BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20334_g1_i2 len=2585 path=[2752:0-882 3634:883-885 @71@!:886-2324
48:2325-2584]

Length=2585
                                                                      Score     E

ref|XP_009593769.1|  PREDICTED: putative pentatricopeptide repeat...    670   0.0      
ref|XP_006348886.1|  PREDICTED: putative pentatricopeptide repeat...    663   0.0      
ref|XP_009599852.1|  PREDICTED: putative pentatricopeptide repeat...    662   0.0      
ref|XP_009766475.1|  PREDICTED: putative pentatricopeptide repeat...    660   0.0      
ref|XP_004243786.1|  PREDICTED: putative pentatricopeptide repeat...    660   0.0      
ref|XP_009790968.1|  PREDICTED: putative pentatricopeptide repeat...    659   0.0      
ref|XP_006357835.1|  PREDICTED: putative pentatricopeptide repeat...    634   0.0      
ref|XP_004232338.1|  PREDICTED: putative pentatricopeptide repeat...    629   0.0      
ref|XP_011075861.1|  PREDICTED: putative pentatricopeptide repeat...    613   0.0      
ref|XP_007048729.1|  Pentatricopeptide repeat superfamily protein...    600   0.0      
ref|XP_007048728.1|  Pentatricopeptide repeat superfamily protein...    601   0.0      
ref|XP_007048731.1|  Pentatricopeptide repeat superfamily protein...    600   0.0      
ref|XP_002274300.1|  PREDICTED: putative pentatricopeptide repeat...    590   0.0      Vitis vinifera
ref|XP_008227583.1|  PREDICTED: pentatricopeptide repeat-containi...    583   0.0      
ref|XP_006450548.1|  hypothetical protein CICLE_v10008244mg             582   0.0      
ref|XP_008442168.1|  PREDICTED: putative pentatricopeptide repeat...    581   0.0      
ref|XP_002532784.1|  pentatricopeptide repeat-containing protein,...    581   0.0      Ricinus communis
emb|CDP15951.1|  unnamed protein product                                579   0.0      
ref|XP_008369674.1|  PREDICTED: pentatricopeptide repeat-containi...    579   0.0      
ref|XP_008364749.1|  PREDICTED: pentatricopeptide repeat-containi...    578   0.0      
ref|XP_008228937.1|  PREDICTED: putative pentatricopeptide repeat...    577   0.0      
ref|XP_004151692.1|  PREDICTED: putative pentatricopeptide repeat...    573   0.0      
ref|XP_007215356.1|  hypothetical protein PRUPE_ppa005519mg             573   0.0      
ref|XP_010102114.1|  hypothetical protein L484_021348                   570   0.0      
emb|CAN63846.1|  hypothetical protein VITISV_010038                     568   0.0      Vitis vinifera
ref|XP_007211611.1|  hypothetical protein PRUPE_ppa005509mg             566   0.0      
ref|XP_010323680.1|  PREDICTED: putative pentatricopeptide repeat...    561   0.0      
ref|XP_009766478.1|  PREDICTED: putative pentatricopeptide repeat...    555   0.0      
gb|KGN54770.1|  hypothetical protein Csa_4G481190                       554   0.0      
ref|XP_010278006.1|  PREDICTED: putative pentatricopeptide repeat...    552   0.0      
emb|CBI26532.3|  unnamed protein product                                550   0.0      
ref|XP_008812386.1|  PREDICTED: putative pentatricopeptide repeat...    545   0.0      
ref|XP_004305450.1|  PREDICTED: putative pentatricopeptide repeat...    544   0.0      
ref|XP_003621847.1|  Pentatricopeptide repeat-containing protein        540   2e-180   
ref|XP_007137425.1|  hypothetical protein PHAVU_009G126100g             535   6e-178   
ref|XP_011002378.1|  PREDICTED: putative pentatricopeptide repeat...    533   1e-177   
ref|XP_003522160.1|  PREDICTED: putative pentatricopeptide repeat...    533   1e-177   
ref|XP_004499962.1|  PREDICTED: putative pentatricopeptide repeat...    531   5e-177   
gb|KDO79612.1|  hypothetical protein CISIN_1g012782mg                   525   2e-175   
ref|XP_009355436.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    525   7e-175   
ref|XP_010674094.1|  PREDICTED: putative pentatricopeptide repeat...    525   1e-174   
ref|XP_010035874.1|  PREDICTED: putative pentatricopeptide repeat...    525   2e-174   
ref|XP_010932326.1|  PREDICTED: putative pentatricopeptide repeat...    523   6e-174   
ref|XP_009379894.1|  PREDICTED: putative pentatricopeptide repeat...    508   3e-168   
ref|XP_009379884.1|  PREDICTED: putative pentatricopeptide repeat...    507   5e-167   
ref|XP_010530041.1|  PREDICTED: putative pentatricopeptide repeat...    505   8e-167   
gb|EYU45340.1|  hypothetical protein MIMGU_mgv1a020198mg                483   5e-158   
ref|XP_010439925.1|  PREDICTED: putative pentatricopeptide repeat...    479   8e-157   
ref|XP_010449539.1|  PREDICTED: putative pentatricopeptide repeat...    473   1e-154   
ref|XP_010436506.1|  PREDICTED: putative pentatricopeptide repeat...    473   2e-154   
ref|XP_002868030.1|  hypothetical protein ARALYDRAFT_914908             473   3e-154   
ref|XP_006283693.1|  hypothetical protein CARUB_v10004757mg             471   2e-153   
sp|P0C043.1|PP318_ARATH  RecName: Full=Putative pentatricopeptide...    470   3e-153   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01501.1|  BnaC07g34910D                                          469   7e-153   
emb|CDX90436.1|  BnaA03g43450D                                          468   1e-152   
ref|XP_004978834.1|  PREDICTED: putative pentatricopeptide repeat...    466   6e-152   
ref|XP_009136884.1|  PREDICTED: putative pentatricopeptide repeat...    466   8e-152   
gb|KDP45894.1|  hypothetical protein JCGZ_15454                         461   4e-151   
ref|XP_002450407.1|  hypothetical protein SORBIDRAFT_05g004830          463   1e-150   Sorghum bicolor [broomcorn]
gb|KFK28477.1|  hypothetical protein AALP_AA7G001300                    463   1e-150   
ref|XP_006414172.1|  hypothetical protein EUTSA_v10025145mg             463   1e-150   
ref|NP_001170632.1|  uncharacterized protein LOC100384682               463   1e-150   Zea mays [maize]
dbj|BAK08037.1|  predicted protein                                      462   4e-150   
ref|XP_006833205.1|  hypothetical protein AMTR_s00072p00167120          457   2e-148   
ref|XP_003578548.1|  PREDICTED: putative pentatricopeptide repeat...    456   4e-148   
gb|AAM67288.1|  unknown                                                 452   2e-146   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568665.1|  pentatricopeptide repeat-containing protein           452   3e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008467270.1|  PREDICTED: putative pentatricopeptide repeat...    451   8e-146   
dbj|BAD95174.1|  hypothetical protein                                   451   1e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006648038.1|  PREDICTED: putative pentatricopeptide repeat...    451   1e-145   
ref|XP_010932325.1|  PREDICTED: putative pentatricopeptide repeat...    447   2e-145   
dbj|BAD19190.1|  zinc finger (CCCH-type) protein-like                   449   5e-145   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048367.1|  Os02g0793200                                       449   5e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002865170.1|  pentatricopeptide repeat-containing protein        449   5e-145   
ref|XP_004143717.1|  PREDICTED: putative pentatricopeptide repeat...    448   8e-145   
gb|KFK31411.1|  hypothetical protein AALP_AA6G108500                    447   2e-144   
gb|EAY87834.1|  hypothetical protein OsI_09254                          446   2e-143   Oryza sativa Indica Group [Indian rice]
ref|XP_006282167.1|  hypothetical protein CARUB_v10028426mg             442   2e-142   
ref|XP_010445785.1|  PREDICTED: pentatricopeptide repeat-containi...    442   3e-142   
ref|XP_010495770.1|  PREDICTED: pentatricopeptide repeat-containi...    439   2e-141   
ref|XP_010484763.1|  PREDICTED: pentatricopeptide repeat-containi...    439   4e-141   
gb|EPS66616.1|  hypothetical protein M569_08159                         437   1e-140   
emb|CDX87688.1|  BnaC02g32610D                                          428   3e-137   
ref|XP_009128889.1|  PREDICTED: pentatricopeptide repeat-containi...    425   7e-136   
emb|CDY66747.1|  BnaA02g36820D                                          422   7e-135   
ref|XP_006398363.1|  hypothetical protein EUTSA_v10001221mg             418   3e-133   
ref|XP_006450549.1|  hypothetical protein CICLE_v10008244mg             402   4e-129   
gb|KCW47360.1|  hypothetical protein EUGRSUZ_K01145                     402   4e-128   
dbj|BAB08912.1|  unnamed protein product                                401   4e-127   Arabidopsis thaliana [mouse-ear cress]
gb|KGN50380.1|  hypothetical protein Csa_5G171145                       389   5e-123   
emb|CAA17134.1|  putative protein                                       411   2e-122   Arabidopsis thaliana [mouse-ear cress]
gb|EMT13221.1|  hypothetical protein F775_05352                         375   1e-117   
gb|KHN26225.1|  Putative pentatricopeptide repeat-containing protein    342   1e-104   
ref|XP_002308767.2|  hypothetical protein POPTR_0006s00830g             273   8e-80    Populus trichocarpa [western balsam poplar]
ref|XP_002991129.1|  hypothetical protein SELMODRAFT_236212             239   1e-64    
ref|XP_002968810.1|  hypothetical protein SELMODRAFT_91015              229   6e-62    
ref|XP_002968311.1|  hypothetical protein SELMODRAFT_89033              231   7e-62    
ref|XP_002977337.1|  hypothetical protein SELMODRAFT_107186             231   2e-61    
ref|XP_010530463.1|  PREDICTED: pentatricopeptide repeat-containi...    228   3e-61    
ref|XP_008806535.1|  PREDICTED: protein Rf1, mitochondrial-like         230   3e-61    
emb|CDP10983.1|  unnamed protein product                                232   4e-61    
ref|XP_002970774.1|  hypothetical protein SELMODRAFT_94312              226   4e-61    
ref|XP_010530278.1|  PREDICTED: pentatricopeptide repeat-containi...    229   4e-61    
ref|XP_010540327.1|  PREDICTED: pentatricopeptide repeat-containi...    228   9e-61    
ref|XP_002971975.1|  hypothetical protein SELMODRAFT_96626              230   1e-60    
ref|XP_010530283.1|  PREDICTED: pentatricopeptide repeat-containi...    226   2e-60    
ref|XP_010278102.1|  PREDICTED: pentatricopeptide repeat-containi...    229   2e-60    
ref|XP_010530356.1|  PREDICTED: pentatricopeptide repeat-containi...    227   2e-60    
ref|XP_010530282.1|  PREDICTED: pentatricopeptide repeat-containi...    226   4e-60    
ref|XP_006470579.1|  PREDICTED: pentatricopeptide repeat-containi...    228   6e-60    
ref|XP_002972017.1|  hypothetical protein SELMODRAFT_96794              231   7e-60    
ref|XP_010530464.1|  PREDICTED: pentatricopeptide repeat-containi...    225   7e-60    
ref|XP_006847029.1|  hypothetical protein AMTR_s00017p00176770          226   8e-60    
emb|CCD31439.1|  RNA processing factor 3                                225   1e-59    
ref|XP_006828472.1|  hypothetical protein AMTR_s00060p00144370          223   1e-59    
ref|XP_002962761.1|  hypothetical protein SELMODRAFT_165305             226   1e-59    
gb|KDP42578.1|  hypothetical protein JCGZ_24352                         225   2e-59    
ref|XP_006854103.1|  hypothetical protein AMTR_s00048p00141020          224   2e-59    
ref|XP_002962532.1|  hypothetical protein SELMODRAFT_404389             229   2e-59    
ref|XP_008444287.1|  PREDICTED: pentatricopeptide repeat-containi...    223   3e-59    
ref|XP_006391783.1|  hypothetical protein EUTSA_v10023354mg             224   3e-59    
ref|XP_006826435.1|  hypothetical protein AMTR_s00004p00168920          226   3e-59    
ref|XP_010530346.1|  PREDICTED: pentatricopeptide repeat-containi...    224   4e-59    
ref|XP_004501057.1|  PREDICTED: pentatricopeptide repeat-containi...    223   4e-59    
emb|CED92696.1|  PPR protein                                            223   5e-59    
ref|XP_008375656.1|  PREDICTED: pentatricopeptide repeat-containi...    225   5e-59    
emb|CED92697.1|  PPR protein                                            223   5e-59    
ref|XP_007029263.1|  Tetratricopeptide repeat (TPR)-like superfam...    221   6e-59    
ref|XP_002971208.1|  hypothetical protein SELMODRAFT_94745              222   6e-59    
ref|XP_010105594.1|  hypothetical protein L484_003967                   223   6e-59    
ref|XP_010473513.1|  PREDICTED: pentatricopeptide repeat-containi...    223   9e-59    
ref|XP_008803207.1|  PREDICTED: pentatricopeptide repeat-containi...    221   9e-59    
ref|XP_008232168.1|  PREDICTED: pentatricopeptide repeat-containi...    223   1e-58    
ref|XP_010048714.1|  PREDICTED: pentatricopeptide repeat-containi...    224   1e-58    
ref|XP_002968006.1|  hypothetical protein SELMODRAFT_88008              224   1e-58    
ref|XP_010540379.1|  PREDICTED: pentatricopeptide repeat-containi...    221   1e-58    
gb|KDO54847.1|  hypothetical protein CISIN_1g004758mg                   218   2e-58    
gb|KHN25331.1|  Pentatricopeptide repeat-containing protein, mito...    216   2e-58    
gb|KDO54845.1|  hypothetical protein CISIN_1g004758mg                   223   2e-58    
ref|XP_009345567.1|  PREDICTED: pentatricopeptide repeat-containi...    223   2e-58    
ref|XP_006391822.1|  hypothetical protein EUTSA_v10023344mg             221   3e-58    
ref|XP_010431703.1|  PREDICTED: pentatricopeptide repeat-containi...    224   3e-58    
ref|NP_176501.1|  transacting siRNA generating locus                    221   4e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002961595.1|  hypothetical protein SELMODRAFT_76510              220   4e-58    
ref|XP_010431706.1|  PREDICTED: pentatricopeptide repeat-containi...    220   4e-58    
ref|XP_007029261.1|  Tetratricopeptide repeat-like superfamily pr...    220   4e-58    
ref|XP_010431715.1|  PREDICTED: pentatricopeptide repeat-containi...    220   4e-58    
ref|XP_010530383.1|  PREDICTED: pentatricopeptide repeat-containi...    220   5e-58    
ref|XP_009612407.1|  PREDICTED: putative pentatricopeptide repeat...    219   5e-58    
emb|CDP00950.1|  unnamed protein product                                219   7e-58    
ref|NP_001031033.1|  pentatricopeptide repeat-containing protein        220   7e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382719.1|  pentatricopeptide repeat-containing family p...    221   7e-58    
ref|XP_007018302.1|  Pentatricopeptide repeat (PPR-like) superfam...    219   9e-58    
ref|XP_008362682.1|  PREDICTED: pentatricopeptide repeat-containi...    221   1e-57    
ref|XP_008797845.1|  PREDICTED: pentatricopeptide repeat-containi...    219   1e-57    
ref|XP_010930804.1|  PREDICTED: pentatricopeptide repeat-containi...    218   1e-57    
ref|XP_010548044.1|  PREDICTED: pentatricopeptide repeat-containi...    219   1e-57    
ref|XP_007161634.1|  hypothetical protein PHAVU_001G085800g             218   1e-57    
ref|XP_010476232.1|  PREDICTED: pentatricopeptide repeat-containi...    219   2e-57    
emb|CBJ23782.1|  pentatricopeptide (PPR) repeat-containing protein      219   2e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006829551.1|  hypothetical protein AMTR_s00074p00172480          217   2e-57    
ref|XP_002984987.1|  hypothetical protein SELMODRAFT_20977              214   2e-57    
ref|XP_007137661.1|  hypothetical protein PHAVU_009G145100g             218   2e-57    
ref|XP_006446275.1|  hypothetical protein CICLE_v10017597mg             220   3e-57    
ref|XP_010541060.1|  PREDICTED: pentatricopeptide repeat-containi...    217   3e-57    
ref|XP_006418847.1|  hypothetical protein EUTSA_v10002441mg             218   3e-57    
ref|XP_010529541.1|  PREDICTED: pentatricopeptide repeat-containi...    217   3e-57    
ref|XP_003540687.1|  PREDICTED: pentatricopeptide repeat-containi...    218   3e-57    
gb|KDP46186.1|  hypothetical protein JCGZ_10026                         218   4e-57    
ref|XP_010276630.1|  PREDICTED: pentatricopeptide repeat-containi...    219   4e-57    
ref|XP_002963827.1|  hypothetical protein SELMODRAFT_79421              217   4e-57    
ref|XP_006433766.1|  hypothetical protein CICLE_v10000605mg             217   4e-57    
ref|XP_004142210.1|  PREDICTED: pentatricopeptide repeat-containi...    220   4e-57    
ref|XP_002870941.1|  pentatricopeptide repeat-containing protein        219   4e-57    
ref|XP_008357006.1|  PREDICTED: pentatricopeptide repeat-containi...    219   4e-57    
ref|XP_008219211.1|  PREDICTED: pentatricopeptide repeat-containi...    217   4e-57    
ref|XP_008444958.1|  PREDICTED: pentatricopeptide repeat-containi...    217   5e-57    
ref|XP_009361375.1|  PREDICTED: pentatricopeptide repeat-containi...    219   5e-57    
emb|CBX25230.1|  hypothetical_protein                                   219   5e-57    
ref|XP_010529540.1|  PREDICTED: pentatricopeptide repeat-containi...    217   5e-57    
ref|XP_010530330.1|  PREDICTED: pentatricopeptide repeat-containi...    217   5e-57    
gb|KDP42551.1|  hypothetical protein JCGZ_24325                         216   5e-57    
ref|XP_006391821.1|  hypothetical protein EUTSA_v10023989mg             217   5e-57    
ref|XP_009378124.1|  PREDICTED: pentatricopeptide repeat-containi...    219   5e-57    
gb|KGN54231.1|  hypothetical protein Csa_4G294390                       220   5e-57    
emb|CBI24234.3|  unnamed protein product                                216   6e-57    
gb|KDP42576.1|  hypothetical protein JCGZ_24350                         218   6e-57    
ref|XP_002889775.1|  pentatricopeptide repeat-containing protein        216   6e-57    
ref|XP_002986246.1|  hypothetical protein SELMODRAFT_123660             218   7e-57    
ref|XP_004162287.1|  PREDICTED: pentatricopeptide repeat-containi...    216   7e-57    
ref|XP_004144640.1|  PREDICTED: pentatricopeptide repeat-containi...    215   7e-57    
ref|XP_008237676.1|  PREDICTED: pentatricopeptide repeat-containi...    217   7e-57    
ref|XP_010104578.1|  hypothetical protein L484_025557                   216   7e-57    
ref|XP_008447642.1|  PREDICTED: pentatricopeptide repeat-containi...    219   7e-57    
ref|XP_010530274.1|  PREDICTED: pentatricopeptide repeat-containi...    216   7e-57    
ref|XP_010544054.1|  PREDICTED: pentatricopeptide repeat-containi...    216   8e-57    
ref|XP_011071341.1|  PREDICTED: pentatricopeptide repeat-containi...    216   8e-57    
ref|XP_010917143.1|  PREDICTED: pentatricopeptide repeat-containi...    216   8e-57    
gb|AAF75803.1|AC011000_6  Contains weak similarity to leaf protei...    216   9e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391806.1|  hypothetical protein EUTSA_v10023345mg             216   1e-56    
ref|XP_003575883.1|  PREDICTED: pentatricopeptide repeat-containi...    218   1e-56    
ref|NP_176481.2|  pentatricopeptide repeat protein RPF3                 216   1e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529542.1|  PREDICTED: pentatricopeptide repeat-containi...    214   2e-56    
ref|XP_002519129.1|  pentatricopeptide repeat-containing protein,...    216   2e-56    Ricinus communis
ref|XP_002976066.1|  hypothetical protein SELMODRAFT_53130              211   2e-56    
ref|NP_172461.1|  pentatricopeptide repeat-containing protein           215   2e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802945.1|  PREDICTED: protein Rf1, mitochondrial-like         218   2e-56    
gb|EAZ27689.1|  hypothetical protein OsJ_11637                          216   2e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011016979.1|  PREDICTED: pentatricopeptide repeat-containi...    215   2e-56    
ref|XP_009408198.1|  PREDICTED: pentatricopeptide repeat-containi...    218   2e-56    
ref|XP_010520854.1|  PREDICTED: pentatricopeptide repeat-containi...    216   2e-56    
ref|XP_007201524.1|  hypothetical protein PRUPE_ppa015625mg             213   2e-56    
ref|XP_009625746.1|  PREDICTED: pentatricopeptide repeat-containi...    215   2e-56    
ref|XP_006391862.1|  hypothetical protein EUTSA_v10023350mg             215   2e-56    
ref|NP_176496.1|  transacting siRNA generating locus                    215   2e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264275.1|  PREDICTED: putative pentatricopeptide repeat...    217   2e-56    
ref|NP_176479.2|  pentatricopeptide repeat-containing protein           215   2e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472405.1|  PREDICTED: pentatricopeptide repeat-containi...    215   2e-56    
ref|XP_004985306.1|  PREDICTED: pentatricopeptide repeat-containi...    218   3e-56    
ref|XP_009782000.1|  PREDICTED: pentatricopeptide repeat-containi...    214   3e-56    
gb|KDO81276.1|  hypothetical protein CISIN_1g043144mg                   214   3e-56    
gb|KDP42607.1|  hypothetical protein JCGZ_24381                         214   3e-56    
ref|XP_003521773.1|  PREDICTED: pentatricopeptide repeat-containi...    214   3e-56    
ref|XP_006406159.1|  hypothetical protein EUTSA_v10020312mg             215   3e-56    
ref|XP_004170776.1|  PREDICTED: pentatricopeptide repeat-containi...    216   3e-56    
ref|XP_006384483.1|  hypothetical protein POPTR_0004s15480g             213   3e-56    
ref|XP_002273398.2|  PREDICTED: putative pentatricopeptide repeat...    217   3e-56    Vitis vinifera
ref|XP_010270186.1|  PREDICTED: pentatricopeptide repeat-containi...    217   3e-56    
ref|XP_009781795.1|  PREDICTED: putative pentatricopeptide repeat...    214   3e-56    
emb|CDX93465.1|  BnaA06g05830D                                          214   4e-56    
ref|XP_006857320.1|  hypothetical protein AMTR_s00067p00076830          214   4e-56    
ref|XP_006391808.1|  hypothetical protein EUTSA_v10023976mg             215   5e-56    
ref|XP_009781797.1|  PREDICTED: putative pentatricopeptide repeat...    213   5e-56    
ref|XP_007219118.1|  hypothetical protein PRUPE_ppa015795mg             211   5e-56    
ref|XP_002464340.1|  hypothetical protein SORBIDRAFT_01g016560          216   5e-56    Sorghum bicolor [broomcorn]
gb|KDP42575.1|  hypothetical protein JCGZ_24349                         211   5e-56    
ref|XP_006391807.1|  hypothetical protein EUTSA_v10023351mg             214   5e-56    
ref|XP_010540625.1|  PREDICTED: pentatricopeptide repeat-containi...    214   5e-56    
ref|XP_011032541.1|  PREDICTED: putative pentatricopeptide repeat...    214   6e-56    
ref|XP_002275790.2|  PREDICTED: pentatricopeptide repeat-containi...    216   6e-56    Vitis vinifera
ref|XP_011030727.1|  PREDICTED: pentatricopeptide repeat-containi...    213   6e-56    
ref|XP_002441764.1|  hypothetical protein SORBIDRAFT_08g002022          215   6e-56    Sorghum bicolor [broomcorn]
ref|XP_004982554.1|  PREDICTED: pentatricopeptide repeat-containi...    216   6e-56    
ref|XP_010490447.1|  PREDICTED: pentatricopeptide repeat-containi...    213   7e-56    
gb|KFK43289.1|  hypothetical protein AALP_AA1G104700                    213   7e-56    
gb|EAY90886.1|  hypothetical protein OsI_12495                          216   7e-56    Oryza sativa Indica Group [Indian rice]
ref|NP_001050605.1|  Os03g0597200                                       216   7e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008450352.1|  PREDICTED: pentatricopeptide repeat-containi...    216   7e-56    
ref|XP_010938969.1|  PREDICTED: pentatricopeptide repeat-containi...    216   7e-56    
ref|XP_010418423.1|  PREDICTED: pentatricopeptide repeat-containi...    212   7e-56    
emb|CAN63985.1|  hypothetical protein VITISV_001389                     217   7e-56    Vitis vinifera
gb|KFK22834.1|  hypothetical protein AALP_AAs49566U000200               214   8e-56    
ref|XP_007015298.1|  Tetratricopeptide repeat (TPR)-like superfam...    215   8e-56    
ref|NP_172694.1|  pentatricopeptide repeat-containing protein           214   8e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002317023.2|  hypothetical protein POPTR_0011s14750g             212   8e-56    Populus trichocarpa [western balsam poplar]
emb|CDO97115.1|  unnamed protein product                                214   8e-56    
ref|XP_010936986.1|  PREDICTED: pentatricopeptide repeat-containi...    214   8e-56    
ref|XP_002302359.2|  hypothetical protein POPTR_0002s11020g             214   8e-56    Populus trichocarpa [western balsam poplar]
ref|XP_008338987.1|  PREDICTED: pentatricopeptide repeat-containi...    213   8e-56    
emb|CED92695.1|  PPR protein                                            213   9e-56    
ref|XP_009781997.1|  PREDICTED: pentatricopeptide repeat-containi...    215   9e-56    
ref|XP_009148305.1|  PREDICTED: pentatricopeptide repeat-containi...    213   9e-56    
ref|XP_010270184.1|  PREDICTED: pentatricopeptide repeat-containi...    217   9e-56    
emb|CAN61988.1|  hypothetical protein VITISV_026694                     212   9e-56    Vitis vinifera
emb|CBJ23784.1|  pentatricopeptide (PPR) repeat-containing protein      213   1e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010044060.1|  PREDICTED: pentatricopeptide repeat-containi...    214   1e-55    
ref|XP_009366374.1|  PREDICTED: pentatricopeptide repeat-containi...    213   1e-55    
ref|XP_009402131.1|  PREDICTED: pentatricopeptide repeat-containi...    212   1e-55    
ref|XP_009413406.1|  PREDICTED: pentatricopeptide repeat-containi...    213   1e-55    
ref|XP_009625742.1|  PREDICTED: pentatricopeptide repeat-containi...    215   1e-55    
ref|XP_002964758.1|  hypothetical protein SELMODRAFT_82857              211   1e-55    
emb|CDP08449.1|  unnamed protein product                                214   1e-55    
emb|CDX94933.1|  BnaC05g07380D                                          212   1e-55    
gb|AFF27500.1|  PPR domain-containing protein                           215   1e-55    
ref|XP_010530347.1|  PREDICTED: pentatricopeptide repeat-containi...    213   1e-55    
ref|XP_002885504.1|  pentatricopeptide repeat-containing protein        213   1e-55    
ref|XP_004168722.1|  PREDICTED: pentatricopeptide repeat-containi...    213   2e-55    
ref|XP_006300860.1|  hypothetical protein CARUB_v10019951mg             213   2e-55    
ref|XP_008454892.1|  PREDICTED: pentatricopeptide repeat-containi...    213   2e-55    
ref|XP_009333737.1|  PREDICTED: pentatricopeptide repeat-containi...    215   2e-55    
ref|XP_010558352.1|  PREDICTED: pentatricopeptide repeat-containi...    214   2e-55    
ref|XP_010935655.1|  PREDICTED: protein Rf1, mitochondrial-like         215   2e-55    
ref|XP_008808854.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    215   2e-55    
ref|XP_008378619.1|  PREDICTED: pentatricopeptide repeat-containi...    212   2e-55    
ref|XP_010246577.1|  PREDICTED: pentatricopeptide repeat-containi...    213   2e-55    
ref|NP_001169662.1|  uncharacterized protein LOC100383543               214   2e-55    
ref|XP_010525817.1|  PREDICTED: pentatricopeptide repeat-containi...    212   2e-55    
ref|XP_004139059.1|  PREDICTED: pentatricopeptide repeat-containi...    214   3e-55    
ref|XP_008226294.1|  PREDICTED: pentatricopeptide repeat-containi...    211   3e-55    
ref|XP_011090170.1|  PREDICTED: pentatricopeptide repeat-containi...    213   3e-55    
ref|XP_002285611.1|  PREDICTED: pentatricopeptide repeat-containi...    211   3e-55    
ref|XP_010458712.1|  PREDICTED: pentatricopeptide repeat-containi...    212   3e-55    
ref|NP_176454.1|  pentatricopeptide repeat protein RPF2                 212   3e-55    
ref|XP_004154653.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    214   3e-55    
gb|EMT14194.1|  hypothetical protein F775_06585                         212   4e-55    
gb|KDP31281.1|  hypothetical protein JCGZ_11657                         212   4e-55    
ref|XP_009800134.1|  PREDICTED: pentatricopeptide repeat-containi...    211   4e-55    
ref|XP_004967235.1|  PREDICTED: putative pentatricopeptide repeat...    213   4e-55    
ref|XP_010520857.1|  PREDICTED: pentatricopeptide repeat-containi...    211   4e-55    
ref|XP_002972555.1|  hypothetical protein SELMODRAFT_97527              210   4e-55    
ref|XP_006423135.1|  hypothetical protein CICLE_v10030406mg             212   4e-55    
emb|CBI20053.3|  unnamed protein product                                211   4e-55    
ref|XP_004137128.1|  PREDICTED: pentatricopeptide repeat-containi...    211   4e-55    
ref|XP_004490220.1|  PREDICTED: pentatricopeptide repeat-containi...    213   5e-55    
gb|KDO44671.1|  hypothetical protein CISIN_1g038622mg                   210   5e-55    
ref|XP_002269015.2|  PREDICTED: pentatricopeptide repeat-containi...    212   6e-55    
ref|XP_010031042.1|  PREDICTED: pentatricopeptide repeat-containi...    211   6e-55    
ref|XP_006836423.1|  hypothetical protein AMTR_s00092p00157010          207   6e-55    
ref|XP_010257551.1|  PREDICTED: pentatricopeptide repeat-containi...    211   7e-55    
ref|XP_010935652.1|  PREDICTED: protein Rf1, mitochondrial-like         213   7e-55    
ref|XP_006391749.1|  hypothetical protein EUTSA_v10023942mg             211   7e-55    
ref|XP_010044211.1|  PREDICTED: pentatricopeptide repeat-containi...    211   7e-55    
ref|XP_010473512.1|  PREDICTED: pentatricopeptide repeat-containi...    211   8e-55    
ref|XP_010061566.1|  PREDICTED: pentatricopeptide repeat-containi...    211   8e-55    
ref|XP_006856874.1|  hypothetical protein AMTR_s00055p00195550          207   8e-55    
ref|XP_008796942.1|  PREDICTED: putative pentatricopeptide repeat...    213   8e-55    
ref|XP_010530461.1|  PREDICTED: putative pentatricopeptide repeat...    210   8e-55    
ref|XP_009361764.1|  PREDICTED: pentatricopeptide repeat-containi...    209   8e-55    
gb|EMT33585.1|  hypothetical protein F775_11798                         210   8e-55    
gb|KDP25129.1|  hypothetical protein JCGZ_22664                         209   8e-55    
ref|XP_009342418.1|  PREDICTED: pentatricopeptide repeat-containi...    211   8e-55    
dbj|BAJ91202.1|  predicted protein                                      211   8e-55    
gb|KFK43516.1|  hypothetical protein AALP_AA1G135600                    209   9e-55    
ref|XP_010934958.1|  PREDICTED: putative pentatricopeptide repeat...    212   9e-55    
ref|XP_010430495.1|  PREDICTED: pentatricopeptide repeat-containi...    210   1e-54    
gb|KHG03194.1|  hypothetical protein F383_06561                         209   1e-54    
ref|XP_006598186.1|  PREDICTED: pentatricopeptide repeat-containi...    209   1e-54    
ref|XP_010673748.1|  PREDICTED: pentatricopeptide repeat-containi...    208   1e-54    
ref|XP_006301404.1|  hypothetical protein CARUB_v10021820mg             211   1e-54    
ref|NP_564809.1|  transacting siRNA generating locus                    210   1e-54    
ref|XP_011032518.1|  PREDICTED: putative pentatricopeptide repeat...    211   1e-54    
ref|XP_010667980.1|  PREDICTED: pentatricopeptide repeat-containi...    209   1e-54    
gb|AGG38110.1|  maternal effect embryo arrest 40 protein                212   1e-54    
ref|XP_008790931.1|  PREDICTED: pentatricopeptide repeat-containi...    212   1e-54    
ref|XP_006485104.1|  PREDICTED: pentatricopeptide repeat-containi...    214   1e-54    
ref|XP_002985098.1|  hypothetical protein SELMODRAFT_121399             210   1e-54    
ref|XP_010520856.1|  PREDICTED: pentatricopeptide repeat-containi...    210   2e-54    
ref|XP_010494656.1|  PREDICTED: pentatricopeptide repeat-containi...    210   2e-54    
ref|XP_010062706.1|  PREDICTED: pentatricopeptide repeat-containi...    208   2e-54    
ref|XP_007041360.1|  Pentatricopeptide repeat (PPR) superfamily p...    210   2e-54    
ref|XP_007030314.1|  Tetratricopeptide repeat-like superfamily pr...    210   2e-54    
ref|XP_010419491.1|  PREDICTED: pentatricopeptide repeat-containi...    207   2e-54    
ref|XP_006436947.1|  hypothetical protein CICLE_v10033858mg             214   2e-54    
ref|XP_007224618.1|  hypothetical protein PRUPE_ppa026847mg             209   2e-54    
ref|XP_003531505.1|  PREDICTED: pentatricopeptide repeat-containi...    208   2e-54    
ref|XP_010254618.1|  PREDICTED: pentatricopeptide repeat-containi...    209   2e-54    
ref|XP_010037855.1|  PREDICTED: pentatricopeptide repeat-containi...    211   2e-54    
ref|XP_011092997.1|  PREDICTED: pentatricopeptide repeat-containi...    211   2e-54    
ref|XP_010671063.1|  PREDICTED: pentatricopeptide repeat-containi...    209   2e-54    
gb|EMT30707.1|  hypothetical protein F775_11490                         208   2e-54    
ref|XP_010530424.1|  PREDICTED: pentatricopeptide repeat-containi...    209   2e-54    
ref|XP_010523366.1|  PREDICTED: pentatricopeptide repeat-containi...    209   2e-54    
gb|KCW88438.1|  hypothetical protein EUGRSUZ_A00824                     212   2e-54    
ref|NP_176522.2|  pentatricopeptide repeat-containing protein           208   2e-54    
ref|XP_008368150.1|  PREDICTED: pentatricopeptide repeat-containi...    209   2e-54    
ref|XP_006485103.1|  PREDICTED: pentatricopeptide repeat-containi...    214   2e-54    
gb|KHN08231.1|  Pentatricopeptide repeat-containing protein             206   2e-54    
ref|XP_007049305.1|  Pentatricopeptide repeat-containing protein,...    211   2e-54    
gb|AAM97065.1|  putative membrane-associated salt-inducible protein     208   3e-54    
ref|XP_004149490.1|  PREDICTED: putative pentatricopeptide repeat...    211   3e-54    
ref|XP_002319601.2|  hypothetical protein POPTR_0013s03290g             206   3e-54    
gb|AFW55898.1|  hypothetical protein ZEAMMB73_909442                    210   3e-54    
gb|KHG11326.1|  hypothetical protein F383_12865                         206   3e-54    
emb|CDY34370.1|  BnaA09g11120D                                          211   3e-54    
ref|XP_006300864.1|  hypothetical protein CARUB_v10019958mg             209   3e-54    
ref|XP_002979436.1|  hypothetical protein SELMODRAFT_177686             206   3e-54    
ref|XP_010419473.1|  PREDICTED: pentatricopeptide repeat-containi...    208   3e-54    
ref|XP_006382709.1|  hypothetical protein POPTR_0005s04650g             207   3e-54    
ref|XP_010904671.1|  PREDICTED: pentatricopeptide repeat-containi...    207   4e-54    
ref|XP_004292464.1|  PREDICTED: pentatricopeptide repeat-containi...    209   4e-54    
ref|XP_011005660.1|  PREDICTED: pentatricopeptide repeat-containi...    209   4e-54    
ref|XP_008454893.1|  PREDICTED: pentatricopeptide repeat-containi...    208   4e-54    
ref|XP_010493846.1|  PREDICTED: pentatricopeptide repeat-containi...    209   4e-54    
gb|AAF79658.1|AC025416_32  F5O11.4                                      212   4e-54    
ref|XP_002977892.1|  hypothetical protein SELMODRAFT_107734             206   4e-54    
ref|NP_176447.1|  pentatricopeptide repeat-adenylate cyclase            208   5e-54    
ref|XP_008776298.1|  PREDICTED: pentatricopeptide repeat-containi...    208   5e-54    
ref|XP_010680035.1|  PREDICTED: putative pentatricopeptide repeat...    211   5e-54    
gb|KHN27740.1|  Pentatricopeptide repeat-containing protein, chlo...    204   5e-54    
ref|XP_006382765.1|  hypothetical protein POPTR_0005s05210g             206   5e-54    
ref|NP_188886.1|  pentatricopeptide repeat-containing protein           208   5e-54    
ref|XP_010540629.1|  PREDICTED: pentatricopeptide repeat-containi...    206   6e-54    
ref|XP_006429052.1|  hypothetical protein CICLE_v10013605mg             210   6e-54    
ref|XP_011090619.1|  PREDICTED: putative pentatricopeptide repeat...    210   6e-54    
ref|XP_010418289.1|  PREDICTED: pentatricopeptide repeat-containi...    211   7e-54    
ref|XP_004293147.1|  PREDICTED: pentatricopeptide repeat-containi...    209   7e-54    
ref|XP_006303167.1|  hypothetical protein CARUB_v10008555mg             208   7e-54    
ref|XP_006405989.1|  hypothetical protein EUTSA_v10028308mg             210   8e-54    
ref|XP_010431726.1|  PREDICTED: pentatricopeptide repeat-containi...    207   8e-54    
ref|XP_004488838.1|  PREDICTED: pentatricopeptide repeat-containi...    206   9e-54    
dbj|BAB01462.1|  unnamed protein product                                208   9e-54    
ref|XP_010673747.1|  PREDICTED: pentatricopeptide repeat-containi...    207   9e-54    
ref|XP_010272603.1|  PREDICTED: pentatricopeptide repeat-containi...    209   1e-53    
emb|CDY25519.1|  BnaC09g11440D                                          207   1e-53    
ref|XP_010687866.1|  PREDICTED: pentatricopeptide repeat-containi...    209   1e-53    
ref|XP_010099493.1|  hypothetical protein L484_000446                   209   1e-53    
ref|XP_007049304.1|  Pentatricopeptide repeat-containing protein,...    211   1e-53    
ref|XP_006417237.1|  hypothetical protein EUTSA_v10007258mg             206   1e-53    
ref|XP_010108616.1|  hypothetical protein L484_000854                   209   1e-53    
gb|KFK37890.1|  hypothetical protein AALP_AA3G042500                    204   1e-53    
ref|XP_010462657.1|  PREDICTED: pentatricopeptide repeat-containi...    205   1e-53    
ref|XP_010935557.1|  PREDICTED: protein Rf1, mitochondrial-like         209   1e-53    
ref|XP_008221377.1|  PREDICTED: putative pentatricopeptide repeat...    209   1e-53    
ref|XP_010247360.1|  PREDICTED: pentatricopeptide repeat-containi...    210   1e-53    
ref|XP_008365653.1|  PREDICTED: pentatricopeptide repeat-containi...    205   1e-53    
ref|XP_010673746.1|  PREDICTED: pentatricopeptide repeat-containi...    208   1e-53    
ref|XP_009385400.1|  PREDICTED: pentatricopeptide repeat-containi...    208   1e-53    
ref|XP_006341056.1|  PREDICTED: pentatricopeptide repeat-containi...    209   1e-53    
gb|KCW88454.1|  hypothetical protein EUGRSUZ_A00842                     206   1e-53    
ref|XP_011003821.1|  PREDICTED: putative pentatricopeptide repeat...    204   2e-53    
gb|KDP42582.1|  hypothetical protein JCGZ_24356                         204   2e-53    
ref|XP_010530355.1|  PREDICTED: pentatricopeptide repeat-containi...    206   2e-53    
ref|XP_003575182.1|  PREDICTED: pentatricopeptide repeat-containi...    205   2e-53    
ref|XP_003523769.1|  PREDICTED: pentatricopeptide repeat-containi...    206   2e-53    
ref|XP_002892307.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    211   2e-53    
gb|AAF19552.1|AC007190_20  F23N19.4                                     212   2e-53    
ref|XP_008802693.1|  PREDICTED: pentatricopeptide repeat-containi...    201   2e-53    
gb|KGN66536.1|  hypothetical protein Csa_1G627440                       202   2e-53    
ref|XP_006300886.1|  hypothetical protein CARUB_v10019976mg             206   2e-53    
ref|XP_010923963.1|  PREDICTED: pentatricopeptide repeat-containi...    208   2e-53    
ref|NP_176529.1|  pentatricopeptide repeat-containing protein           205   2e-53    
ref|XP_010457661.1|  PREDICTED: pentatricopeptide repeat-containi...    207   2e-53    
gb|KEH26934.1|  pentatricopeptide (PPR) repeat protein                  206   3e-53    
ref|XP_008803657.1|  PREDICTED: pentatricopeptide repeat-containi...    208   3e-53    
ref|XP_010673744.1|  PREDICTED: pentatricopeptide repeat-containi...    207   3e-53    
ref|XP_010275860.1|  PREDICTED: pentatricopeptide repeat-containi...    204   3e-53    
ref|XP_002973723.1|  hypothetical protein SELMODRAFT_99426              205   3e-53    
ref|XP_008790694.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    209   3e-53    
ref|XP_009759610.1|  PREDICTED: pentatricopeptide repeat-containi...    208   3e-53    
ref|XP_002975593.1|  hypothetical protein SELMODRAFT_103638             202   3e-53    
ref|XP_010475276.1|  PREDICTED: pentatricopeptide repeat-containi...    207   3e-53    
ref|XP_011076945.1|  PREDICTED: pentatricopeptide repeat-containi...    205   3e-53    
ref|XP_009405630.1|  PREDICTED: pentatricopeptide repeat-containi...    207   3e-53    
ref|XP_008380490.1|  PREDICTED: pentatricopeptide repeat-containi...    206   4e-53    
ref|XP_001777347.1|  predicted protein                                  206   4e-53    
ref|XP_010248027.1|  PREDICTED: pentatricopeptide repeat-containi...    206   4e-53    
emb|CDP12725.1|  unnamed protein product                                207   4e-53    
ref|XP_004230838.1|  PREDICTED: pentatricopeptide repeat-containi...    205   4e-53    
ref|XP_002300545.1|  pentatricopeptide repeat-containing family p...    204   4e-53    
ref|XP_004507375.1|  PREDICTED: pentatricopeptide repeat-containi...    206   4e-53    
emb|CDY31404.1|  BnaA07g03390D                                          207   5e-53    
ref|XP_006296608.1|  hypothetical protein CARUB_v10013258mg             205   5e-53    
ref|XP_002465809.1|  hypothetical protein SORBIDRAFT_01g046200          206   5e-53    
ref|XP_008443759.1|  PREDICTED: pentatricopeptide repeat-containi...    204   5e-53    
ref|XP_004237581.1|  PREDICTED: pentatricopeptide repeat-containi...    207   5e-53    
ref|XP_011024963.1|  PREDICTED: pentatricopeptide repeat-containi...    207   5e-53    
ref|XP_010474606.1|  PREDICTED: pentatricopeptide repeat-containi...    199   5e-53    
ref|XP_007031097.1|  ATP binding,nucleic acid binding,helicases, ...    205   5e-53    
gb|AAM15782.1|AC104428_3  Putative indole-3-acetate beta-glucosyl...    206   5e-53    
ref|XP_006856585.1|  hypothetical protein AMTR_s00046p00202770          204   6e-53    
ref|XP_010430430.1|  PREDICTED: pentatricopeptide repeat-containi...    204   6e-53    
ref|XP_006838158.1|  hypothetical protein AMTR_s00106p00105070          207   6e-53    
ref|XP_006364562.1|  PREDICTED: pentatricopeptide repeat-containi...    205   6e-53    
ref|XP_010044255.1|  PREDICTED: pentatricopeptide repeat-containi...    206   6e-53    
ref|XP_004246460.1|  PREDICTED: pentatricopeptide repeat-containi...    207   6e-53    
ref|XP_010418757.1|  PREDICTED: pentatricopeptide repeat-containi...    204   6e-53    
ref|XP_001776359.1|  predicted protein                                  202   6e-53    
ref|XP_010430336.1|  PREDICTED: pentatricopeptide repeat-containi...    204   6e-53    
gb|KHN32823.1|  Pentatricopeptide repeat-containing protein             205   6e-53    
ref|XP_010431704.1|  PREDICTED: pentatricopeptide repeat-containi...    200   7e-53    
ref|XP_008365654.1|  PREDICTED: pentatricopeptide repeat-containi...    203   7e-53    
ref|XP_006373668.1|  hypothetical protein POPTR_0016s02630g             204   7e-53    
ref|XP_004134213.1|  PREDICTED: pentatricopeptide repeat-containi...    208   7e-53    
emb|CAZ44328.1|  restoring pentatricopeptide repeat protein homol...    206   7e-53    
ref|XP_004164304.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    208   7e-53    
ref|XP_002450255.1|  hypothetical protein SORBIDRAFT_05g002620          208   7e-53    
ref|XP_010277537.1|  PREDICTED: pentatricopeptide repeat-containi...    207   7e-53    
ref|XP_010321813.1|  PREDICTED: pentatricopeptide repeat-containi...    204   7e-53    
ref|NP_176455.2|  pentatricopeptide repeat-containing protein           203   8e-53    
ref|XP_006382761.1|  hypothetical protein POPTR_0005s05170g             202   8e-53    
ref|XP_010494565.1|  PREDICTED: pentatricopeptide repeat-containi...    205   8e-53    
gb|ACM24117.1|  PPR protein                                             206   8e-53    
ref|XP_002267947.3|  PREDICTED: pentatricopeptide repeat-containi...    209   8e-53    
ref|XP_010925750.1|  PREDICTED: pentatricopeptide repeat-containi...    205   8e-53    
gb|KCW80828.1|  hypothetical protein EUGRSUZ_C02193                     206   8e-53    
ref|XP_010476184.1|  PREDICTED: pentatricopeptide repeat-containi...    205   8e-53    
ref|XP_009121190.1|  PREDICTED: pentatricopeptide repeat-containi...    206   9e-53    
ref|XP_010271694.1|  PREDICTED: pentatricopeptide repeat-containi...    205   9e-53    
ref|XP_009586919.1|  PREDICTED: pentatricopeptide repeat-containi...    206   9e-53    
ref|XP_006303916.1|  hypothetical protein CARUB_v10008426mg             206   9e-53    
ref|XP_006384120.1|  hypothetical protein POPTR_0004s07290g             202   9e-53    
gb|KDP46163.1|  hypothetical protein JCGZ_06674                         206   9e-53    
ref|XP_002972554.1|  hypothetical protein SELMODRAFT_97435              204   9e-53    
ref|XP_009371377.1|  PREDICTED: pentatricopeptide repeat-containi...    203   9e-53    
ref|XP_010463963.1|  PREDICTED: pentatricopeptide repeat-containi...    204   1e-52    
ref|XP_006306401.1|  hypothetical protein CARUB_v10012310mg             204   1e-52    
ref|XP_010276196.1|  PREDICTED: pentatricopeptide repeat-containi...    209   1e-52    
ref|XP_009618149.1|  PREDICTED: pentatricopeptide repeat-containi...    206   1e-52    
ref|XP_006382084.1|  hypothetical protein POPTR_0006s27340g             201   1e-52    
ref|XP_008383030.1|  PREDICTED: pentatricopeptide repeat-containi...    203   1e-52    
dbj|BAE98744.1|  PPR-repeat protein                                     203   1e-52    
ref|XP_004288876.1|  PREDICTED: pentatricopeptide repeat-containi...    204   1e-52    
ref|XP_011031385.1|  PREDICTED: putative pentatricopeptide repeat...    204   1e-52    
ref|XP_006846078.1|  hypothetical protein AMTR_s00012p00087690          206   1e-52    
ref|NP_001049065.1|  Os03g0165100                                       205   1e-52    
ref|XP_009110626.1|  PREDICTED: pentatricopeptide repeat-containi...    204   1e-52    
ref|XP_010935645.1|  PREDICTED: protein Rf1, mitochondrial-like         206   1e-52    
ref|XP_010474600.1|  PREDICTED: pentatricopeptide repeat-containi...    208   1e-52    
ref|XP_010658442.1|  PREDICTED: pentatricopeptide repeat-containi...    206   1e-52    
ref|XP_004229569.1|  PREDICTED: pentatricopeptide repeat-containi...    207   1e-52    



