIQSGAFVQCIL  420

Query  265   LALITIFTDWKKQESKAQERLLNDS  191
             L++IT   +W+KQ  KA++RL ++ 
Sbjct  421   LSIITGCINWEKQAIKARKRLFDEK  445



>ref|XP_008229318.1| PREDICTED: MATE efflux family protein 5 [Prunus mume]
Length=478

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 249/469 (53%), Positives = 320/469 (68%), Gaps = 0/469 (0%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             MD E+    E      ++   F  EL+K   IA PM+ V+V Q ++ FVS +M+GH+ +L
Sbjct  1     MDKEIAETVEDEKTREVTWGTFGRELRKEGFIAAPMVAVSVLQYLLQFVSMIMVGHLDQL  60

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             SLS  A+A S TNVTGFSL+ GMA  LETLCGQA+GAGQYHKLGTYT  A++SL +V  P
Sbjct  61    SLSSVAIAISLTNVTGFSLLSGMAGGLETLCGQAFGAGQYHKLGTYTCTAMLSLLLVCPP  120

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             I +LW+F DK L  VGQDP IS  A KYSVWLI A+F  AIL+ L RYLQ QS I PMLL
Sbjct  121   ICVLWIFFDKLLPLVGQDPQISLAARKYSVWLIPALFGGAILKPLTRYLQSQSSIFPMLL  180

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS   L FHI   W   ++ GLGS G A+A  +S W  VILL+ Y   SS+ EK+R+   
Sbjct  181   SSFAILLFHILATWGFVYKVGLGSKGAAIAFSMSTWLYVILLLFYALVSSAFEKTRITFS  240

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              +S   + +FFRLA+PSA M CL+WW+ E++ILL GLLPN ++ETSVLSIC+ I +LHF 
Sbjct  241   MESLLHIRQFFRLAVPSAVMVCLKWWSCELIILLSGLLPNQKLETSVLSICIAISTLHFT  300

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             + +  GA AS R+SNELGA N   AR+AVW    + + E ++ +  L   R V+G+ FS+
Sbjct  301   VSYGFGAAASIRVSNELGANNPQAARVAVWAAMFLSVTEAIIVSTTLFFCRHVLGHVFSS  360

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E  VVDYI  M PL+ L +  D +  +LSG+ARGSGWQ +GAYVNLGA+YLVG P   +L
Sbjct  361   EKPVVDYIAVMAPLICLSVFMDSLQAVLSGIARGSGWQSIGAYVNLGAFYLVGLPVGVVL  420

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             GF   LRG GLW+G+   S+VQ+ +LALIT FT+W KQ  KA+ER+  +
Sbjct  421   GFPLRLRGRGLWIGIVAGSVVQSALLALITGFTNWSKQAKKARERVFVE  469



>gb|KFK41540.1| hypothetical protein AALP_AA2G142400 [Arabis alpina]
Length=484

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 238/457 (52%), Positives = 325/457 (71%), Gaps = 1/457 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F  E+++L  IA PM+ V      +  +S MM+GH+ EL LS  A+A SF +VTGFSL+F
Sbjct  21    FFKEMRRLGYIAGPMVAVNSSMYFLQVISIMMVGHLGELYLSSTAIAVSFCSVTGFSLVF  80

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             G+ASALETLCGQA GA QY KLG +TY  I++L +V +P+S+LW +M + L  +GQDP++
Sbjct  81    GLASALETLCGQANGAKQYEKLGEHTYTGILALFLVCLPLSVLWSYMGEILSLIGQDPMV  140

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAGK++ WLI  +F YA LQ LVR+ Q QSLI+P+++SS  +L  H+ +CW L F  G
Sbjct  141   SQEAGKFATWLIPGLFAYAALQPLVRFFQAQSLILPLIMSSISALFVHVVLCWYLVFNFG  200

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             LGS G A+AI +SYW NV +L +Y+ +SSSC KSR  +    F  +GEFFR  IPSASM 
Sbjct  201   LGSFGAAVAINVSYWLNVSVLGLYMMFSSSCSKSRTAISMSVFDGMGEFFRFGIPSASMI  260

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW+FE +++L G+LPNP++ETSVLS+CL   S  + IP S+GA ASTR++NELGAGN
Sbjct  261   CLEWWSFEFLVMLSGILPNPKLETSVLSVCLSTISSLYQIPESLGAAASTRVANELGAGN  320

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
             +  ARM V+ V ++  +E ++   V+ + R+V GY FS+ETEVVDY++ M PLV+L ++ 
Sbjct  321   SKQARMTVYTVMVMAGVESIMVGAVVFAARNVFGYLFSSETEVVDYVRSMAPLVALSVIF  380

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D +  +LSGVARGSG Q++GAYVNL AYYL G P A +LGF   + G GLW+G+ + S V
Sbjct  381   DALHAVLSGVARGSGRQNIGAYVNLAAYYLFGIPTAIILGFRFKMGGRGLWIGITVGSFV  440

Query  277   QNVVLALITIFTDWKKQESKAQERLLN-DSHPPAVDN  170
             Q V+L LI   T+WK+Q  KA+ER++  +S     D 
Sbjct  441   QAVLLGLIVSLTNWKQQARKARERVMGYESEEKDSDE  477



>ref|XP_009127849.1| PREDICTED: MATE efflux family protein 6-like isoform X1 [Brassica 
rapa]
Length=498

 Score =   486 bits (1250),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 236/444 (53%), Positives = 325/444 (73%), Gaps = 0/444 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
             ++D FL E+++L+ IA PM+ V      +  +S MM+GH+ EL LS  A+A SF +VTGF
Sbjct  21    TRDRFLREMRRLSYIAGPMIAVNSSMYFLQVISIMMVGHLGELYLSSTAIAVSFCSVTGF  80

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             SL+FG+ASALETLCGQA GA Q+ KLG +TY  I SL +V+IP+S+LW +M + L F+GQ
Sbjct  81    SLVFGLASALETLCGQANGAKQFEKLGEHTYTGIFSLFIVSIPLSVLWSYMGEILSFIGQ  140

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DPL+S EAGK++  LI ++F YA LQ LVR+ Q QSL++P+++SS  +LC H+ +CW+L 
Sbjct  141   DPLVSQEAGKFATRLIPSLFAYATLQPLVRFFQAQSLVLPLIMSSMSALCCHVVLCWSLV  200

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+ GLGS G A+AI +SYW N  +L +Y+ +SS+C K+R  +    F  + EFFR  +PS
Sbjct  201   FKFGLGSLGAAIAISVSYWLNATVLGLYMTFSSTCSKTRGKISMSVFKGMKEFFRFGVPS  260

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             ASM CLEWW+FE +++L G+LPNP++ETSVLS+CL   S  + IP S+GA ASTR++NEL
Sbjct  261   ASMICLEWWSFEFLVMLSGILPNPKLETSVLSVCLSTISSLYQIPESLGAAASTRVANEL  320

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN   ARMAV+ V +I  +E ++ + ++ + R+V GY FS+ETEVVDY++ M PLVSL
Sbjct  321   GAGNPKKARMAVYTVMVITGVEALMVSAIVFAARNVFGYLFSSETEVVDYVRTMAPLVSL  380

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +LGF   +RG GLW+G+ +
Sbjct  381   SVIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLFGIPTAVVLGFTFKMRGRGLWIGITV  440

Query  289   ASLVQNVVLALITIFTDWKKQESK  218
              S VQ V+L LI   T+WK+Q SK
Sbjct  441   GSCVQAVLLGLIVSLTNWKQQVSK  464



>emb|CDY49220.1| BnaCnng17090D [Brassica napus]
Length=487

 Score =   484 bits (1247),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 240/469 (51%), Positives = 332/469 (71%), Gaps = 1/469 (0%)
 Frame = -2

Query  1600  MD-AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             MD AE  LL         +KDV L E+ +L+ IA PM+ V      +  +S MM+GH+ E
Sbjct  1     MDSAEKGLLVHGEEEEVNTKDVLLREMGRLSYIAGPMVAVNSSMYFLQVISIMMVGHLGE  60

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+A SF +VTGFSL+FG+ASALETLCGQAYGA Q+ KLG +TY  +++L  V I
Sbjct  61    LYLSSTAIAVSFCSVTGFSLVFGLASALETLCGQAYGAKQFEKLGEHTYTGMLALFFVCI  120

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW FM + L F+GQDP +S EAGK++ WLI A+F YA +Q LV++ Q QSLI+P++
Sbjct  121   PLSVLWSFMAEILSFIGQDPEVSQEAGKFATWLIPALFGYATMQPLVKFFQAQSLILPLM  180

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  ++C H+ +CW+L F+ GLGS G A+AI +SYW NV++L +Y+ +SS+C +SR  +
Sbjct  181   ISSVSAVCCHVVLCWSLVFKFGLGSIGAAIAISVSYWLNVVVLGLYMMFSSTCSESRGKI  240

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                 F  + EFF+  IPSASM CLEWW+FE +++L G+LPNP++E SVLS+CL      +
Sbjct  241   SMSVFEGMREFFQFGIPSASMICLEWWSFEFLVMLSGILPNPKLEASVLSVCLSTIFTLY  300

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
              IP S+GA ASTR++NELGAG+   ARMAV+ V ++  +E V+    + + R+V GY FS
Sbjct  301   QIPESLGAAASTRVANELGAGSPKKARMAVYTVMVMTGVESVLVGATVFAARNVFGYLFS  360

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +E EVVDY++ + PLVSL ++ D +  +LSGVARGSG Q +GAYVNL AYYL G P A +
Sbjct  361   SEAEVVDYVRSIAPLVSLSVIFDALHAVLSGVARGSGRQDIGAYVNLAAYYLFGIPTAIV  420

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLN  197
             LGF   +RG GLW+G+ + S VQ V+L LI   T+WK+Q  KA+ER++ 
Sbjct  421   LGFKFDMRGKGLWIGITVGSFVQAVLLGLIVSLTNWKQQAKKARERVMG  469



>ref|XP_006280378.1| hypothetical protein CARUB_v10026306mg [Capsella rubella]
 gb|EOA13276.1| hypothetical protein CARUB_v10026306mg [Capsella rubella]
Length=486

 Score =   484 bits (1247),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 241/468 (51%), Positives = 335/468 (72%), Gaps = 0/468 (0%)
 Frame = -2

Query  1597  DAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
              AE  LL          KDV   E+K+L  IA PM+ V     +++ +S MM+GH+ EL 
Sbjct  3     SAEESLLVVSHREDVNKKDVLFEEMKRLCYIAGPMVAVNSSSYVLLVISIMMVGHLGELF  62

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LS  A+A SF +VTGFS++FG+ASALETLCGQA+GA Q+ KLG +TY  I+SL +V IP+
Sbjct  63    LSSTAIAVSFCSVTGFSVVFGLASALETLCGQAHGAKQFEKLGVHTYTGIISLFLVCIPL  122

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             S+LW +M   L F GQDPL++ +AGK++ WLI A+F YA LQ LVR+ Q QSLI PM++S
Sbjct  123   SVLWTYMGDILSFTGQDPLVAKQAGKFATWLIPALFGYATLQSLVRFYQAQSLIYPMIIS  182

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             S  +LC H+ +CW+L F+ GLGS G A+++G+SYW NVI+L +Y+K+SSSC K+R  +  
Sbjct  183   SISALCVHVVLCWSLVFKFGLGSHGAAISVGVSYWLNVIVLALYMKFSSSCSKTRATISM  242

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
               F  +GEFFR  IPSASM CLEWW+ E ++LL GLLPNP++E SVLS+CL   ++ + I
Sbjct  243   SVFRGMGEFFRFGIPSASMICLEWWSLEFLLLLSGLLPNPKLEASVLSVCLSTVAILYQI  302

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
               S+GA ASTR++NELGAGN   AR+AV+ V +I  +E ++ + ++   R+V GY FS+E
Sbjct  303   AESLGAAASTRVANELGAGNPKQARIAVYTVMVITCVESIMVSAIVFGARNVFGYLFSSE  362

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
             TEVVDY++ + PLVSL ++ D +  +L+GVARGSG Q +GAYVNL AYYL G P A +L 
Sbjct  363   TEVVDYVRTLAPLVSLSVIFDALHAVLAGVARGSGRQDIGAYVNLAAYYLCGVPTAIILA  422

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             F   +RG GLW+G+ + S VQ  +L+LI I T+W+++  KA++RL+ +
Sbjct  423   FGFKMRGRGLWIGITVGSFVQAFLLSLIVILTNWEQEAKKARQRLMCE  470



>ref|XP_007142994.1| hypothetical protein PHAVU_007G034700g [Phaseolus vulgaris]
 gb|ESW14988.1| hypothetical protein PHAVU_007G034700g [Phaseolus vulgaris]
Length=479

 Score =   484 bits (1246),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 239/462 (52%), Positives = 329/462 (71%), Gaps = 0/462 (0%)
 Frame = -2

Query  1576  SEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVA  1397
              E+     ++   F  E+++++ IA PM+ V   Q ++  V+TM++GH+ EL LS  A+A
Sbjct  10    EEESEEKRVTWSGFSEEMRRISVIAGPMVAVVFSQYLLQIVATMIVGHLGELYLSSAALA  69

Query  1396  TSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFM  1217
              S   V+GFSL+ GMAS LET+CGQAYGA QY ++G  TY AI SL ++ IP+S+LWV++
Sbjct  70    ISLAGVSGFSLLMGMASGLETICGQAYGAQQYQRIGVQTYTAIFSLLLICIPLSLLWVYI  129

Query  1216  DKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCF  1037
             +  L+F+GQDPLIS EAGK+ +WL+ A+F YAILQ LVRY Q+QS+++PML SS ++L  
Sbjct  130   ESILVFIGQDPLISHEAGKFIIWLLPALFAYAILQPLVRYFQIQSMLLPMLASSCVTLII  189

Query  1036  HIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVG  857
             HIP+CWAL F++ L + G ALA+ +S W NVI+L  Y++YSS+C K+R  +  + F  + 
Sbjct  190   HIPLCWALVFKTRLNNVGGALAVSISMWSNVIILGSYMRYSSACAKTRAPISLEVFKGMQ  249

Query  856   EFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAG  677
             EFFR A+PSA M CLEWW+FE+++LL GLLPNPQ+ETSVLS+CL   +  + IPF IGA 
Sbjct  250   EFFRFAVPSAVMVCLEWWSFELLVLLSGLLPNPQLETSVLSVCLNTIATLYTIPFGIGAA  309

Query  676   ASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYI  497
             ASTR+SNELGAGN+  AR+AV     + +IE  V +  L + R V GY FSNE EV+DY+
Sbjct  310   ASTRVSNELGAGNSHAARVAVLAAMSLAVIETCVVSTTLFACRHVFGYIFSNEKEVIDYV  369

Query  496   KKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRG  317
               M PLV L ++ D I G+L+G+ARG GWQHLG YVNLGA+YL G P A +L F+  + G
Sbjct  370   TFMAPLVCLSVILDSIQGVLTGIARGCGWQHLGVYVNLGAFYLCGIPMAAILAFVLRVGG  429

Query  316   MGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              GLW+G+   S VQ V+L +IT   +W+ Q  KA++RL +D 
Sbjct  430   KGLWIGIQCGSFVQTVLLVVITSCINWENQAMKARKRLFDDE  471



>gb|KEH44143.1| MATE efflux family protein [Medicago truncatula]
Length=475

 Score =   484 bits (1245),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 244/470 (52%), Positives = 336/470 (71%), Gaps = 2/470 (0%)
 Frame = -2

Query  1591  EVPLLSEKRP--AAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
             E  LL + R   + +I+  VF  E+K +  +A+PM+ VT+ Q  +  +S +M+G + +L+
Sbjct  2     EKGLLEKDREGDSRSITWGVFFQEVKDVCFLALPMIAVTLSQYFLQIISMIMVGRLGKLA  61

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LS  A+A S   V+GFSL+FGM+ ALET CGQAYGA QY K G   Y A+ SL +  +P+
Sbjct  62    LSSTAIAISLCGVSGFSLLFGMSCALETQCGQAYGAKQYKKFGVQIYTAVFSLIIACLPL  121

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             S+LW+F+ + LI +GQDPLIS EAGK+S+ +I A+F YA LQ LVRY  MQSLI+P+++S
Sbjct  122   SLLWIFLGRLLILLGQDPLISQEAGKFSMCMIPALFAYATLQALVRYFLMQSLILPLVIS  181

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             S ++LCFH+  CW L F+SGLG  G AL+IG SYW NVI+L +Y+K+S+ CE++RV +  
Sbjct  182   STVTLCFHVAFCWLLVFKSGLGCLGAALSIGTSYWLNVIILGLYMKFSTDCEETRVPISM  241

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
             + F  VGEFFR AIPSA M CLEWW+FE++ILL GLLPNPQ+ETSVLSICL I S  + I
Sbjct  242   EPFLGVGEFFRYAIPSAGMICLEWWSFELLILLSGLLPNPQLETSVLSICLSIISTIYTI  301

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
             P + G+ ASTR+SN LG G    AR++V+    + + E ++ +  + + R V+GY FSNE
Sbjct  302   PEATGSAASTRVSNALGGGCPQAARLSVFASMTVAVSEAILVSSTIFASRKVLGYIFSNE  361

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
              +VVDY+  M+PL+S+ ++ D + G LSG+ARGSGWQ LGAYVNLGAYY+ G P A +LG
Sbjct  362   QDVVDYVTHMVPLISINVIVDSLHGTLSGIARGSGWQKLGAYVNLGAYYVFGIPIAVILG  421

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
             F   LRG GLW+G+ + +  Q ++LALIT FT+W+KQ  KA+ER+     
Sbjct  422   FWFELRGKGLWIGILVGAFCQALLLALITGFTNWEKQAIKARERIFQGRQ  471



>ref|XP_010034452.1| PREDICTED: MATE efflux family protein 5-like [Eucalyptus grandis]
 gb|KCW52097.1| hypothetical protein EUGRSUZ_J01528 [Eucalyptus grandis]
Length=482

 Score =   483 bits (1244),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 245/475 (52%), Positives = 330/475 (69%), Gaps = 3/475 (1%)
 Frame = -2

Query  1591  EVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLS  1412
             EVP    +     +++D++  ELKK  RIA PM+ V+V Q +V  VS + +GH+ +LSLS
Sbjct  3     EVP--ESEHIKWGLTRDLYAQELKKATRIAAPMVAVSVLQYLVQLVSVVAVGHLGQLSLS  60

Query  1411  GGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISI  1232
               A+ATS  NVTGFSL+ G+A  LETL GQAYGAGQ+ KLG Y + A MSL +V  P+ I
Sbjct  61    SVAIATSLANVTGFSLLSGLAGGLETLSGQAYGAGQFQKLGVYFFSAAMSLILVCPPVCI  120

Query  1231  LWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSA  1052
             LW+F DKFL  +GQDP+IS EA KY +WLI A+   AIL+ LVR+LQ QSL++ MLLSS 
Sbjct  121   LWIFTDKFLERMGQDPVISLEARKYLMWLIPALLGGAILKPLVRFLQTQSLMLAMLLSSF  180

Query  1051  LSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDS  872
             L LCFHIP+CW L ++  LGS G ALA  +S W NV+LL  Y+ +SS+CE++RV    D+
Sbjct  181   LVLCFHIPLCWILVYKLELGSVGAALAFSISTWLNVMLLGFYMVFSSACERTRVRFTKDA  240

Query  871   FARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPF  692
             F  + EFFR  +PSA M CL+WW+ E+++L    LPNP++ETSVLSICL I +LHF +P+
Sbjct  241   FHGILEFFRYGVPSAVMICLKWWSCELLMLSSAFLPNPKLETSVLSICLTISTLHFTVPY  300

Query  691   SIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETE  512
               GA ASTR+SNELGAG  + AR+AV  +  + +IE V+    L   R V+GYA+SNE +
Sbjct  301   GFGAAASTRVSNELGAGKPNRARVAVLAILSLAIIEAVIVGTTLFCCRHVLGYAYSNEKQ  360

Query  511   VVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFL  332
             VV YI  M  L+ L +  D I  +LSGVARGSGWQ +GAYVN+GA+YL+G P   +LGF+
Sbjct  361   VVHYIGVMTSLICLSIFMDSIQAVLSGVARGSGWQRIGAYVNIGAFYLIGLPVGLVLGFV  420

Query  331   TSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL-NDSHPPAVDN  170
               LR  GLW+G+   + VQ+ +L+LIT  T+W+KQ ++A++R+   + H    D 
Sbjct  421   LHLRAKGLWIGIISGTAVQSALLSLITGATNWQKQANEAKKRIFAQNPHQEQCDQ  475



>ref|XP_006388323.1| hypothetical protein POPTR_0229s00240g [Populus trichocarpa]
 gb|ERP47237.1| hypothetical protein POPTR_0229s00240g [Populus trichocarpa]
Length=462

 Score =   483 bits (1242),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 249/470 (53%), Positives = 326/470 (69%), Gaps = 24/470 (5%)
 Frame = -2

Query  1576  SEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVA  1397
             +E+R  A+ +   F+ EL K+  IA PM+VVTV   ++  VS MM GH+ ELSLSG ++ 
Sbjct  9     TEERTRASTT---FVEELTKVTYIAAPMVVVTVSLHLLQVVSLMMAGHLGELSLSGVSIG  65

Query  1396  TSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFM  1217
              SF  VTGFSL+FG+A  LETLCGQAYGAGQY K GTYTY AI+SL  + +P+SILW+FM
Sbjct  66    GSFAGVTGFSLLFGLAGGLETLCGQAYGAGQYQKFGTYTYCAIISLLPICVPVSILWIFM  125

Query  1216  DKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCF  1037
             D+ LI +GQDP IS  A +Y+  LI A+F YA+LQ L+RY Q QSLI+PML S+  +LC 
Sbjct  126   DRILIAIGQDPEISTVACRYATCLIPALFAYAVLQSLLRYYQSQSLILPMLFSTCATLCV  185

Query  1036  HIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVG  857
             HIP+CWAL F+  LGS G ALAI +SYW NV+ L +Y+ +SSSC+K+RV  WN  F+ + 
Sbjct  186   HIPLCWALIFKWELGSTGAALAIDVSYWLNVVFLALYMGFSSSCKKTRVIYWNHIFSSIK  245

Query  856   EFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAG  677
             EFFR A+PSA M CLEWWTFE++ILL GLLP+ Q+ETSVLSIC                 
Sbjct  246   EFFRFALPSAVMVCLEWWTFELLILLAGLLPDSQLETSVLSIC-----------------  288

Query  676   ASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYI  497
                ++SN LGAGN   A++ V  V  I ++E V+ +  +   R V GYAFSNE  VVDY+
Sbjct  289   --AQVSNHLGAGNHKAAQVVVRAVLSISLVEAVIVSTNIFCFRHVFGYAFSNEKVVVDYV  346

Query  496   KKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRG  317
              ++ PL+ L ++ D +  +LSG+ARG GWQH+GAY+NLGAYY  G P A +L F+  LRG
Sbjct  347   TEVAPLLCLSVIVDSLQTVLSGIARGCGWQHIGAYINLGAYYFAGIPVAILLCFILHLRG  406

Query  316   MGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
              GLW+G+   S VQ  +L LIT  T+WKKQ +KA+ER+L+ +   + DNG
Sbjct  407   KGLWIGVLTGSTVQATLLGLITSLTNWKKQATKARERMLDGT--ASADNG  454



>gb|KHN27482.1| MATE efflux family protein 9 [Glycine soja]
Length=447

 Score =   482 bits (1241),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 228/440 (52%), Positives = 320/440 (73%), Gaps = 1/440 (0%)
 Frame = -2

Query  1507  IAIPMLVVTVCQQMVIFVSTMMLGHISEL-SLSGGAVATSFTNVTGFSLIFGMASALETL  1331
             +A PM+ VTV Q ++  VS MM+GH+  L S SG A+ATSF  VTGFS++ GM+ ALETL
Sbjct  1     MAAPMVAVTVSQYLLQVVSLMMVGHLGILVSFSGVAIATSFAEVTGFSVLLGMSGALETL  60

Query  1330  CGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSV  1151
             CGQ YGA +Y K G Y + AI++LT+V +PIS++W+F DK L+   QDP IS  A +Y +
Sbjct  61    CGQTYGAEEYRKFGNYIWCAIVTLTLVCLPISLVWIFTDKILMLFSQDPEISHAAREYCI  120

Query  1150  WLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALA  971
             +LI A+F +A+LQ L RY Q QS+I PM+ SS  +LC H+P+CW L F+ GL   G ALA
Sbjct  121   YLIPALFGHAVLQALTRYFQTQSMIFPMVFSSITALCLHVPICWGLVFKLGLRHIGAALA  180

Query  970   IGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEI  791
             IG+SYW NV+ L +Y+ +S +C+K+++   +++   + EF +LAIPS  M C EWW+FE+
Sbjct  181   IGVSYWLNVVWLAIYMIFSPACQKTKIVFSSNALLSIPEFLKLAIPSGLMFCFEWWSFEV  240

Query  790   VILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVW  611
             + LL G+LPNPQ+ET+VLS+CL   +LH++IP+++GA ASTR+SNELGAGN   A+ AV 
Sbjct  241   LTLLAGILPNPQLETAVLSVCLNTTTLHYFIPYAVGASASTRVSNELGAGNPKTAKGAVR  300

Query  610   GVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSG  431
              V I+G+ E V+ + V +S R V+GYA+SN+ EV+DY+ +M PL+ + + +D + G LSG
Sbjct  301   VVVILGVAEAVIVSSVFISCRHVLGYAYSNDKEVIDYVAEMAPLLCVSVTADSLIGALSG  360

Query  430   VARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALIT  251
             +ARG G+Q +GAYVNLGAYYLVG P   +LGF   LR  GLWMG    SL Q ++LA++T
Sbjct  361   IARGGGFQEIGAYVNLGAYYLVGIPMGLLLGFHLQLRAKGLWMGTLSGSLTQVIILAIVT  420

Query  250   IFTDWKKQESKAQERLLNDS  191
               TDW K+ +KA+ER++ +S
Sbjct  421   ALTDWHKEATKARERVVENS  440



>emb|CBI33603.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   484 bits (1245),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/442 (56%), Positives = 332/442 (75%), Gaps = 2/442 (0%)
 Frame = -2

Query  1495  MLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAY  1316
             M+V TV Q ++   S +M+GH+ ++SLS  A+AT+ TNVTGFSL+ G+A  LETLCGQAY
Sbjct  1     MVVATVSQYLLQVASVVMVGHLGQVSLSAVAIATALTNVTGFSLLSGLAGGLETLCGQAY  60

Query  1315  GAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISA  1136
             GA QY KLG YTY A +SL  V +PI +LW+FMDK LI +GQDPLI+ EA  YS+WLI  
Sbjct  61    GAHQYGKLGIYTYSATISLAFVCLPICLLWIFMDKLLILIGQDPLIAHEARNYSIWLIPG  120

Query  1135  IFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSY  956
             ++  AIL+ LVRYLQ QSLI PML+SS + L  HIP+CW+L F+  LG+ G A+AI +S 
Sbjct  121   LYGSAILKPLVRYLQTQSLIFPMLISSLIILGLHIPICWSLVFKLELGNVGAAVAISISS  180

Query  955   WFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLG  776
             W NV+LLV+YVKYSS+CEK+R+    D+F  +GEFF  A+P+A M CL+WW+ E++ LL 
Sbjct  181   WLNVVLLVLYVKYSSACEKTRMSFSKDAFFVMGEFFHFAVPAAVMVCLKWWSCELLTLLS  240

Query  775   GLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTII  596
             GLLPNP++E+S+L+ICL I +LHF IP+ +GA ASTR+SNELGAGN   AR+AVW V  +
Sbjct  241   GLLPNPKLESSILAICLTITTLHFTIPYGLGAVASTRVSNELGAGNPQAARVAVWAVMFL  300

Query  595   GMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGS  416
              +IE  V +  L   R V+GYA+S++ ++VD +  M PL+ L +V D I G+LSGVARGS
Sbjct  301   AIIETTVVSTTLFCCRYVLGYAYSSDKQIVDNVAVMAPLICLSIVMDSIQGVLSGVARGS  360

Query  415   GWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDW  236
             GWQH+GAY+NLGA+Y+VG P A +LGF+  L+  GLW+G+   S+VQ+ +L++IT FT+W
Sbjct  361   GWQHIGAYINLGAFYVVGLPVAIILGFVVHLKAKGLWIGIVTGSVVQSTLLSIITGFTNW  420

Query  235   KKQESKAQERLLNDSHPPAVDN  170
             KKQ +KA+ER+     P +V+N
Sbjct  421   KKQANKARERIFEG--PSSVEN  440



>ref|XP_007019868.1| MATE efflux family protein, putative [Theobroma cacao]
 gb|EOY17093.1| MATE efflux family protein, putative [Theobroma cacao]
Length=523

 Score =   484 bits (1247),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 247/451 (55%), Positives = 327/451 (73%), Gaps = 1/451 (0%)
 Frame = -2

Query  1540  VFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLI  1361
             V L ELKK+  IA PM+ VTV Q ++  VS MM+GH+ ELSLSG ++ATSFT VTGF  +
Sbjct  7     VSLKELKKIGCIAAPMVAVTVLQHLLQVVSIMMVGHLGELSLSGVSIATSFTIVTGFCFL  66

Query  1360  FGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPL  1181
             FGM+ ALET+CGQAYGA QY  LGTYTY AI++L +V  PIS+LWVF DK LI VGQD  
Sbjct  67    FGMSGALETICGQAYGAEQYQSLGTYTYCAIINLVLVCFPISVLWVFTDKILILVGQDHS  126

Query  1180  ISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRS  1001
             IS  A +Y+++LI A+F YAILQ +VRY Q QSLI+PML +S ++LCFH+P CW L F+ 
Sbjct  127   ISHVAHRYALFLIPALFGYAILQAMVRYFQTQSLILPMLFTSLVALCFHVPFCWTLVFKL  186

Query  1000  GLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL-WNDSFARVGEFFRLAIPSAS  824
             GLG+ G A++I LS W NVI L  Y+KYSS C+K+R  L   D       FFR A+PSA+
Sbjct  187   GLGTIGAAISIALSTWLNVIWLGFYMKYSSKCDKTRSALSIKDVIKSSRVFFRFAVPSAA  246

Query  823   MACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGA  644
             M CLEWW  E++I L GLLPNP++ETSVLSIC     LH++IP+ IGA  STR++NELGA
Sbjct  247   MVCLEWWASEVLIFLSGLLPNPKLETSVLSICFSFTYLHYFIPYGIGAIGSTRVANELGA  306

Query  643   GNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLML  464
             GN + A+++V  VT+I ++E V+ +  L   R V+GYAFS+E EVV+ +  M+P++S+ +
Sbjct  307   GNPEAAKLSVLVVTVIAVVEAVIVSTTLFFCRHVLGYAFSSEKEVVNRVADMVPIMSVAV  366

Query  463   VSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLAS  284
             ++D +  +LSGVARG GWQ+  A VNLGAYYL GAP A +L F+   +  GL +GL    
Sbjct  367   ITDCLQAVLSGVARGCGWQNTAALVNLGAYYLFGAPLAAVLAFVLHFKAKGLLIGLTSGV  426

Query  283   LVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              +Q +V  LITIFT+W+KQ S+A++R+L + 
Sbjct  427   ALQVIVFGLITIFTNWQKQASRARKRMLEED  457



>ref|XP_004300942.1| PREDICTED: MATE efflux family protein 7-like [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   483 bits (1242),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/457 (54%), Positives = 331/457 (72%), Gaps = 0/457 (0%)
 Frame = -2

Query  1549  SKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGF  1370
             S  +F  E+K+L  +A PM+ V + Q MV  VS MM+GH+ EL+LS  A++ SF+ VTGF
Sbjct  21    SWGLFFEEVKRLGCLAGPMVAVLLSQYMVQVVSMMMVGHLGELALSSTALSISFSGVTGF  80

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             SL+ GMASALETL GQAYGA QY K+G  TY AI+SLTVV +P+S++W+++D  L+F+GQ
Sbjct  81    SLLLGMASALETLSGQAYGAEQYEKVGLQTYTAIVSLTVVCLPLSLIWIYIDDILMFMGQ  140

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DP IS EAGK+++WL+ A+F YA LQ L RY Q QSLI+PMLLSS  ++ FHIP+CWAL 
Sbjct  141   DPEISREAGKFTLWLLPALFSYATLQPLNRYFQTQSLIIPMLLSSLATILFHIPLCWALV  200

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F+SGL S G ALA+ +S+WFN I+L +++K+SS+C K+RV +  + F  + EFFR AIPS
Sbjct  201   FKSGLASLGGALAMSISFWFNAIILGLFMKFSSACSKTRVPISMELFYGMREFFRFAIPS  260

Query  829   ASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNEL  650
             A M CLEWW+FE++ILL GLLPNP +ETSVLS+CL   +  + IP+  GA ASTR+SNEL
Sbjct  261   AVMICLEWWSFELLILLSGLLPNPVLETSVLSVCLQTIATLYSIPYGFGAAASTRVSNEL  320

Query  649   GAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSL  470
             GAGN   AR+A      + + E  +   +L + R+V GY FSN  +V+DY+  M PLV L
Sbjct  321   GAGNPKAARIATHAAMFLALTEATIITTILFACRNVFGYTFSNARDVIDYVTTMAPLVCL  380

Query  469   MLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNL  290
              ++ D   G+LSG++RG GWQH+GAY+NLGA+YL G P A  L F   LRG GLW+G+ +
Sbjct  381   SVLLDSFQGVLSGISRGCGWQHIGAYINLGAFYLCGIPVAATLAFWVQLRGRGLWIGIQV  440

Query  289   ASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPA  179
              +LVQ  +LA++   T+W+KQ SKA+ER+   S   A
Sbjct  441   GALVQTTLLAIVATRTNWEKQASKARERIFEASDEEA  477



>emb|CDY50254.1| BnaC07g47890D [Brassica napus]
 emb|CDY27886.1| BnaA07g04760D [Brassica napus]
Length=483

 Score =   483 bits (1242),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 244/472 (52%), Positives = 325/472 (69%), Gaps = 9/472 (2%)
 Frame = -2

Query  1591  EVPLLSEK--------RPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLG  1436
             E PLL E         +P      D F AELK ++R+A PM  VTV Q ++  +S M+ G
Sbjct  2     EDPLLPEDEQCTTGNPKPTPTWPID-FTAELKNVSRMAAPMATVTVAQFLLPLISVMVAG  60

Query  1435  HISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLT  1256
             H  EL LSG A+ATSF NV+GFS++FG+  ALETLCGQAYGA QY KLGT+TY AI S  
Sbjct  61    HRGELQLSGVALATSFANVSGFSIMFGLVGALETLCGQAYGAKQYSKLGTFTYSAIASNV  120

Query  1255  VVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLI  1076
              + + ISILW++MDK LI +GQD  IS  AG Y+VWLI  +F  A+ Q + R+LQ Q L+
Sbjct  121   PICVLISILWIYMDKLLISIGQDHDISKVAGSYAVWLIPGLFAQAVQQPVTRFLQTQGLV  180

Query  1075  VPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKS  896
             +P+L  +  +L FHIPVCW L +  GLGS G ALAI LSYWFNV+ L  YV++SSSCEK+
Sbjct  181   LPLLYCALSTLLFHIPVCWILVYTFGLGSNGAALAISLSYWFNVLSLACYVRFSSSCEKT  240

Query  895   RVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMIC  716
             R  + +D  + V +FF+  IPSA+M CLEWW FE++IL  GLLPNP++ETSVLS+CL   
Sbjct  241   RGFVSDDFVSGVKQFFQYGIPSAAMTCLEWWLFELLILSSGLLPNPKLETSVLSVCLSTG  300

Query  715   SLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVG  536
             SLH+ IP  I A  STRI+NELGAGN ++AR+AV+    + ++E  + + +L   R++ G
Sbjct  301   SLHYVIPMGIAAAVSTRIANELGAGNPEVARLAVFAGICLWLLEAAICSTILFISRNIFG  360

Query  535   YAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAP  356
             YAFSN  EVVDY+ ++ PL+ L  + DG S +L GVARGSGWQH+GA+ N+ AYYL+GAP
Sbjct  361   YAFSNSKEVVDYVTELAPLLCLSFIVDGFSAVLGGVARGSGWQHIGAWANVVAYYLIGAP  420

Query  355   AAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
                 L F   + G GLW+G+   S  Q ++LA++T    W +Q SKA++R++
Sbjct  421   VGLFLAFWCHMNGKGLWIGVIFGSSSQGIILAIVTACMSWNEQASKARKRIV  472



>ref|XP_006418608.1| hypothetical protein EUTSA_v10002904mg [Eutrema salsugineum]
 gb|ESQ37044.1| hypothetical protein EUTSA_v10002904mg [Eutrema salsugineum]
Length=483

 Score =   483 bits (1242),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 236/446 (53%), Positives = 319/446 (72%), Gaps = 0/446 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F AE+K ++ +A PM  VTV Q ++  +S M+ GH  EL LSG A+ATSF NV+GFS++ 
Sbjct  27    FTAEMKNVSCMAAPMATVTVAQYLLPLISIMVAGHRGELQLSGVALATSFANVSGFSIMA  86

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             G+  ALETLCGQAYGA +Y K+GTYTY AI S   +   ISI+W++M+K LI +GQDP I
Sbjct  87    GLVGALETLCGQAYGAKRYAKMGTYTYSAIASNVPICFLISIVWIYMEKLLISIGQDPEI  146

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S  AG Y+VWLI A+F  A+ Q L R+LQ Q L++P+L  +  +L F+IPVCW L F  G
Sbjct  147   SKLAGSYAVWLIPALFAQAVQQPLTRFLQTQGLVIPLLYCALTTLLFYIPVCWTLVFTFG  206

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             LGS G ALAI LSYWFNV++L VYV++SSSCEK+R  + +D  + V +FF   IPSA+M 
Sbjct  207   LGSNGAALAISLSYWFNVLILAVYVRFSSSCEKTRSFVSHDFVSGVKQFFHYGIPSAAMT  266

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW FE++IL  GLLPNP++ETSVLS+CL I SLH+ IP  I A ASTRISNELGAGN
Sbjct  267   CLEWWLFELLILSSGLLPNPKLETSVLSVCLTIGSLHYVIPMGIAASASTRISNELGAGN  326

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
               +AR+AV+    + +++  + + +L + R++ GYAFSN  EVVDY+ ++  L+ L  + 
Sbjct  327   PKVARLAVFAGICLWLLKATICSTILFTFRNIFGYAFSNSKEVVDYVTELSHLLCLSFIV  386

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             DG S +L GVARGSGWQH+GA+ N+ AYYL+GAP    LGF   + G GLW+G+   S  
Sbjct  387   DGFSAVLGGVARGSGWQHIGAWANVVAYYLIGAPVGLFLGFWCHMNGKGLWIGVIFGSTA  446

Query  277   QNVVLALITIFTDWKKQESKAQERLL  200
             Q ++LA++T    W +Q +KA++R++
Sbjct  447   QGIILAIVTACMSWNEQAAKARKRIV  472



>ref|XP_006420459.1| hypothetical protein CICLE_v10006745mg [Citrus clementina]
 gb|ESR33699.1| hypothetical protein CICLE_v10006745mg [Citrus clementina]
Length=476

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 237/466 (51%), Positives = 321/466 (69%), Gaps = 4/466 (1%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             M+  + +  E   + + + D+   E+KK   IA PM+ VT+ Q ++  VS MM+GH+ +L
Sbjct  1     MEESLLIPKESLSSTSTTWDLLSGEVKKQGYIAAPMVAVTLSQYLLQVVSMMMVGHLGQL  60

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             +LS  A+A S  +VTGFS+  GMASALETLCGQA+GA QY ++GT  Y AI  L +V  P
Sbjct  61    ALSSTAMAISLASVTGFSVRLGMASALETLCGQAHGAQQYQRIGTQIYTAIFCLFLVCFP  120

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             +S L ++M + L+ VGQDP IS E GK+ +WL+ A+F YA +Q L+RY Q QSLI+PM L
Sbjct  121   LSFLGIYMGRLLVLVGQDPQISHEVGKFIIWLLPALFAYAAMQALIRYFQSQSLIIPMFL  180

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS  SLC HIP+CW L F+SGLG+ G ALAIG+SYW NV  L +Y+K+S++C +SR  + 
Sbjct  181   SSYASLCLHIPICWGLVFKSGLGNLGGALAIGISYWLNVTFLAIYMKFSTACAESRAPIS  240

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              + F  +GEFF  AIPSA M CLEWW+FE++IL+ GLLPNPQ+ETSVLS+CL        
Sbjct  241   MELFRGIGEFFHFAIPSAVMVCLEWWSFELLILMSGLLPNPQLETSVLSVCLSTIQTLSA  300

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP  +     TR+SNELGAGN   AR+AV+ V  + ++E ++ +  L + R V GY FSN
Sbjct  301   IPMDL--VLHTRVSNELGAGNVQRARVAVYAVVFMAVMETIIVSASLFASRRVFGYVFSN  358

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E +VVDY+  M PLV L ++ D + G+ SGVARG GWQ++ A+VNLGAYYL G P A +L
Sbjct  359   EGQVVDYVTTMAPLVCLSVIMDSLQGVFSGVARGCGWQNIAAFVNLGAYYLCGVPTAAIL  418

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERL  203
             GF    RG GLW+G+   +  Q ++L +IT FTDW+K   KA++RL
Sbjct  419   GFWLKSRGRGLWIGIQAGAFTQTLLLGIITTFTDWEKH--KARKRL  462



>ref|XP_011035133.1| PREDICTED: MATE efflux family protein 9-like [Populus euphratica]
Length=475

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 248/453 (55%), Positives = 326/453 (72%), Gaps = 0/453 (0%)
 Frame = -2

Query  1555  AISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVT  1376
             AI+ + F+ EL+K   IA PM+ V+V Q ++  VS +++GH+  L+LS  A+ATS TNVT
Sbjct  13    AITWEGFVQELRKAGYIAAPMVAVSVLQYLLQVVSVIIVGHLGALALSSAAIATSITNVT  72

Query  1375  GFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFV  1196
             GFSL+ GMA  LETL GQAYGA QY KLGTYTY AI+SL ++  PI +LW+FM K L  +
Sbjct  73    GFSLLSGMAGGLETLAGQAYGAKQYQKLGTYTYSAIISLIIMCPPICVLWIFMGKLLPLL  132

Query  1195  GQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWA  1016
             GQD LIS EA KYS+W+I A+F  A+L+ L RYLQ QS+I+PML++S+  LCFH   CW 
Sbjct  133   GQDTLISQEACKYSMWVIPALFGGAVLKPLTRYLQTQSVILPMLITSSSILCFHTISCWI  192

Query  1015  LSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAI  836
             L ++  LG  G A+A  LS W NVILL +YVK+SS+CEK+R  L  ++   +GEFF+L +
Sbjct  193   LVYKLQLGQKGAAIAFSLSTWLNVILLSLYVKFSSACEKTRAPLSREALYGIGEFFQLGV  252

Query  835   PSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISN  656
             PSA M CL+WW+ E++ILL GL  NP++ETSVLSICL I +LHF IP+  GA ASTR+SN
Sbjct  253   PSAIMVCLKWWSMELLILLSGLFKNPKLETSVLSICLTISTLHFTIPYGFGAAASTRVSN  312

Query  655   ELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLV  476
             ELGAGN  LARMAV     +   E V+ +  L+  R V+GYA+SN+ +VV YI  M PL+
Sbjct  313   ELGAGNPQLARMAVQVALFLAGTESVIVSSGLLLSRQVLGYAYSNDRQVVRYISVMTPLI  372

Query  475   SLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGL  296
              L  + D +  +LSGVARGSGWQ +GAY+NLG++YLVG P A +LGF   LRG GLW+G+
Sbjct  373   CLSFIMDSLQAVLSGVARGSGWQKIGAYINLGSFYLVGLPLAAVLGFGAHLRGKGLWIGI  432

Query  295   NLASLVQNVVLALITIFTDWKKQESKAQERLLN  197
                S  Q+V+L+++T  TDW KQ  KA+ER+L 
Sbjct  433   LAGSFAQSVLLSIVTACTDWNKQVVKARERVLE  465



>emb|CBI26943.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   481 bits (1238),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 241/443 (54%), Positives = 322/443 (73%), Gaps = 2/443 (0%)
 Frame = -2

Query  1495  MLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAY  1316
             M+ V + Q ++  +S MM+GH+ EL+LS  A+A S + VTGFS + GMASALETLCGQAY
Sbjct  1     MVAVILSQYLLQVISLMMVGHLGELALSSTAIAISLSGVTGFSFLLGMASALETLCGQAY  60

Query  1315  GAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISA  1136
             GA QYHKLGT TY AI+SL +V +P++++W++M K L F+GQDP+IS EAG++S+WL+ A
Sbjct  61    GAEQYHKLGTQTYTAIVSLLLVCLPLAVIWLYMSKLLTFIGQDPVISHEAGQFSIWLVPA  120

Query  1135  IFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSY  956
             +F YA LQ LVRYLQ QSLI+P+LL+S   L FHIP+CWAL F+SGLGS G ALAIG+SY
Sbjct  121   LFGYATLQALVRYLQTQSLIMPLLLTSCAILGFHIPLCWALVFKSGLGSLGGALAIGISY  180

Query  955   WFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLG  776
             W NVI L +Y+KYS +CEK+RV +  +    +GEFFR AIPSA M CLEWW+FE++ILL 
Sbjct  181   WLNVIFLGLYIKYSPACEKTRVPVSMEILGGIGEFFRFAIPSAVMICLEWWSFELLILLS  240

Query  775   GLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTII  596
             GLLPNP++E SVLS+CL   S  + IP  +G+  STR+SNELGAGN   AR+AV     +
Sbjct  241   GLLPNPELEASVLSVCLNTVSTLYAIPHGLGSAGSTRVSNELGAGNPQKARLAVHAAVCL  300

Query  595   GMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGS  416
              + E +V +  L   R V GY FS E EVVDY+  + P + L ++ D + G LSGV RG 
Sbjct  301   AVTEAIVISTTLFVSRRVFGYVFSEEEEVVDYVTNIAPFLCLSVILDSVQGTLSGVVRGC  360

Query  415   GWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDW  236
             G Q +GA++NLGA+YL G P A +L F+  LRG GLW+GL   SL+Q  +L +IT  T+W
Sbjct  361   GRQRIGAFINLGAFYLCGIPVAVILAFVVHLRGKGLWVGLQTGSLLQTSLLLIITGCTNW  420

Query  235   KKQESKAQERLLNDSHPPAVDNG  167
             ++Q +KA++R+   +   +V+NG
Sbjct  421   EEQATKARQRIFEGT--SSVENG  441



>ref|XP_002305842.2| hypothetical protein POPTR_0004s09390g [Populus trichocarpa]
 gb|EEE86353.2| hypothetical protein POPTR_0004s09390g [Populus trichocarpa]
Length=478

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 323/460 (70%), Gaps = 8/460 (2%)
 Frame = -2

Query  1591  EVPL-LSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSL  1415
             E PL  +E+R  A+ +   F+ ELKK+  IA PM+VVTV   ++  VS MM GH+ ELSL
Sbjct  3     EAPLPNTEERTRASTT---FVEELKKVTYIAAPMVVVTVSLHLLQVVSLMMAGHLGELSL  59

Query  1414  SGGAVATSFTNVTGF----SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVA  1247
             SG ++  SF  VTGF    ++ FG+A  LETLCGQAYGAGQY K GTYTY AI+SL  + 
Sbjct  60    SGVSIGGSFAGVTGFMYLHTMQFGLAGGLETLCGQAYGAGQYQKFGTYTYCAIISLLPIC  119

Query  1246  IPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPM  1067
             +P+SILW+FMD+ LI +GQDP IS  A +Y+  LI A+F YA+LQ L+RY Q Q LI+PM
Sbjct  120   VPVSILWIFMDRILIAIGQDPEISTVACRYATCLIPALFAYAVLQSLLRYYQSQGLILPM  179

Query  1066  LLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVC  887
             L S+  +LCFHIP+CWAL F+  LGS G ALAI +SYW NV+ L +Y+ +SSSC+K+RV 
Sbjct  180   LFSTCATLCFHIPLCWALIFKWELGSTGAALAIDVSYWLNVVFLALYMGFSSSCKKTRVI  239

Query  886   LWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLH  707
              WN  F+ + EFFR A+PSA M CLEWWTFE++ILL GLLP+ Q+ETSVLSICL   SLH
Sbjct  240   YWNHIFSSIKEFFRFALPSAVMVCLEWWTFELLILLAGLLPDSQLETSVLSICLATTSLH  299

Query  706   FYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAF  527
             FY    I A  S ++SN LGAGN   A++ V  V  I ++E V+ +  +   R V GYAF
Sbjct  300   FYALSGIAAAGSAQVSNHLGAGNDKAAQVVVRAVLSISLVEAVIVSTNIFCFRHVFGYAF  359

Query  526   SNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAG  347
             SNE  VVDY+ ++ PL+ L ++ D +  +LSG+ARG GWQH+GA +NLGAYY  G P A 
Sbjct  360   SNEKVVVDYVTEVAPLLCLSVIVDSLQTVLSGIARGCGWQHIGASINLGAYYFAGIPVAI  419

Query  346   MLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQ  227
             +L F+  LRG GLW+G+   S VQ  +L LIT  T+WKKQ
Sbjct  420   LLCFIFHLRGKGLWIGVLTGSTVQATLLGLITSLTNWKKQ  459



>ref|XP_007142996.1| hypothetical protein PHAVU_007G034900g [Phaseolus vulgaris]
 gb|ESW14990.1| hypothetical protein PHAVU_007G034900g [Phaseolus vulgaris]
Length=477

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 250/476 (53%), Positives = 330/476 (69%), Gaps = 3/476 (1%)
 Frame = -2

Query  1591  EVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHIS-ELSL  1415
             E  LL++      ++ D F  E+KK+  IA PM +VTV Q ++  VS MM+GH++ EL L
Sbjct  2     EDNLLAKGSEKQKVTWDGFGEEMKKIFWIAGPMAIVTVSQSLLQVVSLMMVGHLADELYL  61

Query  1414  SGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPIS  1235
             SG A+A S   VTGFS+I GMAS LET+CGQAYGA QY K G  TY AI SLT+V +P++
Sbjct  62    SGAALAISLAAVTGFSVITGMASGLETICGQAYGAQQYKKFGVQTYSAIFSLTIVCLPLT  121

Query  1234  ILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSS  1055
              +W+ M+K L+ +GQDPLI+ EAGK+ +WL+ A+F YAI+  +VRY QMQSL +PML  S
Sbjct  122   FIWINMEKILVSIGQDPLIAHEAGKFLIWLLPALFAYAIMGPIVRYFQMQSLTLPMLGIS  181

Query  1054  ALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWND  875
              ++LC HIP+CWAL F++ L + G ALA+ +S W NVI L +Y++YS +C K+R  +  +
Sbjct  182   CVTLCIHIPLCWALVFKTALNNIGGALAMSISLWLNVIFLGLYMRYSPACAKTRAPITME  241

Query  874   SFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIP  695
              F  + EF R AIPSA M C+EWW+FE++ILL GLLPNPQ+ETSVLS+CL   S  F IP
Sbjct  242   LFQGIWEFLRFAIPSAVMICMEWWSFELLILLSGLLPNPQLETSVLSVCLNTISTLFAIP  301

Query  694   FSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNET  515
               I A ASTRISNELGAGN   AR+A+ G     ++E  V +  L   R V GY FSNE 
Sbjct  302   LGISAAASTRISNELGAGNPHAARVAMLGAISFAIMEATVVSGTLFFCRRVFGYVFSNEK  361

Query  514   EVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGF  335
             EVVDY+  M PLV + ++ D + G+LSGVARG GWQH+G YVNLGA+YL G P A  L F
Sbjct  362   EVVDYVTAMAPLVCISVILDSVQGVLSGVARGCGWQHIGVYVNLGAFYLCGIPVAASLAF  421

Query  334   LTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             L  +RG GLW+G+ + + VQ ++L+ IT   DW++Q  KA++RL N     + DNG
Sbjct  422   LAKMRGKGLWIGVQVGAFVQCILLSTITSCIDWEQQAMKAKKRLFNSE--ISADNG  475



>ref|XP_004232019.2| PREDICTED: MATE efflux family protein DTX1-like [Solanum lycopersicum]
Length=507

 Score =   483 bits (1243),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 235/447 (53%), Positives = 325/447 (73%), Gaps = 0/447 (0%)
 Frame = -2

Query  1543  DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSL  1364
             + +  ELKKL+ IA PM+ V+V Q ++  VS MM+GH+ ++SLS  +VATS TNVTGFSL
Sbjct  57    ETYCQELKKLSYIAAPMVAVSVLQYLLQVVSMMMVGHLDQISLSSVSVATSITNVTGFSL  116

Query  1363  IFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDP  1184
             + G+   LETL GQAYGA Q+ K+GTYT+ A++SL +V IPIS++W+FMDK LI +GQDP
Sbjct  117   LSGLVGGLETLSGQAYGANQWQKVGTYTHSAVISLLIVCIPISVVWLFMDKLLILMGQDP  176