>ref|XP_009593769.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana tomentosiformis]
 ref|XP_009593770.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana tomentosiformis]
 ref|XP_009593771.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana tomentosiformis]
 ref|XP_009593772.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana tomentosiformis]
 ref|XP_009593773.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana tomentosiformis]
 ref|XP_009593774.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana tomentosiformis]
 ref|XP_009593776.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana tomentosiformis]
 ref|XP_009593777.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana tomentosiformis]
Length=460

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/459 (69%), Positives = 378/459 (82%), Gaps = 0/459 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M+ IK +LST+L+NI +A LCKAKQLEKAE V++DGIR+GV  DVVTYNT+I AYC FVG
Sbjct  1     MWSIKDKLSTRLMNICIASLCKAKQLEKAEAVLVDGIRIGVQPDVVTYNTVIAAYCRFVG  60

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             IDAGYSIL+RM E GI PDVITYNSLIA ATR+ MLSRCLDL +EMLE+ ILPD WSYNT
Sbjct  61    IDAGYSILYRMKEAGISPDVITYNSLIAGATRYCMLSRCLDLFDEMLEMSILPDIWSYNT  120

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LMHC F+L KPDEAYR FQDI   DI   P TFNIL++GLC NGYTE ALMLFR LK  G
Sbjct  121   LMHCFFKLRKPDEAYRVFQDIILKDISLHPATFNILMNGLCKNGYTENALMLFRSLKRHG  180

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             F PQLVTYNILIHGLC SGR   A+  LNELV+ G+ PNAITYTT+MKCCFR R+FEEGL
Sbjct  181   FTPQLVTYNILIHGLCKSGRGKTAKEFLNELVEAGHIPNAITYTTVMKCCFRCRQFEEGL  240

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             +I  EMRRKGY +D+FAYCTV S L+K GRM +A + +G +I NG +LD V++N +INLY
Sbjct  241   KIFAEMRRKGYTYDAFAYCTVASMLLKTGRMNEANEYLGYIITNGFDLDTVSFNNIINLY  300

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CKEG+LDNAY L+ EAE+KG + DKYTHTI+IDGLC+ GN KEA +HL+C  +MGFDSNL
Sbjct  301   CKEGQLDNAYKLLYEAEKKGLESDKYTHTILIDGLCRTGNFKEAQQHLDCMSMMGFDSNL  360

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA N  I+GLCK G +D+AL +F+SMD KD FTYS++VHGLCKAGRFR AS+LLLSC+ G
Sbjct  361   VALNSFINGLCKAGHLDHALQMFESMDAKDSFTYSTIVHGLCKAGRFRAASKLLLSCVRG  420

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             GM+ILKS+++ VI GL+ SGF  EARK+ S+++L+KIL+
Sbjct  421   GMRILKSNKRVVITGLRSSGFSHEARKVQSKIRLAKILH  459



>ref|XP_006348886.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like [Solanum tuberosum]
Length=460