Query  1183  LISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFR  1004
             +IS EA K+S+WLI A+F  AIL+ L+RYL +QSLI PM++S+ L+LC HI + W   F 
Sbjct  177   VISVEAYKFSLWLIPALFGSAILRPLLRYLLIQSLIFPMVVSAFLALCLHISLSWLFIFH  236

Query  1003  SGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSAS  824
              GLG +G A+A   S W  V  LVVY+  SSSCE++R  L  D+F  +G+FFR A PSA 
Sbjct  237   LGLGKSGAAIAFSFSIWTFVASLVVYISRSSSCERTRTPLNRDAFLAIGQFFRYATPSAL  296

Query  823   MACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGA  644
             M CL+WW+ E++ LL GLLPNP++ETSVLSICL I +LHF +P+ +G G STR+SNELG+
Sbjct  297   MVCLKWWSLEVLTLLSGLLPNPKLETSVLSICLTISALHFALPYGLGTGVSTRVSNELGS  356

Query  643   GNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLML  464
             GN   A +AV     + + E V+A++V+   R V+G A+SN+ +VVDY+ ++ P + L +
Sbjct  357   GNPQKALVAVRVAMFVAVSETVLASIVIFLCRGVLGKAYSNDEQVVDYVARITPFLCLTI  416

Query  463   VSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLAS  284
             ++D    ++ GVARGSGWQ +GAYVNLGA+YLVG P A ++ FL +L+  GLW+GL   S
Sbjct  417   ITDSFQAVICGVARGSGWQIIGAYVNLGAFYLVGIPVAAVMCFLVNLKSKGLWIGLLAGS  476

Query  283   LVQNVVLALITIFTDWKKQESKAQERL  203
              +Q   L+LI +FTDW+KQ   A++R+
Sbjct  477   TIQATSLSLILVFTDWQKQAINAKKRI  503



>gb|KHN19698.1| MATE efflux family protein 9 [Glycine soja]
Length=443

 Score =   480 bits (1235),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 230/440 (52%), Positives = 318/440 (72%), Gaps = 3/440 (1%)
 Frame = -2

Query  1507  IAIPMLVVTVCQQMVIFVSTMMLGHISEL-SLSGGAVATSFTNVTGFSLIFGMASALETL  1331
             +A PM+ VTV Q ++  VS MM+GH   L S SG A+ATSF  VTGFS++ GM+ ALETL
Sbjct  1     MAAPMVAVTVSQYLLQVVSLMMVGHFGILVSFSGVAIATSFAEVTGFSVLLGMSGALETL  60

Query  1330  CGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSV  1151
             CGQ YGA +Y K G YT+ AI++LT+V +PIS++W+F DK L+   QDP IS  A +Y +
Sbjct  61    CGQTYGAEEYRKFGNYTWCAIVTLTLVCLPISLVWIFTDKILLLFSQDPEISHAAREYCI  120

Query  1150  WLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALA  971
             +LI A+F +A+LQ L RY Q QS+I PM+ SS  +LC H+P+CW L F+ GL   G ALA
Sbjct  121   YLIPALFGHAVLQALTRYFQTQSMIFPMVFSSITALCLHVPICWGLVFKLGLRHIGAALA  180

Query  970   IGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEI  791
             IG+SYW NV+ L +Y+ YS +C+K+++   +++   + EF +LAIPS  M C EWW+FE+
Sbjct  181   IGVSYWLNVVWLAIYMIYSPACQKTKIVFSSNALLSIPEFLKLAIPSGLMFCFEWWSFEV  240

Query  790   VILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVW  611
             + LL G+LPNPQ+ET+VLSICL   +LH++IP+++GA ASTR+SNELGAGN   A+ AV 
Sbjct  241   LTLLAGILPNPQLETAVLSICLNTTTLHYFIPYAVGASASTRVSNELGAGNPKTAKGAVR  300

Query  610   GVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSG  431
              V I+G+ E  + + V +S R V+GYA+SN+ EV+DY+ +M PL  L + +D + G LSG
Sbjct  301   VVVILGVAEAAIVSTVFISCRHVLGYAYSNDKEVIDYVAEMAPL--LCVTADSLIGALSG  358

Query  430   VARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALIT  251
             +ARG G+Q +GAYVNLGAYYLVG P   +LGF   LR  GLWMG    SL Q ++LA++T
Sbjct  359   IARGGGFQEIGAYVNLGAYYLVGIPMGLLLGFHLQLRAKGLWMGTLSGSLTQVIILAIVT  418

Query  250   IFTDWKKQESKAQERLLNDS  191
                DW+K+ +KA+ER++ +S
Sbjct  419   ALIDWQKEATKARERVVENS  438



>gb|AES62852.2| MATE efflux family protein [Medicago truncatula]
Length=478

 Score =   481 bits (1239),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 244/470 (52%), Positives = 335/470 (71%), Gaps = 3/470 (1%)
 Frame = -2

Query  1591  EVPLLSEKRPAA---AISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             E  LL + R  A   +I+  VF  E+K +  +A+PM+ VT+ Q  +  +S MM+GH+ +L
Sbjct  2     EKGLLEKDREGAGSRSITWGVFFQEVKDVCFLALPMISVTLSQYFLQIISMMMVGHLGKL  61

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             SLS  A+A S   V+GFSL+FGM+ ALET CGQAYGA QY K G   Y AI+SL +  +P
Sbjct  62    SLSSTAIAISLCVVSGFSLLFGMSCALETQCGQAYGAKQYRKFGVQVYTAIISLIIACVP  121

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             +S+LW+ + K L  +GQDPLIS EAGK+++ +I A+F YA LQ LVRY  MQSL++P+++
Sbjct  122   LSLLWLNLGKLLSLLGQDPLISQEAGKFAMCMIPALFAYATLQALVRYFLMQSLVLPLVI  181

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS+++L FH+  CW L F+SGLGS G A +IG SYW NVI+L +Y+K+S+ CEK+R  + 
Sbjct  182   SSSVTLGFHVAFCWLLVFKSGLGSLGAAFSIGTSYWLNVIILGLYMKFSADCEKTRFTIS  241

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              +SF  +GEFFR AIPSA M C EWW+FE+++ L GLLPNPQ+ETSVLSICL I S  + 
Sbjct  242   MESFDGIGEFFRYAIPSAGMICFEWWSFELLVFLSGLLPNPQLETSVLSICLSIISTLYT  301

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP + G+ AS R+SN LGAG    AR++V+    I + E ++ + ++ + R V+GY FSN
Sbjct  302   IPEATGSAASARVSNALGAGCPHAARLSVYAAMAIAVSEAILVSSIIFASRRVLGYIFSN  361

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E +VVDY+  M PL+SL ++ D + G LSG+ARG GWQ LGAYVNLGAYY+ G P A +L
Sbjct  362   EQDVVDYVTDMAPLISLSVIVDSLHGTLSGIARGCGWQKLGAYVNLGAYYVFGIPIAVIL  421

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             GF   LRG GLW+G+ + +  Q V+L+LIT FT+W+KQ  KA+ER+  +S
Sbjct  422   GFWFELRGKGLWIGIIVGASCQAVLLSLITSFTNWEKQAIKARERIFQES  471



>ref|XP_006603047.1| PREDICTED: MATE efflux family protein 8-like [Glycine max]
Length=483

 Score =   481 bits (1238),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 231/473 (49%), Positives = 325/473 (69%), Gaps = 3/473 (1%)
 Frame = -2

Query  1600  MDAE--VPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHIS  1427
             MD E   PLL +   A     D F  ELK++  +A PML   +CQ ++  VS MM+GH+ 
Sbjct  2     MDKEEATPLLRKSEVAPLEDDDAFCVELKRVGSMAAPMLAANMCQYLLQVVSLMMVGHLG  61

Query  1426  EL-SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVV  1250
              L S SG A+A SF  VTGF ++ GMA ALETLCGQ YGA ++ ++G YT+ AI++L +V
Sbjct  62    LLVSFSGVAIAISFAEVTGFCVLMGMAGALETLCGQTYGAEEFTEIGNYTFCAIVTLLLV  121

Query  1249  AIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVP  1070
              +PIS+LW+FMDK L+  GQDP IS  A KY +  I A++ +A+LQC +RY Q QS+I P
Sbjct  122   CLPISLLWIFMDKILLLFGQDPEISHVAHKYCICSIPALYGFAVLQCQIRYFQTQSMIFP  181

Query  1069  MLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRV  890
             M+ SS   LC H+P+CW L F+ GLG  G A AIG+SYW NVI L +Y+ YS +CEK+++
Sbjct  182   MVFSSIAVLCLHVPICWGLVFKLGLGHVGAAYAIGISYWLNVIGLGIYMNYSPACEKTKI  241

Query  889   CLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSL  710
                 ++   + EF + AIPS  M C E W+FE++ L  GLLPNPQ++TSVLS+CL   +L
Sbjct  242   VFSFNALLSIPEFCQFAIPSGLMFCFEMWSFELLTLFAGLLPNPQLQTSVLSVCLNTTTL  301

Query  709   HFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYA  530
             H+ IP+++GA ASTRISNELGAGN   A+  V  V I+G+++ V+ +   +  R ++GYA
Sbjct  302   HYIIPYAVGASASTRISNELGAGNPKAAQGIVRVVVILGIVDGVIVSTFFVCCRHILGYA  361

Query  529   FSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAA  350
             +SN+ EVVDY+  ++P++     +D + G LSG+ARG G+Q +GAYVNLGAYYLVG P A
Sbjct  362   YSNDKEVVDYVSDIVPILCGSFTADSLIGALSGIARGGGFQQIGAYVNLGAYYLVGVPLA  421

Query  349   GMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              +LGF+      GLWMG    S++Q ++L ++T+ TDW+K+ +KA+ER++  S
Sbjct  422   FLLGFVLHFNAKGLWMGSLTGSVLQVIILTVVTVLTDWQKEATKARERIVEKS  474



>ref|XP_003555268.1| PREDICTED: MATE efflux family protein 7-like isoform X1 [Glycine 
max]
Length=555

 Score =   483 bits (1244),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 251/508 (49%), Positives = 345/508 (68%), Gaps = 10/508 (2%)
 Frame = -2

Query  1666  PHPFSS------KGAGGGDQRVNFLL--PEMDAEVPLLSEKRPAAAISKDVFLAELKKLA  1511
             PH FSS      +  GG    + F +  P   + +    E+     +   VF  E+K++ 
Sbjct  4     PHYFSSFLRKEEQPNGGRKMNLTFFVSSPFFPSFLAGTKEREAEYVMRWSVFGEEMKRVG  63

Query  1510  RIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMASALETL  1331
              +A PM+ VT+ Q  +  +S MM+GH+ +L LS  A+A S   V+GFSLIFGM+ ALET 
Sbjct  64    YLAGPMINVTLSQYFLQIISMMMVGHLGKLVLSSTAIAISLCAVSGFSLIFGMSCALETQ  123

Query  1330  CGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSV  1151
             CGQAYGA QY K G   Y AI+SLT+  +P+++LWV++ K LIF+GQDPLIS EAGK+++
Sbjct  124   CGQAYGAQQYRKFGVQIYTAIVSLTLACLPLTLLWVYLGKILIFLGQDPLISQEAGKFAL  183

Query  1150  WLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALA  971
              +I A+F YA LQ LVRY  MQSL  P+ +SS+++LCFH+  CW L F+ G G+ G A +
Sbjct  184   CMIPALFAYATLQALVRYFLMQSLTSPLFISSSITLCFHVAFCWLLVFKCGFGNLGAAFS  243

Query  970   IGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEI  791
             IG SYW NV+LL +Y+K+S+ CEK+RV +  + F  +GEFFR AIPSA M CLEWW+FE+
Sbjct  244   IGTSYWLNVVLLGLYMKFSTECEKTRVPISMELFHGIGEFFRCAIPSAGMICLEWWSFEL  303

Query  790   VILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVW  611
             + LL GLLPNP++ETSVLSICL + +  + IP +IG+ ASTR+SN LGAG+   A+++V 
Sbjct  304   LTLLSGLLPNPELETSVLSICLSVTTTIYTIPEAIGSAASTRVSNALGAGSPQSAQLSVS  363

Query  610   GVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSG  431
                 +     ++ + ++ + R VVGY FS+E +VVDY   M+PL+ L ++ D + G LSG
Sbjct  364   AAMTLAASAAILVSSIIFACRQVVGYVFSSELDVVDYFTDMVPLLCLSVILDTLHGTLSG  423

Query  430   VARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALIT  251
             +ARG GWQHLGAYVNLGAYY+VG P A MLGF   LRG GLW+G+   +  Q V+L+LIT
Sbjct  424   IARGCGWQHLGAYVNLGAYYVVGIPIAAMLGFWVQLRGKGLWIGILTGAFCQTVMLSLIT  483

Query  250   IFTDWKKQESKAQERLLNDSHPPAVDNG  167
               T+W+KQ  KA+ER    S   AV++G
Sbjct  484   SCTNWEKQAIKARERTFQRSF--AVEDG  509



>emb|CDP00710.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   480 bits (1236),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 246/469 (52%), Positives = 339/469 (72%), Gaps = 2/469 (0%)
 Frame = -2

Query  1591  EVPLLSEKRPAAA--ISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
             E  LL ++R   A  ++  +   E+K+L  +A PM+ VT+CQ ++  +S MM+GH+ ELS
Sbjct  2     EEGLLVKEREVKAERLTWGLIGQEMKRLCCVAGPMMAVTLCQFLLQVISLMMVGHLGELS  61

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LS  A+A S   VTGFSL+ GMASALETLCGQAYGA QY K GT+TY AI  L +V IP+
Sbjct  62    LSSSAIAISLCAVTGFSLLSGMASALETLCGQAYGAQQYQKFGTHTYTAIFCLLIVCIPL  121

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             SI+W+++ K L  +GQDPLIS +AG ++ WLI A+F YA LQ LVRY QMQSLI PML+S
Sbjct  122   SIIWMYLGKILALIGQDPLISHDAGIFATWLIPALFGYATLQPLVRYFQMQSLIFPMLIS  181

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             S +++ FHI +CW L + SGL + G ALA+G+S W NVI+L +Y+  SSSCEK+R  +  
Sbjct  182   SCITISFHILICWVLVYNSGLENHGAALAMGISMWLNVIILGLYMSCSSSCEKTRAPISG  241

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
             +    V EFFR AIPSA M CLEWW++E++IL  GLLPNPQ+ETSVLS+CL      + I
Sbjct  242   EVLYGVKEFFRFAIPSAVMLCLEWWSYELLILSSGLLPNPQLETSVLSVCLNTIITLYAI  301

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
             P+ + A  STR+SNELGAGN + AR++V GV ++ + E+++   VL + R V GY FS++
Sbjct  302   PYGLAAAVSTRVSNELGAGNPEGARVSVIGVLLLAVTEVIIVDAVLFASRHVFGYVFSSD  361

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
              +VVDY+  M PLV L ++ D + G+LS VARG GWQH+GAYVNL ++YLVG P+A +LG
Sbjct  362   RDVVDYVTTMAPLVCLSILMDSLQGILSAVARGCGWQHIGAYVNLASFYLVGIPSALILG  421

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             F+  +RG GLW+G+   + VQ+++L ++T+ T+W+KQ  KA+ERL  ++
Sbjct  422   FVVKIRGKGLWIGILSGATVQSLLLFIVTMCTNWEKQAIKARERLFQEN  470



>ref|XP_009358874.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=491

 Score =   481 bits (1237),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 236/449 (53%), Positives = 317/449 (71%), Gaps = 0/449 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F  ++K+L  IA PM+ V +   M+  +S  M+GH+ EL+LS  ++A S   +TGFSL  
Sbjct  39    FFEDVKRLGCIAGPMVAVVLSHFMLRLISVTMVGHLGELALSSSSIAFSLAGITGFSLFV  98

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
              +ASALETLCGQAYGA QY KLG  TY AI SL +V +P+S++W++M++ LIF GQDP+I
Sbjct  99    RVASALETLCGQAYGAEQYQKLGLETYTAIFSLNLVCLPLSLIWIYMEEILIFTGQDPVI  158

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAGK+ +WLI A+F YA L  LVRY Q QSL  PML+SS ++L  HIP+CWAL F+SG
Sbjct  159   SREAGKFIIWLIPALFAYATLHPLVRYFQAQSLTFPMLVSSVVTLLIHIPLCWALVFKSG  218

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             L   G ALAI +SYW N+ILL +Y+K+SS+C K+R  +  + F  +GEFFR +IPSA M 
Sbjct  219   LDHLGGALAISISYWLNLILLGMYMKFSSACSKTRAPISKEIFDGIGEFFRFSIPSALML  278

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW+FE++ILL GLLPNP +ETSVLS+CL   S  + IP+  GA  STR++NELGAGN
Sbjct  279   CLEWWSFELLILLSGLLPNPALETSVLSVCLQTISTLYAIPYGFGAAVSTRVANELGAGN  338

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
              + AR+A      +  IE  +    L + R + GY F  E +V+DY+  M PL+ L L+ 
Sbjct  339   PEGARLAARVAVFLAAIETSIETTTLFACRHIFGYIFIKEKDVIDYVIAMAPLICLSLIL  398

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D   G+L+GVARG+GWQH+GAY+NLGA+YL G P A +L FL   RG GLW+G+   S V
Sbjct  399   DSFQGVLTGVARGTGWQHIGAYINLGAFYLCGIPVAALLAFLVHQRGRGLWIGIQAGSFV  458

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDS  191
             Q ++L+L+TI T+W+KQ  KA+ER+   +
Sbjct  459   QTILLSLVTIRTNWEKQARKARERIFEKN  487



>ref|NP_001151913.1| LOC100285550 [Zea mays]
 gb|ACG44927.1| transparent testa 12 protein [Zea mays]
 tpg|DAA58082.1| TPA: putative MATE efflux family protein [Zea mays]
Length=487

 Score =   480 bits (1236),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 238/442 (54%), Positives = 318/442 (72%), Gaps = 1/442 (0%)
 Frame = -2

Query  1507  IAIPMLVVTVCQQMVIFVSTMMLGHISE-LSLSGGAVATSFTNVTGFSLIFGMASALETL  1331
             +A+PM+VV + Q  V   S MM+GH+   L LS  A+ATS  NV+GFSL+ GMASALETL
Sbjct  41    LALPMVVVNLSQYAVQVSSNMMVGHLPGVLPLSSAAIATSLANVSGFSLLIGMASALETL  100

Query  1330  CGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSV  1151
             CGQAYGA QYHKLG  TY A+++L VV +P+S+LWVFMDK L+ +GQDPLIS  AG+Y V
Sbjct  101   CGQAYGAKQYHKLGLDTYRAVVTLLVVCVPLSLLWVFMDKILVLIGQDPLISQGAGRYMV  160

Query  1150  WLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALA  971
             WLI  +F  A++Q L ++LQ QSLI P+LLSSA +   H+P+C+ + F++GLG  G AL 
Sbjct  161   WLIPGLFANAVIQPLTKFLQTQSLIYPLLLSSAATAAVHVPLCYVMVFKTGLGYTGAALT  220

Query  970   IGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEI  791
             I +SYW NV +LV Y+ +SSSC+++R     + F  V  F RLA+PSA M CLEWW+FE+
Sbjct  221   ISISYWLNVAMLVGYIAFSSSCKETRARPTVEVFRGVDAFLRLALPSALMMCLEWWSFEL  280

Query  790   VILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVW  611
             + L+ GLLPNP+++TSVLSICL   +L F IPF +GA  STR++NELGAGN D AR AV 
Sbjct  281   LTLMSGLLPNPELQTSVLSICLTSVTLLFTIPFGLGAAGSTRVANELGAGNPDGARSAVR  340

Query  610   GVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSG  431
              V  +  I+ VV +  L++ R +VG A+S+E EV+  +  M+PLV +  ++D + G+LSG
Sbjct  341   VVLSMAGIDAVVVSGSLLAARRLVGIAYSSEEEVISAVAAMVPLVCITAITDCLQGILSG  400

Query  430   VARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALIT  251
             VARG GWQHLGAYVNLG++YL+G P A +LGF+  +   GLWMG+   SL Q  +++ IT
Sbjct  401   VARGCGWQHLGAYVNLGSFYLLGIPMAILLGFVLRMGSRGLWMGIVCGSLSQTTLMSAIT  460

Query  250   IFTDWKKQESKAQERLLNDSHP  185
              FTDW K   KA+ER+ +D  P
Sbjct  461   FFTDWNKMAEKARERVFSDKQP  482



>gb|KHN13925.1| MATE efflux family protein 8 [Glycine soja]
Length=483

 Score =   480 bits (1236),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 230/473 (49%), Positives = 325/473 (69%), Gaps = 3/473 (1%)
 Frame = -2

Query  1600  MDAE--VPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHIS  1427
             MD E   PLL +   A     D F  ELK++  +A PM+   +CQ ++  VS MM+GH+ 
Sbjct  2     MDKEEATPLLRKSEVAPLEDDDAFCVELKRVGSMAAPMVAANMCQYLLQVVSLMMVGHLG  61

Query  1426  EL-SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVV  1250
              L S SG A+A SF  VTGF ++ GMA ALETLCGQ YGA ++ ++G YT+ AI++L +V
Sbjct  62    LLVSFSGVAIAISFAEVTGFCVLMGMAGALETLCGQTYGAEEFTEIGNYTFCAIVTLLLV  121

Query  1249  AIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVP  1070
              +PIS+LW+FMDK L+  GQDP IS  A KY +  I A++ +A+LQC +RY Q QS+I P
Sbjct  122   CLPISLLWIFMDKILLLFGQDPEISHVAHKYCICSIPALYGFAVLQCQIRYFQTQSMIFP  181

Query  1069  MLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRV  890
             M+ SS   LC H+P+CW L F+ GLG  G A AIG+SYW NVI L +Y+ YS +CEK+++
Sbjct  182   MVFSSIAVLCLHVPICWGLVFKLGLGHVGAAYAIGISYWLNVIGLGIYMNYSPACEKTKI  241

Query  889   CLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSL  710
                 ++   + EF + AIPS  M C E W+FE++ L  GLLPNPQ++TSVLS+CL   +L
Sbjct  242   VFSFNALLSIPEFCQFAIPSGLMFCFEMWSFELLTLFAGLLPNPQLQTSVLSVCLNTTTL  301

Query  709   HFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYA  530
             H+ IP+++GA ASTRISNELGAGN   A+  V  V I+G+++ V+ +   +  R ++GYA
Sbjct  302   HYIIPYAVGASASTRISNELGAGNPKAAQGIVRVVVILGIVDGVIVSTFFVCCRHILGYA  361

Query  529   FSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAA  350
             +SN+ EVVDY+  ++P++     +D + G LSG+ARG G+Q +GAYVNLGAYYLVG P A
Sbjct  362   YSNDKEVVDYVSDIVPILCGSFTADSLIGALSGIARGGGFQQIGAYVNLGAYYLVGVPLA  421

Query  349   GMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
              +LGF+      GLWMG    S++Q ++L ++T+ TDW+K+ +KA+ER++  S
Sbjct  422   FLLGFVLHFNAKGLWMGSLTGSVLQVIILTVVTVLTDWQKEATKARERIVEKS  474



>ref|XP_006468793.1| PREDICTED: MATE efflux family protein 9-like [Citrus sinensis]
Length=498

 Score =   481 bits (1237),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 240/458 (52%), Positives = 320/458 (70%), Gaps = 0/458 (0%)
 Frame = -2

Query  1543  DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSL  1364
             DV++ E+K+L  IA PM+ V + Q  +  +S MM+GH+ EL LS  A+A SF+ VTGFSL
Sbjct  38    DVYIDEVKRLGSIAGPMVAVNLSQYFLQVISVMMVGHLGELFLSSTAIAISFSAVTGFSL  97

Query  1363  IFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDP  1184
             +FGM++A+ETL GQAYGA QY KLGT  + A+  L +  +P+S+LW  M K LI +GQDP
Sbjct  98    LFGMSTAMETLSGQAYGAQQYRKLGTQMHTAMFCLLLACLPVSLLWANMGKLLILMGQDP  157

Query  1183  LISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFR  1004
              IS+EAGK++VWLI A+F Y  LQ LVRYLQ+QSL+ PML+SS  ++ FHI +CWAL  +
Sbjct  158   AISSEAGKFTVWLIPALFGYGTLQPLVRYLQVQSLVTPMLISSCATVFFHIIICWALVLK  217

Query  1003  SGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSAS  824
               L + G ALAIG SYW NV+LL +Y+ +SS+C ++RV +  + F  + EFF LAIPSA 
Sbjct  218   FELNNIGAALAIGTSYWLNVLLLGLYMTFSSACAQTRVQVSMELFQGIKEFFLLAIPSAF  277

Query  823   MACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGA  644
             M CLEWW+FE + LL GLLPNP++E SVLS+CL   +  F IP  +GA ASTR+SN LGA
Sbjct  278   MVCLEWWSFEFLTLLSGLLPNPELEASVLSVCLATITTLFTIPDGLGAAASTRVSNALGA  337

Query  643   GNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLML  464
             GN   A +AV  V  + ++E V+ + +L + R V GY FSN+ EVVDY+  M PL+ L +
Sbjct  338   GNPKAAIIAVRAVLFLTVLETVIVSSILYASRHVFGYIFSNDHEVVDYVTSMAPLICLCV  397

Query  463   VSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLAS  284
             + +G+  +LSG+ARG GWQ+LGAY NL AYYL G P A  LGF   +RG GLW+G+   +
Sbjct  398   ILNGLQAVLSGIARGCGWQNLGAYANLTAYYLFGIPVAAALGFWLKMRGEGLWIGIQFGA  457

Query  283   LVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
              VQ V+L LIT   +WKKQ SKA+ER+         +N
Sbjct  458   FVQIVLLFLITSCQNWKKQASKARERIFEGRSSQGEEN  495



>ref|XP_006302201.1| hypothetical protein CARUB_v10020213mg [Capsella rubella]
 gb|EOA35099.1| hypothetical protein CARUB_v10020213mg [Capsella rubella]
Length=481

 Score =   479 bits (1234),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 241/468 (51%), Positives = 333/468 (71%), Gaps = 0/468 (0%)
 Frame = -2

Query  1597  DAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
              AE  LL          KDVF  E+K+L  IA PM+ V     +++ +S MM+GH+ EL 
Sbjct  3     SAEEGLLVVSHREDVNKKDVFFVEMKRLGCIAGPMIAVNSSTYVLLVISIMMVGHLGELF  62

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LS  A+A SF +VTGFS++FG+ASALETLCGQA+GA Q+ KLG +TY  I SL +V IP+
Sbjct  63    LSSTAIAVSFCSVTGFSVVFGLASALETLCGQAHGAKQFEKLGVHTYTGIFSLFLVCIPL  122