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/459 (69%), Positives = 375/459 (82%), Gaps = 0/459 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M+ IK RLST+L+NI VA LCKAKQLEKAE VI+DGIR+GV  DVVTYNTLITAYC FVG
Sbjct  1     MWSIKGRLSTRLMNICVASLCKAKQLEKAEVVIVDGIRIGVQPDVVTYNTLITAYCRFVG  60

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             IDAGYSIL+RM E GI PD ITYNSLIA ATR+ M+SRC +L EEMLE+ ILPD WSYNT
Sbjct  61    IDAGYSILYRMKEAGIYPDTITYNSLIAGATRYCMISRCFNLFEEMLEMSILPDIWSYNT  120

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LMHC F+L KPDEAYR FQDI   DI   P TFNIL++GLCMNGYTE ALMLFR +K  G
Sbjct  121   LMHCFFKLRKPDEAYRVFQDILLKDISVHPATFNILINGLCMNGYTENALMLFRSIKRHG  180

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             FIPQL TYNILIHGLC SGR   AR  LNELV+ G+ PNAITYTT+MKCCFR R+FEEGL
Sbjct  181   FIPQLATYNILIHGLCKSGRGKTAREFLNELVESGHIPNAITYTTVMKCCFRCRQFEEGL  240

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             +I  EMRRKGY +D+FAYCTV S L+K G+M +A + +G +I NG +LD+V++NT++NLY
Sbjct  241   KIFSEMRRKGYTYDAFAYCTVASMLLKTGKMNEANEYLGYIITNGFDLDIVSFNTIVNLY  300

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CKEG+LDNAY L+ EAE+KG + DKYTHTI IDGLC+ GN KEA +HL+   +MGFDSNL
Sbjct  301   CKEGQLDNAYKLLHEAEKKGLESDKYTHTIFIDGLCRTGNFKEAQQHLDYMSMMGFDSNL  360

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA N  I+GLCK G +D+AL +F+SMD KD  TYS++VH LC A RFR AS+LLLSCI G
Sbjct  361   VALNSFINGLCKAGHLDHALRMFESMDAKDSITYSTMVHSLCNARRFRAASKLLLSCIRG  420

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             GM+ILKSD++ VIDGL+ SG+ QEARK+ S+++L+ IL+
Sbjct  421   GMRILKSDKRGVIDGLRGSGYSQEARKVQSKIRLATILH  459



>ref|XP_009599852.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana tomentosiformis]
Length=460

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/459 (68%), Positives = 377/459 (82%), Gaps = 0/459 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M+ IK +LST+L+N+ VA LCKAKQLEKAE VI+DGIR+GV  DVVTYNTLI AYC FVG
Sbjct  1     MWSIKDKLSTRLMNVCVASLCKAKQLEKAEAVIVDGIRIGVQPDVVTYNTLIAAYCRFVG  60

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             IDAGYS+LHRM E GI P+VITYNSLIA ATR+ +LS CLDL +EMLE+ ILPD WSYNT
Sbjct  61    IDAGYSVLHRMKEAGINPNVITYNSLIAGATRYCLLSPCLDLFDEMLEMSILPDIWSYNT  120

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LMHC F++GKPDEAYR FQDI   DI   P TFNIL++GLCMNGYTE ALMLFR LK  G
Sbjct  121   LMHCFFKVGKPDEAYRVFQDILLKDISVHPATFNILINGLCMNGYTENALMLFRSLKRHG  180

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             FIPQLVTYNILIHGLC S R   AR  L ELV+ G+ PNAITYTTIMKCCFR ++FEEGL
Sbjct  181   FIPQLVTYNILIHGLCKSRRGKAAREFLTELVEWGHIPNAITYTTIMKCCFRCKQFEEGL  240

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             +I  EMRRKGY +D+FAYCTV S L+K GR+ +A + +G +I +G  LD V++NT++NLY
Sbjct  241   KIFVEMRRKGYTYDAFAYCTVASMLLKTGRITEAREYLGYIITSGFSLDTVSFNTIVNLY  300

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CKEG+LDNAY L+ EAE++G + DKYTH I+IDGLC+ GN KEAL+HLN   +MGFDSNL
Sbjct  301   CKEGQLDNAYRLLYEAEKEGLESDKYTHAILIDGLCRTGNFKEALQHLNGMSMMGFDSNL  360

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA+N  I+GLCK G  D+AL +F+SMD KD  TYS++VHGLCKAGRFR AS+LLLSCI G
Sbjct  361   VAWNSFINGLCKAGHFDHALQMFESMDVKDSVTYSTIVHGLCKAGRFRAASKLLLSCIRG  420

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             GM+ILKSD++ V+DGL+ SG  QEARK+ S+++L+KIL+
Sbjct  421   GMRILKSDKRFVVDGLRSSGLSQEARKVQSKIRLAKILH  459



>ref|XP_009766475.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X1 [Nicotiana sylvestris]
 ref|XP_009766476.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X1 [Nicotiana sylvestris]
 ref|XP_009766477.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X1 [Nicotiana sylvestris]
Length=460

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/459 (68%), Positives = 375/459 (82%), Gaps = 0/459 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M+ IK +LST+L+N+ VA LCKAKQLEKAE VI+D I +GV  DVVTYNTLI AYC FVG
Sbjct  1     MWSIKDKLSTRLMNVCVASLCKAKQLEKAEAVIVDAIIIGVQPDVVTYNTLIAAYCRFVG  60

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             IDAGYS+LHRM E GI P+VITYN+LIA ATR+ +LSRCLDL +EMLE+ ILPD WSYNT
Sbjct  61    IDAGYSVLHRMKEAGINPNVITYNTLIAGATRYCLLSRCLDLFDEMLEMSILPDIWSYNT  120

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LMHC  +LGKPDEAYR FQDI   DI   P TFNIL++GLCMNGYTE ALMLFR LK  G
Sbjct  121   LMHCFLKLGKPDEAYRVFQDILLKDISVHPATFNILINGLCMNGYTENALMLFRSLKRHG  180

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             FIPQLVTYNILIHGLC S R   AR  L ELV+ G+ PNAITYTTIMKCCFR ++FEEGL
Sbjct  181   FIPQLVTYNILIHGLCKSRRGKAAREFLTELVESGHIPNAITYTTIMKCCFRCKQFEEGL  240

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             +I  EMRRKGY +D+FAYCTV S L+K GR+ +A + +G +I +G  LD V++NT++NLY
Sbjct  241   KIFAEMRRKGYTYDTFAYCTVASMLLKTGRITEASEYLGYIITSGFSLDTVSFNTIVNLY  300

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CKEG+LDNAY L+ EAE++G + DKYTH I+IDGLC+ GN KEAL+HLN   +MGFDSNL
Sbjct  301   CKEGQLDNAYKLLYEAEKEGLESDKYTHAILIDGLCRTGNFKEALQHLNSMSMMGFDSNL  360

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA+N  I+GLCK G  D+AL +F+SMD KD  TYS++VHGLCKAGRFR AS+LLLSCI G
Sbjct  361   VAWNSFINGLCKAGHFDHALQMFESMDVKDSVTYSTIVHGLCKAGRFRAASKLLLSCIRG  420

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             GM+ILKSD++ V+DGL+ SG  QEARK+ S+++L+KIL+
Sbjct  421   GMRILKSDKRFVVDGLRSSGLSQEARKVQSKIRLAKILH  459



>ref|XP_004243786.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X1 [Solanum lycopersicum]
 ref|XP_010323676.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X1 [Solanum lycopersicum]
 ref|XP_010323677.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X1 [Solanum lycopersicum]
 ref|XP_010323678.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X1 [Solanum lycopersicum]
 ref|XP_010323679.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X1 [Solanum lycopersicum]
Length=460

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/459 (68%), Positives = 374/459 (81%), Gaps = 0/459 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M+ IK RLST+L+NI VA LCKAKQLEKAE VI+DGIR+GV  DVVTYNTLITAYC FVG
Sbjct  1     MWSIKGRLSTRLMNICVASLCKAKQLEKAEVVIVDGIRIGVQPDVVTYNTLITAYCRFVG  60

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             IDAGYS+L+RM E GI PD ITYNSLIA ATR+ M+SRC DL EEMLE+ ILPD WSYNT
Sbjct  61    IDAGYSVLYRMKEAGIYPDTITYNSLIAGATRYCMISRCFDLFEEMLEMSILPDIWSYNT  120

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LMHC F+L KPDEAYR FQDI   +I   P TFNIL++GLCMNGYTE ALMLFR +K  G
Sbjct  121   LMHCFFKLRKPDEAYRVFQDILLKNISVHPATFNILINGLCMNGYTENALMLFRSIKRHG  180

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             FIPQL TYNILIHGLC SGR   AR  LNELV+ G+ PNAITYTT+MKCCF+  +FEEGL
Sbjct  181   FIPQLATYNILIHGLCKSGRGKTAREFLNELVESGHIPNAITYTTVMKCCFKCEQFEEGL  240

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             +I  EMRRKGY +D+FAYCTV S L+K G+M +A + +G +I NG +LD+V++NT++NLY
Sbjct  241   KIFAEMRRKGYTYDAFAYCTVASMLLKTGKMNEANEYLGYIITNGFDLDMVSFNTIVNLY  300

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CKEG+LDNAY L+ EAE+KG + DKYTHTI IDGLC+ GN KEA +HL+   +MGFDSNL
Sbjct  301   CKEGQLDNAYKLLHEAEKKGLESDKYTHTIFIDGLCRTGNFKEAQQHLDYMSMMGFDSNL  360

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA N  I+GLCK G +D+AL +F+SMD KD  TYS++VH LC A RFR AS+LLLSCI G
Sbjct  361   VALNSFINGLCKAGHLDHALRMFESMDAKDSITYSTMVHSLCNARRFRAASKLLLSCIRG  420

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             GM+ILKSD++ VIDGL+ SG+ QEA+K+ S+++L+KIL 
Sbjct  421   GMRILKSDKRGVIDGLRGSGYSQEAKKIQSKIRLAKILQ  459



>ref|XP_009790968.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana sylvestris]
 ref|XP_009790969.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana sylvestris]
 ref|XP_009790970.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana sylvestris]
 ref|XP_009790971.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana sylvestris]
 ref|XP_009790973.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nicotiana sylvestris]
Length=460

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/459 (68%), Positives = 374/459 (81%), Gaps = 0/459 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M+ IK +LST+L+NI +A LCKAKQLEKAE+VI+DGIR+GV  DVVTYNT+I AYC  VG
Sbjct  1     MWSIKDKLSTRLMNICIASLCKAKQLEKAESVIVDGIRIGVQPDVVTYNTVIAAYCRVVG  60

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             IDAGYSILHRM E GI PDVITYNSLIA ATR+ MLSRCLDL +EMLE+ ILPD WSYNT
Sbjct  61    IDAGYSILHRMKEAGINPDVITYNSLIAGATRYCMLSRCLDLFDEMLEMSILPDIWSYNT  120

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LMHC F+L KPDEAYR FQDI   DI   P TFNIL++GLC NGYTE ALMLFR LK  G
Sbjct  121   LMHCFFKLRKPDEAYRVFQDIILKDISLHPATFNILMNGLCKNGYTENALMLFRSLKRHG  180

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             F PQLVTYNILIHGLC SGR   A+  LNELV+ G+ PNAITYTT+MKCCFR R+FEEGL
Sbjct  181   FTPQLVTYNILIHGLCKSGRGKTAKEFLNELVEAGHIPNAITYTTVMKCCFRCRQFEEGL  240

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             +I  EMRRKGY +D+FAYCTV S L+K GRM +A + +G +I NG +LD V++N +INLY
Sbjct  241   KIFAEMRRKGYTYDAFAYCTVASMLLKTGRMNEANEYLGYIITNGFDLDTVSFNNIINLY  300

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
              KEG+LDNAY L+ EAE+KG   DKYTHTI+IDGLC+ GN KEA +HL+C  +MGFDSNL
Sbjct  301   YKEGQLDNAYKLLYEAEKKGLKSDKYTHTILIDGLCRTGNFKEAQQHLDCMSMMGFDSNL  360

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA N  I+GLCK G +D+AL +F+SMD KD FTYS++VHGLCKAGRF  AS+LLLSC+  
Sbjct  361   VALNSFINGLCKAGHLDHALRMFESMDAKDSFTYSTIVHGLCKAGRFCAASKLLLSCVRD  420

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             GM+ILKS+++ VI GL+ SGF  EARK+ S+++L+KIL+
Sbjct  421   GMRILKSNKRVVISGLRSSGFSHEARKVQSKIRLAKILH  459



>ref|XP_006357835.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X1 [Solanum tuberosum]
 ref|XP_006357836.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X2 [Solanum tuberosum]
 ref|XP_006357837.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X3 [Solanum tuberosum]
Length=460

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/459 (65%), Positives = 369/459 (80%), Gaps = 0/459 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M RIK +LST+L+N+ VA LCKAK+LEKAE VI+DG+R+G+  DVVTYNTLI AYC FVG
Sbjct  1     MRRIKDKLSTRLMNVCVASLCKAKKLEKAEIVIVDGVRIGLQPDVVTYNTLIAAYCRFVG  60

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             IDAGYSIL+RM + GI PDVITYN+LIA ATR+ +LS+CLDL +EMLE+ ILPD WSYN+
Sbjct  61    IDAGYSILNRMKDAGINPDVITYNALIAGATRYSLLSKCLDLFDEMLEMRILPDIWSYNS  120

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LM+C F+ GKPDEAYR FQDI   DI     TFNIL++GLCMNGYTE ALMLFR LK  G
Sbjct  121   LMNCFFKFGKPDEAYRVFQDILLKDISVHSATFNILINGLCMNGYTENALMLFRSLKRHG  180

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             FIPQLVTYNILIHGLC SGR   AR  LNELV+ G+ PNAITYTT+MKCCFR R+FEEGL
Sbjct  181   FIPQLVTYNILIHGLCKSGRGNVAREFLNELVESGHIPNAITYTTVMKCCFRYRQFEEGL  240

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             +I  EMR KGY +D+FAYCTV S L+K GR+ +A + +G +I +G  LD+V++NT+ NLY
Sbjct  241   KIFAEMRNKGYTYDAFAYCTVASMLLKTGRITEANEYLGYIITSGFTLDIVSFNTIFNLY  300

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CKEG+LDNAY L+ EAE  G + DKYTH I IDGLC+ GN +EA + LN   +MGFDSNL
Sbjct  301   CKEGQLDNAYKLLYEAENGGLESDKYTHAIWIDGLCRTGNFQEAQQQLNRMSVMGFDSNL  360

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA+N  I+GLCK G++DYA  +F+SMD KD  TYS++V GLC+A RFR AS+LLLSCI G
Sbjct  361   VAWNSFINGLCKTGQLDYATHIFESMDTKDSVTYSTIVRGLCQARRFRAASKLLLSCIRG  420

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             GM+ILKSD++ V+DGL+  G   EARK+ S+++++K+L+
Sbjct  421   GMRILKSDKRIVVDGLRSCGLTHEARKVQSKIQMAKLLH  459



>ref|XP_004232338.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Solanum lycopersicum]
 ref|XP_010316320.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Solanum lycopersicum]
Length=460

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/459 (65%), Positives = 367/459 (80%), Gaps = 0/459 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M RIK +LST+L+N+ VA LCKAKQLEKAE VI+DGIR+G+  DVVTYNTLI AYC FVG
Sbjct  1     MRRIKDKLSTRLMNVCVASLCKAKQLEKAEIVIVDGIRIGLQPDVVTYNTLIAAYCRFVG  60

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             IDAGYSIL+RM + GI PDVITYN+LIA ATR+ +LS+CLDL +EMLE+ ILPD WSYNT
Sbjct  61    IDAGYSILNRMKDAGINPDVITYNALIAGATRNSLLSKCLDLFDEMLEMRILPDIWSYNT  120

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LM+C F+ GKPDEAYR FQDI   DI     TF+IL++GLCMNGYTE ALMLFR LK  G
Sbjct  121   LMNCFFKFGKPDEAYRVFQDILLKDISVHSATFSILINGLCMNGYTENALMLFRSLKRHG  180

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             F PQLVTYNILIHGLC SGR   AR  LNELV+ G+ PNAITYTT+MKCCFR R+FEEGL
Sbjct  181   FTPQLVTYNILIHGLCKSGRGNVAREFLNELVESGHIPNAITYTTVMKCCFRYRQFEEGL  240

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             +I  EMR KGY +D+FAYCTV S L+K GR+ +A + +G +I +G  LD+V++NT+ N+Y
Sbjct  241   KIFAEMRNKGYTYDAFAYCTVTSMLLKTGRITEANEYLGYIITSGFTLDIVSFNTIFNVY  300

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CKEG+LDNAY L+ EAE  G + DK+TH I IDGLC+ GN +EA + LN   + GFDSNL
Sbjct  301   CKEGQLDNAYKLLYEAENGGLESDKFTHAIWIDGLCRTGNFQEAQQQLNRMSVTGFDSNL  360

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA+N  I+GLCK G++DYA  +F+SMD KD  TYS++V GLC+A RFR AS+LLLSCI G
Sbjct  361   VAWNSFINGLCKTGQLDYATHIFESMDTKDSVTYSTIVRGLCQARRFRAASKLLLSCIRG  420

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             GM+ILKSD++ VIDGL+  G   EARK+ S+++++K+L+
Sbjct  421   GMRILKSDKRIVIDGLRSCGLTHEARKVQSKIQMAKLLH  459



>ref|XP_011075861.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Sesamum indicum]
 ref|XP_011075862.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Sesamum indicum]
 ref|XP_011075863.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Sesamum indicum]
 ref|XP_011075864.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Sesamum indicum]
 ref|XP_011075865.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Sesamum indicum]
Length=456

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/453 (64%), Positives = 361/453 (80%), Gaps = 1/453 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             RLSTKLLNI++A LC+AKQLEKAE  IID IR+GV  DVVTYNTLIT YC FVG DAGY 
Sbjct  4     RLSTKLLNISIASLCRAKQLEKAEAAIIDAIRLGVLPDVVTYNTLITGYCQFVGFDAGYC  63

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             ++HRM E GI PDV+TYNSL+A ATR   LS CLD+LEEMLE+GI PD WSYNTLMHCLF
Sbjct  64    VIHRMKEAGINPDVVTYNSLMAGATRLQSLSSCLDMLEEMLEMGITPDVWSYNTLMHCLF  123

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             +LGKPDEAYR F DI   +I PC  TFNIL+SGLC NGY +KAL+LFR L+  G+IP++V
Sbjct  124   KLGKPDEAYRTFHDILLKNISPCQATFNILISGLCKNGYIDKALLLFRNLQRHGYIPEIV  183

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+ LC SG W    RL  EL + G++PNAITYTT+MKCCFR + F EGL+I  EM
Sbjct  184   TYNILINSLCKSGMWKDMMRLFEELRESGHDPNAITYTTVMKCCFRCKHFREGLEIFLEM  243

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +RKGY +D F+YCT++  L+K+GR +DA +C+ +MI  G ELD+ +YNTLIN +CKEGKL
Sbjct  244   KRKGYAYDLFSYCTLVGALLKSGRRQDANNCIAHMIKIGYELDMASYNTLINWHCKEGKL  303

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             ++AY L+  AE +G DCDKYTHTI+IDGLCKAG +  A RHLN  K++GF+  LVAFNC 
Sbjct  304   ESAYSLLNLAEERGLDCDKYTHTILIDGLCKAGKIDAAQRHLNHMKMLGFNC-LVAFNCF  362

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             IDGLCK+G +DYAL +F S+D KD FTYSSLVH LCKA R+R+A+ELLLSCI  GMK+LK
Sbjct  363   IDGLCKLGHLDYALKIFHSVDVKDSFTYSSLVHNLCKARRYRLAAELLLSCIKAGMKVLK  422

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             SD++AVI GL  +G  ++A+K   +++++K+L+
Sbjct  423   SDQKAVIKGLTLTGSKRDAKKFELKIRIAKLLH  455



>ref|XP_007048729.1| Pentatricopeptide repeat superfamily protein, putative isoform 
2 [Theobroma cacao]
 ref|XP_007048730.1| Pentatricopeptide repeat superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOX92886.1| Pentatricopeptide repeat superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOX92887.1| Pentatricopeptide repeat superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=457

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/453 (62%), Positives = 358/453 (79%), Gaps = 0/453 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             RLST+LLN+ +A  CKA +LEKAE+VIIDGIR+GV  D VTYN LI AYC  VGIDAGYS
Sbjct  4     RLSTRLLNVCIASFCKAHKLEKAESVIIDGIRLGVLPDGVTYNILIDAYCRLVGIDAGYS  63

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +LHRM E GI PDVI+YNSLIA ATR+  +SR  +L +EM++ GI PD WSYNTLMH  F
Sbjct  64    VLHRMGEAGISPDVISYNSLIAGATRNCQISRSFNLFDEMIQRGIAPDIWSYNTLMHGFF  123

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             +LGKPDEA R F+DI   +  PC  TFNI+++GLC NGYTE A MLFR L+  GF+P+L+
Sbjct  124   KLGKPDEANRVFRDIILVEHLPCVATFNIMMNGLCKNGYTENAFMLFRNLQRHGFVPELM  183

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNIL+ GLC  GR   A R+  E+V+ G+ PNAITYT +++CCFR R+FEEGL++L EM
Sbjct  184   TYNILVSGLCKIGRLGLAMRIFKEIVESGHVPNAITYTPVLRCCFRKRKFEEGLELLSEM  243

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             + KGY FD FAYCTVI  LIK G+MK+A + +  M+  GIELD+V+YNTLIN+YCK+ KL
Sbjct  244   KSKGYTFDGFAYCTVIGALIKIGKMKEATEFMVEMMRTGIELDIVSYNTLINMYCKDNKL  303

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             + AY L+ + E+KG +CDKYTHTI+ID LCKAGN++ A RHL     MGFDSNL A+NC 
Sbjct  304   EEAYKLLDDIEKKGLECDKYTHTIMIDALCKAGNIEGAARHLKYMSTMGFDSNLAAYNCF  363

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             IDGLCKVG++D A+ VFKSM+ +D FTYSSLVH LC+AGR+R AS+LLLSC+  GMKILK
Sbjct  364   IDGLCKVGQIDNAMKVFKSMEVRDSFTYSSLVHNLCRAGRYRSASKLLLSCLRSGMKILK  423

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             S ++AV+ GL++SGF  EARK+ S++++++ILN
Sbjct  424   SAQRAVLSGLRYSGFPGEARKVQSKIRIARILN  456



>ref|XP_007048728.1| Pentatricopeptide repeat superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX92885.1| Pentatricopeptide repeat superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=505

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/457 (62%), Positives = 360/457 (79%), Gaps = 0/457 (0%)
 Frame = -1

Query  2294  RIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGID  2115
             R+  RLST+LLN+ +A  CKA +LEKAE+VIIDGIR+GV  D VTYN LI AYC  VGID
Sbjct  48    RMVRRLSTRLLNVCIASFCKAHKLEKAESVIIDGIRLGVLPDGVTYNILIDAYCRLVGID  107

Query  2114  AGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLM  1935
             AGYS+LHRM E GI PDVI+YNSLIA ATR+  +SR  +L +EM++ GI PD WSYNTLM
Sbjct  108   AGYSVLHRMGEAGISPDVISYNSLIAGATRNCQISRSFNLFDEMIQRGIAPDIWSYNTLM  167

Query  1934  HCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFI  1755
             H  F+LGKPDEA R F+DI   +  PC  TFNI+++GLC NGYTE A MLFR L+  GF+
Sbjct  168   HGFFKLGKPDEANRVFRDIILVEHLPCVATFNIMMNGLCKNGYTENAFMLFRNLQRHGFV  227

Query  1754  PQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQI  1575
             P+L+TYNIL+ GLC  GR   A R+  E+V+ G+ PNAITYT +++CCFR R+FEEGL++
Sbjct  228   PELMTYNILVSGLCKIGRLGLAMRIFKEIVESGHVPNAITYTPVLRCCFRKRKFEEGLEL  287

Query  1574  LEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCK  1395
             L EM+ KGY FD FAYCTVI  LIK G+MK+A + +  M+  GIELD+V+YNTLIN+YCK
Sbjct  288   LSEMKSKGYTFDGFAYCTVIGALIKIGKMKEATEFMVEMMRTGIELDIVSYNTLINMYCK  347

Query  1394  EGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVA  1215
             + KL+ AY L+ + E+KG +CDKYTHTI+ID LCKAGN++ A RHL     MGFDSNL A
Sbjct  348   DNKLEEAYKLLDDIEKKGLECDKYTHTIMIDALCKAGNIEGAARHLKYMSTMGFDSNLAA  407

Query  1214  FNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGM  1035
             +NC IDGLCKVG++D A+ VFKSM+ +D FTYSSLVH LC+AGR+R AS+LLLSC+  GM
Sbjct  408   YNCFIDGLCKVGQIDNAMKVFKSMEVRDSFTYSSLVHNLCRAGRYRSASKLLLSCLRSGM  467

Query  1034  KILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             KILKS ++AV+ GL++SGF  EARK+ S++++++ILN
Sbjct  468   KILKSAQRAVLSGLRYSGFPGEARKVQSKIRIARILN  504



>ref|XP_007048731.1| Pentatricopeptide repeat superfamily protein, putative isoform 
4 [Theobroma cacao]
 ref|XP_007048732.1| Pentatricopeptide repeat superfamily protein, putative isoform 
4 [Theobroma cacao]
 gb|EOX92888.1| Pentatricopeptide repeat superfamily protein, putative isoform 
4 [Theobroma cacao]
 gb|EOX92889.1| Pentatricopeptide repeat superfamily protein, putative isoform 
4 [Theobroma cacao]
Length=490

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/457 (62%), Positives = 360/457 (79%), Gaps = 0/457 (0%)
 Frame = -1

Query  2294  RIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGID  2115
             R+  RLST+LLN+ +A  CKA +LEKAE+VIIDGIR+GV  D VTYN LI AYC  VGID
Sbjct  33    RMVRRLSTRLLNVCIASFCKAHKLEKAESVIIDGIRLGVLPDGVTYNILIDAYCRLVGID  92

Query  2114  AGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLM  1935
             AGYS+LHRM E GI PDVI+YNSLIA ATR+  +SR  +L +EM++ GI PD WSYNTLM
Sbjct  93    AGYSVLHRMGEAGISPDVISYNSLIAGATRNCQISRSFNLFDEMIQRGIAPDIWSYNTLM  152

Query  1934  HCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFI  1755
             H  F+LGKPDEA R F+DI   +  PC  TFNI+++GLC NGYTE A MLFR L+  GF+
Sbjct  153   HGFFKLGKPDEANRVFRDIILVEHLPCVATFNIMMNGLCKNGYTENAFMLFRNLQRHGFV  212

Query  1754  PQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQI  1575
             P+L+TYNIL+ GLC  GR   A R+  E+V+ G+ PNAITYT +++CCFR R+FEEGL++
Sbjct  213   PELMTYNILVSGLCKIGRLGLAMRIFKEIVESGHVPNAITYTPVLRCCFRKRKFEEGLEL  272

Query  1574  LEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCK  1395
             L EM+ KGY FD FAYCTVI  LIK G+MK+A + +  M+  GIELD+V+YNTLIN+YCK
Sbjct  273   LSEMKSKGYTFDGFAYCTVIGALIKIGKMKEATEFMVEMMRTGIELDIVSYNTLINMYCK  332

Query  1394  EGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVA  1215
             + KL+ AY L+ + E+KG +CDKYTHTI+ID LCKAGN++ A RHL     MGFDSNL A
Sbjct  333   DNKLEEAYKLLDDIEKKGLECDKYTHTIMIDALCKAGNIEGAARHLKYMSTMGFDSNLAA  392

Query  1214  FNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGM  1035
             +NC IDGLCKVG++D A+ VFKSM+ +D FTYSSLVH LC+AGR+R AS+LLLSC+  GM
Sbjct  393   YNCFIDGLCKVGQIDNAMKVFKSMEVRDSFTYSSLVHNLCRAGRYRSASKLLLSCLRSGM  452

Query  1034  KILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             KILKS ++AV+ GL++SGF  EARK+ S++++++ILN
Sbjct  453   KILKSAQRAVLSGLRYSGFPGEARKVQSKIRIARILN  489



>ref|XP_002274300.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Vitis vinifera]
 ref|XP_010662116.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Vitis vinifera]
 ref|XP_010662117.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Vitis vinifera]
 ref|XP_010662118.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Vitis vinifera]
 ref|XP_010662119.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Vitis vinifera]
Length=457

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/453 (62%), Positives = 357/453 (79%), Gaps = 0/453 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             R STKLLNI +A LCK  QLEKAE V+IDGIR+G+  DVVTYNTL++AY  FVGIDA YS
Sbjct  4     RFSTKLLNICIASLCKVGQLEKAEAVVIDGIRLGLLPDVVTYNTLLSAYSRFVGIDAAYS  63

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             ++HRM E GI PDVITYNSLIA+AT+  +LSR LDL EEML  GI PD WSYN+LMHC F
Sbjct  64    VIHRMKEAGISPDVITYNSLIAAATKRCLLSRSLDLFEEMLRTGIRPDVWSYNSLMHCFF  123

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             +LGKPDEA R FQDI   ++ P   TFNI+++GLC NGYT  AL L+R L+  GF+P+LV
Sbjct  124   KLGKPDEANRVFQDIILTNLLPSSSTFNIMINGLCNNGYTGYALSLYRYLQRQGFVPELV  183

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S +   ARR+L EL + G  P+AITYTT+MKCCFRSR+FE+G +I  EM
Sbjct  184   TYNILINGLCKSRKLNAARRILRELGESGNVPDAITYTTVMKCCFRSRQFEQGFEIFSEM  243

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             + KGY FD+F+YC VI+ L K GR+++A D +  M  + I+LD+V+YNT++NLYC+ GKL
Sbjct  244   KSKGYAFDAFSYCAVIAALTKTGRLEEANDIMEQMARSDIDLDIVSYNTVMNLYCRNGKL  303

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             +  Y L+ E E  G +CD+YTHTI+IDGLCKAGN++ ALRHL     MGFDS LVA NC 
Sbjct  304   EATYKLLDEIEEHGLECDEYTHTILIDGLCKAGNVEGALRHLKNMTKMGFDSTLVAQNCV  363

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             IDGLCKVG++D+A+ +F SM+ KD FTYSS+VH LCKA R+R AS LLL+C+ GGMKIL+
Sbjct  364   IDGLCKVGQLDHAIKMFASMEVKDSFTYSSMVHNLCKARRYRHASRLLLACLRGGMKILR  423

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             +++++VIDGL +SG+  EAR+L S+++L++IL+
Sbjct  424   ANQRSVIDGLCYSGYTSEARRLKSKIRLARILH  456



>ref|XP_008227583.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46680-like 
[Prunus mume]
 ref|XP_008227584.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46680-like 
[Prunus mume]
 ref|XP_008227585.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46680-like 
[Prunus mume]
 ref|XP_008227586.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46680-like 
[Prunus mume]
Length=457

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/452 (61%), Positives = 351/452 (78%), Gaps = 0/452 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LSTKLLNI +A  CK + LEKAE ++IDGIR+GV  DVVTYNTL++AY  FV +DA YS+
Sbjct  6     LSTKLLNICIASFCKVRLLEKAEAIVIDGIRLGVIPDVVTYNTLVSAYSRFVSLDAAYSV  65

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             +HRM E GI P+VITYNSL++ AT++ +LSR LDL EEML  GI P+ WSYN LMHC F+
Sbjct  66    IHRMKEAGISPNVITYNSLMSGATQNCLLSRSLDLFEEMLLAGIHPNLWSYNILMHCFFK  125

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
             LGKPDEA R FQDI   ++PP P T NI+++GLC NGYT+ ALML+R L+  GF+PQLVT
Sbjct  126   LGKPDEANRVFQDILLSNLPPHPATLNIMINGLCNNGYTDNALMLYRNLRRHGFVPQLVT  185

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YNILI+ LC + R   ARR+L EL D G+ PN ITYTT+MKCCFRS ++++GL+I+  M 
Sbjct  186   YNILINWLCKTRRLRQARRILKELGDSGHEPNLITYTTVMKCCFRSNKYDKGLEIMSVMM  245

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              KGY FD +AYCTV++ L+K GR+++A  C+   I NGIELDLVAYNTL+N+YC+EGK +
Sbjct  246   GKGYTFDGYAYCTVVAALVKTGRVEEANACMEQTIRNGIELDLVAYNTLLNMYCREGKFE  305

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              AY L+ E E  G  CDKYTHTIIIDGLCKAGN+  A +HL+  K+MGF  NLVA NC I
Sbjct  306   AAYKLLDEMENGGLLCDKYTHTIIIDGLCKAGNISGAQKHLHYMKMMGFHENLVALNCMI  365

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             DGLCK G++D A+ ++KSM+ KD FTY+SLVH LCKAGRFR+AS+L++ C+  G KI K+
Sbjct  366   DGLCKAGQIDRAMELYKSMETKDSFTYTSLVHNLCKAGRFRLASKLMMKCLRHGKKIPKA  425

Query  1019  DRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
              ++AV DGL  SGF  EARKL  ++++++IL+
Sbjct  426   TQRAVFDGLYSSGFTDEARKLWWKIRVARILH  457



>ref|XP_006450548.1| hypothetical protein CICLE_v10008244mg [Citrus clementina]
 ref|XP_006476201.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X1 [Citrus sinensis]
 ref|XP_006476202.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X2 [Citrus sinensis]
 ref|XP_006476203.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X3 [Citrus sinensis]
 gb|ESR63788.1| hypothetical protein CICLE_v10008244mg [Citrus clementina]
 gb|KDO79609.1| hypothetical protein CISIN_1g012782mg [Citrus sinensis]
 gb|KDO79610.1| hypothetical protein CISIN_1g012782mg [Citrus sinensis]
 gb|KDO79611.1| hypothetical protein CISIN_1g012782mg [Citrus sinensis]
Length=456

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/451 (63%), Positives = 362/451 (80%), Gaps = 0/451 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             +LST+LLNI V   CKA +LEKAE +IIDGIR+GV  DVVTYN LI AYC FV  DAGY+
Sbjct  4     KLSTRLLNICVCTFCKANRLEKAEAIIIDGIRLGVLPDVVTYNMLIDAYCQFVSFDAGYT  63

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             IL+RM E GI PDV+TYNSLIA ATR+ +LS  LDLL+EMLE+GI PD WSYN+LMHCLF
Sbjct  64    ILNRMREAGISPDVVTYNSLIAGATRNSLLSCSLDLLDEMLEMGIPPDVWSYNSLMHCLF  123

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             +LGKPDEA R FQD+  GD+ PC  TFNI+L+GLC N YT+ AL +FR L+  GF+P+LV
Sbjct  124   QLGKPDEANRVFQDMICGDLTPCTATFNIMLNGLCKNRYTDNALRMFRGLQKHGFVPELV  183

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI GLC +GR   AR +L EL D G+ PNAITYTTIMKCCFR+R+++ GL+IL  M
Sbjct  184   TYNILIKGLCKAGRLRTARWILKELGDSGHAPNAITYTTIMKCCFRNRKYKLGLEILSAM  243

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +RKGY FD F YCTVI+  +K GR+K+A D +  M+ +G++LD+V+YNTLINLYCKEGKL
Sbjct  244   KRKGYTFDGFGYCTVIAAFVKIGRLKEATDYMEQMVTDGVQLDIVSYNTLINLYCKEGKL  303

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             + AY+L+ E E++GF+CDKYTHTI+IDGLCKAGN+K A  HL     +GFDSNL A+NC 
Sbjct  304   EAAYLLLDEMEKQGFECDKYTHTILIDGLCKAGNIKGARLHLEYMNKIGFDSNLEAYNCI  363

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             +D L K G++D+A++VF+SM+ KD FTYSS+VH LCKA R   AS+LLLSC+  G++ILK
Sbjct  364   VDRLGKDGKIDHAINVFESMEVKDSFTYSSMVHNLCKAKRLPSASKLLLSCLKSGVRILK  423

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
             S ++AV+DGL+HSG  +EA+K+ S+++++KI
Sbjct  424   SAQKAVVDGLRHSGCRREAKKIQSKIRMAKI  454



>ref|XP_008442168.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Cucumis melo]
 ref|XP_008442169.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Cucumis melo]
 ref|XP_008442170.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Cucumis melo]
Length=456

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/452 (61%), Positives = 341/452 (75%), Gaps = 0/452 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             + STK LNI VA  CK++Q++KAE VIIDGIR+GV  +VVTYNTLI  YC F G+DA YS
Sbjct  4     KYSTKFLNICVASFCKSQQMQKAEAVIIDGIRIGVLPNVVTYNTLIDGYCRFSGMDAAYS  63

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +L+RM E GI PDVITYNSLIA ATR+  L + LDL EEML+ GI PD WSYNTLMHC F
Sbjct  64    VLYRMREAGISPDVITYNSLIAGATRNFSLEQSLDLFEEMLQSGITPDIWSYNTLMHCFF  123

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
              LGKPDEAYR F+DI   D+ P PVTFN +++GLC +GYT  A+MLFR L+  GFIPQLV
Sbjct  124   ILGKPDEAYRVFKDIILKDLSPHPVTFNTMINGLCKHGYTSNAVMLFRNLQRHGFIPQLV  183

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC   R   A R+LNE VD G  PNA+TYTT+MK CFRSR++E G +I  +M
Sbjct  184   TYNILINGLCKVSRLRAAIRMLNEAVDSGLEPNAVTYTTLMKSCFRSRQYEHGFEIFSKM  243

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             + KGY FD FAYCTVI   +K GR ++A  C   MI N + +D+  YNTLINLYCKEGKL
Sbjct  244   KSKGYAFDGFAYCTVIGAFLKLGRFEEANSCTEQMIKNDVGIDMTFYNTLINLYCKEGKL  303

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             + AY L+ + E +G +CD YTH+II +GLC+ GN++ A++HLNC    GF SNLVA NC 
Sbjct  304   EAAYKLLDQIESRGLECDDYTHSIITNGLCRVGNIEGAMQHLNCVYTTGFASNLVALNCL  363

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             ID LCK G++D A+ +F+SM+ +D FTY+SLVH LCKA RFR AS+LL+SC  GG+KIL+
Sbjct  364   IDRLCKAGQIDRAIRLFESMETRDSFTYTSLVHNLCKARRFRCASKLLISCSRGGIKILR  423

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             + R+AVIDGL  SGF  EARKL  +L L+++ 
Sbjct  424   ATRRAVIDGLYSSGFTSEARKLKFKLHLARLF  455



>ref|XP_002532784.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF29603.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=487

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/457 (61%), Positives = 352/457 (77%), Gaps = 0/457 (0%)
 Frame = -1

Query  2294  RIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGID  2115
             R+  RLST+LLNI++A LCKAK+L KAE+VIIDGIR+GV  DVVTYNTLI AY  FV  +
Sbjct  30    RMVRRLSTRLLNISIASLCKAKELNKAESVIIDGIRLGVLPDVVTYNTLIDAYSRFVSFN  89

Query  2114  AGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLM  1935
             A YS+L+RM E  I PDV+TYNSLIA A R+ +L   L+L +EML +GI+PD WSYNTLM
Sbjct  90    AAYSLLNRMREASISPDVVTYNSLIAGAARNCLLLESLNLFDEMLNMGIVPDVWSYNTLM  149

Query  1934  HCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFI  1755
             HC F+LGK +EA    + IF   + PCP TFNI+++GLC NG+T  ALMLFR LK  GF+
Sbjct  150   HCFFKLGKAEEANEVLRQIFGHGLSPCPTTFNIMINGLCKNGFTSNALMLFRSLKQHGFV  209

Query  1754  PQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQI  1575
             PQL+TYNILI+GLC   R   AR +L EL   GY PNAITYTT+MK CFRSRRF++GL+I
Sbjct  210   PQLITYNILINGLCKDRRLRAARSMLKELETSGYVPNAITYTTVMKFCFRSRRFKQGLEI  269

Query  1574  LEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCK  1395
             L+EM  KGY FD FAYCTV+  LIK GR+++A + +  MI NGIE DL +YNTLINLYCK
Sbjct  270   LQEMIDKGYTFDGFAYCTVVGVLIKTGRLEEATEYMRQMIKNGIEHDLASYNTLINLYCK  329

Query  1394  EGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVA  1215
             +G L+ AY L+ E E++G  CD+YTHTI+I+ +CKAGN+  A RH+    +MGFDS LVA
Sbjct  330   QGNLEAAYQLLDEIEKEGLQCDEYTHTILINWMCKAGNILGARRHMQHMNMMGFDSCLVA  389

Query  1214  FNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGM  1035
              NC +DGLCK G++D+A+ +F+SM  +D FTYSSLVH LCK GRF  AS+LLLSC+  GM
Sbjct  390   LNCMVDGLCKNGQIDHAVKLFESMKMRDSFTYSSLVHNLCKNGRFHRASKLLLSCLRSGM  449

Query  1034  KILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             KIL S ++ VI GL++SGF +EARKL S++KL+++L+
Sbjct  450   KILPSAQRVVISGLRYSGFQKEARKLKSKIKLARMLH  486



>emb|CDP15951.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/459 (59%), Positives = 357/459 (78%), Gaps = 3/459 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             MF+I   LST  LNI +A LC+ K L+ AE V+IDGIRVG+  DVVTYNTLI  YC   G
Sbjct  1     MFKI---LSTTSLNICIASLCRVKNLKNAEAVLIDGIRVGILPDVVTYNTLIDGYCRLFG  57

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             ID+GYS+L RM E GI P+VITYN+L++ A+R+ +L + LD+ +EML+VGILPD WSYN 
Sbjct  58    IDSGYSVLGRMMEAGIHPNVITYNTLLSCASRYRLLYQSLDIFDEMLQVGILPDVWSYNI  117

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LMHC F++GKPDEAYR F+DIF  +I P P TFNI+ +GLC N YT+ ALML R L+ +G
Sbjct  118   LMHCFFKVGKPDEAYRVFKDIFLRNIYPSPATFNIMFTGLCKNWYTDNALMLLRNLQRNG  177

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             F P+LVTYNILI GLC SG+W   + LL E++D G+ PNAITYTT+MKCCF+++ F EGL
Sbjct  178   FRPELVTYNILIDGLCKSGKWRTVKGLLKEILDYGHIPNAITYTTVMKCCFKNKMFNEGL  237

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             +I  EM+ KGY FD FAYCTV   L++ GR+++A  C+GNM  +GI+LD+V YNTLINLY
Sbjct  238   EIFSEMKAKGYTFDGFAYCTVAGALLRTGRIEEANQCMGNMFRSGIDLDMVCYNTLINLY  297

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CKEGKL++A+ L+ E E+ G +CD YTHTI+IDGLCKAGN++ A RHL     MGF +NL
Sbjct  298   CKEGKLEDAFGLLDEVEKMGLECDIYTHTILIDGLCKAGNIQGAQRHLKYLNKMGFGTNL  357

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VAFN  IDGLCK+G+++YA+ VF+SM  KD FTYSS+V GLC AGRF +A+ LLL C+  
Sbjct  358   VAFNSFIDGLCKLGQIEYAMQVFESMKVKDEFTYSSIVQGLCSAGRFHLAARLLLCCVRS  417

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             G++IL+SD++AVI GL+ +GF  +A+K+ S ++L+K+L+
Sbjct  418   GVRILRSDKKAVIRGLRFTGFGPQAKKVQSNIRLAKLLH  456



>ref|XP_008369674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46680 
[Malus domestica]
Length=457

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/453 (59%), Positives = 350/453 (77%), Gaps = 0/453 (0%)
 Frame = -1

Query  2285  SRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGY  2106
             S LST+LLNI +A  CK++ LE+AE VIIDGIR+GV  DVVTYNTL+ AY  FV +D+ Y
Sbjct  4     SGLSTRLLNICIASFCKSRLLERAEAVIIDGIRLGVIPDVVTYNTLLNAYSRFVSLDSAY  63

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
             S++HRM E GI PDVITYNSL++ ATR+ +LS+ LDL EEML+ GI P+ WSYN LMHC 
Sbjct  64    SVVHRMKEAGISPDVITYNSLLSGATRNCLLSQSLDLFEEMLQAGIHPNVWSYNILMHCF  123

Query  1925  FRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             F+LGKPDEA R FQDI   ++ P P TFNI+++GLC N Y + ALMLFR L+  GF+P+L
Sbjct  124   FKLGKPDEANRVFQDILLRNLTPHPATFNIMINGLCKNEYIDNALMLFRNLQRHGFVPRL  183

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             VTYNILIHGLC + R   AR++L EL + GY PNAITYTT+MKCCF+ ++++E L+I+ E
Sbjct  184   VTYNILIHGLCKARRLGQARKMLKELGESGYKPNAITYTTVMKCCFKFKQYDEALEIMSE  243

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGK  1386
             M+ KGY FD FA CTV++ L+K GR+++A  C+   + NGIELDL AYNTL+N+YC+EGK
Sbjct  244   MKSKGYTFDGFANCTVVAALVKTGRIEEANACMEQTMRNGIELDLAAYNTLLNMYCREGK  303

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
              + AY L+ E E  G  CDKYTHTIIIDGLCKAGN+  A +HL   K++GF  NLVA NC
Sbjct  304   FEAAYKLMDEIENGGLRCDKYTHTIIIDGLCKAGNIIGAEQHLQYMKMIGFRENLVAXNC  363

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              IDGLCK G++D A+ ++KSM+ KD FTY+SLVH LCKAGRFR AS+L++ C+  G KIL
Sbjct  364   MIDGLCKAGQIDRAMDLYKSMETKDSFTYTSLVHNLCKAGRFRCASKLMMKCLRDGKKIL  423

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              + ++AV+DGL  +G+  EARKL  ++++++IL
Sbjct  424   XATQRAVLDGLHSTGYTDEARKLRWKIQVARIL  456



>ref|XP_008364749.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46680-like 
[Malus domestica]
Length=457

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/453 (59%), Positives = 350/453 (77%), Gaps = 0/453 (0%)
 Frame = -1

Query  2285  SRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGY  2106
             S LST+LLNI +A  CK++ LE+AE VIIDGIR+GV  DVVTYNTL+ AY  FV +D+ Y
Sbjct  4     SGLSTRLLNICIASFCKSRLLERAEAVIIDGIRLGVIPDVVTYNTLLNAYSRFVSLDSAY  63

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
             S++HRM E GI PDVITYNSL++ ATR+ +LS+ LDL EEML+ GI P+ WSYN LMHC 
Sbjct  64    SVVHRMKEAGISPDVITYNSLLSGATRNCLLSQSLDLFEEMLQAGIHPNVWSYNILMHCF  123

Query  1925  FRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             F+LGKPDEA R FQDI   ++ P P TFNI+++GLC N Y + ALMLFR L+  GF+P+L
Sbjct  124   FKLGKPDEANRVFQDILLRNLTPHPATFNIMINGLCKNEYIDNALMLFRNLQRHGFVPRL  183

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             VTYNILIHGLC + R   AR++L EL + GY PNAITYTT+MKCCF+ ++++E L+I+ E
Sbjct  184   VTYNILIHGLCKARRLGQARKMLKELGESGYXPNAITYTTVMKCCFKFKQYDEALEIMSE  243

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGK  1386
             M+ KGY FD FA CTV++ L+K GR+++A  C+   + NGIELDL AYNTL+N+YC+EGK
Sbjct  244   MKSKGYTFDGFANCTVVAALVKTGRIEEANACMEQTMRNGIELDLAAYNTLLNMYCREGK  303

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
              + AY L+ E E  G  CDKYTHTIIIDGLCKAGN+  A +HL   K++GF  NLVA NC
Sbjct  304   FEAAYKLMDEIENGGLRCDKYTHTIIIDGLCKAGNIIGAEQHLQYMKMIGFRENLVAXNC  363

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              IDGLCK G++D A+ ++KSM+ KD FTY+SLVH LCKAGRFR AS+L++ C+  G KIL
Sbjct  364   MIDGLCKAGQIDRAMDLYKSMETKDSFTYTSLVHNLCKAGRFRCASKLMMKCLRDGKKIL  423

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              + ++AV+DGL  +G+  EARKL  ++++++IL
Sbjct  424   XATQRAVLDGLHSTGYTDEARKLRWKIQVARIL  456



>ref|XP_008228937.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Prunus mume]
 ref|XP_008228938.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Prunus mume]
Length=457

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/458 (59%), Positives = 352/458 (77%), Gaps = 3/458 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             MFR    LSTKLLNI +A  CK + LEKAE +IIDG+R+GV  DVVTYNTL++AY  +V 
Sbjct  2     MFR---GLSTKLLNICIASFCKVRLLEKAEAIIIDGVRLGVIPDVVTYNTLVSAYSRYVS  58

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +DA YS++HRM EVGI PDVITYNSLIA +TR  +LS+ LDL EEML+ GI PD WSYN 
Sbjct  59    LDAAYSVIHRMKEVGISPDVITYNSLIAGSTRDCLLSQSLDLFEEMLQAGIHPDVWSYNI  118

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LM+C F+LGKPDEA R FQDI   ++   P TFNI+++GLC N Y + ALMLFR L+  G
Sbjct  119   LMNCFFKLGKPDEANRVFQDILLSNLASHPATFNIMINGLCKNEYIDNALMLFRNLQRHG  178

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             F+PQLVTYNILI+GLC + R   AR +L EL +    PNAITYTT+MKCCFRS+++++GL
Sbjct  179   FVPQLVTYNILINGLCKARRLRQARTMLRELGESDLEPNAITYTTVMKCCFRSKQYDKGL  238

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
              I+ EM+ KGY FDSFAYCT+++ L+K GR+++A  C+  ++ NGIELDL AYNTL+N+Y
Sbjct  239   DIMSEMKSKGYTFDSFAYCTIVAALVKTGRIEEANACMEQVMSNGIELDLAAYNTLLNMY  298

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             C+EGK + AY L+ E E+ G  CDKYTHTIIIDGLCKAGN+  A  HL+  K+MGF  NL
Sbjct  299   CREGKFEAAYKLLDEIEKGGLLCDKYTHTIIIDGLCKAGNITGAQHHLHYMKMMGFHENL  358

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA NC IDGLCK G +D A+ ++KSM+ KD  TY+SLVH LC+AGRFR AS+L++ C+  
Sbjct  359   VALNCMIDGLCKAGHIDRAMELYKSMETKDSVTYTSLVHNLCRAGRFRCASKLMMKCLKD  418

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             G KIL++ ++AV+ GL+ SG+  EA+KL  ++++++IL
Sbjct  419   GKKILRATKRAVLAGLRSSGYTDEAKKLQWKIQVARIL  456



>ref|XP_004151692.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like [Cucumis sativus]
 ref|XP_004151768.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like [Cucumis sativus]
 ref|XP_004173169.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like [Cucumis sativus]
Length=456

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/450 (61%), Positives = 338/450 (75%), Gaps = 0/450 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             + STK LNI VA  CK++Q++KAE VIIDGIR+GV  DVVTYNTLI  YC F G+DA YS
Sbjct  4     KYSTKFLNICVASFCKSQQMQKAEAVIIDGIRIGVLPDVVTYNTLIDGYCRFSGMDAAYS  63

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +L+RM E GI PDVITYNSLIA ATR+  L + LDL EEML+ GI PD WSYNTLMHC F
Sbjct  64    VLYRMREAGISPDVITYNSLIAGATRNFSLEQSLDLFEEMLQSGITPDIWSYNTLMHCFF  123

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
              LGKPDEAYR F+DI   D+ P PVTFN +++GLC +GYT  A+MLFR L+  GFIPQLV
Sbjct  124   ILGKPDEAYRVFKDIILKDLSPHPVTFNTMINGLCKHGYTSNAIMLFRNLQRHGFIPQLV  183

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC   R   A R+LNE +D G  PNA+TYTT+MK CFRSR++E G +I  +M
Sbjct  184   TYNILINGLCKVDRLRAAIRMLNEAMDSGLEPNAVTYTTLMKSCFRSRQYERGFEIFSKM  243

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             + KGY FD FAYCTV    +K GR ++A  C+  MI N + +D+  YNT INLYCKEGKL
Sbjct  244   KNKGYAFDGFAYCTVSGAFLKLGRFEEAKFCMEQMIKNDVGIDITFYNTFINLYCKEGKL  303