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             S+LW +M   L   GQDPL++ +AGK++ WLI A+F YA LQ LVR+ Q QSLI PM++S
Sbjct  123   SVLWTYMGDILSLTGQDPLVAQQAGKFATWLIPALFGYATLQSLVRFFQAQSLIFPMIMS  182

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             S  SLC H+ +CW+L F+ GLGS G A+++G+SYW NVI+L +Y+ +SSSC K R  +  
Sbjct  183   SVSSLCVHVVLCWSLVFKFGLGSRGAAISVGVSYWLNVIVLGLYMTFSSSCSKCRAPISM  242

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
               F  +GEFFR  IPSASM CLEWW+ E ++LL GLLPNP++E SVLS+CL   ++ + I
Sbjct  243   SVFKGMGEFFRFGIPSASMICLEWWSLEFLLLLSGLLPNPKLEASVLSVCLSTVAIIYQI  302

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
               S+GA ASTR++NELGAGN   AR+AV+ V +I  +E ++ + ++   R+V GY FS+E
Sbjct  303   AESLGAAASTRVANELGAGNPKQARIAVYTVMVITCVESIMVSTIVFGARNVFGYLFSSE  362

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
             TEVVDY++ + PLVSL ++ D +  +L+GVARGSG Q +GAYVNL AYYL G P A +L 
Sbjct  363   TEVVDYVRTLAPLVSLSVIFDALHAVLAGVARGSGRQDIGAYVNLAAYYLCGVPTAIILA  422

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             F   +RG GLW+G+ + S VQ ++L+LI I T+W+++  KA++RL+ +
Sbjct  423   FGLKMRGRGLWIGITVGSFVQALLLSLIVIRTNWEQEAKKARQRLMCE  470



>ref|XP_011038709.1| PREDICTED: MATE efflux family protein 9-like isoform X2 [Populus 
euphratica]
Length=395

 Score =   476 bits (1225),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 295/397 (74%), Gaps = 5/397 (1%)
 Frame = -2

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             GMASALETLCGQAYGA QY KLGT TY AI  L +V IP+S++W++M K L F GQDP I
Sbjct  2     GMASALETLCGQAYGAKQYKKLGTQTYTAIFCLNLVCIPLSVIWIYMGKILHFTGQDPAI  61

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAGK++VWL+ A+F YA LQ LVRY Q QSLI+PML+SS  +LCFHIP+CWAL ++SG
Sbjct  62    SHEAGKFTVWLVPALFAYATLQPLVRYFQTQSLIMPMLISSCATLCFHIPLCWALVYKSG  121

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             L + G A+A+G+SYW NVI L +Y+KYSS+C K+RV +  + F  VGEFFR AIPSA M 
Sbjct  122   LKNVGSAVAMGISYWLNVIFLGLYIKYSSACAKTRVPISKELFYGVGEFFRFAIPSAVMI  181

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW+FE++ILL G LPNPQ++TSVLS+CLM  S  + IPF +GA ASTR++NELGAGN
Sbjct  182   CLEWWSFELLILLSGFLPNPQLQTSVLSVCLMTISTLYGIPFGLGAAASTRVANELGAGN  241

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
                AR+AV+    + + E ++    L + R V GY FSNE EV+DY+  M PLV L ++ 
Sbjct  242   PRAARLAVYAAMFLAVSETIMVTSALFASRRVFGYIFSNEKEVIDYVTTMDPLVCLSVIM  301

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D + G+LSGVARG GWQH+GAY+NLGA+YL G P A +L F  +L GMGLW+G+ + +  
Sbjct  302   DSLQGVLSGVARGCGWQHIGAYINLGAFYLCGIPVAALLAFWLNLGGMGLWIGIQIGAFT  361

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             Q ++L+++T  T+W+KQ   A+ER+  + H    DNG
Sbjct  362   QTILLSIVTSCTNWEKQARMARERIF-EGH----DNG  393



>ref|XP_007142992.1| hypothetical protein PHAVU_007G034600g [Phaseolus vulgaris]
 gb|ESW14986.1| hypothetical protein PHAVU_007G034600g [Phaseolus vulgaris]
Length=481

 Score =   479 bits (1232),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 235/454 (52%), Positives = 324/454 (71%), Gaps = 0/454 (0%)
 Frame = -2

Query  1552  ISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTG  1373
             I   VF  E+K++  +A PM+ V + Q  +  +S MM+G + +L+LS  A+A S  NV+G
Sbjct  20    IRWSVFGEEVKRVGYLAGPMIGVNLSQYFLQIISMMMVGRLGKLALSSTAIAISLCNVSG  79

Query  1372  FSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVG  1193
              S+IFGM+ ALET CGQAYGA QY K G   Y AI+SLT+  +P+++LWV++ K LI +G
Sbjct  80    LSVIFGMSCALETQCGQAYGAQQYRKFGVQIYTAIVSLTLACLPLTLLWVYLGKLLIILG  139

Query  1192  QDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWAL  1013
             QDPLIS EAGK+++ ++ A+F YA LQ LVR+  MQSLI P+++SS+++LCFH+   W +
Sbjct  140   QDPLISQEAGKFALCMVPALFAYATLQSLVRFFFMQSLISPLVISSSITLCFHVAFSWLM  199

Query  1012  SFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIP  833
              F+SGLG+ G A +I  SYW NVILL +Y+K+S+ CEK+RV +  + F  +GEF R AIP
Sbjct  200   VFKSGLGNIGAAFSISTSYWLNVILLGLYMKFSTQCEKTRVPISMELFHGIGEFIRYAIP  259

Query  832   SASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNE  653
             SA M CLEWW+FE++ILL GLLPNP++ETSVLSICL I +  + I  SIG+ ASTRISN 
Sbjct  260   SAGMICLEWWSFELIILLSGLLPNPELETSVLSICLNITTTIYTIAESIGSAASTRISNA  319

Query  652   LGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVS  473
             LGAGN   AR+ V+   I+   + ++ + ++ + R ++GY FSNE +V DY+  M+PL+S
Sbjct  320   LGAGNPQSARVCVYAAMILAASDAILVSSIIFACRQILGYVFSNEQDVADYVTDMVPLLS  379

Query  472   LMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLN  293
             L ++ D + G LSG+ARG GWQHLGAYVNLGAYY  G P A +LGF   L G GLW+G+ 
Sbjct  380   LSVILDSLYGTLSGIARGCGWQHLGAYVNLGAYYGFGIPTAAILGFWILLGGKGLWIGIL  439

Query  292   LASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
               S  Q V+L+LIT  T+W++Q  KA+ER+   S
Sbjct  440   TGSFCQTVMLSLITTSTNWEEQAIKARERIFQRS  473



>ref|XP_009356186.1| PREDICTED: MATE efflux family protein 9-like [Pyrus x bretschneideri]
Length=477

 Score =   479 bits (1232),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 242/476 (51%), Positives = 328/476 (69%), Gaps = 5/476 (1%)
 Frame = -2

Query  1618  NFLLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMML  1439
               LL + + E   L+ +R + A     F  E+K+L  IA PM+ V + Q  +  +S MM+
Sbjct  3     KILLIKEEGEGEGLARRRRSGA-----FGGEVKRLGYIAAPMVAVNLSQYFLQIISIMMV  57

Query  1438  GHISELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSL  1259
             GH+ +LSLS  A+A SF  V+GFSL+FGMASALETL GQAYGA QY +LG     AI SL
Sbjct  58    GHLGQLSLSSTAIAISFCAVSGFSLLFGMASALETLSGQAYGARQYKQLGLQINTAIFSL  117

Query  1258  TVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSL  1079
              +V +P+S++W++M   L+F+GQDP IS  AGK++  L+ A+F YA LQ L +YLQ QSL
Sbjct  118   FLVCLPLSLVWIYMGNILVFLGQDPQISHGAGKFARMLLPALFAYAALQPLCKYLQTQSL  177

Query  1078  IVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEK  899
             I+P+L+SS   LCFHIP CW + F+SG G  G ALAIG SYW NVILL++YVKYS++C  
Sbjct  178   IIPLLVSSFACLCFHIPFCWVMVFKSGQGHLGAALAIGTSYWLNVILLLLYVKYSAACAS  237

Query  898   SRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMI  719
             +RV +  + F  +GEF R A+PSA M CLEWW+FE++ LL G LPNP++ETSVLS+CL  
Sbjct  238   TRVPISLELFRGIGEFLRFAVPSAVMICLEWWSFELLTLLAGFLPNPELETSVLSVCLAT  297

Query  718   CSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVV  539
              S  + IP  +GA  STR+SNELGAGN   AR+AV  V  + + E V+ +  + + RS+ 
Sbjct  298   ISSLYTIPEGLGAAVSTRVSNELGAGNPQAARLAVGAVMFLTVSEAVLISTTVFATRSIF  357

Query  538   GYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGA  359
             GY FSN+  VVDY+  M PL+ L ++S+ + G+LSG+ARG GWQ L  YVNLGAYYL G 
Sbjct  358   GYIFSNDKVVVDYVSSMAPLICLAVISESLHGVLSGIARGCGWQDLAMYVNLGAYYLFGI  417

Query  358   PAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             P A  L F   LRG GLW+G+ + S +Q  + ++IT  T+W+++ SKA+ER+  +S
Sbjct  418   PVAATLCFWLDLRGKGLWIGIQVGSFLQAALYSVITGCTNWEEKASKARERIFLES  473



>gb|KDP34995.1| hypothetical protein JCGZ_09283 [Jatropha curcas]
Length=487

 Score =   479 bits (1232),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 245/461 (53%), Positives = 324/461 (70%), Gaps = 0/461 (0%)
 Frame = -2

Query  1579  LSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAV  1400
             L++ +    ++ D+F  E K+L  +A PM+  T+   ++  ++ MM+GH+ +L LS  A+
Sbjct  12    LAKDKEGLNLTWDLFRKEGKRLGYVAGPMVAATLSMFLINVITMMMVGHLGKLDLSSSAI  71

Query  1399  ATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVF  1220
             A S + VTGFSL+ GMASALETLCGQAYGA QY KLG  TY AI SL  VA  +SILWV 
Sbjct  72    AISLSAVTGFSLLTGMASALETLCGQAYGAEQYKKLGNQTYSAIFSLIFVAFAVSILWVN  131

Query  1219  MDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLC  1040
             M+K LI +GQDPLI+ EA K+  WL+ A+F  AI Q L RY Q QSL +PML+SS+++L 
Sbjct  132   MEKLLILMGQDPLIAREAEKFLRWLVPALFASAIFQPLNRYYQTQSLTMPMLISSSVTLS  191

Query  1039  FHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARV  860
              HIP+CW L F+SGL + G ALAI +S W NVI L  Y+KYSSSC K+RV +  + F  V
Sbjct  192   LHIPLCWILVFKSGLRNVGGALAISISNWLNVIFLAFYMKYSSSCAKTRVPISLELFQGV  251

Query  859   GEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGA  680
             G+FFRLAIPSA M CL+WW++E VILL GLLPNPQ+ETSVLSICL      +  P+ + A
Sbjct  252   GQFFRLAIPSAVMICLQWWSYECVILLSGLLPNPQLETSVLSICLTTIVTLYAFPYGLSA  311

Query  679   GASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDY  500
               STR+SN LGAGN   AR AV+ V  I   EL++ +  L   R + GY FSNE +VV  
Sbjct  312   AVSTRVSNALGAGNPKAARNAVYSVMSIAGTELILVSGALFITRHIFGYTFSNEKQVVHS  371

Query  499   IKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLR  320
             +  M PL+ L ++ DG+ G+LSGVARG GWQ +GAYVNL A Y+ G PAA +LGFL  LR
Sbjct  372   VSAMAPLICLSVIIDGLQGVLSGVARGCGWQKIGAYVNLAALYICGVPAAAILGFLLHLR  431

Query  319   GMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLN  197
             G GLW+G+ + +++Q V+L+++T +T+W+KQ SKA+ER+  
Sbjct  432   GRGLWIGMQIGAILQTVLLSVVTCYTNWEKQASKARERVFE  472



>ref|XP_004493054.1| PREDICTED: MATE efflux family protein 5-like [Cicer arietinum]
Length=483

 Score =   479 bits (1232),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 229/449 (51%), Positives = 318/449 (71%), Gaps = 0/449 (0%)
 Frame = -2

Query  1534  LAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFG  1355
             + E+KK++ IA PM+  +V Q ++  VS MM+GH+++LSLS  A+ATS TNV+GFS++ G
Sbjct  23    MVEMKKMSNIAGPMVATSVLQYLLQVVSMMMVGHLNQLSLSSVAIATSLTNVSGFSILSG  82

Query  1354  MASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLIS  1175
             MA  LETLCGQAYGA Q+ K G YTY AI+SLT+V  PI+I+W F DK LI +GQD  IS
Sbjct  83    MAGGLETLCGQAYGAEQFEKFGIYTYTAIISLTMVCAPITIIWFFFDKILILIGQDTTIS  142

Query  1174  AEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGL  995
              EA  Y++WLI A+F  AIL+ L R+ Q QSLI PM++SS + LCFH   CW L F+ GL
Sbjct  143   HEARTYALWLIPALFASAILKPLTRFFQTQSLISPMIISSFMVLCFHGVTCWTLVFKLGL  202

Query  994   GSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMAC  815
             G  G A++  L  W NV+LL+ +VKYSS+C+K+RV     +F  + EFF LA+PSA+M C
Sbjct  203   GHIGAAISFSLGAWLNVMLLLSFVKYSSACDKTRVPFSKKAFLGIREFFGLAVPSAAMVC  262

Query  814   LEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNT  635
             L+WW  E+++LL GL PNP++ETSVLSICL I +LHF I + +GA ASTR+SNELGAGN 
Sbjct  263   LKWWACELLVLLAGLFPNPKLETSVLSICLTISTLHFTISYGLGAAASTRVSNELGAGNP  322

Query  634   DLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSD  455
                R +V     + + E  +   +L+  R+V GYA++N++ VV Y+  M PL+   + +D
Sbjct  323   KTIRFSVCTAMFLAITEAAIITTILLGCRNVFGYAYTNDSVVVHYVAVMTPLLCASIFTD  382

Query  454   GISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQ  275
              +  +LSGVARGSGWQH+GAYVNLGA+Y++G P   +LGF++  R  GLW+G+ + S+ Q
Sbjct  383   SLQAVLSGVARGSGWQHIGAYVNLGAFYVIGVPVGIVLGFISHFRSKGLWVGIVVGSIFQ  442

Query  274   NVVLALITIFTDWKKQESKAQERLLNDSH  188
              + L +IT  T+WKKQ   A+ R+ + ++
Sbjct  443   TLFLFIITALTNWKKQAMMARGRIFDATY  471



>ref|XP_002458328.1| hypothetical protein SORBIDRAFT_03g031420 [Sorghum bicolor]
 gb|EES03448.1| hypothetical protein SORBIDRAFT_03g031420 [Sorghum bicolor]
Length=489

 Score =   479 bits (1232),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 243/474 (51%), Positives = 328/474 (69%), Gaps = 3/474 (1%)
 Frame = -2

Query  1603  EMDAEVPLLSEKRPAAAISK--DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHI  1430
             E     PLL  +RPA    K    +  E   +  +A+PM+VV + Q  V   S MM+GH+
Sbjct  9     EATQARPLLLPRRPAQEDQKWWRRWAREAGWVGYLALPMVVVNLSQYAVQVSSNMMVGHL  68

Query  1429  SE-LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
                L LS  A+ATS  NV+GFSL+ G+ASALETLCGQAYGA QYHKLG  TY AI++L V
Sbjct  69    PGVLPLSSAAIATSLANVSGFSLLIGLASALETLCGQAYGAKQYHKLGLDTYRAIVTLLV  128

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
             V IP+S+LWVFMDK L+ +GQDPLIS  AG+Y +W+I  +F  A++Q L ++LQ QSLI 
Sbjct  129   VCIPLSLLWVFMDKILVLIGQDPLISQGAGRYMIWMIPGLFANAVIQPLTKFLQTQSLIY  188

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             P+LLSS  +   HIP+C+ + F++GLG  G AL I +SYW NV +LV Y+ +SSSC+++R
Sbjct  189   PLLLSSVATAAIHIPLCYVMVFKTGLGYTGAALTISISYWLNVAMLVGYIVFSSSCKETR  248

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
                  + F  V  F RLA+PSA M C EWW+FE++ L+ GLLPNP+++TSVLSICL   +
Sbjct  249   ARPTIEVFRGVDAFLRLALPSALMMCFEWWSFELLTLMSGLLPNPELQTSVLSICLTSVT  308

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
             L F IPF +GA  STR++NELGAGN D AR AV  V  +  I+ V+ +  L++ R +VG 
Sbjct  309   LLFTIPFGLGAAGSTRVANELGAGNPDGARSAVRVVLSMAGIDAVIVSGTLLAARRLVGL  368

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             A+S+E EV+  +  M+PLV + +++D + G+LSGVARG GWQHLGAYVNLG++YL+G P 
Sbjct  369   AYSSEEEVISSVAAMVPLVCITVITDCLQGVLSGVARGCGWQHLGAYVNLGSFYLLGIPM  428

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             A +LGF+  +   GLWMG+   SL Q  +++ IT FTDW K   KA+ER+ +D 
Sbjct  429   AILLGFVLHMGSRGLWMGIVCGSLSQTTLMSAITFFTDWPKMAEKARERVFSDK  482



>gb|KEH24740.1| MATE efflux family protein [Medicago truncatula]
Length=500

 Score =   479 bits (1233),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 240/462 (52%), Positives = 325/462 (70%), Gaps = 6/462 (1%)
 Frame = -2

Query  1603  EMDAEV--PLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHI  1430
             EM  EV  PL+   R +    +  F+ ELKK++ +A PM+ VTV Q ++  VS MM+GH+
Sbjct  7     EMSKEVTTPLI---RKSDHEIESTFVQELKKVSFVAAPMVAVTVSQYLLQVVSLMMVGHL  63

Query  1429  SEL-SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTV  1253
               L S SG ++A SF  VTGFS++ GMA ALETLCGQ +GA +Y KLG YT  AI++LTV
Sbjct  64    GILVSFSGVSIAMSFAEVTGFSVLLGMAGALETLCGQTFGAEEYGKLGNYTCCAILTLTV  123

Query  1252  VAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIV  1073
             V  PIS++W+F DK L+F  QDP +S  A +Y ++LI A+F YA+LQ L+RY Q Q +I 
Sbjct  124   VCFPISLVWIFTDKILMFFSQDPGMSHVAREYCIYLIPALFGYALLQALIRYFQTQGMIF  183

Query  1072  PMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSR  893
             PM+ SS  +L  HIP+CW L F+ GLG  G ALAIG+SYW NVI L VY+KYS SCEK++
Sbjct  184   PMVFSSVSALFLHIPICWILVFKLGLGHIGAALAIGISYWLNVIWLWVYIKYSPSCEKTK  243

Query  892   VCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICS  713
             +     +   + EF + AIPS  M C EWW+FEI+IL+ GLLPNPQ+ETSVLS+CL   S
Sbjct  244   IVFSTHALHNLPEFCKYAIPSGLMFCFEWWSFEILILIAGLLPNPQLETSVLSVCLNTTS  303

Query  712   LHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGY  533
             LHF+IP++IGA ASTR+SNELGAGN   A+ AV  V IIG+ E ++ +   +  R+++GY
Sbjct  304   LHFFIPYAIGASASTRVSNELGAGNPKTAKGAVRVVVIIGIAEAIIVSTFFLCFRNILGY  363

Query  532   AFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPA  353
             A+SN+ +VV+YI  M+PL+ + + +D + G LSGVARG G+Q +GAYVNLGAYY+VG P 
Sbjct  364   AYSNDEQVVNYIADMVPLLCVSVSADSLIGALSGVARGGGFQEMGAYVNLGAYYIVGIPV  423

Query  352   AGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQ  227
               + GF   L   GLWMG    S++  ++L+++T  TDW+K+
Sbjct  424   GLLFGFHLKLNAKGLWMGTLSGSVLNVIILSIVTALTDWQKE  465



>ref|XP_006589654.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Glycine 
max]
 ref|XP_003536653.2| PREDICTED: MATE efflux family protein 5-like isoform X1 [Glycine 
max]
Length=477

 Score =   478 bits (1231),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 247/475 (52%), Positives = 334/475 (70%), Gaps = 3/475 (1%)
 Frame = -2

Query  1591  EVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE-LSL  1415
             E  LL+++R    ++ D    E+K++  IA+PM++VT  Q ++  VS MM+GH++  L L
Sbjct  2     EENLLAKQREKQKVTWDGLGEEMKRIICIAVPMVIVTATQYLLQVVSIMMVGHLNNNLYL  61

Query  1414  SGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPIS  1235
             SG A+A S   VTGFS++ GMAS LET+CGQAYGA QY K+G  TY AI SLTVV +P++
Sbjct  62    SGAALAISLATVTGFSVLAGMASGLETICGQAYGAQQYEKVGVQTYTAIFSLTVVCLPLT  121

Query  1234  ILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSS  1055
              +W+ M+K L+F+GQDPLI+ EAGK+ +WL+ A+F +AI+Q  VRY QMQSL++PML+SS
Sbjct  122   FIWISMEKILVFIGQDPLIAQEAGKFLIWLVPALFAHAIMQPFVRYFQMQSLLLPMLISS  181

Query  1054  ALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWND  875
              ++LC HIP+CWAL F++G+ + G ALA+ +S W NV  L +Y++YS +C K+R  +  +
Sbjct  182   CVTLCIHIPLCWALVFQTGMNNIGGALAMSISIWLNVTFLGLYMRYSPACAKTRAPISME  241

Query  874   SFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIP  695
              F  + EFFR AIPSA M CLEWW+FE++ILL GLLPNPQ+ETSVLSICL   S  F IP
Sbjct  242   LFQGIWEFFRFAIPSAVMICLEWWSFELLILLSGLLPNPQLETSVLSICLNTISTLFSIP  301

Query  694   FSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNET  515
             F I A ASTRISNELGAGN   A +AV       ++E  + +  L   R   GY FSNE 
Sbjct  302   FGIAAAASTRISNELGAGNPHAAHVAVLAAMSFAIMETAIVSGTLFVCRHDFGYIFSNEK  361

Query  514   EVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGF  335
             EVVDY+  M PL+ + ++ D I G+L+GVARG GWQH+G YVNLGA+YL G P A  L F
Sbjct  362   EVVDYVTVMAPLICISVILDSIQGVLAGVARGCGWQHIGVYVNLGAFYLCGIPVAATLAF  421

Query  334   LTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
             L  +RG GLW+G+ + + VQ ++ + IT   +W++Q  KA++RL  DS   A DN
Sbjct  422   LAKMRGKGLWIGVQVGAFVQCILFSTITSCINWEQQAIKARKRLF-DSEISA-DN  474



>ref|XP_009764428.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Nicotiana 
sylvestris]
Length=483

 Score =   478 bits (1231),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 245/473 (52%), Positives = 329/473 (70%), Gaps = 3/473 (1%)
 Frame = -2

Query  1582  LLSEKRPAAAISK--DVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSG  1409
             LL EK     +    +V   E+K+L  +A PM+ VT+ Q  +  +S MM+GH+ ELSLS 
Sbjct  9     LLKEKEEKGVVELRWEVIWEEMKELGYLAGPMIAVTLSQYFLQVISMMMVGHLGELSLSS  68

Query  1408  GAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISIL  1229
              A+A S   VTGFS + GMASALETLCGQA+GA QY +LGT TY AI SL +V IP++IL
Sbjct  69    TAIALSLAGVTGFSFLLGMASALETLCGQAFGAKQYQRLGTQTYTAIFSLFIVCIPLTIL  128

Query  1228  WVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSAL  1049
             W++M   L F+GQDP IS EAGK+  WLI A+F YA L  L+RY QMQS+IVPML+SS +
Sbjct  129   WMYMGTLLTFIGQDPQISHEAGKFIKWLIPALFAYANLHPLIRYYQMQSMIVPMLVSSCM  188

Query  1048  SLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSF  869
             ++CFHIP+ W L FRSGLG+ G A+AIG+S W NVI+L  Y++ S +C K+R  +  +  
Sbjct  189   TICFHIPLSWVLVFRSGLGNIGAAIAIGISMWLNVIILASYMRLSPACAKTRAPMSWEIV  248

Query  868   ARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFS  689
               + EFF+ AIPSA M CLEWW+FE++ILL GLLPNPQ+E SVLSICL   S  + IPF 
Sbjct  249   KGMREFFQFAIPSAIMICLEWWSFELLILLSGLLPNPQLEASVLSICLNTISTLYAIPFG  308

Query  688   IGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEV  509
             +    S R+SN+LGAGN   AR++V    +I   E ++ +  + + R+V GY FSNE EV
Sbjct  309   LAGAVSIRVSNQLGAGNPQGARVSVLSAMLIAATETILVSTTVFACRNVFGYIFSNEKEV  368

Query  508   VDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLT  329
             VDY+  M PL+ + +++D + G LSGVARG GWQH+GAYVNL ++YL G P A  L F  
Sbjct  369   VDYVANMAPLLCISVITDSLQGTLSGVARGCGWQHIGAYVNLASFYLCGIPIAASLAFWL  428

Query  328   SLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
             + RG GLW+G+   ++VQ+++L++IT  T+WKKQ + A+ERL  D    ++DN
Sbjct  429   NFRGKGLWIGVLSGAVVQSILLSVITCCTNWKKQAAMARERLHAD-EKSSIDN  480



>ref|NP_001043893.1| Os01g0684900 [Oryza sativa Japonica Group]
 dbj|BAD82162.1| MATE efflux protein-like [Oryza sativa Japonica Group]
 dbj|BAD82515.1| MATE efflux protein-like [Oryza sativa Japonica Group]
 dbj|BAF05807.1| Os01g0684900 [Oryza sativa Japonica Group]
 dbj|BAG95364.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55193.1| hypothetical protein OsJ_03037 [Oryza sativa Japonica Group]
Length=491

 Score =   478 bits (1231),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 233/448 (52%), Positives = 328/448 (73%), Gaps = 1/448 (0%)
 Frame = -2

Query  1531  AELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE-LSLSGGAVATSFTNVTGFSLIFG  1355
             +E  KLA +A+PM+ V++    V   S MM+GH+   L LS  A+ATS  +VTGFSL+ G
Sbjct  33    SEAGKLAYLALPMVAVSLTNYAVQVFSNMMVGHLPGVLPLSSAAIATSLASVTGFSLLIG  92