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             + AY L  E E +G +CD YTH+II +GLC+ GN++ A++HLNC    GF SNLVA NC 
Sbjct  304   EAAYKLFDEIEPRGLECDVYTHSIITNGLCRVGNIEGAMQHLNCVYTTGFASNLVALNCL  363

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             ID LCK G++D A+ +F+SM+ +D FTY+SLVH LCKA RFR AS+LL+SC   GMK+LK
Sbjct  364   IDRLCKAGQIDRAIRLFESMETRDSFTYTSLVHNLCKARRFRCASKLLISCSRDGMKVLK  423

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSK  933
             + R+AVIDGL  SGF  EARKL  +L+L++
Sbjct  424   ATRRAVIDGLCSSGFTSEARKLKFKLRLAR  453



>ref|XP_007215356.1| hypothetical protein PRUPE_ppa005519mg [Prunus persica]
 gb|EMJ16555.1| hypothetical protein PRUPE_ppa005519mg [Prunus persica]
Length=456

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/458 (59%), Positives = 350/458 (76%), Gaps = 3/458 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             MFR    LSTKLLNI +A  CK + LEKAE +IIDG R+GV  DVVTYNTL++AY  +V 
Sbjct  1     MFR---GLSTKLLNICIASFCKVRLLEKAEAIIIDGERLGVIPDVVTYNTLVSAYYRYVS  57

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +DA YS++HRM E GI PDV+TYNSLIA +TR  +LS+ LDL EEML+ GI PD WSYN 
Sbjct  58    LDAAYSVIHRMKEAGISPDVVTYNSLIAGSTRDCLLSQSLDLFEEMLQAGIHPDVWSYNI  117

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LM+C F+LGKPDEA R FQDI   ++   P TFNI+++GLC N Y + ALMLFR L+  G
Sbjct  118   LMNCFFKLGKPDEANRVFQDILLSNLASHPATFNIMINGLCKNEYIDNALMLFRNLQRHG  177

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             F+PQLVTYNILI+GLC + R   AR +L EL +    PNAITYTT+MKCCFRS+++++GL
Sbjct  178   FVPQLVTYNILINGLCKARRLRQARTMLRELGESDLEPNAITYTTVMKCCFRSKQYDKGL  237

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
              I+ EM+ KGY FDSFAYCTV++ L+K GR+++A  C+  ++ NGIELDL AYNTL+N+Y
Sbjct  238   DIMSEMKSKGYTFDSFAYCTVVAALVKTGRIEEANACMEQVMSNGIELDLAAYNTLLNMY  297

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             C+EGK + AY L+ E E+ G  CDKYTHTIIIDGLCKAGN+  A  HL+  K+MGF  NL
Sbjct  298   CREGKFEAAYKLLDEIEKGGLLCDKYTHTIIIDGLCKAGNITGAQHHLHYMKMMGFHENL  357

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA NC IDGLCK G +D A+ ++KSM+ KD  TY+SLVH LC+AGRFR AS+L++ C+  
Sbjct  358   VALNCMIDGLCKAGHIDRAMELYKSMETKDSVTYTSLVHNLCRAGRFRCASKLMMKCLKD  417

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             G KIL++ ++AV+ GL+ SG+  EA+KL  ++++++IL
Sbjct  418   GKKILRATKRAVVAGLRSSGYTDEAKKLQWKIQVARIL  455



>ref|XP_010102114.1| hypothetical protein L484_021348 [Morus notabilis]
 gb|EXB92364.1| hypothetical protein L484_021348 [Morus notabilis]
Length=453

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/452 (60%), Positives = 344/452 (76%), Gaps = 0/452 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI +   CK++ L KAE VI+DGIR+ +  DVVTYN L+ AYC  VG+DA YSI
Sbjct  2     LSTRLLNICITSFCKSRDLAKAEAVIVDGIRLDILPDVVTYNALVDAYCRIVGLDAAYSI  61

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             L RM E GI PDV+TYNSLIA A R  +LSR LD  +EML  GI PD WSYNTLMHC F+
Sbjct  62    LQRMREAGITPDVVTYNSLIAGAARRCLLSRVLDFFDEMLRAGIRPDVWSYNTLMHCFFK  121

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
             +GKPDEA   F+DI   D  PC  TFNI+L+GLC NGY   ALMLFR L+H GF+PQLVT
Sbjct  122   VGKPDEANAIFRDIILSDFLPCATTFNIMLNGLCKNGYINNALMLFRNLEHHGFVPQLVT  181

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
              NILI+GLC + R   AR++L EL + G  PN+ITYTT+MKCC  S+++++GL+I+  M+
Sbjct  182   CNILINGLCKARRLRAARKILRELGESGIEPNSITYTTVMKCCLMSKQYQQGLEIMSLMK  241

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              KGY FD F+YCT+IS L+K GRM++A   +  M+ NGIELDLV+YNTLIN YCKEG L+
Sbjct  242   NKGYAFDGFSYCTIISALVKTGRMEEANSYIEEMMTNGIELDLVSYNTLINWYCKEGDLE  301

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              AY L+ E E+ G +CDKYTHTIII+GLCKAGN++ ALRHL     MGFDSN+VAFNC I
Sbjct  302   TAYKLLHEIEKGGLECDKYTHTIIINGLCKAGNIECALRHLEYMCTMGFDSNVVAFNCLI  361

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             DGLCK G++D A+ +F+SM+ +D F Y+SLV  LCK  R++ A++LLLSC+  GMK+L+S
Sbjct  362   DGLCKSGQIDRAIKLFESMEVRDSFAYTSLVCNLCKVKRYKCAAKLLLSCLKDGMKVLRS  421

Query  1019  DRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
              R+AV+DGL+ SG I EA KL  EL++++IL+
Sbjct  422   ARRAVLDGLRGSGLIHEANKLKLELRMAQILH  453


 Score = 94.0 bits (232),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 78/355 (22%), Positives = 145/355 (41%), Gaps = 44/355 (12%)
 Frame = -1

Query  2408  LRRSQSSPRLPLAASALQLATRTCPMLRLGD*HLE*MFRIKSRLSTKLLNITVACLCKAK  2229
             +R +  +P +    S +  A R C + R+ D   + M R   R      N  + C  K  
Sbjct  65    MREAGITPDVVTYNSLIAGAARRCLLSRVLD-FFDEMLRAGIRPDVWSYNTLMHCFFKVG  123

Query  2228  QLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYN  2049
             + ++A  +  D I         T+N ++   C    I+    +   +   G  P ++T N
Sbjct  124   KPDEANAIFRDIILSDFLPCATTFNIMLNGLCKNGYINNALMLFRNLEHHGFVPQLVTCN  183

Query  2048  SLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHC--------------------  1929
              LI    +   L     +L E+ E GI P++ +Y T+M C                    
Sbjct  184   ILINGLCKARRLRAARKILRELGESGIEPNSITYTTVMKCCLMSKQYQQGLEIMSLMKNK  243

Query  1928  ---------------LFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKA  1794
                            L + G+ +EA  + +++    I    V++N L++  C  G  E A
Sbjct  244   GYAFDGFSYCTIISALVKTGRMEEANSYIEEMMTNGIELDLVSYNTLINWYCKEGDLETA  303

Query  1793  LMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKC  1614
               L  E++  G      T+ I+I+GLC +G    A R L  +  +G++ N + +  ++  
Sbjct  304   YKLLHEIEKGGLECDKYTHTIIINGLCKAGNIECALRHLEYMCTMGFDSNVVAFNCLIDG  363

Query  1613  CFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
               +S + +  +++ E M     + DSFAY +++  L K  R    Y C   ++++
Sbjct  364   LCKSGQIDRAIKLFESME----VRDSFAYTSLVCNLCKVKR----YKCAAKLLLS  410



>emb|CAN63846.1| hypothetical protein VITISV_010038 [Vitis vinifera]
Length=457

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/429 (62%), Positives = 337/429 (79%), Gaps = 0/429 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             R STKLLNI +A LCK  QLEKAE V+IDGIR+G+  DVVTYNTL++AY  FVGIDA YS
Sbjct  4     RFSTKLLNICIASLCKVGQLEKAEAVVIDGIRLGLLPDVVTYNTLLSAYSRFVGIDAAYS  63

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             ++HRM E GI PDVITYNSLIA+AT+  +LSR LDL EEML  GI PD WSYN+LMHC F
Sbjct  64    VIHRMKEAGISPDVITYNSLIAAATKRCLLSRSLDLFEEMLRTGIRPDVWSYNSLMHCFF  123

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             +LGKPDEA R FQDI   ++ P   TFNI+++GLC NGYT  AL L+R L+  GF+P+LV
Sbjct  124   KLGKPDEANRVFQDIILTNLLPSSSTFNIMINGLCNNGYTGYALSLYRYLQRQGFVPELV  183

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S +   ARR+L EL + G  P+AITYTT+MKCCFRSR+FE+G +I  EM
Sbjct  184   TYNILINGLCKSRKLNAARRILRELGESGNVPDAITYTTVMKCCFRSRQFEQGFEIFSEM  243

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             + KGY FD+F+YC VI+ L K GR+++A D +  M  + I+LD+V+YNT++NLYC+ GKL
Sbjct  244   KSKGYAFDAFSYCAVIAALTKTGRLEEANDIMEQMARSDIDLDIVSYNTVMNLYCRNGKL  303

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             +  Y L+ E E  G +CD+YTHTI+IDGLCKAGN++ ALRHL     MGFDS LVA NC 
Sbjct  304   EATYKLLDEIEEHGLECDEYTHTILIDGLCKAGNVEGALRHLKNMTKMGFDSTLVAQNCV  363

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             IDGLCKVG++D+A+ +F SM+ KD FTYSS+VH LCKA R+R AS LLL+C+ GGMKIL+
Sbjct  364   IDGLCKVGQLDHAIKMFASMEVKDSFTYSSMVHNLCKARRYRHASRLLLACLRGGMKILR  423

Query  1022  SDRQAVIDG  996
             +++++VIDG
Sbjct  424   ANQRSVIDG  432



>ref|XP_007211611.1| hypothetical protein PRUPE_ppa005509mg [Prunus persica]
 gb|EMJ12810.1| hypothetical protein PRUPE_ppa005509mg [Prunus persica]
Length=457

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/452 (59%), Positives = 348/452 (77%), Gaps = 0/452 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LSTKLLNI +A  CK + LEKAE ++IDGIR+G+  DVVTYNTL++AY  FV +DA YS+
Sbjct  6     LSTKLLNICIASFCKVRLLEKAEAIVIDGIRLGLIPDVVTYNTLVSAYSRFVSLDAAYSV  65

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             +HRM E GI P+VITYNSL++ AT++ +LSR LDL EEML  G+ P+ WSYN LMHC F+
Sbjct  66    IHRMKEAGISPNVITYNSLMSGATQNCLLSRSLDLFEEMLLAGVHPNLWSYNILMHCFFK  125

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
             LGKPDEA + FQDI   ++ P P T NI+++GLC NGY + ALML+R L+  GF+PQLVT
Sbjct  126   LGKPDEANKVFQDILLSNLTPHPATLNIMINGLCNNGYIDNALMLYRNLQRHGFVPQLVT  185

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YNILI+ LC + R   ARR+L EL + G+ P+ ITYTT+MKCCFRS ++++GL+I+  M 
Sbjct  186   YNILINWLCKTRRLRQARRILKELGESGHEPSLITYTTVMKCCFRSNKYDKGLEIMSVMM  245

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              KGY FD +A CTV++ L+K GR+++A  C+   I NG+ELDLVAYNTL+N+YC+EGK +
Sbjct  246   GKGYTFDGYACCTVVAALVKTGRIEEANACMEQTIRNGVELDLVAYNTLLNMYCREGKFE  305

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              AY L+ E E  G  CDKYTHTIIIDGLCKAGN+  A +HL+  K+MGF  NLVA NC I
Sbjct  306   AAYKLLDEMENGGLLCDKYTHTIIIDGLCKAGNISGAQKHLHYMKMMGFHENLVALNCMI  365

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             DGLCK G++D A+ ++KSM+ KD FTY+SLVH LCKAGRFR+AS+L++ C+  G KI K+
Sbjct  366   DGLCKAGQIDRAMELYKSMETKDSFTYTSLVHNLCKAGRFRLASKLMMKCLRHGKKIPKA  425

Query  1019  DRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
              ++AV DGL  SGF  EARKL  ++++++IL+
Sbjct  426   TQRAVFDGLYSSGFTNEARKLWWKIRVARILH  457



>ref|XP_010323680.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X2 [Solanum lycopersicum]
Length=402

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/396 (66%), Positives = 319/396 (81%), Gaps = 0/396 (0%)
 Frame = -1

Query  2111  GYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMH  1932
             GYS+L+RM E GI PD ITYNSLIA ATR+ M+SRC DL EEMLE+ ILPD WSYNTLMH
Sbjct  6     GYSVLYRMKEAGIYPDTITYNSLIAGATRYCMISRCFDLFEEMLEMSILPDIWSYNTLMH  65

Query  1931  CLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIP  1752
             C F+L KPDEAYR FQDI   +I   P TFNIL++GLCMNGYTE ALMLFR +K  GFIP
Sbjct  66    CFFKLRKPDEAYRVFQDILLKNISVHPATFNILINGLCMNGYTENALMLFRSIKRHGFIP  125

Query  1751  QLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQIL  1572
             QL TYNILIHGLC SGR   AR  LNELV+ G+ PNAITYTT+MKCCF+  +FEEGL+I 
Sbjct  126   QLATYNILIHGLCKSGRGKTAREFLNELVESGHIPNAITYTTVMKCCFKCEQFEEGLKIF  185

Query  1571  EEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKE  1392
              EMRRKGY +D+FAYCTV S L+K G+M +A + +G +I NG +LD+V++NT++NLYCKE
Sbjct  186   AEMRRKGYTYDAFAYCTVASMLLKTGKMNEANEYLGYIITNGFDLDMVSFNTIVNLYCKE  245

Query  1391  GKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAF  1212
             G+LDNAY L+ EAE+KG + DKYTHTI IDGLC+ GN KEA +HL+   +MGFDSNLVA 
Sbjct  246   GQLDNAYKLLHEAEKKGLESDKYTHTIFIDGLCRTGNFKEAQQHLDYMSMMGFDSNLVAL  305

Query  1211  NCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             N  I+GLCK G +D+AL +F+SMD KD  TYS++VH LC A RFR AS+LLLSCI GGM+
Sbjct  306   NSFINGLCKAGHLDHALRMFESMDAKDSITYSTMVHSLCNARRFRAASKLLLSCIRGGMR  365

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             ILKSD++ VIDGL+ SG+ QEA+K+ S+++L+KIL 
Sbjct  366   ILKSDKRGVIDGLRGSGYSQEAKKIQSKIRLAKILQ  401


 Score =   103 bits (257),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 83/365 (23%), Positives = 147/365 (40%), Gaps = 40/365 (11%)
 Frame = -1

Query  2351  ATRTCPMLRLGD*HLE*MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPA  2172
             ATR C + R  D   E M  +         N  + C  K ++ ++A  V  D +   +  
Sbjct  32    ATRYCMISRCFD-LFEEMLEMSILPDIWSYNTLMHCFFKLRKPDEAYRVFQDILLKNISV  90

Query  2171  DVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLL  1992
                T+N LI   C     +    +   +   G  P + TYN LI    + G      + L
Sbjct  91    HPATFNILINGLCMNGYTENALMLFRSIKRHGFIPQLATYNILIHGLCKSGRGKTAREFL  150

Query  1991  EEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMN  1812
              E++E G +P+  +Y T+M C F+  + +E                              
Sbjct  151   NELVESGHIPNAITYTTVMKCCFKCEQFEE------------------------------  180

Query  1811  GYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITY  1632
                   L +F E++  G+      Y  +   L  +G+   A   L  ++  G++ + +++
Sbjct  181   -----GLKIFAEMRRKGYTYDAFAYCTVASMLLKTGKMNEANEYLGYIITNGFDLDMVSF  235

Query  1631  TTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIM  1452
              TI+    +  + +   ++L E  +KG   D + +   I  L + G  K+A   +  M M
Sbjct  236   NTIVNLYCKEGQLDNAYKLLHEAEKKGLESDKYTHTIFIDGLCRTGNFKEAQQHLDYMSM  295

Query  1451  NGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKE  1272
              G + +LVA N+ IN  CK G LD+A  +    + K    D  T++ ++  LC A   + 
Sbjct  296   MGFDSNLVALNSFINGLCKAGHLDHALRMFESMDAK----DSITYSTMVHSLCNARRFRA  351

Query  1271  ALRHL  1257
             A + L
Sbjct  352   ASKLL  356


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/239 (26%), Positives = 107/239 (45%), Gaps = 8/239 (3%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFV--GIDAGYSILHRM  2088
             NI +  LCK+ + + A   + + +  G   + +TY T++   CCF     + G  I   M
Sbjct  131   NILIHGLCKSGRGKTAREFLNELVESGHIPNAITYTTVMK--CCFKCEQFEEGLKIFAEM  188

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
                G   D   Y ++ +   + G ++   + L  ++  G   D  S+NT+++   + G+ 
Sbjct  189   RRKGYTYDAFAYCTVASMLLKTGKMNEANEYLGYIITNGFDLDMVSFNTIVNLYCKEGQL  248

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             D AY+   +     +     T  I + GLC  G  ++A      +   GF   LV  N  
Sbjct  249   DNAYKLLHEAEKKGLESDKYTHTIFIDGLCRTGNFKEAQQHLDYMSMMGFDSNLVALNSF  308

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKG  1551
             I+GLC +G    A R+  E +D     ++ITY+T++     +RRF    ++L    R G
Sbjct  309   INGLCKAGHLDHALRMF-ESMDA---KDSITYSTMVHSLCNARRFRAASKLLLSCIRGG  363


 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 95/253 (38%), Gaps = 39/253 (15%)
 Frame = -1

Query  1589  EGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLI  1410
             +G  +L  M+  G   D+  Y ++I+   +   +   +D    M+   I  D+ +YNTL+
Sbjct  5     KGYSVLYRMKEAGIYPDTITYNSLIAGATRYCMISRCFDLFEEMLEMSILPDIWSYNTLM  64

Query  1409  NLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFD  1230
             + + K  K D AY +  +   K       T  I+I+GLC  G  + AL      K  GF 
Sbjct  65    HCFFKLRKPDEAYRVFQDILLKNISVHPATFNILINGLCMNGYTENALMLFRSIKRHGFI  124

Query  1229  SNLVAFNCCIDGLCKVG-----------------------------------EVDYALSV  1155
               L  +N  I GLCK G                                   + +  L +
Sbjct  125   PQLATYNILIHGLCKSGRGKTAREFLNELVESGHIPNAITYTTVMKCCFKCEQFEEGLKI  184

Query  1154  FKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQH  987
             F  M  K    D F Y ++   L K G+   A+E L   I  G  +       +++    
Sbjct  185   FAEMRRKGYTYDAFAYCTVASMLLKTGKMNEANEYLGYIITNGFDLDMVSFNTIVNLYCK  244

Query  986   SGFIQEARKLHSE  948
              G +  A KL  E
Sbjct  245   EGQLDNAYKLLHE  257



>ref|XP_009766478.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X2 [Nicotiana sylvestris]
Length=390

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/389 (67%), Positives = 316/389 (81%), Gaps = 0/389 (0%)
 Frame = -1

Query  2090  MNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGK  1911
             M E GI P+VITYN+LIA ATR+ +LSRCLDL +EMLE+ ILPD WSYNTLMHC  +LGK
Sbjct  1     MKEAGINPNVITYNTLIAGATRYCLLSRCLDLFDEMLEMSILPDIWSYNTLMHCFLKLGK  60

Query  1910  PDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNI  1731
             PDEAYR FQDI   DI   P TFNIL++GLCMNGYTE ALMLFR LK  GFIPQLVTYNI
Sbjct  61    PDEAYRVFQDILLKDISVHPATFNILINGLCMNGYTENALMLFRSLKRHGFIPQLVTYNI  120

Query  1730  LIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKG  1551
             LIHGLC S R   AR  L ELV+ G+ PNAITYTTIMKCCFR ++FEEGL+I  EMRRKG
Sbjct  121   LIHGLCKSRRGKAAREFLTELVESGHIPNAITYTTIMKCCFRCKQFEEGLKIFAEMRRKG  180

Query  1550  YIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAY  1371
             Y +D+FAYCTV S L+K GR+ +A + +G +I +G  LD V++NT++NLYCKEG+LDNAY
Sbjct  181   YTYDTFAYCTVASMLLKTGRITEASEYLGYIITSGFSLDTVSFNTIVNLYCKEGQLDNAY  240

Query  1370  MLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGL  1191
              L+ EAE++G + DKYTH I+IDGLC+ GN KEAL+HLN   +MGFDSNLVA+N  I+GL
Sbjct  241   KLLYEAEKEGLESDKYTHAILIDGLCRTGNFKEALQHLNSMSMMGFDSNLVAWNSFINGL  300

Query  1190  CKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQ  1011
             CK G  D+AL +F+SMD KD  TYS++VHGLCKAGRFR AS+LLLSCI GGM+ILKSD++
Sbjct  301   CKAGHFDHALQMFESMDVKDSVTYSTIVHGLCKAGRFRAASKLLLSCIRGGMRILKSDKR  360

Query  1010  AVIDGLQHSGFIQEARKLHSELKLSKILN  924
              V+DGL+ SG  QEARK+ S+++L+KIL+
Sbjct  361   FVVDGLRSSGLSQEARKVQSKIRLAKILH  389


 Score =   108 bits (271),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 77/276 (28%), Positives = 121/276 (44%), Gaps = 4/276 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              NI +  LC     E A  +     R G    +VTYN LI   C      A    L  + 
Sbjct  83    FNILINGLCMNGYTENALMLFRSLKRHGFIPQLVTYNILIHGLCKSRRGKAAREFLTELV  142

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             E G  P+ ITY +++    R       L +  EM   G   DT++Y T+   L + G+  
Sbjct  143   ESGHIPNAITYTTIMKCCFRCKQFEEGLKIFAEMRRKGYTYDTFAYCTVASMLLKTGRIT  202

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             EA  +   I         V+FN +++  C  G  + A  L  E +  G      T+ ILI
Sbjct  203   EASEYLGYIITSGFSLDTVSFNTIVNLYCKEGQLDNAYKLLYEAEKEGLESDKYTHAILI  262

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
              GLC +G +  A + LN +  +G++ N + + + +    ++  F+  LQ+ E M  K   
Sbjct  263   DGLCRTGNFKEALQHLNSMSMMGFDSNLVAWNSFINGLCKAGHFDHALQMFESMDVK---  319

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIEL  1437
              DS  Y T++  L KAGR + A   + + I  G+ +
Sbjct  320   -DSVTYSTIVHGLCKAGRFRAASKLLLSCIRGGMRI  354


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 85/333 (26%), Positives = 146/333 (44%), Gaps = 8/333 (2%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  + C  K  + ++A  V  D +   +     T+N LI   C     +    +   +  
Sbjct  49    NTLMHCFLKLGKPDEAYRVFQDILLKDISVHPATFNILINGLCMNGYTENALMLFRSLKR  108

Query  2081  VGIKPDVITYNSLIAS--ATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
              G  P ++TYN LI     +R G  +R  + L E++E G +P+  +Y T+M C FR  + 
Sbjct  109   HGFIPQLVTYNILIHGLCKSRRGKAAR--EFLTELVESGHIPNAITYTTIMKCCFRCKQF  166

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             +E  + F ++           +  + S L   G   +A      +  SGF    V++N +
Sbjct  167   EEGLKIFAEMRRKGYTYDTFAYCTVASMLLKTGRITEASEYLGYIITSGFSLDTVSFNTI  226

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             ++  C  G+   A +LL E    G   +  T+  ++    R+  F+E LQ L  M   G+
Sbjct  227   VNLYCKEGQLDNAYKLLYEAEKEGLESDKYTHAILIDGLCRTGNFKEALQHLNSMSMMGF  286

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
               +  A+ + I+ L KAG    A     +M +     D V Y+T+++  CK G+   A  
Sbjct  287   DSNLVAWNSFINGLCKAGHFDHALQMFESMDVK----DSVTYSTIVHGLCKAGRFRAASK  342

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
             L++   R G    K     ++DGL  +G  +EA
Sbjct  343   LLLSCIRGGMRILKSDKRFVVDGLRSSGLSQEA  375



>gb|KGN54770.1| hypothetical protein Csa_4G481190 [Cucumis sativus]
Length=446

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/433 (61%), Positives = 326/433 (75%), Gaps = 0/433 (0%)
 Frame = -1

Query  2231  KQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITY  2052
             +Q++KAE VIIDGIR+GV  DVVTYNTLI  YC F G+DA YS+L+RM E GI PDVITY
Sbjct  11    QQMQKAEAVIIDGIRIGVLPDVVTYNTLIDGYCRFSGMDAAYSVLYRMREAGISPDVITY  70

Query  2051  NSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFW  1872
             NSLIA ATR+  L + LDL EEML+ GI PD WSYNTLMHC F LGKPDEAYR F+DI  
Sbjct  71    NSLIAGATRNFSLEQSLDLFEEMLQSGITPDIWSYNTLMHCFFILGKPDEAYRVFKDIIL  130

Query  1871  GDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAP  1692
              D+ P PVTFN +++GLC +GYT  A+MLFR L+  GFIPQLVTYNILI+GLC   R   
Sbjct  131   KDLSPHPVTFNTMINGLCKHGYTSNAIMLFRNLQRHGFIPQLVTYNILINGLCKVDRLRA  190

Query  1691  ARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVIS  1512
             A R+LNE +D G  PNA+TYTT+MK CFRSR++E G +I  +M+ KGY FD FAYCTV  
Sbjct  191   AIRMLNEAMDSGLEPNAVTYTTLMKSCFRSRQYERGFEIFSKMKNKGYAFDGFAYCTVSG  250

Query  1511  FLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDC  1332
               +K GR ++A  C+  MI N + +D+  YNT INLYCKEGKL+ AY L  E E +G +C
Sbjct  251   AFLKLGRFEEAKFCMEQMIKNDVGIDITFYNTFINLYCKEGKLEAAYKLFDEIEPRGLEC  310