Query  1354  MASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLIS  1175
             MASALETLCGQAYGA QYH LG +TY AI++L VV IP+S+LWVFM K L+ +GQDPLIS
Sbjct  93    MASALETLCGQAYGAKQYHTLGVHTYRAILTLLVVCIPLSLLWVFMGKILVLIGQDPLIS  152

Query  1174  AEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGL  995
               AG+Y VWLI  +F  A++Q + ++LQ QSLI+PML++S  +L FHIP+CW + F++GL
Sbjct  153   HGAGRYIVWLIPGLFANALIQPITKFLQSQSLIMPMLVASVATLVFHIPLCWLMVFKTGL  212

Query  994   GSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMAC  815
             G  G AL+I +SYW NV +LV Y+  SSSC+++R     ++F  +  F RLA+PSA M C
Sbjct  213   GYTGAALSISISYWLNVAMLVAYILLSSSCKETRTPPTIEAFKGLDGFLRLALPSALMIC  272

Query  814   LEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNT  635
             LEWW+FE++IL+ GLLPNP+++TSVLSICL   +L F IP+ +GAG STR++NELGAGN 
Sbjct  273   LEWWSFELLILMSGLLPNPELQTSVLSICLTSITLLFTIPYGLGAGGSTRVANELGAGNP  332

Query  634   DLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSD  455
             + AR AV+ V  + + E ++    L++ R ++G A+S+E EV+ ++  M+PLV + +V+D
Sbjct  333   EGARSAVYVVLSVAVTEALIVCGTLLASRRLLGRAYSSEEEVISFVAMMVPLVCITVVTD  392

Query  454   GISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQ  275
             G+ G++SG+ARG GWQHLGAYVNLG++YL+G P A +LGF+  +   GLWMG+   S+ Q
Sbjct  393   GLQGVMSGIARGCGWQHLGAYVNLGSFYLLGIPMAILLGFVLHMGAKGLWMGIVCGSISQ  452

Query  274   NVVLALITIFTDWKKQESKAQERLLNDS  191
               +L+ IT FT+W+K    A+ER+ ++ 
Sbjct  453   ITLLSAITFFTNWQKMAENARERVFSEK  480



>ref|XP_007142990.1| hypothetical protein PHAVU_007G034500g [Phaseolus vulgaris]
 gb|ESW14984.1| hypothetical protein PHAVU_007G034500g [Phaseolus vulgaris]
Length=482

 Score =   478 bits (1230),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 237/465 (51%), Positives = 329/465 (71%), Gaps = 2/465 (0%)
 Frame = -2

Query  1561  AAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTN  1382
             +  I  +VF  E+K++  +A PM+ VT+ Q  +  +S MM+GH+ +L+LS  A+A S   
Sbjct  18    SGVIRWNVFGEEVKRVGYLAGPMVTVTLSQYFLQIISMMMVGHLGKLALSSTAIAISLCA  77

Query  1381  VTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLI  1202
             V+GFS+IFGM+ ALET CGQAYGA QY K G   Y AI+SLT+  +P+++LW+++ K LI
Sbjct  78    VSGFSVIFGMSCALETQCGQAYGAQQYRKFGVQIYTAIVSLTLACLPLTLLWIYLGKLLI  137

Query  1201  FVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVC  1022
              +GQDPLIS EAGK+++ +I A+F YA LQ LVR+  MQSLI P+++SS ++LCFH+   
Sbjct  138   ILGQDPLISQEAGKFALCMIPALFAYAALQTLVRFFLMQSLISPLVISSFITLCFHVAFS  197

Query  1021  WALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRL  842
             W + F+SGLG+ G A +I  SYW NVILL +Y+K+S+ CEK+RV +  + F  +GEF R 
Sbjct  198   WLMVFKSGLGNLGAAFSISTSYWLNVILLGLYMKFSTQCEKTRVPISMELFHGIGEFIRY  257

Query  841   AIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRI  662
             AIPSA M CLEWW+FE++ILL GLLPNP++ETSVLSICL I +  + I  SIG+ ASTRI
Sbjct  258   AIPSAGMICLEWWSFELIILLSGLLPNPELETSVLSICLNITTTIYTIAESIGSAASTRI  317

Query  661   SNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIP  482
             SN LGAGN   AR+ V+    +   E ++ + ++ + R ++GY FSNE +V  Y+  M P
Sbjct  318   SNALGAGNPQSARVCVYAAMTLAASEAILVSSIIFAFRQILGYVFSNELDVAFYVTDMAP  377

Query  481   LVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWM  302
             L+SL ++ D + G LSG+ARG GWQHLGAYVNLGAYY  G P A +LGF   L G GLW+
Sbjct  378   LLSLSIILDSLHGTLSGIARGCGWQHLGAYVNLGAYYGFGIPTAAILGFWILLGGKGLWI  437

Query  301   GLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDNG  167
             G+   +  Q V+L+LIT  T+W++Q  KA+ER+   S   +V++G
Sbjct  438   GILTGAFCQTVMLSLITASTNWEEQAIKARERIFQRSF--SVEDG  480



>ref|XP_008358206.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
Length=480

 Score =   478 bits (1229),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 247/472 (52%), Positives = 321/472 (68%), Gaps = 1/472 (0%)
 Frame = -2

Query  1609  LPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHI  1430
             +  MD     + E++   A++   FL E+KK   IA PM+ V+V Q ++  VS +M GH+
Sbjct  1     MATMDQXTAEMKEEK-TWAVTWGTFLXEVKKEGFIAAPMVAVSVLQYLLQLVSMIMAGHL  59

Query  1429  SELSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVV  1250
              +L+LS  A+A S TNVTGFSL+ GMA  LETLCGQA+GAGQY KLGTYT  A++ L +V
Sbjct  60    DQLALSSVAIAISLTNVTGFSLLSGMAGGLETLCGQAFGAGQYQKLGTYTCTAMIXLLLV  119

Query  1249  AIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVP  1070
               PI +LW+F DK L  VGQ+P IS EA  YSVWLI A+F  AIL+ L RY Q QS I P
Sbjct  120   CPPICVLWIFFDKLLPLVGQNPQISHEAQIYSVWLIPALFGGAILKPLTRYFQSQSSIFP  179

Query  1069  MLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRV  890
             MLLSS + L FHI   WA  ++  LG  G A++  LS W  V+LL +Y  +SSS E++R+
Sbjct  180   MLLSSFVILLFHILTSWAFIYKLELGVKGSAISFSLSTWLYVVLLWLYAMFSSSFEETRL  239

Query  889   CLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSL  710
                 +S   +G FFRLA+PSA M CL+WW+ E++ILL GLLPNP++ETSVLSICL I +L
Sbjct  240   AFSMESLVHIGLFFRLAVPSAVMICLKWWSCELIILLSGLLPNPKLETSVLSICLTISTL  299

Query  709   HFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYA  530
             HF I +  GA AS R+SNELGAGN   AR+AVW    + + E V+ +  L   R V+G+ 
Sbjct  300   HFTISYGFGAAASIRVSNELGAGNPQAARVAVWAAMFLSVTEAVIVSTTLFCCRYVLGHV  359

Query  529   FSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAA  350
             FS+E  VVDY+  M PL+ + +  D +  +LSGVARGSGWQH+GAYVNLGA+YLVG P  
Sbjct  360   FSSEKPVVDYVVVMAPLICISVFMDSVQAVLSGVARGSGWQHIGAYVNLGAFYLVGLPVG  419

Query  349   GMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
               LGF   LRG GLW+G+   S VQ+ +LALIT FT+W KQ  +A+ER+  +
Sbjct  420   CALGFALGLRGKGLWIGIVAGSAVQSALLALITSFTNWTKQAKRARERVFAE  471



>ref|XP_004969570.1| PREDICTED: MATE efflux family protein DTX1-like [Setaria italica]
Length=492

 Score =   478 bits (1230),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 243/482 (50%), Positives = 334/482 (69%), Gaps = 9/482 (2%)
 Frame = -2

Query  1597  DAEVPLLSEKRPAAAISKD--------VFLAELKKLARIAIPMLVVTVCQQMVIFVSTMM  1442
             +A +PLL  +  A   +K+        ++  E  ++  +A+PM+VV++ Q +V   S MM
Sbjct  9     EAALPLLLPRAGAGGGNKEEASSSWWRLWAREAGRVGYLALPMVVVSMSQNVVQVSSNMM  68

Query  1441  LGHISE-LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIM  1265
             +GH+   L LS  A+ATS  NVTGFSL+ GMASALETLCGQAYGA QYHKLG  TY AI 
Sbjct  69    VGHLPGVLPLSSAAIATSLANVTGFSLLIGMASALETLCGQAYGAKQYHKLGVDTYRAIA  128

Query  1264  SLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQ  1085
             +L VV IP+S++WVFMDK L+  GQD LIS  AG+Y +WLI  +F  A++Q + ++LQ Q
Sbjct  129   TLLVVCIPLSLIWVFMDKVLVLTGQDLLISHGAGRYMIWLIPGLFANAVIQPITKFLQTQ  188

Query  1084  SLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSC  905
             SLI P+LLSS +++  HIP+C+ + F++G G  G AL   +SYW NV +LV Y+ +SSSC
Sbjct  189   SLIYPLLLSSIVTMAIHIPLCYVMVFKTGFGYTGAALTTSISYWLNVGMLVGYIVFSSSC  248

Query  904   EKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICL  725
             +++R     ++F  V  F RLA+PSA M CLEWW+FE++ILL G LPNP+++TSVLSICL
Sbjct  249   KETRTRPTIEAFRGVDAFLRLALPSALMICLEWWSFELLILLSGFLPNPELQTSVLSICL  308

Query  724   MICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRS  545
                +L F IPF +GA  STR++N LGAGN D AR AV  V  +  ++ V+    L++ R 
Sbjct  309   TSVTLLFTIPFGLGAAGSTRVANGLGAGNPDGARSAVRVVLSMAAMDAVIVGGTLLAARR  368

Query  544   VVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLV  365
             +VG A+S+E EVV ++  M+PLV + +V+D I G+LSGVARG GWQHLGAYVNLG++YL+
Sbjct  369   LVGLAYSSEEEVVSFVAAMVPLVCITVVTDSIQGVLSGVARGCGWQHLGAYVNLGSFYLL  428

Query  364   GAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHP  185
             G P A +LGF+ ++   GLWMG    SL Q+  ++ IT FTDW K   KA+ER+ ++  P
Sbjct  429   GIPMAILLGFVLNMGARGLWMGAVCGSLSQSTFMSAITFFTDWPKMAEKARERVFSEKSP  488

Query  184   PA  179
              A
Sbjct  489   EA  490



>ref|XP_004135071.1| PREDICTED: MATE efflux family protein 7-like [Cucumis sativus]
 gb|KGN52128.1| hypothetical protein Csa_5G611100 [Cucumis sativus]
Length=485

 Score =   478 bits (1229),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 226/466 (48%), Positives = 332/466 (71%), Gaps = 2/466 (0%)
 Frame = -2

Query  1591  EVPLLSEKRPA--AAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
             E  LL++++    ++ +  V+L E+K++  +A P+++VT  Q M+  ++ MM+GH+  L+
Sbjct  10    EESLLAKQKETNLSSTTTAVYLEEMKRVGFLAAPLVIVTFSQFMLQIITMMMVGHLGALA  69

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LS  A+A S + VTGFS++ G++SALETLCGQAYGA Q+ K+G  TY AI  + ++  P+
Sbjct  70    LSSTAIAVSISAVTGFSVLLGLSSALETLCGQAYGAQQFEKVGVQTYTAIFCVFLICFPL  129

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             S++W+F++K L+FVGQDPLIS EAGK+ VWLI  +F  A LQ LVRY Q QSL++PM++ 
Sbjct  130   SLIWLFLEKLLLFVGQDPLISHEAGKFIVWLIPGLFASAFLQPLVRYFQAQSLVIPMVIF  189

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             S ++L FHIP+CW + +++GL + G AL++  SY  NVILL +Y+K+S  CEK+R  +  
Sbjct  190   SCITLFFHIPLCWFMVYKTGLRNLGGALSMSFSYCLNVILLALYMKFSPKCEKTRGVISM  249

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
             + F  + +FF LA+PSA M CLEWW+FE++ILL GLLPNP++ETSVLS+CL   +  + I
Sbjct  250   ELFQGIRDFFSLAVPSAVMVCLEWWSFELIILLSGLLPNPELETSVLSVCLQTIASLYSI  309

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
              + +GA  STR+SNELGAGN   AR A   V  + ++E +  + +L +LR + GY FSNE
Sbjct  310   AYGLGAAGSTRVSNELGAGNPQAARRATRVVLFLAILETLTLSTILFALRHIFGYTFSNE  369

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
              +VV Y+  M PLV + ++ DGI G+LSG+ARG GWQH+GAYVN G++YL G P A +LG
Sbjct  370   KDVVAYVASMAPLVCISVLMDGIQGVLSGIARGCGWQHIGAYVNFGSFYLCGIPVAALLG  429

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
             FL  ++G GLW+G+ + + VQ  +L+ IT   +W++Q   A +RLL
Sbjct  430   FLVHMKGRGLWIGIQMGAFVQVTLLSFITSRINWEEQARMASDRLL  475



>ref|XP_006297538.1| hypothetical protein CARUB_v10013560mg [Capsella rubella]
 gb|EOA30436.1| hypothetical protein CARUB_v10013560mg [Capsella rubella]
Length=485

 Score =   476 bits (1226),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 236/466 (51%), Positives = 326/466 (70%), Gaps = 0/466 (0%)
 Frame = -2

Query  1597  DAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
             D +V      +P+    +  F AELK ++ +A PM  VTV Q ++  +S M+ GH  EL 
Sbjct  9     DDQVTNTGSLKPSTPTWRKSFTAELKNVSLMAAPMSTVTVAQYLLPVISVMVAGHRGELQ  68

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LSG A+AT+FTNV+GFS+++G+  ALETLCGQAYGA QY KLGTYTY AI+S     + I
Sbjct  69    LSGVALATAFTNVSGFSIMYGLVGALETLCGQAYGAKQYTKLGTYTYSAIVSNVPFCLLI  128

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             SILW +MDK L+ +GQDP IS  AG Y+V LI A+F  A+ Q L R+LQ Q L++P+L  
Sbjct  129   SILWFYMDKLLVSIGQDPDISRVAGSYAVCLIPALFSQAVQQPLTRFLQTQGLVLPLLYC  188

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             +  +L FHIPVC  L ++ GLGS G ALAI LSYWFNV++L +YV++SSSC ++R  + +
Sbjct  189   AVTTLLFHIPVCLVLVYKFGLGSNGAALAISLSYWFNVLILALYVRFSSSCVETRGFVSD  248

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
             D  +   +FF+  IPSA+MAC+EW  FE ++L  GLLPNP++ETSVLSICL   SLH+ I
Sbjct  249   DFVSSAKQFFQYGIPSAAMACIEWSLFEFLVLSSGLLPNPKLETSVLSICLTTGSLHYVI  308

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
             P  IGA  STRISNELGAGN ++AR+AV+    +  +E  + + +L + R++ GYAFSN 
Sbjct  309   PMGIGAAGSTRISNELGAGNPEVARLAVFAGIFLWFLEATICSTLLFTCRNIFGYAFSNS  368

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
              EVVDY+ ++ PL+ L  + DG S +L GVARGSGWQH+GA+ N+ AYYL+G P   +LG
Sbjct  369   KEVVDYVTELSPLLCLSFMVDGFSAVLGGVARGSGWQHIGAWANVVAYYLLGGPVGILLG  428

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
             F   + G GLW+G+ + S  Q ++LA++T    W +Q +KA++R++
Sbjct  429   FWCHMNGKGLWIGVVVGSTAQGIILAIVTACMSWNEQAAKARKRIV  474



>ref|XP_004162729.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 7-like 
[Cucumis sativus]
Length=485

 Score =   475 bits (1223),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 226/466 (48%), Positives = 330/466 (71%), Gaps = 2/466 (0%)
 Frame = -2

Query  1591  EVPLLSEKRPA--AAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
             E  LL++++    ++ +  V+L E+K++  +A P+++VT  Q M+  ++ MM+GH+  L+
Sbjct  10    EESLLAKQKETNLSSTTTAVYLEEMKRVGFLAAPLVIVTFSQFMLQIITMMMVGHLGALA  69

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LS  A+A S + VTGFS++ G++SALETLCGQAYGA Q+ K+G  TY AI  + ++  P+
Sbjct  70    LSSTAIAVSISAVTGFSVLLGLSSALETLCGQAYGAQQFEKVGVQTYTAIFCVFLICFPL  129

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             S++W F+ K L+FVGQDPLIS EAGK+ VWLI  +F  A LQ LVRY Q QSL++PM++ 
Sbjct  130   SLIWXFLGKLLLFVGQDPLISHEAGKFIVWLIPGLFASAFLQPLVRYFQAQSLVIPMVIF  189

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             S ++L FHIP+CW + +++GL + G AL++  SY  NVILL +Y+K+S  CEK+R  +  
Sbjct  190   SCITLFFHIPLCWFMVYKTGLRNLGGALSMSFSYCLNVILLALYMKFSPKCEKTRGVISM  249

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
             + F  + +FF LA+PSA M CLEWW+FE++ILL GLLPNP++ETSVLS+CL   +  + I
Sbjct  250   ELFQGIRDFFSLAVPSAVMVCLEWWSFELIILLSGLLPNPELETSVLSVCLQTIASLYSI  309

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
              + +GA  STR+SNELGAGN   AR A   V  + ++E +  + +L +LR + GY FSNE
Sbjct  310   AYGLGAAGSTRVSNELGAGNPQAARRATRVVLFLAILETLTLSTILFALRHIFGYTFSNE  369

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
              +VV Y+  M PLV + ++ DGI G+LSG+ARG GWQH+GAYVN G++YL G P A +LG
Sbjct  370   KDVVAYVASMAPLVCISVLMDGIQGVLSGIARGCGWQHIGAYVNFGSFYLCGIPVAALLG  429

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
             FL  ++G GLW+G+ + + VQ  +L+ IT   +W++Q   A +RLL
Sbjct  430   FLVHMKGRGLWIGIQMGAFVQVTLLSFITSRINWEEQARMASDRLL  475



>gb|KHN06722.1| MATE efflux family protein 5 [Glycine soja]
Length=477

 Score =   474 bits (1221),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 245/472 (52%), Positives = 332/472 (70%), Gaps = 3/472 (1%)
 Frame = -2

Query  1582  LLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE-LSLSGG  1406
             LL+++R    ++ D    E+K++  IA+PM++VT  Q ++  VS MM+GH++  L LSG 
Sbjct  5     LLAKQREKQKVTWDGLGEEMKRIICIAVPMVIVTATQYLLQVVSIMMVGHLNNNLYLSGA  64

Query  1405  AVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILW  1226
             A+A S   VTGFS++ GMAS LET+CGQAYGA QY K+G  TY AI SLTVV +P++ +W
Sbjct  65    ALAISLATVTGFSVLAGMASGLETICGQAYGAQQYEKVGVQTYTAIFSLTVVCLPLTFIW  124

Query  1225  VFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALS  1046
             + M+K L+F+GQDPLI+ EAGK+ +WL+ A+F +AI+Q  VRY QMQSL++PML+SS ++
Sbjct  125   ISMEKILVFIGQDPLIAQEAGKFLIWLVPALFAHAIMQPFVRYFQMQSLLLPMLISSCVT  184

Query  1045  LCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFA  866
             LC HIP+CWAL F++G+ + G ALA+ +S W NV  L +Y++YS +C K+R  +  + F 
Sbjct  185   LCIHIPLCWALVFQTGMNNIGGALAMSISIWLNVTFLGLYMRYSPACAKTRAPISMELFQ  244

Query  865   RVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSI  686
              + EFFR AIPSA M CLEWW+FE++ILL GLLPNPQ+ETSVLSICL   S  F IPF I
Sbjct  245   GIWEFFRFAIPSAVMICLEWWSFELLILLSGLLPNPQLETSVLSICLNTISTLFSIPFGI  304

Query  685   GAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVV  506
              A ASTRISNELGAGN   A +AV       ++E  + +  L   R   GY FSNE EVV
Sbjct  305   AAAASTRISNELGAGNPHAAHVAVLAAMSFAIMETAIVSGTLFVCRHDFGYIFSNEKEVV  364

Query  505   DYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTS  326
             DY+  M PL+ + ++ D I G+L+GVARG GWQH+G YVNLGA+YL G P A  L  L  
Sbjct  365   DYVTVMAPLICISVILDSIQGVLAGVARGCGWQHIGVYVNLGAFYLCGIPVAATLAVLAK  424

Query  325   LRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
             +RG GLW+G+ + + VQ ++ + IT   +W++Q  KA++RL  DS   A DN
Sbjct  425   MRGKGLWIGVQVGAFVQCILFSTITSCINWEQQAIKARKRLF-DSEISA-DN  474



>ref|XP_010466975.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 9-like 
[Camelina sativa]
Length=484

 Score =   475 bits (1222),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 238/459 (52%), Positives = 321/459 (70%), Gaps = 1/459 (0%)
 Frame = -2

Query  1576  SEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVA  1397
             S K       KD F AELK ++ +A PM  VTV Q ++  +S M+ GH  EL LSG A+A
Sbjct  16    SPKSTTQTWRKD-FTAELKNVSLMAAPMATVTVAQYLLPVISVMVAGHRGELQLSGVALA  74

Query  1396  TSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFM  1217
             TSF NV+GFS+++G+  ALETLCGQAYGA QY KLGTYTY AI S   + + IS+LW +M
Sbjct  75    TSFANVSGFSIMYGLVGALETLCGQAYGARQYAKLGTYTYSAIASNVPICLLISVLWFYM  134

Query  1216  DKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCF  1037
             DK L+ +GQDP IS  AG Y+V LI A+F  A+ Q L R+LQ Q L++P+L  +  +L F
Sbjct  135   DKLLVSIGQDPDISKVAGSYAVCLIPALFSQAVQQPLTRFLQTQGLVLPLLYCAITTLLF  194

Query  1036  HIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVG  857
             HIPVC  L +  GLGS G ALAI LSYWFNV++L +YV++SSSCEK+R  + +D  + V 
Sbjct  195   HIPVCLTLVYTFGLGSNGAALAISLSYWFNVLILALYVRFSSSCEKTRGFVSDDFVSSVK  254

Query  856   EFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAG  677
             +FF+  IPSA+M C+EW  FE +IL  GLLPNP++ETSVLSICL   SLH+ IP  IGA 
Sbjct  255   QFFQYGIPSAAMTCIEWSLFEFLILSSGLLPNPKLETSVLSICLTTGSLHYVIPMGIGAA  314

Query  676   ASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYI  497
              STRISNELGAGN ++AR+AV+    +  +E  + + +L + R++ GYAFSN  EVVDY+
Sbjct  315   GSTRISNELGAGNPEVARLAVFAGIFLWFLEATICSTLLFTCRNIFGYAFSNSKEVVDYV  374

Query  496   KKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRG  317
              ++ PL+ L  + DG S +L GVARGSGWQH GA+ N+ AYY++GAP    LGF   + G
Sbjct  375   TELSPLLCLSFLVDGFSAVLGGVARGSGWQHFGAWANVVAYYVLGAPVGLFLGFWCHMNG  434

Query  316   MGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
              GLW+G+ + S  Q ++LA++T    W +Q ++A++R++
Sbjct  435   KGLWIGVVVGSTAQGIILAIVTACMSWNEQAAQARKRIV  473



>ref|XP_006654756.1| PREDICTED: MATE efflux family protein 9-like [Oryza brachyantha]
Length=498

 Score =   475 bits (1223),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 243/483 (50%), Positives = 326/483 (67%), Gaps = 13/483 (3%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLA------------ELKKLARIAIPMLVVTVCQQMVIF  1457
             M+  +PLLS + PA   +                  E  K+  +A+PM  ++V Q  V  
Sbjct  1     MEERIPLLSPRGPADGTAGVGGGEEGGDRWWSGLAREAGKVGSMALPMAAMSVAQNAVQV  60

Query  1456  VSTMMLGHISE-LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYT  1280
              S MM+GH+   L LS  A+ATS  +V+GFSL+ GMAS LETLCGQAYGA QY KLG  T
Sbjct  61    ASNMMVGHLPGVLPLSASAIATSLASVSGFSLLVGMASGLETLCGQAYGAKQYDKLGVQT  120

Query  1279  YGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVR  1100
             Y AI++LTVV IPIS+LWVF+ K LI +GQD LIS EAG+Y VWLI  +F YA+ Q L +
Sbjct  121   YRAIVTLTVVTIPISLLWVFIGKLLILIGQDALISQEAGRYIVWLIPGLFAYAVCQPLTK  180

Query  1099  YLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVK  920
             +LQ QSLI PML SS  +L  HIP+ W L F++ +G  G ALAI +SYW N  +L  Y++
Sbjct  181   FLQSQSLIFPMLWSSIATLLLHIPLSWLLVFKTSMGFTGAALAISISYWLNTFMLAAYIR  240

Query  919   YSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSV  740
             +S SCE +R     ++F  VG F RLA+PSA M C EWW+FEI++LL GLLPNP++E+SV
Sbjct  241   FSCSCEVTRSPPTIEAFRGVGLFLRLALPSALMLCFEWWSFEILVLLSGLLPNPELESSV  300

Query  739   LSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVL  560
             LSICL   SL + IP+ +G  ASTR++NELGAGN + AR AV  V  I   E V+   +L
Sbjct  301   LSICLTTTSLMYTIPYGLGGAASTRVANELGAGNPEGARSAVHLVMSIAGTEAVIVTGML  360

Query  559   MSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLG  380
             ++ + ++GYA+S++ EVV Y   M+P V + + +D + G+LSGVARG GWQHLGAYVNLG
Sbjct  361   LAAQRILGYAYSSDEEVVAYFTSMVPFVCISVAADSLQGVLSGVARGCGWQHLGAYVNLG  420

Query  379   AYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
             ++YLVG P A  LGF   + G GLW+G+   S++Q ++LA+I  F++W+K   KA+ERL 
Sbjct  421   SFYLVGIPVALFLGFSLKMEGKGLWLGIAGGSVLQFLLLAVIAFFSNWQKMAEKARERLF  480

Query  199   NDS  191
              ++
Sbjct  481   GET  483



>ref|XP_002440210.1| hypothetical protein SORBIDRAFT_09g027830 [Sorghum bicolor]
 gb|EES18640.1| hypothetical protein SORBIDRAFT_09g027830 [Sorghum bicolor]
Length=514

 Score =   476 bits (1224),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 235/467 (50%), Positives = 328/467 (70%), Gaps = 15/467 (3%)
 Frame = -2