Query  1331  DKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVF  1152
             D YTH+II +GLC+ GN++ A++HLNC    GF SNLVA NC ID LCK G++D A+ +F
Sbjct  311   DVYTHSIITNGLCRVGNIEGAMQHLNCVYTTGFASNLVALNCLIDRLCKAGQIDRAIRLF  370

Query  1151  KSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQ  972
             +SM+ +D FTY+SLVH LCKA RFR AS+LL+SC   GMK+LK+ R+AVIDGL  SGF  
Sbjct  371   ESMETRDSFTYTSLVHNLCKARRFRCASKLLISCSRDGMKVLKATRRAVIDGLCSSGFTS  430

Query  971   EARKLHSELKLSK  933
             EARKL  +L+L++
Sbjct  431   EARKLKFKLRLAR  443



>ref|XP_010278006.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Nelumbo nucifera]
Length=457

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/453 (59%), Positives = 341/453 (75%), Gaps = 0/453 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             RLST+LLNI +  LCKA QLEKAE V+IDGIR+G   DVVTYNTLI AYC  VG+   Y+
Sbjct  4     RLSTRLLNICITSLCKAWQLEKAEVVLIDGIRLGYLPDVVTYNTLIAAYCRLVGVHEAYT  63

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +L RM E GI PDVITYN+LIA A R+ +L  CLDL EEML+  I+PD WSYNTLM+C F
Sbjct  64    VLRRMREAGINPDVITYNALIAGAARYRLLPLCLDLFEEMLQNDIIPDVWSYNTLMNCFF  123

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             + G+P EA R F+D+   ++ P P T+N ++ GLC  GY+  AL LFR L+  GF+PQLV
Sbjct  124   KSGQPVEANRIFRDMILSNVSPSPTTYNTMIDGLCKAGYSVNALRLFRSLQRHGFLPQLV  183

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC SG+   AR +L EL + G+ PNAITYT++M+CCFR  +FE+G +I  EM
Sbjct  184   TYNILINGLCKSGKLGEARMILKELGESGHVPNAITYTSVMRCCFRHGKFEQGFEIFLEM  243

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             + KGY FDSFAYCTVIS L K G+ K+A D +  M+  G  LD+V+YNTLINLYCKEGKL
Sbjct  244   KGKGYTFDSFAYCTVISALAKMGKPKEANDYIEEMLRTGFGLDIVSYNTLINLYCKEGKL  303

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             + A+ L+ E E+ G   D+YTHTI++DGLCK G++  A RHL   K MGF+SNLVA NC 
Sbjct  304   ETAFQLLYEIEKCGMQSDEYTHTILVDGLCKIGDIDGAQRHLEYMKRMGFESNLVACNCL  363

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             I GLCKVG+VDYA+ VF++M+ KD FTY SLVHGLCKA +F +AS+LLLSC+  GMK+L 
Sbjct  364   IHGLCKVGKVDYAMKVFENMELKDSFTYDSLVHGLCKARKFLLASKLLLSCLRKGMKVLS  423

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             S ++AVI GL+ SG  +EA++L S + +++IL+
Sbjct  424   STKRAVIAGLRSSGLRREAKELRSAIWMARILH  456



>emb|CBI26532.3| unnamed protein product [Vitis vinifera]
Length=441

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/453 (59%), Positives = 343/453 (76%), Gaps = 16/453 (4%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             R STKLLNI +A LCK  QLEKAE V+IDGIR+G+  DVVTYNTL++AY  FVGIDA YS
Sbjct  4     RFSTKLLNICIASLCKVGQLEKAEAVVIDGIRLGLLPDVVTYNTLLSAYSRFVGIDAAYS  63

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             ++HRM E GI PDVITYNSLIA+AT+  +LSR LDL EEML  GI PD WSYN+LMH   
Sbjct  64    VIHRMKEAGISPDVITYNSLIAAATKRCLLSRSLDLFEEMLRTGIRPDVWSYNSLMHY--  121

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
                           I   ++ P   TFNI+++GLC NGYT  AL L+R L+  GF+P+LV
Sbjct  122   --------------IILTNLLPSSSTFNIMINGLCNNGYTGYALSLYRYLQRQGFVPELV  167

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S +   ARR+L EL + G  P+AITYTT+MKCCFRSR+FE+G +I  EM
Sbjct  168   TYNILINGLCKSRKLNAARRILRELGESGNVPDAITYTTVMKCCFRSRQFEQGFEIFSEM  227

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             + KGY FD+F+YC VI+ L K GR+++A D +  M  + I+LD+V+YNT++NLYC+ GKL
Sbjct  228   KSKGYAFDAFSYCAVIAALTKTGRLEEANDIMEQMARSDIDLDIVSYNTVMNLYCRNGKL  287

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             +  Y L+ E E  G +CD+YTHTI+IDGLCKAGN++ ALRHL     MGFDS LVA NC 
Sbjct  288   EATYKLLDEIEEHGLECDEYTHTILIDGLCKAGNVEGALRHLKNMTKMGFDSTLVAQNCV  347

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             IDGLCKVG++D+A+ +F SM+ KD FTYSS+VH LCKA R+R AS LLL+C+ GGMKIL+
Sbjct  348   IDGLCKVGQLDHAIKMFASMEVKDSFTYSSMVHNLCKARRYRHASRLLLACLRGGMKILR  407

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             +++++VIDGL +SG+  EAR+L S+++L++IL+
Sbjct  408   ANQRSVIDGLCYSGYTSEARRLKSKIRLARILH  440



>ref|XP_008812386.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Phoenix dactylifera]
 ref|XP_008812387.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Phoenix dactylifera]
Length=462

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/450 (59%), Positives = 332/450 (74%), Gaps = 0/450 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
              ST+LLNI++A LCKA+ LEKAE V+IDGIR+G   DVVTYNTLITAYC FVGI+  YSI
Sbjct  10    FSTQLLNISIASLCKARNLEKAEAVLIDGIRLGYIPDVVTYNTLITAYCRFVGINEAYSI  69

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             L+RM E G+KPDVITYNSLIA ATR+ + SR L+L EEML+ G+ PD WSYNTLMHCLF+
Sbjct  70    LYRMREAGVKPDVITYNSLIAGATRYCLPSRSLELFEEMLQTGLAPDEWSYNTLMHCLFK  129

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
              G P+EAY+ + D+   +I P   T+N L++GLC  G    AL LFR L+  GF   LVT
Sbjct  130   SGYPEEAYKIYMDMILKNITPSSATYNTLINGLCKVGKAGNALRLFRNLQRFGFSAGLVT  189

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YN +I GLC SGR   ARR+L EL + GY PNAITYTT+MKCCFRS +FE+G +I  EM 
Sbjct  190   YNTIIDGLCKSGRMGQARRILKELGESGYAPNAITYTTVMKCCFRSGKFEQGFEIFSEMM  249

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              KGY  D FAYCTVIS L K G +KDA  CV  M+ NGI LD   YNTLI L C+EG L+
Sbjct  250   NKGYNSDVFAYCTVISALTKKGMIKDANACVKQMLGNGIGLDKACYNTLIYLLCREGNLE  309

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              A+ L+ E E  G + D+YT++I++D LCK G++  A + L   ++ GF SNLVA+NC I
Sbjct  310   TAFRLLNEMEEGGLEGDEYTYSILVDALCKMGHVDAAHKQLQLMEMRGFQSNLVAYNCLI  369

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             DGLCKVGEVD A+ +F  M+ KD FTY+SLVHGLC+ GRFRVAS+LLL+C+  GM +L+S
Sbjct  370   DGLCKVGEVDSAMKLFNKMNSKDPFTYTSLVHGLCRKGRFRVASKLLLTCLREGMNVLRS  429

Query  1019  DRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
              ++AV  GLQ SGF ++A KL + L+L+++
Sbjct  430   AQRAVTAGLQSSGFKRDAGKLRTALRLAQL  459



>ref|XP_004305450.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like [Fragaria vesca subsp. vesca]
Length=456

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/451 (57%), Positives = 341/451 (76%), Gaps = 0/451 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI ++  CKA+ L +AE VIIDGIR+GV  +  TYNTL+ AYC FV IDA YS+
Sbjct  5     LSTRLLNICISSFCKARLLGRAEAVIIDGIRLGVVPNRHTYNTLLHAYCQFVDIDAAYSV  64

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             +HRM E GI PDV T+NSLI+ ATR+ +LSRCLDL +EML+ GI PD WSYN LMHC F+
Sbjct  65    VHRMKEAGISPDVCTFNSLISGATRNRLLSRCLDLFDEMLQEGIHPDVWSYNILMHCFFK  124

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
             LGKPDEA R FQDI   D+ P   T+NI+++GLC NGYT+ ALMLFR L+  GF P LVT
Sbjct  125   LGKPDEANRVFQDILLSDLTPHAATYNIMINGLCKNGYTDHALMLFRNLQRHGFAPTLVT  184

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YNI+I GLC + R   AR++L +LV+ G+ P+AITYTT++K CFRS++++ GL+I+ EM+
Sbjct  185   YNIIISGLCKARRVRQARKILQDLVESGHVPDAITYTTVLKSCFRSKQYDHGLEIMSEMK  244

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              KGY FD FAYCTVI+ L+K GRM+ A   +  ++ +GIE+DLV+YN L+N  CK+GK +
Sbjct  245   SKGYTFDGFAYCTVIAALLKTGRMEGANLFMEQLMDSGIEMDLVSYNNLLNTLCKDGKFE  304

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              AY L+ E E +G  CDKYTHTI+IDGLCKAGN+  AL+HL+   +MGF  N+VA NC I
Sbjct  305   AAYKLMDEIENRGLSCDKYTHTIMIDGLCKAGNIAGALKHLHYMNMMGFHDNVVALNCLI  364

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             DGL K GE+D A+ ++  M+ +D FTY SLV  LCKAGRF  AS++++ C+  GM +L S
Sbjct  365   DGLGKAGEIDRAMELYNLMETRDSFTYDSLVFNLCKAGRFLCASKVMMKCLRDGMLLLYS  424

Query  1019  DRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              R+A+++GL+  GF  EARKL S+++L+++L
Sbjct  425   TRRALLNGLRSIGFTNEARKLRSKIQLARLL  455



>ref|XP_003621847.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES78065.1| PPR containing plant-like protein, putative [Medicago truncatula]
Length=457

 Score =   540 bits (1391),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 344/455 (76%), Gaps = 1/455 (0%)
 Frame = -1

Query  2285  SRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGY  2106
             +RLSTK +NIT++ +CK+ Q+ KAETV+IDGI++G+  D++TYNTLI  YC FVGIDA Y
Sbjct  3     TRLSTKFMNITISTMCKSNQIAKAETVLIDGIKLGLNPDIITYNTLIDGYCRFVGIDAAY  62

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
             +IL+RM E GI PDV++YNSL + A R  +L + LDL +EML+ GI PD WSYN LMHC 
Sbjct  63    NILNRMKEAGINPDVVSYNSLSSGAVRKCLLQKSLDLFDEMLQSGIRPDVWSYNILMHCY  122

Query  1925  FRLGKPDEAYRFFQDIF-WGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQ  1749
             FRLGKP+EA   F+DIF  G+I P   ++N++++GLC NGY   ALMLFR L+  GF+P+
Sbjct  123   FRLGKPEEANGVFRDIFERGEIYPSMASYNVMINGLCKNGYVNNALMLFRNLRRRGFVPE  182

Query  1748  LVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILE  1569
             ++TYN +I+GLC + R A ARR+LNE  D G+ PNAITYTT+MKCCFR  R E+GL+IL 
Sbjct  183   VLTYNAMINGLCKARRLADARRVLNEFCDFGFEPNAITYTTVMKCCFRCGRLEQGLEILS  242

Query  1568  EMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEG  1389
             EMRRKG+ FD FAYCTV++ L+K GR+++A +    M+ NG+  DL +YNT+INL+C++G
Sbjct  243   EMRRKGFTFDGFAYCTVVAALVKTGRIEEADEIAEKMMSNGLVPDLASYNTMINLFCRQG  302

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
             + D A  LV E E++G  CD+YTHTIII GLCK GN + A +HL+    +GF  NLVAFN
Sbjct  303   RFDEALRLVDEIEKQGMKCDQYTHTIIIHGLCKDGNFEGAEKHLDYMNTLGFGFNLVAFN  362

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
               +D L K G++D A+ VF SM+ KD FTY+SL+H LC+A +FR+AS+LL++ I  G +I
Sbjct  363   SILDCLGKAGDIDKAVKVFDSMEVKDSFTYTSLLHNLCRAKKFRIASKLLVASIEDGFQI  422

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             L++ ++AVIDGL  SG + EARK+  +++ +++++
Sbjct  423   LRATQRAVIDGLTTSGLVYEARKVKLKIQRARLVH  457



>ref|XP_007137425.1| hypothetical protein PHAVU_009G126100g [Phaseolus vulgaris]
 gb|ESW09419.1| hypothetical protein PHAVU_009G126100g [Phaseolus vulgaris]
Length=498

 Score =   535 bits (1378),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 251/455 (55%), Positives = 339/455 (75%), Gaps = 3/455 (1%)
 Frame = -1

Query  2288  KSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAG  2109
             +S+LSTKLLNIT++ LCK KQ+ KAE+VI DGIR+GV  D VTYNTLI AYC F  ID  
Sbjct  44    RSKLSTKLLNITISLLCKKKQISKAESVITDGIRIGVLPDAVTYNTLIDAYCRFASIDVA  103

Query  2108  YSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHC  1929
             YS+L RM E GI PDV++YNSL++ A R  +LS+ +DL EEM+  G+ PD WS+N LMHC
Sbjct  104   YSVLARMREAGIPPDVVSYNSLVSGAVRKCLLSKSIDLFEEMMASGVTPDAWSHNILMHC  163

Query  1928  LFRLGKPDEAYRFFQD-IFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIP  1752
             LF+LGKP EA R F++ +  G++     T+N++++GLC NGY   AL LFR L+  GF+P
Sbjct  164   LFKLGKPYEANRVFKESVIRGEVHA--TTYNVMINGLCKNGYVSHALSLFRNLQRHGFVP  221

Query  1751  QLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQIL  1572
             Q++TYN LI+GLC + R   AR++L E  + GY PNAITYTT+MKCCFR   FE+GL+IL
Sbjct  222   QVLTYNALINGLCKAKRLKDARKVLKEFGESGYEPNAITYTTVMKCCFRCGYFEQGLEIL  281

Query  1571  EEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKE  1392
              EMR  G+ FD FAYCTVI+ +IK GRM++A + +  M+ +GI  DLV+YNTLINLYC++
Sbjct  282   SEMRNLGFTFDGFAYCTVIAAMIKTGRMREAEEIIEVMVSSGIRPDLVSYNTLINLYCRQ  341

Query  1391  GKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAF  1212
             G+L++A  L+ E E +G +CD+YTHTII+DGLCKAG+   A RHLN    +GF  NLVAF
Sbjct  342   GRLEDALKLLDEIEEEGLECDQYTHTIIVDGLCKAGDFDGAQRHLNYMNTLGFGYNLVAF  401

Query  1211  NCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             NC +DGL K G +D+AL +F+ M+ KD FTY+ LVH LCKAG F  AS++L+SC+  G +
Sbjct  402   NCMLDGLGKAGHIDHALKLFEMMEVKDSFTYTILVHNLCKAGSFLSASKVLVSCLKCGYQ  461

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             +L++ ++AV+DGL+  GF  E RKL   ++L++++
Sbjct  462   VLRATQRAVLDGLRSIGFTNEERKLRKRIRLARLM  496


 Score =   115 bits (289),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/271 (27%), Positives = 128/271 (47%), Gaps = 4/271 (1%)
 Frame = -1

Query  2291  IKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDA  2112
             I+  +     N+ +  LCK   +  A ++  +  R G    V+TYN LI   C    +  
Sbjct  182   IRGEVHATTYNVMINGLCKNGYVSHALSLFRNLQRHGFVPQVLTYNALINGLCKAKRLKD  241

Query  2111  GYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMH  1932
                +L    E G +P+ ITY +++    R G   + L++L EM  +G   D ++Y T++ 
Sbjct  242   ARKVLKEFGESGYEPNAITYTTVMKCCFRCGYFEQGLEILSEMRNLGFTFDGFAYCTVIA  301

Query  1931  CLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIP  1752
              + + G+  EA    + +    I P  V++N L++  C  G  E AL L  E++  G   
Sbjct  302   AMIKTGRMREAEEIIEVMVSSGIRPDLVSYNTLINLYCRQGRLEDALKLLDEIEEEGLEC  361

Query  1751  QLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQIL  1572
                T+ I++ GLC +G +  A+R LN +  +G+  N + +  ++    ++   +  L++ 
Sbjct  362   DQYTHTIIVDGLCKAGDFDGAQRHLNYMNTLGFGYNLVAFNCMLDGLGKAGHIDHALKLF  421

Query  1571  EEMRRKGYIFDSFAYCTVISFLIKAGRMKDA  1479
             E M  K    DSF Y  ++  L KAG    A
Sbjct  422   EMMEVK----DSFTYTILVHNLCKAGSFLSA  448



>ref|XP_011002378.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Populus euphratica]
 ref|XP_011002379.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Populus euphratica]
 ref|XP_011002380.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Populus euphratica]
 ref|XP_011002382.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Populus euphratica]
 ref|XP_011002383.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Populus euphratica]
 ref|XP_011002384.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Populus euphratica]
 ref|XP_011002385.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Populus euphratica]
 ref|XP_011002386.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Populus euphratica]
Length=454

 Score =   533 bits (1372),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 258/450 (57%), Positives = 333/450 (74%), Gaps = 3/450 (1%)
 Frame = -1

Query  2285  SRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGY  2106
             SR ST+ LNI +A  CKAK L +AETVIIDG+R+GV  DVVTYNTLI AY  FV  DA Y
Sbjct  3     SRSSTRFLNICIASFCKAKHLRRAETVIIDGVRLGVLPDVVTYNTLINAYSRFVSFDAAY  62

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
             SIL RM E  IKPD++TYNSLIA A RH +LS C+DL EEMLE+GI PD WSYNTLMHC 
Sbjct  63    SILDRMKEASIKPDIVTYNSLIAGAMRHCLLSNCMDLFEEMLELGIKPDIWSYNTLMHCF  122

Query  1925  FRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             F+L +PD+AYR F DI    + P   T+N +L+GLC  G+ E ALMLFR+LK  GF+P L
Sbjct  123   FKLERPDDAYRVFTDIILCYLSPSHATYNTMLNGLCKCGFVENALMLFRKLKRHGFVPSL  182

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             VTYNILI+GLC + +   AR +L EL   G  PN ITYTT+M+CCFRSRRFE+GL+I EE
Sbjct  183   VTYNILINGLCKAWKLKTARWMLKELGASGLVPNVITYTTVMRCCFRSRRFEQGLEIFEE  242

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGK  1386
             M  KGY FD FAYCTV+  L+K  R+++A   +  M+   I LD+ +YNTLINLYCK GK
Sbjct  243   MIDKGYTFDGFAYCTVVGALVKTCRIEEASHYMEQMVSTDIGLDMASYNTLINLYCKGGK  302

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
             L+ A+ ++ + E++GF+ D+YT+TI+++GLC+ G+++ A+ ++N   + GF+SNLVA N 
Sbjct  303   LEMAHGVLDKMEKEGFERDEYTNTILMNGLCEEGDVEGAMEYMN---VAGFNSNLVALNT  359

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              +D  CK   +DYA  +F SMD +D FTYSSL+H LCK GRFR AS+LLLSC+  G +IL
Sbjct  360   MVDRCCKADRIDYAFKIFDSMDMRDSFTYSSLIHNLCKVGRFRCASKLLLSCVRSGTRIL  419

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
              S ++AV D L+HSG  +EA++L SE+KL+
Sbjct  420   PSAKRAVFDCLRHSGHQREAKRLKSEIKLA  449



>ref|XP_003522160.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X1 [Glycine max]
 ref|XP_006576572.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X2 [Glycine max]
 ref|XP_006576573.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X3 [Glycine max]
 ref|XP_006576574.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X4 [Glycine max]
 ref|XP_006576575.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X5 [Glycine max]
Length=461

 Score =   533 bits (1372),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 255/455 (56%), Positives = 340/455 (75%), Gaps = 1/455 (0%)
 Frame = -1

Query  2291  IKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDA  2112
             +KS LSTKLLNITV+ LCKAKQ+  AET I+DGIR+GV  DVVTYNTLI AYC F  +D 
Sbjct  7     LKSSLSTKLLNITVSSLCKAKQIPNAETAIVDGIRLGVLPDVVTYNTLIDAYCRFATLDV  66

Query  2111  GYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMH  1932
              YS+L RM++ GI PDV+++N+LI+ A R  + S+ LDL +EML+ GI PD WS+N LM+
Sbjct  67    AYSVLARMHDAGIPPDVVSFNTLISGAVRKSLFSKSLDLFDEMLKRGINPDAWSHNILMN  126

Query  1931  CLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIP  1752
             CLF+LGKPDEA R F++I   D    P T+NI+++GLC NGY   AL LFR L+  GF+P
Sbjct  127   CLFQLGKPDEANRVFKEIVLRD-EVHPATYNIMINGLCKNGYVGNALSLFRNLQRHGFVP  185

Query  1751  QLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQIL  1572
             Q++TYN LI+GLC + R   ARR+L E  + G  PNA+TYTT+M CCFR R FEEGL+IL
Sbjct  186   QVLTYNALINGLCKARRLKDARRVLKEFGETGNEPNAVTYTTVMTCCFRCRLFEEGLEIL  245

Query  1571  EEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKE  1392
              EMR  G+ FD FAYCTVI+ +IK GRM++A + V  M+ +G+  DLV+YNTLINLYC++
Sbjct  246   SEMRSLGFTFDGFAYCTVIAAMIKTGRMQEAEEIVEMMVSSGVRPDLVSYNTLINLYCRQ  305

Query  1391  GKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAF  1212
             G+LD+A  L+ E E +G +CD+YTHTII+DGLCKAGN   A RHLN    +GF SNLVAF
Sbjct  306   GRLDDALRLLDEIEGEGLECDQYTHTIIVDGLCKAGNFDGAQRHLNYMNSLGFGSNLVAF  365

Query  1211  NCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             NC +DGL K G +D+AL +F+ M+ KD FTY+ +VH LC+A RF  AS++L+SC+  G +
Sbjct  366   NCFLDGLGKAGHIDHALRLFEVMEVKDSFTYTIVVHNLCRARRFLCASKVLVSCLKCGYQ  425

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             +L++ ++AVI GL+  G+  EARK+   ++L++ +
Sbjct  426   VLRATQRAVIVGLRSIGYANEARKVKLTIRLAQFV  460



>ref|XP_004499962.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X1 [Cicer arietinum]
 ref|XP_004499963.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X2 [Cicer arietinum]
 ref|XP_004499964.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X3 [Cicer arietinum]
Length=457

 Score =   531 bits (1367),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 246/454 (54%), Positives = 336/454 (74%), Gaps = 1/454 (0%)
 Frame = -1

Query  2285  SRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGY  2106
             +RLSTK +NI ++ +CK+ Q+ KAE V+IDGI++GV  D+ TYNTLI  YC FV +DA Y
Sbjct  3     TRLSTKFMNICISTMCKSNQISKAEVVLIDGIKLGVYPDIFTYNTLINGYCRFVSLDAAY  62

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
             +IL+RM E GI PDV++YNSLI+ A R   LS+ L L +EML+ GI PD WSYN LMHCL
Sbjct  63    NILNRMKEAGINPDVVSYNSLISGAVRKSHLSKSLQLFDEMLQSGIRPDVWSYNILMHCL  122

Query  1925  FRLGKPDEAYRFFQDIF-WGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQ  1749
             FRLGKP+EA   F+DI   G++ PC  T+N++++GLC NGY + A+MLFR L+  GF+PQ
Sbjct  123   FRLGKPEEANSVFKDIVESGEMYPCTSTYNVMINGLCKNGYVKNAVMLFRNLQRHGFVPQ  182

Query  1748  LVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILE  1569
             ++TYN +I+GLC + R   ARR+L E  + GY PNAITYTT+MKCCFR  R E+GL+IL 
Sbjct  183   VLTYNTMINGLCKAKRLGDARRVLREFCEYGYEPNAITYTTVMKCCFRCGRLEQGLEILS  242

Query  1568  EMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEG  1389
             EMR KGY FD FAYCTV++ L+K GR+++A +    M+ NG+  DL +YNT+INL+C++G
Sbjct  243   EMRMKGYTFDGFAYCTVVAALVKTGRIEEADEIAQKMMSNGLVPDLASYNTMINLFCRQG  302

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
             + D+A  LV + ER+G  CD+YTHTIII GLCK G+   A +HL+    +GF  NLVAFN
Sbjct  303   RFDDALKLVDKIERQGLKCDQYTHTIIIHGLCKVGDFAGAEKHLDFMNSLGFGFNLVAFN  362

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             C ID L K G +D A+ VF SM+ KD FTY+ LVH LC+A +F  AS+LL+ C+  G  I
Sbjct  363   CLIDCLGKAGHIDQAMKVFDSMEVKDSFTYTILVHNLCRARKFLFASQLLIGCLKSGFHI  422

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             L++ ++AVIDGL   GFI++ARK+ ++++ ++++
Sbjct  423   LRATQRAVIDGLCSVGFIKQARKVKTKIRSARLI  456



>gb|KDO79612.1| hypothetical protein CISIN_1g012782mg [Citrus sinensis]
Length=410

 Score =   525 bits (1352),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 254/407 (62%), Positives = 327/407 (80%), Gaps = 0/407 (0%)
 Frame = -1

Query  2150  LITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVG  1971
             LI AYC FV  DAGY+IL+RM E GI PDV+TYNSLIA ATR+ +LS  LDLL+EMLE+G
Sbjct  2     LIDAYCQFVSFDAGYTILNRMREAGISPDVVTYNSLIAGATRNSLLSCSLDLLDEMLEMG  61

Query  1970  ILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKAL  1791
             I PD WSYN+LMHCLF+LGKPDEA R FQD+  GD+ PC  TFNI+L+GLC N YT+ AL
Sbjct  62    IPPDVWSYNSLMHCLFQLGKPDEANRVFQDMICGDLTPCTATFNIMLNGLCKNRYTDNAL  121