Query  1546  KDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE-LSLSGGAVATSFTNVTGF  1370
             +++   E  K+  +A+PM  V+V Q  V   S MM+GH+   L LS  A+ATS   V+GF
Sbjct  33    RELLAREAGKVGCVALPMAAVSVSQYAVQVASNMMVGHLPGVLPLSASAIATSLATVSGF  92

Query  1369  SLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQ  1190
             SL+ GMAS LETLCGQAYGA QY KLG +TY AI++L VV+IPIS+LW F+ K L+ +GQ
Sbjct  93    SLLIGMASGLETLCGQAYGAKQYDKLGMHTYRAIVTLIVVSIPISLLWAFIGKLLMLIGQ  152

Query  1189  DPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALS  1010
             DPLIS EAG+Y  WLI  +F YAI Q L ++LQ QSLI+PML SS  +L  HIP+CW L 
Sbjct  153   DPLISKEAGRYIAWLIPGLFAYAISQPLTKFLQSQSLIIPMLWSSIATLLLHIPICWLLV  212

Query  1009  FRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPS  830
             F++ LG  G +LAI LSYW NVI+L  Y++YS+SC+++R     ++F  VG F RLA+PS
Sbjct  213   FKTSLGYIGASLAISLSYWLNVIMLAAYIRYSNSCKETRSPPTVEAFKGVGVFLRLALPS  272

Query  829   ASMA--------------CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPF  692
             A M                 EWW+FEI+IL+ G+LPNP+++TSVLSICL   +L + IP+
Sbjct  273   ALMLWFHIGLMNSIPQFYSFEWWSFEILILVSGILPNPELQTSVLSICLTTITLMYTIPY  332

Query  691   SIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETE  512
              +GA ASTR++NELG GN + AR +V  V  I ++E V+  ++L++ + ++GYA+S++ +
Sbjct  333   GLGAAASTRVANELGGGNPEGARSSVQVVMCIAVMEAVIITIILLASQHILGYAYSSDKD  392

Query  511   VVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFL  332
             VV Y+  M+P V + + +D + G+LSG+ARG GWQHLGAYVNLG++YLVG P A  LGF+
Sbjct  393   VVAYVNAMVPFVCVSVAADSLQGVLSGIARGCGWQHLGAYVNLGSFYLVGIPTALFLGFV  452

Query  331   TSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
               +   GLWMG++  S+VQ ++LA+IT F++W+K   KA+ER+ +D 
Sbjct  453   LKMEAKGLWMGISCGSIVQFLLLAIITFFSNWQKMSEKARERVFSDE  499



>ref|NP_178499.2| MATE efflux family protein [Arabidopsis thaliana]
 sp|Q8RWF5.1|MATE9_ARATH RecName: Full=MATE efflux family protein 9; AltName: Full=Protein 
DETOXIFICATION 1-like 5; AltName: Full=Protein DTX6 [Arabidopsis 
thaliana]
 gb|AAM13125.1| unknown protein [Arabidopsis thaliana]
 gb|AAP31968.1| At2g04100 [Arabidopsis thaliana]
 gb|AEC05799.1| MATE efflux family protein [Arabidopsis thaliana]
Length=483

 Score =   474 bits (1221),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 236/446 (53%), Positives = 318/446 (71%), Gaps = 0/446 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F AELK L+R+A+PM  VTV Q ++  +S M+ GH SEL LSG A+ATSFTNV+GFS++F
Sbjct  27    FTAELKNLSRMALPMATVTVAQYLLPVISVMVAGHRSELQLSGVALATSFTNVSGFSVMF  86

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             G+A ALETLCGQAYGA QY K+GTYT+ AI+S   + + ISILW +MDK  + +GQDP I
Sbjct  87    GLAGALETLCGQAYGAKQYAKIGTYTFSAIVSNVPIVVLISILWFYMDKLFVSLGQDPDI  146

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S  AG Y+V LI A+   A+ Q L R+LQ Q L++P+L  +  +L FHIPVC  L +  G
Sbjct  147   SKVAGSYAVCLIPALLAQAVQQPLTRFLQTQGLVLPLLYCAITTLLFHIPVCLILVYAFG  206

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             LGS G ALAIGLSYWFNV++L +YV++SSSCEK+R  + +D    V +FF+  IPSA+M 
Sbjct  207   LGSNGAALAIGLSYWFNVLILALYVRFSSSCEKTRGFVSDDFVLSVKQFFQYGIPSAAMT  266

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
              +EW  FE +IL  GLLPNP++ETSVLSICL   SLH+ IP  IGA  S R+SNELGAGN
Sbjct  267   TIEWSLFEFLILSSGLLPNPKLETSVLSICLTTSSLHYVIPMGIGAAGSIRVSNELGAGN  326

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
              ++AR+AV+    +  +E  + + +L   R + GYAFSN  EVVDY+ ++ PL+ +  + 
Sbjct  327   PEVARLAVFAGIFLWFLEATICSTLLFICRDIFGYAFSNSKEVVDYVTELSPLLCISFLV  386

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             DG S +L GVARGSGWQH+GA+ N+ AYYL+GAP    LGF   + G GLW+G+ + S  
Sbjct  387   DGFSAVLGGVARGSGWQHIGAWANVVAYYLLGAPVGLFLGFWCHMNGKGLWIGVVVGSTA  446

Query  277   QNVVLALITIFTDWKKQESKAQERLL  200
             Q ++LA++T    W +Q +KA++R++
Sbjct  447   QGIILAIVTACMSWNEQAAKARQRIV  472



>ref|XP_010488662.1| PREDICTED: MATE efflux family protein 9-like [Camelina sativa]
Length=484

 Score =   474 bits (1221),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 235/456 (52%), Positives = 318/456 (70%), Gaps = 0/456 (0%)
 Frame = -2

Query  1567  RPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSF  1388
             +P     +  F AELK ++ +  PM  VTV Q ++  +S M+ GH  EL LSG A+ATSF
Sbjct  18    KPTTHTWRKDFTAELKNVSLMGAPMATVTVAQYLLPVISVMVAGHRGELQLSGVALATSF  77

Query  1387  TNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKF  1208
              NV+GFS+++G+  ALETLCGQAYGA QY KLGTYTY AI S   + + IS+LW +MDK 
Sbjct  78    ANVSGFSIMYGLVGALETLCGQAYGAKQYAKLGTYTYSAIASNVPICLLISVLWFYMDKL  137

Query  1207  LIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIP  1028
             L+ +GQDP IS  AG Y+V LI A+F  A+ Q L R+LQ Q L++P+L  +  +L FHIP
Sbjct  138   LVSIGQDPDISKVAGSYAVCLIPALFSQAVQQPLTRFLQTQGLVLPLLYCAITTLLFHIP  197

Query  1027  VCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFF  848
             VC  L +  GLGS G ALAI LSYWFNV++L +YV++SSSCEK+R  + +D  + V +FF
Sbjct  198   VCLTLVYTFGLGSNGAALAISLSYWFNVLILALYVRFSSSCEKTRGFVSDDFVSSVKQFF  257

Query  847   RLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGAST  668
             +  IPSA+M C+EW  FE +IL  GLLPNP++ETSVLSICL   SLH+ IP  IGA  ST
Sbjct  258   QYGIPSAAMTCIEWSLFEFLILSSGLLPNPKLETSVLSICLTTGSLHYVIPMGIGAAGST  317

Query  667   RISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKM  488
             RISNELGAGN ++AR+AV+    +  +E      +L + R++ GYAFSN  EVVDY+ ++
Sbjct  318   RISNELGAGNPEVARLAVFAGIFLWFLEATTCCTLLFACRNIFGYAFSNSKEVVDYVTEL  377

Query  487   IPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGL  308
              PL+ L  + DG S +L GVARGSGWQH+GA+ N+ AYYL+GAP    LGF   + G GL
Sbjct  378   SPLLCLSFLVDGFSAVLGGVARGSGWQHIGAWANVVAYYLLGAPVGLFLGFWCHMNGKGL  437

Query  307   WMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
             W+G+ + S  Q ++LA++T    W +Q ++A++R++
Sbjct  438   WIGVVVGSTAQGIILAIVTACMSWNEQAAQARKRIV  473



>gb|KEH44144.1| MATE efflux family protein [Medicago truncatula]
Length=488

 Score =   474 bits (1220),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 240/457 (53%), Positives = 330/457 (72%), Gaps = 2/457 (0%)
 Frame = -2

Query  1591  EVPLLSEKRP--AAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
             E  LL + R   + +I+  VF  E+K +  +A+PM+ VT+ Q  +  +S +M+G + +L+
Sbjct  2     EKGLLEKDREGDSRSITWGVFFQEVKDVCFLALPMIAVTLSQYFLQIISMIMVGRLGKLA  61

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LS  A+A S   V+GFSL+FGM+ ALET CGQAYGA QY K G   Y A+ SL +  +P+
Sbjct  62    LSSTAIAISLCGVSGFSLLFGMSCALETQCGQAYGAKQYKKFGVQIYTAVFSLIIACLPL  121

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             S+LW+F+ + LI +GQDPLIS EAGK+S+ +I A+F YA LQ LVRY  MQSLI+P+++S
Sbjct  122   SLLWIFLGRLLILLGQDPLISQEAGKFSMCMIPALFAYATLQALVRYFLMQSLILPLVIS  181

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             S ++LCFH+  CW L F+SGLG  G AL+IG SYW NVI+L +Y+K+S+ CE++RV +  
Sbjct  182   STVTLCFHVAFCWLLVFKSGLGCLGAALSIGTSYWLNVIILGLYMKFSTDCEETRVPISM  241

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
             + F  VGEFFR AIPSA M CLEWW+FE++ILL GLLPNPQ+ETSVLSICL I S  + I
Sbjct  242   EPFLGVGEFFRYAIPSAGMICLEWWSFELLILLSGLLPNPQLETSVLSICLSIISTIYTI  301

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
             P + G+ ASTR+SN LG G    AR++V+    + + E ++ +  + + R V+GY FSNE
Sbjct  302   PEATGSAASTRVSNALGGGCPQAARLSVFASMTVAVSEAILVSSTIFASRKVLGYIFSNE  361

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
              +VVDY+  M+PL+S+ ++ D + G LSG+ARGSGWQ LGAYVNLGAYY+ G P A +LG
Sbjct  362   QDVVDYVTHMVPLISINVIVDSLHGTLSGIARGSGWQKLGAYVNLGAYYVFGIPIAVILG  421

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQ  227
             F   LRG GLW+G+ + +  Q ++LALIT FT+W+KQ
Sbjct  422   FWFELRGKGLWIGILVGAFCQALLLALITGFTNWEKQ  458



>ref|XP_010427940.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Camelina 
sativa]
Length=458

 Score =   473 bits (1217),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 238/471 (51%), Positives = 324/471 (69%), Gaps = 20/471 (4%)
 Frame = -2

Query  1600  MD-AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE  1424
             MD AE  LL++        KD F+ E+++LA IA PM+ V +    +  +S +M+GH+ E
Sbjct  1     MDSAEKGLLAKSDKEEVNKKDGFIQEMRRLAYIAGPMVAVNLSMDFLQVISVVMIGHLGE  60

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+A SF + TGFSL+FG+ASALETLCGQAYGA QY KLG +TY  I+SL +V I
Sbjct  61    LFLSSTAIAVSFCSATGFSLVFGLASALETLCGQAYGAKQYEKLGVHTYTTILSLYLVCI  120

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW +M   L  +GQDPL++ EAGK++ WLI A+F YA LQ LV++ Q QSLI P++
Sbjct  121   PLSVLWNYMGAILSLIGQDPLVAQEAGKFATWLIPALFAYATLQPLVQFFQAQSLIFPLI  180

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             +SS  +LC H+ +CW+L F+ GLGS G A+AIG+SYW NVI+L +Y+K+SSSC KSR  +
Sbjct  181   ISSLSALCCHLVLCWSLVFKFGLGSVGAAIAIGVSYWLNVIVLGLYMKFSSSCSKSRATI  240

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                 F  + EFF L IPSASM CLEWW+FE ++LL G+LPN  +ETSVLS+C        
Sbjct  241   SMSVFRGMKEFFWLGIPSASMICLEWWSFEFLVLLSGILPNSTLETSVLSVC--------  292

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
                        TR++NELGAGN   ARMAV+ V +I  +E ++ + ++   R+V GY FS
Sbjct  293   -----------TRVANELGAGNPKQARMAVYTVMVIAGVESILVSAIVFGSRNVFGYLFS  341

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +ETEVVDY++ M PLVSL+++ D +   LSGVARG+G Q +GAYVNL AYYL G P A +
Sbjct  342   SETEVVDYVRSMAPLVSLLVILDALHTTLSGVARGAGRQDIGAYVNLAAYYLCGTPTAII  401

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             L F   + G GLW+G+ + S VQ  +L LI I T+W+++   A+ERL+ + 
Sbjct  402   LAFGFKMAGRGLWIGITVGSFVQAFLLGLIVILTNWEQEAKNARERLMAEE  452



>ref|XP_009356182.1| PREDICTED: MATE efflux family protein 8-like [Pyrus x bretschneideri]
Length=495

 Score =   474 bits (1219),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 240/449 (53%), Positives = 321/449 (71%), Gaps = 0/449 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F  E+K+L  IA PM+ V + Q M+ F+S MM+GH+ EL+LS  ++A S   VTGFSL  
Sbjct  33    FFEEVKRLGCIAGPMVAVVLSQYMLRFISMMMVGHLGELALSSSSIAISLAGVTGFSLFL  92

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             GMASALETLCGQAYGA QY +LG  TY AI SL +V +P+S++W++ ++ LIF GQDP I
Sbjct  93    GMASALETLCGQAYGAEQYQELGLLTYTAIFSLNMVCLPLSLIWIYTEEILIFTGQDPAI  152

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S +AGKY++WLI  +F YA LQ L+RY Q QSL++P+L++S  +  FHIP+ W L F+SG
Sbjct  153   SRKAGKYTIWLIPGLFAYATLQPLIRYFQTQSLVMPLLVTSFATFLFHIPLFWILIFKSG  212

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             L   G ALAIG+SYW NVI L +Y+K+S +C K+R  +  D F  +GEFFR A+PSA M 
Sbjct  213   LEHLGGALAIGISYWLNVIFLWLYMKFSPACSKTRAPISKDIFHSIGEFFRFALPSAVMQ  272

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW+FE++ILL GLLPNP +ETSVLS CL+  S  + IP++ GA  STR+SNELGAGN
Sbjct  273   CLEWWSFELLILLSGLLPNPALETSVLSACLLAISTIYAIPYAFGAAVSTRVSNELGAGN  332

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
               LAR+A +    + + E  +    L + R V GY FSNE EV+DY+  M+P+V   ++ 
Sbjct  333   PQLARIATFAAMFLAVAETSMTTTTLFACRKVFGYTFSNEKEVIDYVTIMVPIVCPSVIL  392

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D + G+L+G+ARG+GWQH+GAY+NLGAYYL G P A  L F   LRG GLW+G+ + + V
Sbjct  393   DSMHGVLTGIARGTGWQHIGAYINLGAYYLCGIPVAIALAFWVQLRGRGLWIGIQVGAFV  452

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDS  191
             Q  +LAL T  T+W+KQ SKA+ R+ + S
Sbjct  453   QVSLLALGTCCTNWEKQASKARVRIFDRS  481



>ref|XP_009606968.1| PREDICTED: MATE efflux family protein 9-like [Nicotiana tomentosiformis]
Length=468

 Score =   473 bits (1216),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 231/430 (54%), Positives = 321/430 (75%), Gaps = 3/430 (1%)
 Frame = -2

Query  1552  ISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTG  1373
             ISK    A  K+++RIAIPM+VV +CQ ++ +   +MLGH+SELS S  ++ATS+ NVTG
Sbjct  12    ISKK---AVFKEVSRIAIPMIVVHLCQFLLRYAPMVMLGHLSELSFSSASIATSYCNVTG  68

Query  1372  FSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVG  1193
             F+++FG+A+   TLCGQAYGA QY K+GT T  AI+ L    +P+S++W+F  K L+++G
Sbjct  69    FAILFGLATGSITLCGQAYGARQYQKVGTITCAAIIFLLFACLPVSLIWIFTGKLLLWIG  128

Query  1192  QDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWAL  1013
             QDPLIS EAGKYS++LI  + PYAILQ LV Y Q QSLI+PM+ +S  SLCF++P+ WAL
Sbjct  129   QDPLISVEAGKYSIYLIPTLVPYAILQSLVCYFQTQSLIIPMVWTSVASLCFNVPISWAL  188

Query  1012  SFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIP  833
              F+  LG++G A+AIG SYW NVILLV+Y+KYSS+C+K+R     D F  + EFF+ AIP
Sbjct  189   VFKYELGASGAAMAIGSSYWLNVILLVIYLKYSSTCQKTRPFFSKDVFLVMPEFFQFAIP  248

Query  832   SASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNE  653
             SA+M CL+WW  E+++L  GLLPNPQ+ETSV SICL   SLH++IP S  A ASTRISNE
Sbjct  249   SAAMVCLKWWATELILLFCGLLPNPQLETSVQSICLTTTSLHYFIPCSFSAAASTRISNE  308

Query  652   LGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVS  473
             LGAGN    R++++ V  +  +E ++A+ ++  LR+V G AF++E EVV+ I+++ PL+ 
Sbjct  309   LGAGNPKAVRISIYVVFALATVEFLLASAIIFWLRNVWGLAFTHEEEVVNLIEELTPLLC  368

Query  472   LMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLN  293
             L ++ D I  LL+GVARGSGWQH+ AYVNLGAYYL+G PA+ ++GF+ + +  GLW GL 
Sbjct  369   LSIILDSIITLLAGVARGSGWQHIVAYVNLGAYYLIGIPASLLMGFVLNWKEKGLWSGLI  428

Query  292   LASLVQNVVL  263
             + S+VQ ++ 
Sbjct  429   MGSVVQAILF  438



>ref|XP_003526583.2| PREDICTED: MATE efflux family protein 5-like [Glycine max]
 gb|KHN03904.1| MATE efflux family protein 9 [Glycine soja]
Length=480

 Score =   473 bits (1218),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 241/447 (54%), Positives = 319/447 (71%), Gaps = 1/447 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE-LSLSGGAVATSFTNVTGFSLIFGM  1352
             E+K++  IA PM+VVT  Q+++  VS MM+GH+++ L LS  A+A S T VTGFS + GM
Sbjct  26    EMKRMIDIAGPMVVVTASQRLLQVVSVMMVGHLNDDLFLSSAALAISLTAVTGFSFLMGM  85

Query  1351  ASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISA  1172
             AS LET+CGQAYGA Q+ K+G  TY AI +LT V +P + LW+ M+K L+F+GQDPLI+ 
Sbjct  86    ASGLETICGQAYGAQQHKKIGVQTYTAIFALTFVCLPFTFLWINMEKILVFIGQDPLIAK  145

Query  1171  EAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLG  992
             EAGK+ +WLI A+F YAILQ LVRY QMQSL++PML++S ++LC HIP+CW L F++ L 
Sbjct  146   EAGKFIIWLIPALFAYAILQPLVRYFQMQSLLLPMLMTSCVTLCVHIPLCWVLVFKTRLN  205

Query  991   SAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACL  812
             + G ALA+ +S W NVI L +Y++YS  C K+R  +  + F  + EFFR AIPSA M CL
Sbjct  206   NVGGALAMSISTWSNVIFLGLYMRYSPRCAKTRAPISMELFQGLREFFRFAIPSAVMICL  265

Query  811   EWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTD  632
             EWW+FE++ILL GLL NPQ+ETSVLSICL   S+ + IPF IGA ASTRISNELGAGN  
Sbjct  266   EWWSFELIILLSGLLLNPQLETSVLSICLNTTSILYAIPFGIGAAASTRISNELGAGNPH  325

Query  631   LARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDG  452
              A ++V       +IE  V +  L + R V GY FSNE EVVDY+  M PLV + ++ D 
Sbjct  326   GACVSVLAAISFAIIETTVVSGTLFACRHVFGYVFSNEKEVVDYVTVMAPLVCISVILDN  385

Query  451   ISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQN  272
             I G+L+GVARG GWQH+G YVN+GA+YL G P A +L F   +RG GLW+G+ + S  Q 
Sbjct  386   IQGVLAGVARGCGWQHIGVYVNIGAFYLCGIPMAILLSFFAKMRGKGLWIGVQVGSFAQC  445

Query  271   VVLALITIFTDWKKQESKAQERLLNDS  191
             V+L+ IT   +W++Q  KA++RL    
Sbjct  446   VLLSTITSCINWEQQTIKARKRLFGSE  472



>ref|XP_010681702.1| PREDICTED: MATE efflux family protein 6-like [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   473 bits (1217),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 316/446 (71%), Gaps = 0/446 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             E+K+++ +A PM+ V + Q ++  VS MM+GH+  L LS  A+A S   VTGFSL+ GMA
Sbjct  27    EIKRVSWVAGPMVAVLMSQYLLQVVSLMMVGHLGALYLSSTALAVSLAAVTGFSLLLGMA  86

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
              ALET+ GQAYGA QY KLGT TY AI SL++ +IP+ I+W++M   L+F+GQDP I+ E
Sbjct  87    GALETISGQAYGAQQYQKLGTQTYTAIFSLSLFSIPLCIIWIYMGNILVFIGQDPSIAHE  146

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             AG++  +L   +F YA+ Q L+RY Q QSL+VPM++SS  +LC HIP+CWAL F+SGLG+
Sbjct  147   AGRFMTYLTPTLFAYAVFQPLLRYFQSQSLVVPMVVSSVATLCLHIPLCWALVFKSGLGN  206

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
              G A+A+ LS W + I L +Y+K S SC  +R  L  + F  +GEF R AIPSASM CLE
Sbjct  207   LGGAVAMSLSNWLSAIFLALYMKLSPSCAPTRSPLSMEIFHGIGEFLRFAIPSASMICLE  266

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW+FE++ILL G L NP++ETSVLS+CL   S  F IP+ I A ASTRI+NELGAGN   
Sbjct  267   WWSFELLILLSGFLTNPELETSVLSVCLTTISTLFSIPYGISAAASTRIANELGAGNPQA  326

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
             AR+A  GV+++G+   +V + VL + R V GY FSN+ EVVDY+  M PLV + ++ D  
Sbjct  327   ARIAACGVSVLGVANGLVVSSVLFATRKVFGYCFSNDKEVVDYVTTMAPLVCVNILLDST  386

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
               +LSGVARG GWQH+G+ VNL A+YLVG P A +LGF   +RG GLW+G+   +L Q  
Sbjct  387   QAVLSGVARGCGWQHIGSLVNLAAFYLVGIPVAAVLGFWMQMRGRGLWIGVMCGALTQCA  446

Query  268   VLALITIFTDWKKQESKAQERLLNDS  191
             +LA++T  T+WK++  KA++RL   +
Sbjct  447   LLAIVTGRTNWKEEAKKARKRLTEQT  472



>ref|XP_003569578.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Brachypodium 
distachyon]
Length=492

 Score =   473 bits (1217),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 242/476 (51%), Positives = 328/476 (69%), Gaps = 4/476 (1%)
 Frame = -2

Query  1612  LLPEMDAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGH  1433
             LLP  D E     EK+ AAA     + +E  KLA +A+PM+ V++ Q  V   S MM+GH
Sbjct  10    LLPRKDQEAADDGEKKDAAAAG---WRSETGKLAYLALPMVAVSLSQYAVQVSSNMMVGH  66

Query  1432  ISE-LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLT  1256
             +   L LS  A+ATS  +V+GFSL+ GMASALETLCGQAYGA QYH LG + Y A ++L 
Sbjct  67    LPGVLPLSSAAIATSLASVSGFSLLIGMASALETLCGQAYGAKQYHTLGLHAYRATVTLL  126

Query  1255  VVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLI  1076
              V +P+S+LW FM K L+ +GQDPLI+  AG+Y VWLI  +F  A++Q   ++LQ QSLI
Sbjct  127   AVCVPLSLLWAFMGKVLVLLGQDPLIAHGAGRYIVWLIPGLFANAVIQPATKFLQSQSLI  186

Query  1075  VPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKS  896
             +P+L SS  +L  H+P+CWA+ FRSG+G  G ALA+ +S W N  +LV Y+  SSSC+ +
Sbjct  187   MPLLASSVATLALHVPLCWAMVFRSGMGYTGAALAVSVSSWINAAMLVAYIALSSSCQDT  246

Query  895   RVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMIC  716
             R      +F  VG F RLA+PSA M CLEWW+FEI+IL+ GLLPNP+++TSVLSICL   
Sbjct  247   RTPPTVKAFTGVGVFLRLALPSALMICLEWWSFEILILMSGLLPNPELQTSVLSICLTSV  306

Query  715   SLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVG  536
             S  + IP  +GAG STR++NELGAGN   AR AV  +  I + E V+ +  L+  R ++G
Sbjct  307   SSLYSIPSGLGAGGSTRVANELGAGNPLGARSAVRVMMSIAVTEAVLVSGTLVLSRRLLG  366

Query  535   YAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAP  356
              A+S+E +VV  +  M+PLVS+ +V+DG+ G LSGVARG GWQHLGAYVNLG++YL+G P
Sbjct  367   RAYSSEEQVVSAVAAMVPLVSITVVTDGLQGALSGVARGCGWQHLGAYVNLGSFYLLGIP  426

Query  355   AAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
              A +LGF+ ++   GLWMG+   S+ Q  +L+ IT F DW+K   +A+ER L++  
Sbjct  427   IALILGFVLNMGAKGLWMGIICGSISQTTLLSAITFFIDWQKMADQARERSLSEKE  482



>ref|XP_009615041.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Nicotiana 
tomentosiformis]
Length=483

 Score =   473 bits (1216),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 240/470 (51%), Positives = 326/470 (69%), Gaps = 1/470 (0%)
 Frame = -2

Query  1579  LSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAV  1400
             + E +    +  +V   E+K++  +A PM+ VT+ Q  +  +S MM+GH+ ELSLS  A+
Sbjct  12    VKEDKGVVELRWEVIWEEVKEVGYLAGPMIAVTLSQYFLQVISMMMVGHLGELSLSSTAI  71

Query  1399  ATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVF  1220
             A S   VTGFS + GMASALETLCGQA+GA QY +LGT TY AI SL +V IP++ILW++
Sbjct  72    ALSLAGVTGFSFLLGMASALETLCGQAFGAKQYQRLGTQTYTAIFSLFIVCIPLTILWMY  131

Query  1219  MDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLC  1040
             M K L F+GQDP IS EAGK+  WLI A+F YA L  L+RY QMQS+I PML+SS +++C
Sbjct  132   MGKLLTFIGQDPQISHEAGKFIKWLIPALFAYANLHPLIRYYQMQSMIAPMLVSSCVTIC  191

Query  1039  FHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARV  860
             FHIP+ W L F SGLG+ G A+AIG+S W NVI+L  Y++ S +C K+R  +  +    +
Sbjct  192   FHIPLSWMLVFCSGLGNIGAAIAIGISMWLNVIILASYMRLSPACAKTRAPMSWEIVKGM  251

Query  859   GEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGA  680
              EFF+ AIPSA M CLEWW+FE++ILL GLLPNPQ+E SVLSICL   S  + IPF +  
Sbjct  252   REFFQFAIPSAIMICLEWWSFELLILLSGLLPNPQLEASVLSICLNTISTLYAIPFGLAG  311

Query  679   GASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDY  500
               S R+SN+LGAGN   AR++V    ++   E ++ +  + + R+V GY FSNE EVVDY
Sbjct  312   AVSIRVSNQLGAGNPQGARVSVLSAMLMATTETILVSTTVFACRNVFGYIFSNEKEVVDY  371

Query  499   IKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLR  320
             +  M PL+ + +++D + G LSGVARG GWQH+GAYVNL ++YL G P A  L F  + R
Sbjct  372   VANMAPLLCISVITDSLQGTLSGVARGCGWQHIGAYVNLASFYLCGIPIAASLAFWLNFR  431

Query  319   GMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
             G GLW+G+   + VQ+++L++IT  TDWKKQ + A+ERL  D    ++DN
Sbjct  432   GKGLWIGVLSGAAVQSILLSVITCCTDWKKQAAMARERLHAD-EKSSIDN  480



>ref|XP_010514294.1| PREDICTED: MATE efflux family protein 9-like isoform X1 [Camelina 
sativa]
Length=484

 Score =   473 bits (1216),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 237/459 (52%), Positives = 321/459 (70%), Gaps = 1/459 (0%)
 Frame = -2

Query  1576  SEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVA  1397
             S K       KD F AELK ++ +A PM  VTV Q ++  +S M+ GH  EL LSG A+A
Sbjct  16    SPKSTTQTWRKD-FTAELKNVSLMAAPMATVTVAQYLLPVISVMVAGHRGELQLSGVALA  74

Query  1396  TSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFM  1217
             TSF NV+GFS+++G+  ALETLCGQAYGA QY ++GTYTY AI S   + + IS+LW +M
Sbjct  75    TSFANVSGFSIMYGLVGALETLCGQAYGAKQYAEIGTYTYSAIASNVPICLLISVLWFYM  134

Query  1216  DKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCF  1037
             DK L+ +GQDP IS  AG Y+V LI A+F  A+ Q L R+LQ Q L++P+L  +  +L F
Sbjct  135   DKLLVSIGQDPDISKVAGSYAVCLIPALFSQAVQQPLTRFLQTQGLVLPLLYCAITTLLF  194

Query  1036  HIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVG  857
             HIPVC  L +  GLGS G ALAI LSYWFNV++L +YV++SSSCEK+R  + +D  + V 
Sbjct  195   HIPVCLTLVYTFGLGSNGAALAISLSYWFNVLILALYVRFSSSCEKTRGFVSDDFVSSVK  254

Query  856   EFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAG  677
             +FF+  IPSA+M C+EW  FE +IL  GLLPNP++ETSVLSICL   SLH+ IP  IGA 
Sbjct  255   QFFQYGIPSAAMTCIEWSLFEFLILSSGLLPNPKLETSVLSICLTAGSLHYVIPMGIGAA  314

Query  676   ASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYI  497
              STRISNELGAGN ++AR+AV+    +  +E  + + +L + R++ GYAFSN  EVVDY+
Sbjct  315   GSTRISNELGAGNPEVARLAVFAGIFLWFLEATICSTLLFACRNIFGYAFSNSKEVVDYV  374

Query  496   KKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRG  317
              ++ PL+ L  + DG S +L GVARGSGWQH+GA+ N+ AYYL+GAP    LGF   + G
Sbjct  375   TELSPLLCLSFLVDGFSAVLGGVARGSGWQHIGAWANVVAYYLLGAPVGLFLGFWCHMNG  434

Query  316   MGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLL  200
              GLW+G+ + S  Q ++LA++T    W +Q ++A +R++
Sbjct  435   RGLWIGVVVGSTAQGIILAIVTACMSWNEQATQAGKRIV  473



>ref|XP_004299024.1| PREDICTED: MATE efflux family protein 9-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   472 bits (1214),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 244/447 (55%), Positives = 324/447 (72%), Gaps = 0/447 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F+ E+K+L  IA PM+ V + Q  +  VS MM+GH+ +LSLS  A+A SF  V+GFSLIF
Sbjct  22    FVREVKRLGYIAGPMVAVNLSQYFLQIVSIMMVGHLGQLSLSSTAIAISFCAVSGFSLIF  81

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             GMA ALETL GQAYGA QY +LG +   AI SL +V +P+S++W++M+K L+ +GQDPLI
Sbjct  82    GMACALETLSGQAYGAQQYRQLGLHISTAIFSLMLVCLPLSLVWIYMEKILVLLGQDPLI  141

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAG+++  L+ A+F YA LQ L +YLQ QSLIVP+LLSS   +CFHI VCW L F+SG
Sbjct  142   SHEAGRFARMLLPALFAYAALQPLCKYLQTQSLIVPLLLSSCACVCFHILVCWLLVFKSG  201

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             LG+ G ALAIG+SYW NV+LLV+YVKYSS+C  +RV +  + F  +GEF R AIPSA M 
Sbjct  202   LGNLGAALAIGMSYWLNVVLLVLYVKYSSTCAHTRVQISFEVFQGIGEFLRFAIPSAIMI  261

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             CLEWW+FE++ LL G LPNP++ETSVLS+CL   +  F IP ++GA  STR+SNELGAGN
Sbjct  262   CLEWWSFELLTLLAGFLPNPRLETSVLSVCLSTIASLFTIPEALGAAVSTRVSNELGAGN  321

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
                AR+AV     + +   V+ +  + + RSV GY FSNE EVVDY+  + PL+ L +++
Sbjct  322   PQAARLAVIASMFLTVSGSVIISSTVFASRSVFGYIFSNEKEVVDYVTAIAPLLCLSVIT  381

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D + G LSG+ARGSGWQ LG YVNLGAYYL+G P A  LGF    RG GLW+G+ + S +
Sbjct  382   DSLHGNLSGIARGSGWQDLGVYVNLGAYYLIGIPVAATLGFWFDFRGRGLWIGILVGSFL  441

Query  277   QNVVLALITIFTDWKKQESKAQERLLN  197
             Q V+ ++IT  T+W+++  KA+ER+  
Sbjct  442   QVVLYSIITSCTNWEEKAKKARERVFE  468



>emb|CDM83923.1| unnamed protein product [Triticum aestivum]
Length=483

 Score =   471 bits (1213),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 241/470 (51%), Positives = 330/470 (70%), Gaps = 3/470 (1%)
 Frame = -2

Query  1594  AEVPLLSEK--RPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE-  1424
             AE PLL  K    AA      + +E  KLA +A+PM+ V++ Q  V   S MM+GH+   
Sbjct  2     AEAPLLPRKDQEDAAEEGPGRWRSEAGKLAYLALPMVAVSLSQYAVQVSSNMMVGHLPGV  61

Query  1423  LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAI  1244
             L LS  A+ATS  +VTGFSL+ GMASALETLCGQAYGA QYH LG +TY AI++L VV +
Sbjct  62    LPLSSAAIATSLASVTGFSLLIGMASALETLCGQAYGARQYHTLGLHTYRAIVTLLVVCV  121

Query  1243  PISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPML  1064
             P+S+LW FM K L+ +GQDPLI+  AG+Y VWLI  +F  A++Q + ++LQ QSL  P+L
Sbjct  122   PLSLLWAFMGKILVLIGQDPLIADGAGRYIVWLIPGLFANAVIQPITKFLQSQSLTTPLL  181

Query  1063  LSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCL  884
             LSS  +L  H+P+CW + FR+G+G  G ALAI +SYW NV +LV Y+  SSSC+++R   
Sbjct  182   LSSVATLALHVPLCWVMVFRTGMGYTGAALAISVSYWLNVAMLVAYIVMSSSCKETRTPP  241

Query  883   WNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHF  704
                +F  VG F RLA+PSA M CLEWW+FE++IL+ GLLPNP+++TSVLSICL   +L F
Sbjct  242   TIKAFRGVGVFLRLALPSALMICLEWWSFELLILMSGLLPNPELQTSVLSICLTSITLLF  301

Query  703   YIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFS  524
              IP+ +GA  STR++NELG GN + AR AV  V  + + E V+ +  L+  R ++G A+S
Sbjct  302   TIPYGLGAAGSTRVANELGVGNPEGARSAVRVVMSVAVTEAVIVSGALLLSRRLLGRAYS  361

Query  523   NETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGM  344
             +E EV   +  M+PLV + +V+DG+ G+LSGVARG GWQH+GAYVNLG++YL+G P A +
Sbjct  362   SEEEVASAVAAMVPLVCITVVTDGLQGVLSGVARGCGWQHVGAYVNLGSFYLLGIPMAML  421

Query  343   LGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             LGF+  +   GLWMG+   S+ Q  +L+ IT FT+W+K   +A+ER L++
Sbjct  422   LGFVLKMGAKGLWMGVVCGSISQTTLLSAITFFTNWQKMADEARERSLSE  471



>ref|XP_003567938.1| PREDICTED: MATE efflux family protein 6-like [Brachypodium distachyon]
Length=514

 Score =   473 bits (1216),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 234/450 (52%), Positives = 322/450 (72%), Gaps = 3/450 (1%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE---LSLSGGAVATSFTNVTGFSLIF  1358
             E +K+A +A+PM  V+V Q  V   S MM+GH+     L LS  A+ATS  +V+GFSL+ 
Sbjct  52    EGRKVAHVALPMAAVSVAQYAVQLASNMMVGHLPGGGVLPLSASAIATSLASVSGFSLLI  111

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             GMAS LETLCGQAYGA QY KLG  TY AI++LT V+IPIS+LWVFM K L  +GQDPLI
Sbjct  112   GMASGLETLCGQAYGAEQYGKLGVQTYRAIVTLTAVSIPISLLWVFMGKLLNIIGQDPLI  171

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S EAG+Y +WLI  +F YA+ Q L ++LQ QSLI+PML SS  +L  HIP+ W L F++ 
Sbjct  172   SQEAGRYIIWLIPGLFAYAVSQPLTKFLQSQSLIIPMLWSSIATLVLHIPLSWLLVFKTS  231

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             LG  G ALAI +SYW NV +LV Y++ S+SC+++      D+F+ VG F RLA+PSA M 
Sbjct  232   LGFIGAALAISISYWLNVFMLVGYIRCSTSCKETFSPPTLDAFSGVGVFMRLALPSALML  291

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
             C EWW+FE++ILL GLLPNP+++TSVLSIC+   +L + I + +GA ASTR++NELGAGN
Sbjct  292   CFEWWSFEVIILLSGLLPNPELQTSVLSICMTTVTLMYTIAYGLGAAASTRVANELGAGN  351

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
              + AR+AV  + +I + E  +    L++ + ++GYA+S + EVV+Y+  M+P V + + S
Sbjct  352   PEGARLAVRVIMLIAVTEAALITGTLLASQHILGYAYSTDKEVVEYVNAMVPFVCISVAS  411

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             D + G+LSG+ARG GWQHLGAYVNLG++YL G P + +LGF   + G GLWMG++  SLV
Sbjct  412   DSLQGVLSGIARGCGWQHLGAYVNLGSFYLFGIPMSLLLGFGLKMGGKGLWMGISSGSLV  471

Query  277   QNVVLALITIFTDWKKQESKAQERLLNDSH  188
             Q ++LA I  F++W+K   KA+E + + + 
Sbjct  472   QFILLATIVFFSNWQKMSDKAREGVFSGTQ  501



>gb|EEC79664.1| hypothetical protein OsI_20909 [Oryza sativa Indica Group]
Length=500

 Score =   471 bits (1213),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 238/485 (49%), Positives = 327/485 (67%), Gaps = 15/485 (3%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLA--------------ELKKLARIAIPMLVVTVCQQMV  1463
             M+  +PLLS++ PA   +                    E  K+  +A+PM  ++V Q  V
Sbjct  1     MEERIPLLSKRFPADGTAGVGGGREEEGGDRWWSGLAREAGKVGSMALPMAAMSVAQNAV  60

Query  1462  IFVSTMMLGHISE-LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGT  1286
                S MM+GH+   L LS  A+ATS  +V+GFSL+ GMAS LETLCGQAYGA QY KLG 
Sbjct  61    QVASNMMVGHLPGVLPLSASAIATSLASVSGFSLLVGMASGLETLCGQAYGAKQYDKLGV  120

Query  1285  YTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCL  1106
              TY AI++LTVV IPIS+LWVF+ K L  +GQDP+IS EAG+Y VWLI  +F YA+ Q L
Sbjct  121   QTYRAIVTLTVVTIPISLLWVFIGKLLTLIGQDPVISHEAGRYIVWLIPGLFAYAVCQPL  180

Query  1105  VRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVY  926
              ++LQ QSLI PML SS  +L  HIP+ W L F++ +G  G ALAI +SYW N  +L  Y
Sbjct  181   TKFLQSQSLIFPMLWSSIATLLLHIPLSWLLVFKTSMGFTGAALAISISYWLNTFMLAAY  240

Query  925   VKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVET  746
             +++S SC+ +R     ++F  VG F R+A+PSA M C EWW+FEI++LL GLLPNP++E+
Sbjct  241   IRFSCSCKVTRSPPTIEAFRGVGLFLRIALPSALMLCFEWWSFEILVLLSGLLPNPELES  300

Query  745   SVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAV  566
             SVLSICL   SL + IP+ +G  ASTR++NELGAGN + AR AV  V  I   E V+   
Sbjct  301   SVLSICLTTTSLMYTIPYGLGGAASTRVANELGAGNPEGARSAVHLVMSIAGTEAVLVTG  360

Query  565   VLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVN  386
             +L + + ++GYA+S++ EVV Y   M+P V + + +D + G+LSG+ARG GWQHLGAYVN
Sbjct  361   MLFAAQRILGYAYSSDEEVVTYFTSMVPFVCISVAADSLQGVLSGIARGCGWQHLGAYVN  420

Query  385   LGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQER  206
             LG++YLVG P A +LGF   + G GLW+G+   S++Q ++LA+I  F++W+K   KA+ER
Sbjct  421   LGSFYLVGIPVALLLGFGYKMEGKGLWLGIACGSVLQFLLLAVIAFFSNWQKMAEKARER  480

Query  205   LLNDS  191
             +  ++
Sbjct  481   IFGET  485



>gb|KDP33026.1| hypothetical protein JCGZ_13057 [Jatropha curcas]
Length=477

 Score =   470 bits (1210),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 245/456 (54%), Positives = 325/456 (71%), Gaps = 1/456 (0%)
 Frame = -2

Query  1555  AISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHI-SELSLSGGAVATSFTNV  1379
             AI++D FL ELKK + +A PM+ V+V Q ++  VS +++GH+  +++LS  A+ATS +NV
Sbjct  15    AITRDGFLKELKKESCLAAPMVAVSVLQYLLQVVSVIIVGHLGDQIALSSVAIATSISNV  74

Query  1378  TGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIF  1199
             TGFSL+ GM   LETLCGQAYGA QYHKLGTYTY AI+ L ++  PI +LW+FM++ L  
Sbjct  75    TGFSLLSGMVGGLETLCGQAYGAEQYHKLGTYTYTAIICLIIICPPICLLWIFMNRLLPL  134

Query  1198  VGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCW  1019
             +GQDPL+S  A  YS++LI  +   A+L+ L R+LQ QSLI+PMLLSS   L FH  VCW
Sbjct  135   IGQDPLVSKLACTYSMYLIPGLLASAVLKPLTRFLQTQSLILPMLLSSLFILIFHTAVCW  194

Query  1018  ALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLA  839
                ++  LG  G ALA  LS W N+ LL  YVK+SS CEK+R     + F   GEFFRL 
Sbjct  195   IFVYKVELGYKGAALAFSLSVWLNIALLGFYVKFSSDCEKTRSPFSKEVFYGAGEFFRLG  254

Query  838   IPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRIS  659
             +PSA M CL+WW+ E++ LL GLLPNP++ETSVLSICL I +LHF IP   GA ASTR+S
Sbjct  255   VPSAVMVCLKWWSMELLTLLSGLLPNPKLETSVLSICLTISTLHFTIPHGFGAAASTRVS  314

Query  658   NELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPL  479
             NELGAGN  LAR+AV     +   E ++ + ++ S R ++GYA+SN+ +VV YI  M PL
Sbjct  315   NELGAGNPQLARLAVLAAISVAGAEAIIISTLIFSCRHILGYAYSNDKQVVSYISIMAPL  374

Query  478   VSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMG  299
             +SL ++ D +  +LSGVARG GWQH+GAY+NLGA+YLVG P   +LGF+  LRG GLW+G
Sbjct  375   ISLSVIMDSLQAVLSGVARGCGWQHIGAYINLGAFYLVGLPVGAVLGFVAHLRGKGLWIG  434

Query  298   LNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             +   S++Q+ +L+LIT  TDWKKQ S A+ER+   S
Sbjct  435   IVAGSILQSTLLSLITASTDWKKQVSIARERISKKS  470



>ref|XP_004981577.1| PREDICTED: MATE efflux family protein 5-like [Setaria italica]
Length=499

 Score =   471 bits (1212),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 224/449 (50%), Positives = 322/449 (72%), Gaps = 0/449 (0%)
 Frame = -2

Query  1531  AELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGM  1352
             AE  +LA +A PM+ V + Q  +  +ST+M+GH+ E+ L+G A+A S TNV+GFS++ G+
Sbjct  47    AEAGRLASLAAPMIAVALLQLTMQLISTIMVGHLGEVPLAGAAIANSLTNVSGFSVLMGL  106

Query  1351  ASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISA  1172
             A  LET+CGQAYGA QYHKL  +TY +I  L +V++PI+ILWVF+   L F+GQDPLI++
Sbjct  107   ACGLETICGQAYGAEQYHKLALFTYRSITVLLIVSVPIAILWVFIPDILPFIGQDPLIAS  166

Query  1171  EAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLG  992
             EAG+Y++WLI  +F +++ QCL ++LQ QSLI PM+LSS  +L   IP+CW + ++ G+G
Sbjct  167   EAGRYALWLIPGLFAFSVAQCLSKFLQSQSLIFPMVLSSLTTLTLFIPLCWFMVYKVGMG  226

Query  991   SAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACL  812
             +AG ALA+ +  W  V +L +Y+K+S SCEK+R     ++F  +G F RLA+PSA M CL
Sbjct  227   NAGAALAVSICDWVEVTVLGLYIKFSPSCEKTRAAPTWETFQGIGNFMRLAVPSALMICL  286

Query  811   EWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTD  632
             EWW++E+++LL G+LPNP +ETSVLSIC+    L + +P+ IG  AS R+SNELGAGN D
Sbjct  287   EWWSYELLVLLSGILPNPALETSVLSICISTVVLVYNLPYGIGTAASVRVSNELGAGNPD  346

Query  631   LARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDG  452
              AR+ V     I +   V+ +V L+SLR  +G AFSNE EVV+Y+ +M+PL+S+ +++D 
Sbjct  347   GARLVVVVALSIIICTAVLVSVTLLSLRHFIGIAFSNEEEVVNYVTRMVPLLSISVLTDN  406

Query  451   ISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQN  272
             + G+LSG++RG GWQHLGAYVNLGA+YLVG P A +LGF   L G G W+G+      Q 
Sbjct  407   LQGVLSGISRGCGWQHLGAYVNLGAFYLVGIPVALVLGFALHLGGAGFWIGMIAGGATQV  466

Query  271   VVLALITIFTDWKKQESKAQERLLNDSHP  185
              +L++IT  T+W K    A++R+  +S P
Sbjct  467   TLLSVITAMTNWGKMADNARDRVFEESLP  495



>ref|XP_006344200.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=480

 Score =   470 bits (1210),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 239/476 (50%), Positives = 330/476 (69%), Gaps = 1/476 (0%)
 Frame = -2

Query  1597  DAEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELS  1418
             + E  LL +++    +   V   E+K++  +A PM++VT+ Q  +  +S MM+GH+ EL+
Sbjct  3     NVEEGLLLKEKELIELRYGVIWEEMKEIGYLAGPMIIVTLSQYFLQTISLMMVGHLGELA  62

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LS  A+A S   VTGFS + GMA+ALETLCGQA+GA QY +LGT TY AI SL +  IPI
Sbjct  63    LSSTAIAVSIAGVTGFSFLLGMATALETLCGQAFGAKQYQRLGTQTYTAIFSLVIACIPI  122

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             ++LW+++ + L F+GQDP IS EAGK+  W+I A+F YA LQ LVRY QMQS+IVPML+S
Sbjct  123   AVLWLYVGELLTFMGQDPQISHEAGKFIKWMIPALFAYANLQSLVRYFQMQSMIVPMLIS  182

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             S +++CFHIP+ W L F SGLG+ G A+A+G+S W NVI+L  Y+  S +C K+R  +  
Sbjct  183   SCITICFHIPLSWVLVFNSGLGNIGAAVAVGISLWLNVIILASYMMLSPACAKTRAPVSW  242

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
             +    + EFF+ AIPSA M CLEWW+FE++ILL GLLPNPQ+ETSVLSICL      + I
Sbjct  243   EIVNGMIEFFQFAIPSAVMICLEWWSFELLILLSGLLPNPQLETSVLSICLNTTYTLYAI  302

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
             PF +    STR+SN+LGAGN   AR++   V +I   E ++    + + R+V GY FSNE
Sbjct  303   PFGLSGAVSTRVSNQLGAGNPQGARLSAVSVMLIAAAESILVGTTVFACRNVFGYIFSNE  362

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
              EVVDY+  + PL+ L ++ D   G LSGVARG GWQH+GAYVNL ++YL G P A  L 
Sbjct  363   KEVVDYVANIAPLLCLSVIIDSFQGTLSGVARGCGWQHIGAYVNLASFYLCGIPIAASLA  422

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
             FL + RG GLW+G+   +++Q ++L++IT  T+WKKQ + A++RL  D +  +VDN
Sbjct  423   FLLNFRGKGLWIGILSGAILQTILLSVITCCTNWKKQAAMARKRLHADEN-SSVDN  477



>ref|XP_003567622.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Brachypodium 
distachyon]
Length=486

 Score =   470 bits (1209),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 221/448 (49%), Positives = 320/448 (71%), Gaps = 0/448 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             E  +L  +A PM+ V + Q M+  +ST+M+GH+ E++L+G A+A S TNV+GFS++ G+A
Sbjct  34    EAGRLTALAAPMIAVALLQLMMQLISTVMVGHLGEVALAGAAIANSLTNVSGFSVLIGLA  93

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
             S LET+CGQAYGA QYHKL  YTY +I+ L +V++PI+ILWVF+   L  +GQ+P I+ E
Sbjct  94    SGLETICGQAYGAEQYHKLSLYTYRSIIVLLIVSVPIAILWVFIPTVLPLIGQEPQIANE  153

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             AGKY++WLI  +F +++ QC  ++LQ QSLI PM+LSS  +L   IP+CW + ++ G+G+
Sbjct  154   AGKYALWLIPGLFAFSVAQCFSKFLQCQSLIFPMVLSSMTTLVVFIPLCWFMVYKVGMGN  213

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
             AG AL++ +  W  V +L +Y+K+S SCEK+R  L  ++F  +G F RLAIPSA M CLE
Sbjct  214   AGAALSVSICDWVEVTVLGLYIKFSPSCEKTRAPLSWEAFKGIGSFMRLAIPSALMICLE  273

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW++E+++LL G+LPNP +ETSVLSIC+    L + +P+ IG  AS R+SNELGAGN + 
Sbjct  274   WWSYELLVLLSGILPNPALETSVLSICISTVVLLYNLPYGIGTAASVRVSNELGAGNPEG  333

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
             ARM V     I +   V+ +  L++LR  +G AFSNE EV++Y+ +M+P++S+ +++D  
Sbjct  334   ARMVVSVALSIIICSAVLVSTTLLALRHFIGIAFSNEEEVINYVTRMVPVLSVSVITDSF  393

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
              G+LSGV+RG GWQHLGAYVNLGA+YL+G P A   GF  +LRGMG W+G+      Q  
Sbjct  394   QGVLSGVSRGCGWQHLGAYVNLGAFYLIGIPTALFFGFTMNLRGMGFWIGMIAGGATQVT  453

Query  268   VLALITIFTDWKKQESKAQERLLNDSHP  185
             +L++IT  T+W K   KA+ER+  +  P
Sbjct  454   LLSVITAKTNWSKMADKAKERVFEERLP  481



>emb|CDM83438.1| unnamed protein product [Triticum aestivum]
Length=478

 Score =   469 bits (1208),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 241/468 (51%), Positives = 330/468 (71%), Gaps = 4/468 (1%)
 Frame = -2

Query  1594  AEVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISE-LS  1418
             AE PLL  K   A      + +E +KLA +A+PM+ V++ Q  V   S MM+GH+   L 
Sbjct  2     AEAPLLPRKDQEA---TGYWRSEARKLAYLALPMVAVSLSQYAVQVSSNMMVGHLPGVLP  58

Query  1417  LSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPI  1238
             LS  A+ATS  +V+GFSL+ GMASALETLCGQAYGA QYH LG + Y AI++L V  +P+
Sbjct  59    LSSAAIATSLASVSGFSLLTGMASALETLCGQAYGARQYHTLGLHMYTAIVTLLVACVPL  118

Query  1237  SILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLS  1058
             S+LW FM   L+ +GQDPLI+  AG+Y VWLI  +F  A++Q + ++LQ QSLI+P+LLS
Sbjct  119   SLLWAFMGNLLVLIGQDPLIAHGAGRYIVWLIPGLFANAVIQPITKFLQSQSLIMPLLLS  178

Query  1057  SALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWN  878
             S  +L  H+P+CW + FR+G+G  G ALAI +SYW NV +LV Y+  SS+C+++R     
Sbjct  179   SVATLALHVPLCWVMVFRTGMGYTGAALAISVSYWLNVAMLVAYIVMSSTCKETRTPPTI  238

Query  877   DSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYI  698
              +F  VG F RLA+PSA M CLEWW+FE++IL+ GLLPNP+++TSVLSICL   +L F I
Sbjct  239   KAFRGVGVFLRLALPSALMICLEWWSFELLILMSGLLPNPELQTSVLSICLTSVTLLFTI  298