Query  1790  MLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCC  1611
              +FR L+  GF+P+LVTYNILI GLC +GR   AR +L EL D G+ PNAITYTTIMKCC
Sbjct  122   RMFRGLQKHGFVPELVTYNILIKGLCKAGRLRTARWILKELGDSGHAPNAITYTTIMKCC  181

Query  1610  FRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDL  1431
             FR+R+++ GL+IL  M+RKGY FD F YCTVI+  +K GR+K+A D +  M+ +G++LD+
Sbjct  182   FRNRKYKLGLEILSAMKRKGYTFDGFGYCTVIAAFVKIGRLKEATDYMEQMVTDGVQLDI  241

Query  1430  VAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNC  1251
             V+YNTLINLYCKEGKL+ AY+L+ E E++GF+CDKYTHTI+IDGLCKAGN+K A  HL  
Sbjct  242   VSYNTLINLYCKEGKLEAAYLLLDEMEKQGFECDKYTHTILIDGLCKAGNIKGARLHLEY  301

Query  1250  TKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVA  1071
                +GFDSNL A+NC +D L K G++D+A++VF+SM+ KD FTYSS+VH LCKA R   A
Sbjct  302   MNKIGFDSNLEAYNCIVDRLGKDGKIDHAINVFESMEVKDSFTYSSMVHNLCKAKRLPSA  361

Query  1070  SELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
             S+LLLSC+  G++ILKS ++AV+DGL+HSG  +EA+K+ S+++++KI
Sbjct  362   SKLLLSCLKSGVRILKSAQKAVVDGLRHSGCRREAKKIQSKIRMAKI  408


 Score =   107 bits (266),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/289 (26%), Positives = 132/289 (46%), Gaps = 4/289 (1%)
 Frame = -1

Query  2273  TKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILH  2094
             T   NI +  LCK +  + A  +     + G   ++VTYN LI   C    +     IL 
Sbjct  101   TATFNIMLNGLCKNRYTDNALRMFRGLQKHGFVPELVTYNILIKGLCKAGRLRTARWILK  160

Query  2093  RMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLG  1914
              + + G  P+ ITY +++    R+      L++L  M   G   D + Y T++    ++G
Sbjct  161   ELGDSGHAPNAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFGYCTVIAAFVKIG  220

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             +  EA  + + +    +    V++N L++  C  G  E A +L  E++  GF     T+ 
Sbjct  221   RLKEATDYMEQMVTDGVQLDIVSYNTLINLYCKEGKLEAAYLLLDEMEKQGFECDKYTHT  280

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             ILI GLC +G    AR  L  +  IG++ N   Y  I+    +  + +  + + E M  K
Sbjct  281   ILIDGLCKAGNIKGARLHLEYMNKIGFDSNLEAYNCIVDRLGKDGKIDHAINVFESMEVK  340

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
                 DSF Y +++  L KA R+  A   + + + +G+ +   A   +++
Sbjct  341   ----DSFTYSSMVHNLCKAKRLPSASKLLLSCLKSGVRILKSAQKAVVD  385


 Score = 75.5 bits (184),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 108/239 (45%), Gaps = 4/239 (2%)
 Frame = -1

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             +LI   C    +     +LN + + G +P+ +TY +++    R+      L +L+EM   
Sbjct  1     MLIDAYCQFVSFDAGYTILNRMREAGISPDVVTYNSLIAGATRNSLLSCSLDLLDEMLEM  60

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
             G   D ++Y +++  L + G+  +A     +MI   +      +N ++N  CK    DNA
Sbjct  61    GIPPDVWSYNSLMHCLFQLGKPDEANRVFQDMICGDLTPCTATFNIMLNGLCKNRYTDNA  120

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               +    ++ GF  +  T+ I+I GLCKAG ++ A   L      G   N + +   +  
Sbjct  121   LRMFRGLQKHGFVPELVTYNILIKGLCKAGRLRTARWILKELGDSGHAPNAITYTTIMKC  180

Query  1193  LCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
               +  +    L +  +M  K    D F Y +++    K GR + A++ +   +  G+++
Sbjct  181   CFRNRKYKLGLEILSAMKRKGYTFDGFGYCTVIAAFVKIGRLKEATDYMEQMVTDGVQL  239



>ref|XP_009355436.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g46680 [Pyrus x bretschneideri]
Length=460

 Score =   525 bits (1353),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 329/447 (74%), Gaps = 7/447 (2%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
             +LNI +A  CKA+ LE+AE VI DGIR+GV  DVVTYNTL++AY  FV +DA YS++HRM
Sbjct  20    ILNICIASFCKARLLERAEAVITDGIRLGVIPDVVTYNTLLSAYSRFVSLDATYSVVHRM  79

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
              E  I P VI YNSL++ ATR+ +LS+ LDL EE L  GI P+ WSYN LMHC F+LGKP
Sbjct  80    KEARISPYVIAYNSLVSGATRNCLLSQSLDLFEETLRAGIHPNLWSYNILMHCFFKLGKP  139

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             DEA R FQDI   ++ P P TFN +++GLC N Y + ALMLFR L+  G +PQLVTYNIL
Sbjct  140   DEANRVFQDILLANLSPXPATFNTMINGLCKNEYIDNALMLFRNLQRRGSVPQLVTYNIL  199

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             IHGLC + R   AR+LL EL + GY PNAIT TT+MKCCF+ ++++EGL+I+ EMR KGY
Sbjct  200   IHGLCKACRLGQARKLLRELGESGYEPNAITSTTVMKCCFKFKQYDEGLEIMSEMRSKGY  259

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
             +FD  AYCTV++ L+K  R+++A  C+   + NG+ELDL AYNTL+N+YC+EGKL +   
Sbjct  260   VFDGLAYCTVVAALVKTVRIEEANACMEQTMRNGVELDLSAYNTLLNMYCREGKLMD---  316

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLC  1188
                E E  G  CDKYTH IIIDGLCK GN+  A +HL   K MGF   LVA +  IDGLC
Sbjct  317   ---EKENGGLVCDKYTHAIIIDGLCKVGNIIGAEQHLQYMKTMGFREILVALS-MIDGLC  372

Query  1187  KVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQA  1008
             K  ++D A+ ++KSM+ KD FTY+SLVH LCKAGRFR AS+L++ C+  G KIL++ ++A
Sbjct  373   KADQIDRAMELYKSMETKDSFTYTSLVHNLCKAGRFRCASKLMMKCLRDGKKILRATQRA  432

Query  1007  VIDGLQHSGFIQEARKLHSELKLSKIL  927
             V+D L+  G+  EARKL  ++++++IL
Sbjct  433   VLDDLRSMGYTDEARKLRWKIQVARIL  459



>ref|XP_010674094.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Beta vulgaris subsp. vulgaris]
 ref|XP_010674095.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Beta vulgaris subsp. vulgaris]
 ref|XP_010674096.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Beta vulgaris subsp. vulgaris]
 ref|XP_010674098.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Beta vulgaris subsp. vulgaris]
 ref|XP_010674099.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Beta vulgaris subsp. vulgaris]
 ref|XP_010674100.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Beta vulgaris subsp. vulgaris]
 ref|XP_010674101.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Beta vulgaris subsp. vulgaris]
 ref|XP_010674102.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Beta vulgaris subsp. vulgaris]
Length=456

 Score =   525 bits (1352),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 255/453 (56%), Positives = 328/453 (72%), Gaps = 0/453 (0%)
 Frame = -1

Query  2285  SRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGY  2106
             SRLST+LLNI ++  CK ++L+KAE++IIDGIRVGV  DVVTYN L+ AYC FVG DA Y
Sbjct  3     SRLSTRLLNICISTYCKLQRLDKAESLIIDGIRVGVLPDVVTYNALVDAYCRFVGFDAAY  62

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
              ++ RM   GIKP+  TYNSL+A A+R   LS  LD+ EEML++GI PD WSYNT+MHC 
Sbjct  63    DVIRRMQVAGIKPNRFTYNSLLAGASRQCQLSLSLDIFEEMLKLGISPDLWSYNTVMHCC  122

Query  1925  FRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             FRLGKPDEAY  F++I   ++ P   +FN LL+GLC  GYT  ALML+R LK  G   +L
Sbjct  123   FRLGKPDEAYGVFRNIILNNLCPDRTSFNTLLNGLCKTGYTNHALMLYRNLKRHGCELEL  182

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             +TYNILI+GLC +GR   AR +L EL D GY PNAITYTT++KCCF  RRFEE L++  E
Sbjct  183   ITYNILINGLCKAGRLKAARWILKELGDSGYIPNAITYTTVLKCCFMCRRFEEALEVFWE  242

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGK  1386
             M+ KGY FD+FAYCTV     K GR+K+A DC+  M+ +GI  D+V+YNTL+N+YCK GK
Sbjct  243   MKSKGYTFDAFAYCTVAGAFAKKGRLKEANDCIEAMLKSGIAPDIVSYNTLMNIYCKVGK  302

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
              +  Y L+ +  + G +CD YTHTI+IDG CK+GN++ A RHL      GF +NL AFN 
Sbjct  303   FEAVYELLDKIAKAGLECDNYTHTILIDGFCKSGNIQGAQRHLQLISSTGFSTNLAAFNS  362

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              +DG+ K G    A+++FK M  KD FTYSSLVH LCK  +FR AS+LLLSC+  GM IL
Sbjct  363   LLDGMYKAGHAKRAMNLFKLMKVKDEFTYSSLVHNLCKERKFRSASKLLLSCLKNGMNIL  422

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             KS  +AVI G ++SGF + AR+L S+++++K L
Sbjct  423   KSAERAVIRGFRNSGFRRGARELQSKIRMAKFL  455



>ref|XP_010035874.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Eucalyptus grandis]
 ref|XP_010035875.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Eucalyptus grandis]
Length=458

 Score =   525 bits (1351),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 244/451 (54%), Positives = 337/451 (75%), Gaps = 0/451 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI +A +CK +QL++AE ++ID IR+GV  +VVTYN L+ AYC FVG+ A   +
Sbjct  5     LSTRLLNICIASVCKTQQLQRAEVLLIDAIRLGVLPNVVTYNILVDAYCRFVGMGAALDV  64

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             + RM E GI PDVITYNSL+A +TR   LS  LDL +EMLE+ I PD WSYNTLMHC F+
Sbjct  65    IPRMREAGISPDVITYNSLVAGSTRKRSLSLTLDLFDEMLELSIHPDRWSYNTLMHCFFK  124

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
             +G PDE Y  F+++   +I P   TFNIL++GLC NGY    LMLFR L+  G +P+LVT
Sbjct  125   VGNPDEGYNVFRNLVLSEITPGQDTFNILINGLCKNGYAMHGLMLFRNLQRHGVVPELVT  184

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YN+LI GLC +G+W  A+ ++ EL++   NPNAIT+TT+MKCCF+ +++E+GL++  EM 
Sbjct  185   YNLLIDGLCKAGQWRAAKTMIMELLETDENPNAITFTTVMKCCFKFQKYEQGLEVFLEMA  244

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              +G+ FD F YCT +  LIK GR+++A   +  M+ NGI LDLV+YNTLINL+C+EG+L 
Sbjct  245   NRGHTFDGFGYCTAVGGLIKIGRIEEANRWMDRMLKNGIGLDLVSYNTLINLHCREGRLG  304

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              AY +V E E++G +CD YTH IIIDGLC+AG+++ A RHL+  K++G  SN VA NC I
Sbjct  305   AAYAVVEELEKRGLECDAYTHAIIIDGLCRAGDIEGAYRHLDRMKVLGLGSNRVALNCMI  364

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             D L K G ++ A+ +F+SM+ KD FTYSS+VH LCK GRFR AS++LLSC+  G KILKS
Sbjct  365   DRLFKAGYMEAAMRLFESMETKDDFTYSSVVHSLCKLGRFRSASKVLLSCLRSGTKILKS  424

Query  1019  DRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              ++AV+ GL+ SG+ ++A+KL S++ ++++L
Sbjct  425   AQKAVLTGLKMSGYRRDAKKLQSQIYMARVL  455



>ref|XP_010932326.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X2 [Elaeis guineensis]
Length=462

 Score =   523 bits (1348),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 258/450 (57%), Positives = 329/450 (73%), Gaps = 0/450 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLN+ +A LCKA+ LEKAE V+IDGIR+G   DVVTYNTLITAYC FVG+D  YSI
Sbjct  10    LSTQLLNVCIASLCKARNLEKAEAVLIDGIRLGCIPDVVTYNTLITAYCRFVGMDEAYSI  69

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             L+RM EVGIKPDVITYNSLIA ATR+ + SR L+L +EML++G+ PD WSYNTLMHCLF+
Sbjct  70    LYRMREVGIKPDVITYNSLIAGATRYCLPSRALELFDEMLQIGLAPDEWSYNTLMHCLFK  129

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
              G P+EAY+ + D+   +I P   T+N L++GLC  G    A+ LFR L+  GF   LVT
Sbjct  130   TGYPEEAYKIYLDMILKNITPSSATYNTLINGLCKMGKAVYAVRLFRNLQKLGFSAGLVT  189

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YN +I GLC  GR   ARR+L EL + G  PN ITYTT+MKCCFR  +FE+G +I  EM 
Sbjct  190   YNTIIDGLCKCGRIDQARRILKELGESGCAPNVITYTTVMKCCFRCGKFEQGFEIFYEMM  249

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              KGY  D FAYCTVIS L K G + DA  CV  M+ NGI LD   YNTL+ L C+EGKL+
Sbjct  250   NKGYNSDVFAYCTVISTLTKKGMLTDANACVEQMLGNGIGLDKACYNTLLYLLCREGKLE  309

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              A+ L+ E E  G + D+YT++I+++GLCK G +  A + L   ++  F SNLVA+NC I
Sbjct  310   IAFQLLNEMEEGGLEGDEYTYSILVNGLCKMGYIDAAFKQLRLMEVRDFKSNLVAYNCLI  369

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             DGLCKVGEVD A+ +F  M  KD FTY+SL+HGLC+ GRFRVAS+LLL+C+  GM +L+S
Sbjct  370   DGLCKVGEVDSAMKLFNKMKSKDPFTYTSLLHGLCRKGRFRVASKLLLTCLREGMNVLRS  429

Query  1019  DRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
              ++AVI GLQ SGF ++A KL + L+L+++
Sbjct  430   AQRAVITGLQSSGFKRDAGKLRTALRLAQL  459



>ref|XP_009379894.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X2 [Musa acuminata subsp. malaccensis]
Length=457

 Score =   508 bits (1309),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 249/452 (55%), Positives = 323/452 (71%), Gaps = 0/452 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             RLSTKLLN+ V+ LCKA+ L+KAE VIIDGIR+G   DVVTYNTLI AYCC VGID  Y 
Sbjct  4     RLSTKLLNVCVSSLCKARNLDKAEAVIIDGIRLGCLPDVVTYNTLIDAYCCLVGIDEAYV  63

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             IL+RM E G++PDVITYNSLIA ATR  + +R LDL EEML+ G++PD W+YNTLMHCLF
Sbjct  64    ILYRMREAGVRPDVITYNSLIAGATRCCLPTRSLDLFEEMLQAGLVPDVWTYNTLMHCLF  123

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             + G P++AY+ + D+   ++ P   T+N L++G+C  G     L LFR L+  GF  +LV
Sbjct  124   KCGYPEDAYKIYLDMISKNVTPSLTTYNTLINGMCKTGNAMSGLRLFRNLERLGFSAELV  183

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYN +I+GLC SGR   ARR+L EL +    PN ITYTT+MKCCF++ RFE+G +I   M
Sbjct  184   TYNTIINGLCKSGRIGEARRILKELGESDCVPNEITYTTVMKCCFQNGRFEQGFEIFYGM  243

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
               KGY  D FAYC  IS LIK G ++DA  CV  M+ NGI LD   YNT+I L CKEGKL
Sbjct  244   MNKGYTADVFAYCAAISALIKMGNLEDANACVEQMLRNGIGLDKACYNTIIYLQCKEGKL  303

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D A+ LV E E  G   D+YT++I+IDGLC+ G +  A + L+  ++ GF SNLVA+NC 
Sbjct  304   DYAFQLVNEMEEAGLGSDQYTYSILIDGLCRMGYIDSANKQLHMMEMRGFRSNLVAYNCL  363

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             IDGLCK+GEVD AL +F  M  KD +TY+S+V+GLCK  RF  AS+LLL+C+  G  +L 
Sbjct  364   IDGLCKLGEVDLALKLFHEMKSKDNYTYTSIVNGLCKKSRFHAASKLLLNCLKEGSSVLT  423

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             S  +AVI GLQ +GF ++A++L + L+++ +L
Sbjct  424   STHRAVIAGLQSAGFRRDAKRLRASLRVACLL  455



>ref|XP_009379884.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X1 [Musa acuminata subsp. malaccensis]
Length=494

 Score =   507 bits (1305),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 249/452 (55%), Positives = 323/452 (71%), Gaps = 0/452 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             RLSTKLLN+ V+ LCKA+ L+KAE VIIDGIR+G   DVVTYNTLI AYCC VGID  Y 
Sbjct  41    RLSTKLLNVCVSSLCKARNLDKAEAVIIDGIRLGCLPDVVTYNTLIDAYCCLVGIDEAYV  100

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             IL+RM E G++PDVITYNSLIA ATR  + +R LDL EEML+ G++PD W+YNTLMHCLF
Sbjct  101   ILYRMREAGVRPDVITYNSLIAGATRCCLPTRSLDLFEEMLQAGLVPDVWTYNTLMHCLF  160

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             + G P++AY+ + D+   ++ P   T+N L++G+C  G     L LFR L+  GF  +LV
Sbjct  161   KCGYPEDAYKIYLDMISKNVTPSLTTYNTLINGMCKTGNAMSGLRLFRNLERLGFSAELV  220

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYN +I+GLC SGR   ARR+L EL +    PN ITYTT+MKCCF++ RFE+G +I   M
Sbjct  221   TYNTIINGLCKSGRIGEARRILKELGESDCVPNEITYTTVMKCCFQNGRFEQGFEIFYGM  280

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
               KGY  D FAYC  IS LIK G ++DA  CV  M+ NGI LD   YNT+I L CKEGKL
Sbjct  281   MNKGYTADVFAYCAAISALIKMGNLEDANACVEQMLRNGIGLDKACYNTIIYLQCKEGKL  340

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D A+ LV E E  G   D+YT++I+IDGLC+ G +  A + L+  ++ GF SNLVA+NC 
Sbjct  341   DYAFQLVNEMEEAGLGSDQYTYSILIDGLCRMGYIDSANKQLHMMEMRGFRSNLVAYNCL  400

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             IDGLCK+GEVD AL +F  M  KD +TY+S+V+GLCK  RF  AS+LLL+C+  G  +L 
Sbjct  401   IDGLCKLGEVDLALKLFHEMKSKDNYTYTSIVNGLCKKSRFHAASKLLLNCLKEGSSVLT  460

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             S  +AVI GLQ +GF ++A++L + L+++ +L
Sbjct  461   STHRAVIAGLQSAGFRRDAKRLRASLRVACLL  492



>ref|XP_010530041.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Tarenaya hassleriana]
Length=469

 Score =   505 bits (1300),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 327/455 (72%), Gaps = 1/455 (0%)
 Frame = -1

Query  2285  SRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGY  2106
             S LS +LLNI V  LCK + LEKAE++IIDGIR+GV  DVVTYNTLI  YC FVGI   Y
Sbjct  9     SGLSRRLLNICVDSLCKFRNLEKAESLIIDGIRLGVLPDVVTYNTLINGYCRFVGIGKAY  68

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
              ++ RM E GI+PDV TYNSLIA A R  ML+R L+L +EM    I PD WSYNTLM+C 
Sbjct  69    DVVRRMREAGIRPDVATYNSLIAGAARKLMLNRVLELFDEMRLSHISPDLWSYNTLMYCY  128

Query  1925  FRLGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQ  1749
             F+LGKP EAYR   +DI   D+P    T NILL GLC NGYT+ A+MLFR+L+H GF+PQ
Sbjct  129   FKLGKPKEAYRILSEDIQHSDLPFGADTVNILLDGLCKNGYTDNAIMLFRQLQHDGFVPQ  188

Query  1748  LVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILE  1569
             L+TYNILI+GLC S R   ARR++ EL  +GY PN ITYTTIMK  F++RR ++GL + +
Sbjct  189   LITYNILINGLCKSRRVGSARRMMRELERLGYTPNVITYTTIMKSYFKTRRIDQGLCLFQ  248

Query  1568  EMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEG  1389
             EM+ +GY +D +AYCTV+S LIK GR ++AYD +  ++ +  + DLV+YNTL+NLYCK+G
Sbjct  249   EMKDRGYTYDGYAYCTVVSALIKLGRKEEAYDYMLQLVRSRRKQDLVSYNTLLNLYCKDG  308

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
               +  + L+ E E KG + D+YTHTII+DGL KA N++ A  HL   K  G  SNLVA N
Sbjct  309   DFEAVHDLLNEMEEKGLETDEYTHTIIVDGLAKADNIERAEDHLVYMKATGLGSNLVACN  368

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             C +DGLCK G VD A+S+ +SM+ KD +TY+++VH LCKAG+F+ A++LLLSC   G K 
Sbjct  369   CLVDGLCKAGHVDRAMSLLESMEMKDDYTYTTIVHNLCKAGQFKCAAKLLLSCYKNGKKT  428

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
              +S R+AV  GL+  GF    +K+ +++ ++  LN
Sbjct  429   PRSARRAVYCGLRRLGFRSRVKKIQAKITVAGALN  463



>gb|EYU45340.1| hypothetical protein MIMGU_mgv1a020198mg, partial [Erythranthe 
guttata]
Length=480

 Score =   483 bits (1242),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 236/426 (55%), Positives = 301/426 (71%), Gaps = 4/426 (1%)
 Frame = -1

Query  2249  ACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIK  2070
             A LC+AKQLEKAE  I+DGI++GV  +VVTYNTLIT YC F+G DAGY ++ RM E  I 
Sbjct  33    ASLCRAKQLEKAEAAIVDGIKLGVLPNVVTYNTLITGYCQFIGFDAGYDVIRRMKEAEIT  92

Query  2069  PDVITYNSLIASATRH-GMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             PDVITYNSL+A ATR    L RC ++L+EML++GI PD W+YNTLMH  F+ G P EAY+
Sbjct  93    PDVITYNSLMAGATRQQNSLHRCREMLDEMLQIGITPDIWTYNTLMHSYFKSGNPGEAYK  152

Query  1892  FFQD--IFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
              FQD  I   +I PC  TFNI+++GLC NG    ALM FR LK  G+   +VTYNILI  
Sbjct  153   IFQDEIILKKNISPCHATFNIMINGLCKNGCIGNALMFFRYLKQQGYDLDIVTYNILISS  212

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFD  1539
             LC +  W     LL EL    + PNAITYT +MK CFR + F EGL+I  EM+ KGY +D
Sbjct  213   LCKARMWKSMMSLLEELSVSDHEPNAITYTAVMKACFRRKHFREGLEIFLEMKSKGYAYD  272

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVV  1359
              F+YCTV+  L+K+GR +D Y  + +MI  G ELD+V+YNTLIN +CKE K++NAY L +
Sbjct  273   LFSYCTVVGALLKSGRSQDTYSLIAHMIKIGYELDIVSYNTLINWHCKERKIENAYNLSI  332

Query  1358  EAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVG  1179
              A+ +G   D YTHTI+I+GL K+G+   A RH++  +   FDS LV  NC ID LCK G
Sbjct  333   VAKERGLKWDAYTHTILINGLYKSGDFDGAQRHIDHLETTTFDS-LVTTNCFIDSLCKFG  391

Query  1178  EVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVID  999
              ++YAL VF+SM  KD FTYSS+VH LC+A ++R+AS++LLSCI  G K LKSDR+AV+ 
Sbjct  392   HLEYALHVFRSMVVKDSFTYSSMVHNLCRARKYRLASQILLSCIKAGFKTLKSDRRAVVK  451

Query  998   GLQHSG  981
             GL  +G
Sbjct  452   GLSLTG  457


 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 81/316 (26%), Positives = 138/316 (44%), Gaps = 21/316 (7%)
 Frame = -1

Query  1865  IPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC-NSGRWAPA  1689
             + P  VT+N L++G C     +    + R +K +   P ++TYN L+ G           
Sbjct  56    VLPNVVTYNTLITGYCQFIGFDAGYDVIRRMKEAEITPDVITYNSLMAGATRQQNSLHRC  115

Query  1688  RRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILE-EMRRKGYIFDSFA-YCTVI  1515
             R +L+E++ IG  P+  TY T+M   F+S    E  +I + E+  K  I    A +  +I
Sbjct  116   REMLDEMLQIGITPDIWTYNTLMHSYFKSGNPGEAYKIFQDEIILKKNISPCHATFNIMI  175

Query  1514  SFLIKAGRMKDAYDCVGNMIM-------NGIELDLVAYNTLINLYCKEGKLDNAYMLVVE  1356
             + L K G       C+GN +M        G +LD+V YN LI+  CK     +   L+ E
Sbjct  176   NGLCKNG-------CIGNALMFFRYLKQQGYDLDIVTYNILISSLCKARMWKSMMSLLEE  228

Query  1355  AERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGE  1176
                   + +  T+T ++    +  + +E L      K  G+  +L ++   +  L K G 
Sbjct  229   LSVSDHEPNAITYTAVMKACFRRKHFREGLEIFLEMKSKGYAYDLFSYCTVVGALLKSGR  288

Query  1175  VDYALSVFKSM----DEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQA  1008
                  S+   M     E D  +Y++L++  CK  +   A  L +     G+K        
Sbjct  289   SQDTYSLIAHMIKIGYELDIVSYNTLINWHCKERKIENAYNLSIVAKERGLKWDAYTHTI  348

Query  1007  VIDGLQHSGFIQEARK  960
             +I+GL  SG    A++
Sbjct  349   LINGLYKSGDFDGAQR  364



>ref|XP_010439925.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Camelina sativa]
Length=463