Query  697   PFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNE  518
             P  +GA  STR++NELGAGN + AR AV  V  + + E VV +  L+  RS++G A+S+E
Sbjct  299   PSGLGAAGSTRVANELGAGNPEGARSAVRVVMSVAVTEAVVVSGTLLLSRSLLGRAYSSE  358

Query  517   TEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLG  338
              EV   +  M+PLV + +V+DG+ G+LSGVARG GWQH+GAYVNLG++YL+G P A +LG
Sbjct  359   EEVASAVAVMVPLVCITVVTDGLQGVLSGVARGCGWQHVGAYVNLGSFYLLGIPMAMLLG  418

Query  337   FLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLND  194
             F+  +   GLWMG+   S+ Q  +L+ IT FTDW+K   KA+ER L++
Sbjct  419   FVLKMGEKGLWMGVVCGSISQTTLLSAITFFTDWQKMADKARERSLSE  466



>ref|XP_004238872.1| PREDICTED: MATE efflux family protein 5 isoform X1 [Solanum lycopersicum]
Length=478

 Score =   469 bits (1208),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 242/471 (51%), Positives = 330/471 (70%), Gaps = 4/471 (1%)
 Frame = -2

Query  1582  LLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGA  1403
             LL E+     +   V   E+K++  +A PM++VT+ Q  +  +S MM+GH+ EL+LS  +
Sbjct  9     LLKERE---LVKWGVIWEEVKEIGYLAGPMIIVTLSQYFLQTISLMMVGHLGELALSSTS  65

Query  1402  VATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWV  1223
             +A S   VTG SL+ GM +ALETLCGQA+GA QY +LGT TY AI+SL +V IPI++LW+
Sbjct  66    IAISIAGVTGLSLLLGMGTALETLCGQAFGAKQYQRLGTQTYTAILSLFIVCIPIAVLWL  125

Query  1222  FMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSL  1043
             ++ K L F+GQDP IS EAGK+  W+I A+F YA LQ L+RY  MQS+IVPML+SS +++
Sbjct  126   YVGKLLTFIGQDPQISHEAGKFIKWMIPALFAYANLQPLIRYFLMQSMIVPMLISSCITI  185

Query  1042  CFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFAR  863
             CFHIP+ W L F SGLG+ G A+A GLS W NVI+L  Y+K S +C K+R  +  +    
Sbjct  186   CFHIPLSWVLVFSSGLGNIGAAVAFGLSMWLNVIILASYMKLSPACAKTRAPVSWEVVNG  245

Query  862   VGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIG  683
             + EFF+ AIPSA M CLEWW+FE++ILL GLLPNPQ+ETSVLSICL   S  + IPF + 
Sbjct  246   MREFFQFAIPSAVMICLEWWSFELLILLSGLLPNPQLETSVLSICLNTISTLYAIPFGLS  305

Query  682   AGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVD  503
                STR+SN+LGAGN   AR++V  V ++   E ++ +  + + R+V GY FSNE EVVD
Sbjct  306   GAVSTRVSNQLGAGNPLGARVSVISVMLLAATETILVSAAVFASRNVFGYIFSNEKEVVD  365

Query  502   YIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSL  323
             Y+ KM PL+ L +++D + G LSGVARG GWQH+GAYVNL ++YL G P A  L F  + 
Sbjct  366   YVAKMAPLLCLSVITDSLQGTLSGVARGCGWQHIGAYVNLASFYLCGIPIAASLAFWLNF  425

Query  322   RGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSHPPAVDN  170
             RG GLWMG+   + +Q ++L++IT  T+W+KQ + A+ERL  D    +VDN
Sbjct  426   RGKGLWMGILSGAALQTILLSVITCCTNWEKQAAMARERLHAD-EKSSVDN  475



>ref|XP_003592601.1| Protein TRANSPARENT TESTA [Medicago truncatula]
Length=502

 Score =   470 bits (1209),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 239/458 (52%), Positives = 327/458 (71%), Gaps = 3/458 (1%)
 Frame = -2

Query  1591  EVPLLSEKRPAA---AISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISEL  1421
             E  LL + R  A   +I+  VF  E+K +  +A+PM+ VT+ Q  +  +S MM+GH+ +L
Sbjct  2     EKGLLEKDREGAGSRSITWGVFFQEVKDVCFLALPMISVTLSQYFLQIISMMMVGHLGKL  61

Query  1420  SLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIP  1241
             SLS  A+A S   V+GFSL+FGM+ ALET CGQAYGA QY K G   Y AI+SL +  +P
Sbjct  62    SLSSTAIAISLCVVSGFSLLFGMSCALETQCGQAYGAKQYRKFGVQVYTAIISLIIACVP  121

Query  1240  ISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLL  1061
             +S+LW+ + K L  +GQDPLIS EAGK+++ +I A+F YA LQ LVRY  MQSL++P+++
Sbjct  122   LSLLWLNLGKLLSLLGQDPLISQEAGKFAMCMIPALFAYATLQALVRYFLMQSLVLPLVI  181

Query  1060  SSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLW  881
             SS+++L FH+  CW L F+SGLGS G A +IG SYW NVI+L +Y+K+S+ CEK+R  + 
Sbjct  182   SSSVTLGFHVAFCWLLVFKSGLGSLGAAFSIGTSYWLNVIILGLYMKFSADCEKTRFTIS  241

Query  880   NDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFY  701
              +SF  +GEFFR AIPSA M C EWW+FE+++ L GLLPNPQ+ETSVLSICL I S  + 
Sbjct  242   MESFDGIGEFFRYAIPSAGMICFEWWSFELLVFLSGLLPNPQLETSVLSICLSIISTLYT  301

Query  700   IPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSN  521
             IP + G+ AS R+SN LGAG    AR++V+    I + E ++ + ++ + R V+GY FSN
Sbjct  302   IPEATGSAASARVSNALGAGCPHAARLSVYAAMAIAVSEAILVSSIIFASRRVLGYIFSN  361

Query  520   ETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGML  341
             E +VVDY+  M PL+SL ++ D + G LSG+ARG GWQ LGAYVNLGAYY+ G P A +L
Sbjct  362   EQDVVDYVTDMAPLISLSVIVDSLHGTLSGIARGCGWQKLGAYVNLGAYYVFGIPIAVIL  421

Query  340   GFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQ  227
             GF   LRG GLW+G+ + +  Q V+L+LIT FT+W+KQ
Sbjct  422   GFWFELRGKGLWIGIIVGASCQAVLLSLITSFTNWEKQ  459



>dbj|BAJ92554.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   469 bits (1207),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 220/448 (49%), Positives = 319/448 (71%), Gaps = 0/448 (0%)
 Frame = -2

Query  1528  ELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIFGMA  1349
             E  +LA +A PM+ V + Q M+  +ST+M+GH+ E++L+G A+A S TNV+GFS++ G+A
Sbjct  38    ESGRLAALAAPMIAVALLQLMMQLISTVMVGHLGEVALAGAAIANSLTNVSGFSVLIGLA  97

Query  1348  SALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAE  1169
               LET+CGQAYGA QYHKL  YTY +I+ L +V++PI+I+WVF+ + L  +GQ P I+ E
Sbjct  98    CGLETICGQAYGAEQYHKLSLYTYRSIIVLLIVSVPIAIVWVFIPEVLPLIGQQPEIANE  157

Query  1168  AGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGS  989
             AGKY++WLI  +F +++ QC  ++LQ QSLI PM+LSS ++L   IP+CW + ++ G+G+
Sbjct  158   AGKYALWLIPGLFAFSVAQCFSKFLQCQSLIFPMVLSSMITLAVFIPLCWFMVYKVGMGN  217

Query  988   AGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLE  809
             AG AL++ +  W  VI+L +Y+K+S SCEK+R  L  ++F  +G F RLA+PSA M CLE
Sbjct  218   AGAALSVSICDWVEVIVLGLYIKFSPSCEKTRAPLTWEAFKGIGSFMRLAVPSALMICLE  277

Query  808   WWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDL  629
             WW++E+++LL G+LPNP +ETSVLSIC+    L + +P+ IG  AS R+SNELGAGN + 
Sbjct  278   WWSYELLVLLSGILPNPALETSVLSICISTVVLLYNLPYGIGTAASVRVSNELGAGNPEG  337

Query  628   ARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGI  449
             AR+ V     I +    + +  L++ R  +G AFSNE EV+DY+ +M+P++S+ +++D +
Sbjct  338   ARLVVGVALSIVVCSAALVSTTLLASRHFIGIAFSNEEEVIDYVTRMVPVLSISVITDSL  397

Query  448   SGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNV  269
              G+LSGV+RG GWQHLGAYVNLGA+YLVG P A   GF   LRGMG W+G+      Q  
Sbjct  398   QGVLSGVSRGCGWQHLGAYVNLGAFYLVGIPVALFFGFTMQLRGMGFWIGMIAGGATQVT  457

Query  268   VLALITIFTDWKKQESKAQERLLNDSHP  185
             +L++IT  T W K   KA+ER+  D  P
Sbjct  458   LLSVITATTKWDKMADKAKERVFEDRLP  485



>ref|XP_006589653.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
 gb|KHN06724.1| MATE efflux family protein DTX1 [Glycine soja]
Length=478

 Score =   469 bits (1206),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 242/468 (52%), Positives = 329/468 (70%), Gaps = 1/468 (0%)
 Frame = -2

Query  1591  EVPLLSEKRPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHIS-ELSL  1415
             E  +++++     ++ D    E+K++ R+A PM+ V   Q ++  VS MM+GH++ EL L
Sbjct  3     ENLIITKQSEKQRVTWDGLGEEMKRIIRVAGPMVFVYASQNLLQVVSIMMIGHLNDELFL  62

Query  1414  SGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPIS  1235
             SG A+A S   VTGFSL+ GMAS LET+CGQAYGA QY K G  TY AI SLT V +P++
Sbjct  63    SGAALAISLATVTGFSLLTGMASGLETICGQAYGARQYQKTGVQTYTAIFSLTCVCLPLT  122

Query  1234  ILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSS  1055
             I+W+ ++  L+F+GQDPLI+ EAG + +WL+ A+F YAILQ LVRY QMQSL++PML +S
Sbjct  123   IIWISLENILVFIGQDPLIAHEAGNFIIWLLPALFAYAILQPLVRYFQMQSLLLPMLATS  182

Query  1054  ALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWND  875
              ++LC HIP+CWAL F++ L + G ALA+ +S W NVI LV+Y++YS +CEK+R  +  +
Sbjct  183   CVTLCLHIPLCWALVFKTELSNVGGALAMSISIWLNVIFLVLYMRYSPACEKTRAPVSME  242

Query  874   SFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIP  695
              F  + EFFR AIPSA M CLEWW+FE++ILL GLLPNPQ+ETSVLSICL   S  + I 
Sbjct  243   LFQGIWEFFRFAIPSAVMICLEWWSFELLILLSGLLPNPQLETSVLSICLNTISTLYAIA  302

Query  694   FSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNET  515
             F I A ASTRISNELGAGN   AR+AV       ++E  + + +L   R V GY FSN+ 
Sbjct  303   FGIAAAASTRISNELGAGNPHSARVAVLASMSFAIMEATIISGILFVCRHVFGYTFSNKK  362

Query  514   EVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGF  335
             EVVDY+  M PLV + ++ D I G+L+G+ARG GWQH+G YVNLGA+YL G P A  L F
Sbjct  363   EVVDYVTVMAPLVCISVILDNIQGVLAGIARGCGWQHIGVYVNLGAFYLCGIPVAASLAF  422

Query  334   LTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDS  191
             L  + G GLW+GL + + VQ  +L+ +T  T+W++Q  KA++RL +  
Sbjct  423   LAKMSGKGLWIGLQVGAFVQCALLSTVTSCTNWEQQAMKARKRLFDSE  470



>gb|EEC71287.1| hypothetical protein OsI_03300 [Oryza sativa Indica Group]
Length=447

 Score =   468 bits (1203),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 227/436 (52%), Positives = 319/436 (73%), Gaps = 1/436 (0%)
 Frame = -2

Query  1495  MLVVTVCQQMVIFVSTMMLGHISE-LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQA  1319
             M+ V++    V   S MM+GH+   L LS  A+ATS  +VTGFSL+ GMASALETLCGQA
Sbjct  1     MVAVSLTNYAVQVSSNMMVGHLPGVLPLSSAAIATSLASVTGFSLLIGMASALETLCGQA  60

Query  1318  YGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLIS  1139
             YGA QYH LG +TY AI++L VV IP+S+LWVFM K L+ +GQDPLIS  AG+Y VWLI 
Sbjct  61    YGAKQYHTLGVHTYRAILTLLVVCIPLSLLWVFMGKILVLIGQDPLISHGAGRYIVWLIP  120

Query  1138  AIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLS  959
              +F  A++Q + ++LQ QSLI+PML++S  +L FHIP+CW + F++GLG  G AL+I +S
Sbjct  121   GLFANALIQPITKFLQSQSLIMPMLVASVATLVFHIPLCWLMVFKTGLGYTGAALSISIS  180

Query  958   YWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILL  779
             YW NV +LV Y+  SSSC+++R     ++F  +  F RLA+PSA M CLEWW+FE++IL+
Sbjct  181   YWLNVAMLVAYILLSSSCKETRTPPTIEAFKGLDGFLRLALPSALMICLEWWSFELLILM  240

Query  778   GGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTI  599
              GLLPNP+++TSVLSICL   +L F IP+ +GAG STR++NELGAGN + AR AV+ V  
Sbjct  241   SGLLPNPELQTSVLSICLTSITLLFTIPYGLGAGGSTRVANELGAGNPEGARSAVYVVLS  300

Query  598   IGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARG  419
             + + E ++    L++ R ++G A+S+E EV+ ++  M+PLV + +V+DG+ G++SG+ARG
Sbjct  301   VAVTEALIVCGTLLASRRLLGRAYSSEEEVISFVAMMVPLVCITVVTDGLQGVMSGIARG  360

Query  418   SGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTD  239
              GWQHLGAYVNLG++YL+G P A +LGF+  +   GLWMG+   S+ Q  +L+ IT FT+
Sbjct  361   CGWQHLGAYVNLGSFYLLGIPMAILLGFVLHMGAKGLWMGIVCGSISQITLLSAITFFTN  420

Query  238   WKKQESKAQERLLNDS  191
             W+K    A+ER+ ++ 
Sbjct  421   WQKMAENARERVFSEK  436



>ref|XP_010533239.1| PREDICTED: MATE efflux family protein 5 [Tarenaya hassleriana]
Length=483

 Score =   468 bits (1205),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 237/460 (52%), Positives = 325/460 (71%), Gaps = 0/460 (0%)
 Frame = -2

Query  1567  RPAAAISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSF  1388
             R      +D F  E+++L+ +A PM+ V      +  +S MM+GH+ EL LS  A+A SF
Sbjct  12    RDGGESCRDGFWREVRRLSYLAGPMIAVNSSMYFLQVISIMMVGHLGELFLSSTAIAVSF  71

Query  1387  TNVTGFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKF  1208
              +VTGFSL++G+ASALETLCGQA+GA QY +LG +TY AI+SL +V +P+S+LW  M + 
Sbjct  72    CSVTGFSLVYGLASALETLCGQAFGAKQYERLGIHTYTAILSLFLVCVPVSLLWSHMGEI  131

Query  1207  LIFVGQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIP  1028
             L  +GQDPLIS EA K+++WLI  +F YA +Q LVR+ Q QSLI P+++SS  +LC HI 
Sbjct  132   LSLIGQDPLISGEARKFAIWLIPGLFGYATMQPLVRFFQAQSLIFPLIVSSCSTLCCHIL  191

Query  1027  VCWALSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFF  848
             +CW L F+  LG+ G A+AIG+SYW NV +L +Y+ +SSSC KSR  +    F  + EFF
Sbjct  192   LCWTLVFKFELGNVGAAVAIGVSYWLNVSVLGLYMMFSSSCSKSRAPISMRVFEGMREFF  251

Query  847   RLAIPSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGAST  668
             R  IPSASM CLEWW+FE ++++ G LPNP++ETSVLS+CL   S  + I  S+GA AST
Sbjct  252   RFGIPSASMICLEWWSFEFLVMMSGFLPNPKLETSVLSVCLSTISTLYQISDSLGAAAST  311

Query  667   RISNELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKM  488
             R++NELGAG  + ARMAV+ V ++  +  +V +  L + R+V G+ FS+ETEVVDY+++M
Sbjct  312   RVANELGAGKPERARMAVYTVMVMTAVVALVVSGTLFAGRNVFGFLFSSETEVVDYVRRM  371

Query  487   IPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGL  308
              PLVS+ +V D +  +LSGVARGSGWQ LGA +NL AYYL G P A +LGF   LRG GL
Sbjct  372   APLVSISVVFDALHAVLSGVARGSGWQDLGALINLAAYYLCGIPIAVVLGFGMKLRGRGL  431

Query  307   WMGLNLASLVQNVVLALITIFTDWKKQESKAQERLLNDSH  188
             W+G+   S +Q  +LALI   T+WK+Q  KA+ERL+  + 
Sbjct  432   WIGITAGSFLQAALLALIACLTNWKEQARKARERLMTGTE  471



>gb|AGL95788.1| metal/metalloid transporter protein [Oryza sativa Indica Group]
Length=500

 Score =   469 bits (1206),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 237/485 (49%), Positives = 328/485 (68%), Gaps = 15/485 (3%)
 Frame = -2

Query  1600  MDAEVPLLSEKRPAAAISKDVFLA--------------ELKKLARIAIPMLVVTVCQQMV  1463
             M+  +PLLS++ PA   ++                   E  K+  +A+PM  ++V Q  V
Sbjct  1     MEERIPLLSKRFPADGTAEVGGGREEEGGDRWWSGLAREAGKVGSMALPMAAMSVAQNAV  60

Query  1462  IFVSTMMLGHISE-LSLSGGAVATSFTNVTGFSLIFGMASALETLCGQAYGAGQYHKLGT  1286
                S MM+GH+   L LS  A+ATS  +V+GFSL+ GMAS LETLCGQAYGA QY KLG 
Sbjct  61    QVASNMMVGHLPGVLPLSASAIATSLASVSGFSLLVGMASGLETLCGQAYGAKQYDKLGV  120

Query  1285  YTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLISAEAGKYSVWLISAIFPYAILQCL  1106
              TY AI++LTVV IPIS+LWVF+ K L  +GQDP+IS EAG+Y VWLI  +F YA+ Q L
Sbjct  121   QTYRAIVTLTVVTIPISLLWVFIGKLLTLIGQDPVISHEAGRYIVWLIPGLFAYAVCQPL  180

Query  1105  VRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSGLGSAGPALAIGLSYWFNVILLVVY  926
              ++LQ QSLI PML SS  +L  HIP+ W L F++ +G  G ALAI +SYW +  +L  Y
Sbjct  181   TKFLQSQSLIFPMLWSSIATLLLHIPLSWLLVFKTSMGFTGAALAISISYWLSTFMLAAY  240

Query  925   VKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMACLEWWTFEIVILLGGLLPNPQVET  746
             +++S SC+ +R     ++F  VG F R+A+PSA M C EWW+FEI++LL GLLPNP++E+
Sbjct  241   IRFSCSCKVTRSPPTIEAFRGVGLFLRIALPSALMLCFEWWSFEILVLLSGLLPNPELES  300

Query  745   SVLSICLMICSLHFYIPFSIGAGASTRISNELGAGNTDLARMAVWGVTIIGMIELVVAAV  566
             SVLSICL   SL + IP+ +G  ASTR++NELGAGN + AR AV  V  I   E V+   
Sbjct  301   SVLSICLTTTSLMYTIPYGLGGAASTRVANELGAGNPEGARSAVHLVMSIAGTEAVLVTG  360

Query  565   VLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVSDGISGLLSGVARGSGWQHLGAYVN  386
             +L + + ++GYA+S++ EVV Y   M+P V + + +D + G+LSG+ARG GWQHLGAYVN
Sbjct  361   MLFAAQRILGYAYSSDEEVVTYFTSMVPFVCISVAADSLQGVLSGIARGCGWQHLGAYVN  420

Query  385   LGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLVQNVVLALITIFTDWKKQESKAQER  206
             LG++YLVG P A +LGF   + G GLW+G+   S++Q ++LA+I  F++W+K   KA+ER
Sbjct  421   LGSFYLVGIPVALLLGFGFKMEGKGLWLGIACGSVLQFLLLAVIAFFSNWQKMAEKARER  480

Query  205   LLNDS  191
             +  ++
Sbjct  481   IFGET  485



>ref|XP_002885736.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61995.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=483

 Score =   468 bits (1205),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/446 (53%), Positives = 317/446 (71%), Gaps = 0/446 (0%)
 Frame = -2

Query  1537  FLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVTGFSLIF  1358
             F AELK ++R+A+PM  VTV Q ++  +S M+ GH SEL LSG A+ATSF NV+GFSL+F
Sbjct  27    FTAELKNVSRMALPMATVTVAQYLLPVISVMVAGHRSELQLSGVALATSFANVSGFSLMF  86

Query  1357  GMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFVGQDPLI  1178
             G+  ALETLCGQAYGA QY K+GTYTY AI+S   + + ISILW +MDK LI +GQDP I
Sbjct  87    GLVGALETLCGQAYGAKQYAKIGTYTYSAIVSNIPIVVLISILWFYMDKLLISIGQDPDI  146

Query  1177  SAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWALSFRSG  998
             S  AG Y+V LI A+   A+ Q L R+LQ Q L++P+L  +  +L FHI VC  L +  G
Sbjct  147   SKVAGSYAVCLIPALLAQAVQQPLNRFLQTQGLVLPLLYCAITTLLFHIFVCLVLVYAFG  206

Query  997   LGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAIPSASMA  818
             LGS G ALAIGLSYWFNV++L +YV++SS+CEK+R  + +D    V +FF+  IPSA+M 
Sbjct  207   LGSNGAALAIGLSYWFNVLILALYVRFSSACEKTRGFVSDDFVLSVKQFFQYGIPSAAMT  266

Query  817   CLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISNELGAGN  638
              +EW  FE++IL  GLLPNP++ETSVLSICL   SLH+ IP  IGA  S R+SNELGAGN
Sbjct  267   TIEWSLFELLILSSGLLPNPKLETSVLSICLTTSSLHYVIPMGIGAAGSVRVSNELGAGN  326

Query  637   TDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLVSLMLVS  458
              ++AR+AV     +  +E  + + +L   R++ GYAFSN  EVVDY+ ++ PL+ +  + 
Sbjct  327   PEVARLAVLTGIFLWFLEATICSTLLFICRNIFGYAFSNSKEVVDYVTELSPLLCISFMV  386

Query  457   DGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGLNLASLV  278
             DG S +L GVARGSGWQH+GA+ N+ AYYL+GAP    LGF   + G GLW+G+ + S  
Sbjct  387   DGFSAVLGGVARGSGWQHIGAWANVVAYYLLGAPVGLFLGFWCHMNGKGLWIGVVVGSTA  446

Query  277   QNVVLALITIFTDWKKQESKAQERLL  200
             Q ++LA++T    W +Q +KA++R++
Sbjct  447   QGIILAIVTACMSWNEQAAKARKRIV  472



>ref|XP_006388322.1| hypothetical protein POPTR_0229s00230g [Populus trichocarpa]
 gb|ERP47236.1| hypothetical protein POPTR_0229s00230g [Populus trichocarpa]
Length=475

 Score =   468 bits (1203),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 248/453 (55%), Positives = 327/453 (72%), Gaps = 0/453 (0%)
 Frame = -2

Query  1555  AISKDVFLAELKKLARIAIPMLVVTVCQQMVIFVSTMMLGHISELSLSGGAVATSFTNVT  1376
             AI+ + F+ ELKK   IA PM+ V+V Q ++  VS +++GH+  L+LS  A+ATS TNVT
Sbjct  13    AITWEGFVQELKKAGCIAAPMVAVSVLQYLLQVVSVIIVGHLGALALSSAAIATSITNVT  72

Query  1375  GFSLIFGMASALETLCGQAYGAGQYHKLGTYTYGAIMSLTVVAIPISILWVFMDKFLIFV  1196
             GFSL+ GMA  LETL GQAYGA QY KLGTYTY AI+SL ++  PI +LW+F+ K L  +
Sbjct  73    GFSLLSGMAGGLETLAGQAYGAKQYQKLGTYTYSAIISLIIMCPPICVLWIFIGKLLPLL  132

Query  1195  GQDPLISAEAGKYSVWLISAIFPYAILQCLVRYLQMQSLIVPMLLSSALSLCFHIPVCWA  1016
             GQD  IS EA KYS++LI A+F  A+L+ L RYLQ QS+I+PML++S+  LCFH   CW 
Sbjct  133   GQDTSISQEACKYSMYLIPALFGGAVLKPLTRYLQTQSVILPMLITSSCILCFHTISCWI  192

Query  1015  LSFRSGLGSAGPALAIGLSYWFNVILLVVYVKYSSSCEKSRVCLWNDSFARVGEFFRLAI  836
             L ++  LG  G A+A  LS W NVILL +YVKYSS+CEK+R  L  ++   + EFF+L +
Sbjct  193   LVYKLQLGQKGAAIAFSLSTWLNVILLCLYVKYSSACEKTRAPLSREALYGIREFFQLGV  252

Query  835   PSASMACLEWWTFEIVILLGGLLPNPQVETSVLSICLMICSLHFYIPFSIGAGASTRISN  656
             PSA M CL+WW+ E++ILL GL  NP++ETSVLSICL I +LHF IP+  GA ASTR+SN
Sbjct  253   PSAIMVCLKWWSLELLILLSGLFKNPKLETSVLSICLTISTLHFTIPYGFGAAASTRVSN  312

Query  655   ELGAGNTDLARMAVWGVTIIGMIELVVAAVVLMSLRSVVGYAFSNETEVVDYIKKMIPLV  476
             ELGAGN  LARMAV     +  IE V+ +  L   R V+GYA+SN+ +VV YI  M PL+
Sbjct  313   ELGAGNPQLARMAVLVALFLAGIESVIVSSGLFLSRQVLGYAYSNDRQVVRYISVMTPLI  372

Query  475   SLMLVSDGISGLLSGVARGSGWQHLGAYVNLGAYYLVGAPAAGMLGFLTSLRGMGLWMGL  296
              L  ++D +  +LSGVARGSGWQ +GAY+NLG++YLVG P A +LGF+  LRG GLW+G+
Sbjct  373   CLSFITDSVQAVLSGVARGSGWQKIGAYINLGSFYLVGLPLAAVLGFVAHLRGKGLWIGI  432

Query  295   NLASLVQNVVLALITIFTDWKKQESKAQERLLN  197
                S VQ+V+L+++T  TDW KQ +KA+ER+  
Sbjct  433   LAGSFVQSVLLSIVTACTDWNKQATKARERVFE  465



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5422109254650