 Score =   479 bits (1233),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 243/453 (54%), Positives = 317/453 (70%), Gaps = 2/453 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI V  LCK ++LEKAE++IIDGIR+GVP DVVTYNTLI+ YC FVGI+  Y +
Sbjct  11    LSTRLLNICVDSLCKFRKLEKAESLIIDGIRLGVPPDVVTYNTLISGYCRFVGIEEAYDV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM + GI+PDV TYNSLIA A R  ML R L L +EMLE GI PD WSYNTLM C F+
Sbjct  71    TRRMRDAGIRPDVATYNSLIAGAARQLMLDRVLYLFDEMLEWGIYPDLWSYNTLMCCYFK  130

Query  1919  LGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK +EA+R  ++D+    + P P T+N+LL  LC  GY + AL LF+E++ S F P+L+
Sbjct  131   LGKQEEAFRVLYKDLQLAGLSPGPDTYNVLLDALCKCGYIDNALELFKEMQ-SKFKPELM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC + R   A+ +L EL   GY PNA+TYTTI+K  F++RRF  GLQ+  EM
Sbjct  190   TYNILINGLCKARRVGTAKWMLTELRRSGYTPNAVTYTTILKLYFKTRRFRRGLQLFLEM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R+GY +D +AY  V+S LIK GR K+AY+ +  ++  G   D+V+YNTL+NLY K+G L
Sbjct  250   KREGYTYDGYAYFAVVSALIKTGRTKEAYEYMQELVRKGRRHDIVSYNTLLNLYFKDGNL  309

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D    L+ E ERKG   D+YTHTII++GL + G  + A +H      MG   NLV  NC 
Sbjct  310   DAVDDLLGEIERKGMKADEYTHTIIVNGLLRTGQTRRAEQHFVSMGEMGIGLNLVTCNCL  369

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             +DGLCK G VD A+  F+SM+ KD ++Y+S+VH LCK  RF  AS+LLLSC   G+KI  
Sbjct  370   VDGLCKAGHVDRAMRYFESMEVKDEYSYTSVVHNLCKDMRFVCASKLLLSCYNKGIKIPT  429

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             S R+AV+ GL+ SG   EARK  +E+KL+ + N
Sbjct  430   SARRAVLSGLRMSGCYGEARKAKAEMKLTPVGN  462



>ref|XP_010449539.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Camelina sativa]
Length=464

 Score =   473 bits (1218),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 242/454 (53%), Positives = 318/454 (70%), Gaps = 3/454 (1%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGID-AGYS  2103
             LST+LLNI V  LCK ++LEKAE++IIDGIR+GVP DVVTYNTLI+ YC FVGI+ A Y+
Sbjct  11    LSTRLLNICVDSLCKFRKLEKAESLIIDGIRLGVPPDVVTYNTLISGYCRFVGIEEATYA  70

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +  RM + GI+PDV TYNSLIA A +  ML R L L +EMLE GI PD WSYNTLM C F
Sbjct  71    VTRRMRDAGIRPDVATYNSLIAGAAKQLMLDRVLYLFDEMLEWGIYPDLWSYNTLMCCYF  130

Query  1922  RLGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             +LGK +EA+R  ++D+    + P P T+N+LL  LC  GY + AL LF+E++ S F P+L
Sbjct  131   KLGKQEEAFRVLYKDLQLAGLSPGPDTYNVLLDALCKCGYIDNALELFKEMQ-SKFKPEL  189

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             +TYNILI+GLC + R   A+ +L EL   GY PNA+TYTTI+K  F++RR   GLQ+  E
Sbjct  190   MTYNILINGLCKARRVGTAKWMLTELRRSGYTPNAVTYTTILKLYFKTRRIRRGLQLFLE  249

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGK  1386
             M+R+GY +D +AY  V+S LIK GR K+AY+ +  ++  G   D+V+YNTL+NLY K+G 
Sbjct  250   MKREGYTYDGYAYFAVVSALIKTGRTKEAYEYMQELVRKGRRHDIVSYNTLLNLYFKDGN  309

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
             LD    L+ E ERKG   D+YTHTII++GL + G  + A +H      MG   NLV  NC
Sbjct  310   LDAVDDLLGEIERKGMKADEYTHTIIVNGLLRTGQTRRAEQHFVSMGEMGIGLNLVTCNC  369

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              +DGLCK G VD A+  F+SM+ KD ++Y+S+VH LCK  RF  AS+LLLSC   G+KI 
Sbjct  370   LVDGLCKAGHVDRAMRYFESMEVKDEYSYTSVVHNLCKDMRFVCASKLLLSCYNKGIKIP  429

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
              S R+AV+ GL+ SG   EARK  +E+KL+ + N
Sbjct  430   TSARRAVLSGLRMSGCYGEARKAKAEMKLTPVGN  463



>ref|XP_010436506.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Camelina sativa]
Length=463

 Score =   473 bits (1217),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 240/453 (53%), Positives = 315/453 (70%), Gaps = 2/453 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI V  LCK ++L+KAE++IIDGIR+GVP DVVTYNTLI+ YC FVGI+  Y++
Sbjct  11    LSTRLLNICVDSLCKFRKLKKAESLIIDGIRLGVPPDVVTYNTLISGYCRFVGIEEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM + GI+PDV TYNSLIA A R  ML R L L +EMLE GI PD WSYNTLM C F+
Sbjct  71    TRRMRDAGIRPDVATYNSLIAGAARQLMLDRVLYLFDEMLEWGIYPDVWSYNTLMCCYFK  130

Query  1919  LGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK +EA+R  ++D+    + P P T+N+LL  LC  GY + AL LF+E++ S F P+L+
Sbjct  131   LGKQEEAFRVLYKDLQLAGLSPGPDTYNVLLDALCKCGYIDNALELFKEMQ-SKFKPELM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC + R   A+ +L EL   GY PNA+TYTTI+K  F++RR   GLQ+  EM
Sbjct  190   TYNILINGLCKARRVGTAKWMLTELRRSGYTPNAVTYTTILKLYFKTRRIRRGLQLFLEM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R+GY +D +AY  V+S LIK GR K+AY+ +  ++  G   D+V+YNTL+NLY K   L
Sbjct  250   KREGYTYDGYAYFAVVSALIKTGRTKEAYEYMQELVRKGRRHDIVSYNTLLNLYFKNRNL  309

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D    L+ E ERKG   D+YTHTII++GL + G  + A +H      MG   NLV  NC 
Sbjct  310   DAVDDLLGEIERKGMKADEYTHTIIVNGLLRTGQTRRAKQHFVSMGEMGIGLNLVTCNCL  369

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             +DGLCK G VD A+  F+SM+ KD ++Y+S+VH LCK  RF  AS+LLLSC   G+KI  
Sbjct  370   VDGLCKAGHVDRAMRYFESMEVKDEYSYTSVVHNLCKDMRFVCASKLLLSCYNKGIKIPT  429

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             S R+AV+ GL+ SG   EARK  +E+KL+ + N
Sbjct  430   SARRAVLSGLRMSGCYGEARKAKAEMKLTPVGN  462



>ref|XP_002868030.1| hypothetical protein ARALYDRAFT_914908 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44289.1| hypothetical protein ARALYDRAFT_914908 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score =   473 bits (1216),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 243/453 (54%), Positives = 315/453 (70%), Gaps = 2/453 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI V  LCK ++LEKAET+IIDGIR+GV  DVVTYNTLI+ YC FVGI+ GY++
Sbjct  11    LSTRLLNICVDSLCKFRKLEKAETLIIDGIRLGVAPDVVTYNTLISGYCRFVGIEEGYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM + GI+PDV TYNSLIA A R  ML R L L +EMLE GI PD WSYNTLM C F+
Sbjct  71    TLRMRDAGIRPDVATYNSLIAGAARRLMLDRVLYLFDEMLEWGIYPDLWSYNTLMCCYFK  130

Query  1919  LGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK +EA+R  ++D+    + P P T+N+LL  LC  GY + AL LF+E++ S F P+L+
Sbjct  131   LGKHEEAFRVLYKDLQLAGLSPGPDTYNVLLDALCKCGYIDNALELFKEMQ-SKFKPELM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S R   A+ +L EL   GY PNA+TYTTI+K   ++RR   GLQ+  EM
Sbjct  190   TYNILINGLCKSRRVGTAKWMLTELKRSGYTPNAVTYTTILKLYIKTRRIRRGLQLFLEM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R+GY +D +AY  V+S LIK GR K+AY+ +  ++  G   D+V+YNTL+NLY K+G L
Sbjct  250   KREGYTYDGYAYFAVVSALIKTGRTKEAYEYMQELVRKGRRHDIVSYNTLLNLYFKDGNL  309

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D    L+ E ERKG   D+YTHTII++GL + G  + A  H      MG   NLV  NC 
Sbjct  310   DAVDDLLGEIERKGMKADEYTHTIIVNGLLRTGQTRRAEEHFVSMGEMGIGLNLVTCNCL  369

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             +DGLCK G VD A+  F+SM+ KD +TY+S+VH LCK  RF  AS+LLLSC   G+KI  
Sbjct  370   VDGLCKAGHVDRAMRYFESMEVKDEYTYTSVVHNLCKDMRFVCASKLLLSCYNKGIKIPT  429

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             S R+AV+ GL+ SG   EARK  +++KL+ + N
Sbjct  430   SARRAVLSGLRMSGCYGEARKAKAKMKLTLVGN  462



>ref|XP_006283693.1| hypothetical protein CARUB_v10004757mg [Capsella rubella]
 gb|EOA16591.1| hypothetical protein CARUB_v10004757mg [Capsella rubella]
Length=463

 Score =   471 bits (1211),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 244/453 (54%), Positives = 312/453 (69%), Gaps = 2/453 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI V  LCK ++LEKAE +IIDGIR+GV  DVVTYNTLI+ YC FVGI+  Y++
Sbjct  11    LSTRLLNICVDSLCKFRKLEKAECLIIDGIRLGVAPDVVTYNTLISGYCRFVGIEEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM + GI+PDV TYNSLIA A R  ML R L L +EMLE GI PD WSYNTLM C F+
Sbjct  71    TRRMRDAGIRPDVATYNSLIAGAGRRLMLDRVLYLFDEMLEWGIYPDLWSYNTLMCCYFK  130

Query  1919  LGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK +EA+R  ++D+    + P P T+N++L  LC  GY E AL LF+E++ S F P+L+
Sbjct  131   LGKQEEAFRVLYKDLQLAGLNPGPDTYNVILDALCKCGYIENALELFKEMQ-SKFKPELM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S R   A+ +L EL   GY PNA+TYTTI+K  F++RR   GLQ+  EM
Sbjct  190   TYNILINGLCKSRRVGTAKWMLTELKKSGYTPNAVTYTTILKLYFKTRRIRRGLQLFLEM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R+GY +D +AY  VIS LIK GR K+AY+ +  ++  G   D+V+YNTL+NLY K G L
Sbjct  250   KREGYTYDGYAYFAVISALIKTGRTKEAYEYMQELVRKGRRHDIVSYNTLLNLYFKVGNL  309

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D    L+ E ERKG   D+YTHTII++GL + G  + A  H      MG   NLV  NC 
Sbjct  310   DAVDDLLGEIERKGMKVDEYTHTIIVNGLLRTGQTRRAESHFVSMGEMGIGLNLVTCNCL  369

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             +DGLCK G VD A+  F+SM  KD +TY+S+VH LCK  RF  AS+LLLSC   G+KI  
Sbjct  370   VDGLCKAGHVDRAMRYFESMQVKDEYTYTSVVHNLCKDMRFVCASKLLLSCYNKGIKIPT  429

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             S R+AV+ GL+ SG   EARK  +E+KL+ + N
Sbjct  430   SARRAVLSGLRMSGCYGEARKAKAEMKLTLVGN  462



>sp|P0C043.1|PP318_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein 
At4g17915 [Arabidopsis thaliana]
Length=463

 Score =   470 bits (1209),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 241/453 (53%), Positives = 314/453 (69%), Gaps = 2/453 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI V  LCK ++LEKAE++IIDGIR+GV  DVVTYNTLI+ YC FVGI+  Y++
Sbjct  11    LSTRLLNICVDSLCKFRKLEKAESLIIDGIRLGVDPDVVTYNTLISGYCRFVGIEEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM + GI+PDV TYNSLIA A R  ML   L L +EMLE GI PD WSYNTLM C F+
Sbjct  71    TRRMRDAGIRPDVATYNSLIAGAARRLMLDHVLYLFDEMLEWGIYPDLWSYNTLMCCYFK  130

Query  1919  LGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK +EA+R  ++D+    + P P T+N+LL  LC  GY + AL LF+E++ S F P+L+
Sbjct  131   LGKHEEAFRVLYKDLQLAGLNPGPDTYNVLLDALCKCGYIDNALELFKEMQ-SRFKPELM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S R   A+ +L EL   GY PNA+TYTTI+K  F++RR   GLQ+  EM
Sbjct  190   TYNILINGLCKSRRVGTAKWMLTELKKSGYTPNAVTYTTILKLYFKTRRIRRGLQLFLEM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R+GY +D +AY  V+S LIK GR K+AY+ +  ++  G   D+V+YNTL+NLY K+G L
Sbjct  250   KREGYTYDGYAYFAVVSALIKTGRTKEAYEYMQELVRKGRRHDIVSYNTLLNLYFKDGNL  309

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D    L+ E ER+G   D+YTHTII++GL + G  + A  H      MG   NLV  NC 
Sbjct  310   DAVDDLLGEIERRGMKADEYTHTIIVNGLLRTGQTRRAEEHFVSMGEMGIGLNLVTCNCL  369

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             +DGLCK G VD A+  F+SM+ KD +TY+S+VH LCK  RF  AS+LLLSC   G+KI  
Sbjct  370   VDGLCKAGHVDRAMRYFESMEVKDEYTYTSVVHNLCKDMRFVCASKLLLSCYNKGIKIPT  429

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             S R+AV+ GL+ SG   EARK  +E+KL+ + N
Sbjct  430   SARRAVLSGLRMSGCYGEARKAKAEMKLTLVGN  462



>emb|CDY01501.1| BnaC07g34910D [Brassica napus]
Length=463

 Score =   469 bits (1207),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 236/451 (52%), Positives = 314/451 (70%), Gaps = 2/451 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI V  LCK +++EKAET+I DGIR+GV  DVVTYNTLIT YC FVGI+  Y++
Sbjct  11    LSTRLLNICVHSLCKFRKIEKAETLITDGIRLGVSPDVVTYNTLITGYCRFVGIEEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM + GI+PDV TYNSLIA A R  ML R L L +EMLE G+ PD WSYNTLM C F+
Sbjct  71    TRRMRDAGIRPDVATYNSLIAGAARRLMLDRVLYLFDEMLEWGLYPDLWSYNTLMCCYFK  130

Query  1919  LGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK DEA+R  ++D+    + P P T+N+LL  LC  GY + AL +FRE++ S F P L+
Sbjct  131   LGKQDEAFRVLYKDLRLAGLSPGPDTYNVLLDALCKCGYVDDALEMFREMQ-SRFKPGLM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC + R   A+ +L EL   GY PNA+TYTTI+K  F++RR   GL++  EM
Sbjct  190   TYNILINGLCKARRVGTAKWMLTELKRSGYTPNAVTYTTILKLYFKTRRIRRGLELFLEM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R+GY +D +AY  V+S L+K G+ K+A++ +  ++ NG   D+V+YNTL+NLY +EG L
Sbjct  250   KREGYTYDGYAYFAVVSALVKTGKTKEAFEYMQELVRNGRRHDIVSYNTLLNLYFREGDL  309

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D    L+ E ERKG   D+YTHTII++GL + G  + A +H      MG   NLV  NC 
Sbjct  310   DAVDDLLGEIERKGMKADEYTHTIIVNGLLRTGQTRRAEKHFVSMGEMGIGLNLVTCNCL  369

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             +DGLCK G VD AL +F+SM+ KD +TY+ +VH LCK  RF  AS+LLLSC   G+KI  
Sbjct  370   VDGLCKAGHVDRALRLFESMEVKDEYTYTCVVHNLCKETRFVCASKLLLSCYSKGIKIPS  429

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
             S R+AV+ GL+ SG   EAR   +++KL+++
Sbjct  430   SARRAVLSGLRMSGCYGEARMAKAKMKLAQV  460



>emb|CDX90436.1| BnaA03g43450D [Brassica napus]
Length=463

 Score =   468 bits (1205),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 239/453 (53%), Positives = 313/453 (69%), Gaps = 2/453 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI V  LCK +++EKAET+I DGIR+GV  DVVTYNTLIT YC FVGI+  Y++
Sbjct  11    LSTRLLNICVHSLCKFRKIEKAETLITDGIRLGVSPDVVTYNTLITGYCRFVGIEEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM + GI+PDV TYNSLIA A R  ML R L L +EMLE G+ PD WSYNTLM C F+
Sbjct  71    TRRMRDAGIRPDVATYNSLIAGAARRLMLDRVLYLFDEMLEWGLYPDLWSYNTLMCCYFK  130

Query  1919  LGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK DEA+R  ++D+    + P P T+N+LL  LC  GY + AL +FRE++ S F P L+
Sbjct  131   LGKQDEAFRVLYKDLRLAGLSPGPDTYNVLLDALCKCGYVDDALEMFREMQ-SRFKPGLM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC + R   A+ +L EL   GY PNA+TYTTI+K  F++RR   GLQ+  EM
Sbjct  190   TYNILINGLCKARRVGTAKWMLTELKRSGYTPNAVTYTTILKLYFKTRRIRRGLQLFLEM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R+GY +D +AY  V+S LIK GR K+A++ +  ++ NG   D+V+YNTL+NLY ++G L
Sbjct  250   KREGYTYDGYAYFAVVSALIKTGRTKEAFEYMQELVRNGRRHDIVSYNTLLNLYFRDGDL  309

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D    L+ E ERKG   D+YTHTII++GL + G  + A  H      MG   NLV  NC 
Sbjct  310   DAVDDLLGEIERKGMKADEYTHTIIVNGLLRTGQTRRAENHFVSMGDMGIGLNLVTCNCL  369

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             +DGLCK G VD AL +F+SM+ KD +TY+ +VH LCK  RF  AS+LLLSC   G+KI  
Sbjct  370   VDGLCKAGHVDRALRLFESMEVKDEYTYTCVVHNLCKETRFVCASKLLLSCYSKGIKIPS  429

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             S R+AV+ GL+ SG   EAR   +++KL ++ N
Sbjct  430   SARRAVLSGLRMSGCYGEARIAKAKMKLPQVGN  462



>ref|XP_004978834.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X1 [Setaria italica]
 ref|XP_004978835.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X2 [Setaria italica]
 ref|XP_004978836.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like isoform X3 [Setaria italica]
Length=462

 Score =   466 bits (1200),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 222/451 (49%), Positives = 308/451 (68%), Gaps = 0/451 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+L+N+T+A LC+   L++AE+V++D IR+G+P DVVTYNTL+ AYC   G+DA  ++
Sbjct  10    LSTRLMNVTLAALCRGGCLDRAESVLVDAIRLGLPPDVVTYNTLLAAYCRAAGLDAALAV  69

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             +HRM E G+ PD +TYNSLI+ A R G+  R LDL +EM+  G+ PD+WSYN LMHCLFR
Sbjct  70    VHRMREAGVSPDAVTYNSLISGAARRGLTMRALDLFDEMIRSGVAPDSWSYNALMHCLFR  129

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
              G P++AYR F D+    + P   T+N +L GL   G+   A  +FR L+  G    +VT
Sbjct  130   SGHPEDAYRVFADMAEKGVTPSATTYNTMLDGLFRTGHATNAYRMFRYLQRVGLPIGIVT  189

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YN +I+GLC SG+   AR +L EL    + PNA+TYTT+MKCCFR  RF++GL+    + 
Sbjct  190   YNTMINGLCKSGKVGYARMVLKELGSTEHAPNAVTYTTVMKCCFRYGRFDQGLETFLSLL  249

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
               GYI D+F Y TVIS L+K GRM++A      MI +G  +D V YNTLI+L C+EGKLD
Sbjct  250   EGGYISDAFPYTTVISALVKKGRMQEANTYCELMIQSGSTIDNVCYNTLIHLRCQEGKLD  309

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
             +A+ L+   E  G + D+YT +I+++GLCK G + EA + +   ++MG  SN+VA+NC I
Sbjct  310   DAFELLNMMEEGGLESDEYTFSILVNGLCKMGQIGEAEKQIWSMEMMGMQSNVVAYNCLI  369

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             D LCK  EVD A+ V  SM  KD FTY+SLVHGLCK GR+ +AS+ L  C+  G  +L S
Sbjct  370   DALCKSHEVDAAIKVLHSMKLKDDFTYTSLVHGLCKVGRYHMASKFLRICLHEGNNVLAS  429

Query  1019  DRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              ++AVI GL+ +GF  + RK+ S L +S++L
Sbjct  430   AKRAVISGLRSAGFKNDLRKVRSALYMSRLL  460



>ref|XP_009136884.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Brassica rapa]
Length=463

 Score =   466 bits (1199),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 237/453 (52%), Positives = 314/453 (69%), Gaps = 2/453 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI V  LCK +++EKAET+I DGI++GV  DVVTYNTLIT YC FVGI+  Y++
Sbjct  11    LSTRLLNICVHSLCKFRKIEKAETLITDGIKLGVSPDVVTYNTLITGYCRFVGIEEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM + GI+PDV T NSLIA A R  ML R L L +EMLE G+ PD WSYNTLM C F+
Sbjct  71    TRRMRDAGIRPDVATCNSLIAGAARRLMLDRVLYLFDEMLEWGLYPDLWSYNTLMCCYFK  130

Query  1919  LGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK DEA+R  ++D+    + P P T+N+LL  LC  GY + AL +FRE++ S F P L+
Sbjct  131   LGKQDEAFRVLYKDLRLAGLSPGPDTYNVLLDALCKCGYVDDALEMFREMQ-SRFKPGLM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC + R   A+ +L EL   GY PNA+TYTTI+K  F++RR   GLQ+  EM
Sbjct  190   TYNILINGLCKARRVGTAKWMLTELKRSGYTPNAVTYTTILKLYFKTRRIRRGLQLFLEM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R+GY +D +AY  V+S LIK GR K+A++ +  ++ NG   D+V+YNTL+NLY ++G L
Sbjct  250   KREGYTYDGYAYFAVVSALIKTGRTKEAFEYIQELVRNGRRHDIVSYNTLLNLYFRDGDL  309

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D    L+ E ERKG   D+YTHTII++GL + G  + A +H      MG   NLV  NC 
Sbjct  310   DAVDDLLGEIERKGLKADEYTHTIIVNGLLRTGQTRRAEKHFVSMGEMGIGLNLVTCNCL  369

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             +DGLCK G VD AL +F+SM+ KD +TY+ +VH LCK  RF  AS+LLLSC   G+KI  
Sbjct  370   VDGLCKAGHVDRALRLFESMEVKDEYTYTCVVHNLCKETRFVCASKLLLSCYSKGIKIPS  429

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             S R+AV+ GL+ SG   EAR   +++KL+++ N
Sbjct  430   SARRAVLSGLRMSGCYGEARIAKAKMKLTQVGN  462



>gb|KDP45894.1| hypothetical protein JCGZ_15454 [Jatropha curcas]
Length=386

 Score =   461 bits (1187),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 214/384 (56%), Positives = 288/384 (75%), Gaps = 3/384 (1%)
 Frame = -1

Query  2090  MNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGK  1911
             M + GI PDV+TYNSLIA A R+ + S+  +L +EMLE+GI+PD W++NTL+HC F+LG 
Sbjct  1     MTQAGINPDVVTYNSLIAGAARNCLFSKSSELFDEMLELGIVPDIWTFNTLIHCFFKLGN  60

Query  1910  PDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNI  1731
             P+EA RFF+ IF+  + PCP TFNI+++GLCMNGYT+ AL   R+L+ +GF+P LVTYNI
Sbjct  61    PEEATRFFEGIFYHGLLPCPTTFNIMINGLCMNGYTDNALRWLRDLQRNGFVPGLVTYNI  120

Query  1730  LIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKG  1551
             L+   C +GR   ARR+L EL   GY PNA+TYTT++K C RSR FE+ L+IL+EM  KG
Sbjct  121   LLSWFCKAGRLGTARRILKELAASGYAPNAVTYTTVLKFCLRSRNFEQALEILQEMSDKG  180

Query  1550  YIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAY  1371
             Y +D FAYCTV+  L+K GR+K+A   +  M+ +G+E DLV+YNTL+NLYCKEG ++  Y
Sbjct  181   YTYDGFAYCTVVGALVKIGRIKEATYYMEKMVRSGVEHDLVSYNTLLNLYCKEGNVEAVY  240

Query  1370  MLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGL  1191
              L+ E ++ G +CD+YTHTI+ID +CK GN++ A +H+   K MG  S+LVA N  IDGL
Sbjct  241   QLLGEIQKGGLECDEYTHTILIDNMCKTGNIQGAQQHM---KEMGLHSHLVALNSVIDGL  297

Query  1190  CKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQ  1011
              K GE+D+AL  F+SM+  D FTYSSL+H LCKA RF  AS+LL SC+  GMK+L S ++
Sbjct  298   GKAGEIDHALKKFESMEAADSFTYSSLIHNLCKARRFLCASKLLFSCLKSGMKMLPSVKR  357

Query  1010  AVIDGLQHSGFIQEARKLHSELKL  939
             AVIDGL +SGF +EAR L S+++L
Sbjct  358   AVIDGLHYSGFHKEARNLRSKIRL  381


 Score = 93.2 bits (230),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 64/258 (25%), Positives = 118/258 (46%), Gaps = 7/258 (3%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              NI +  LC     + A   + D  R G    +VTYN L++ +C    +     IL  + 
Sbjct  83    FNIMINGLCMNGYTDNALRWLRDLQRNGFVPGLVTYNILLSWFCKAGRLGTARRILKELA  142

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
               G  P+ +TY +++    R     + L++L+EM + G   D ++Y T++  L ++G+  
Sbjct  143   ASGYAPNAVTYTTVLKFCLRSRNFEQALEILQEMSDKGYTYDGFAYCTVVGALVKIGRIK  202

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             EA  + + +    +    V++N LL+  C  G  E    L  E++  G      T+ ILI
Sbjct  203   EATYYMEKMVRSGVEHDLVSYNTLLNLYCKEGNVEAVYQLLGEIQKGGLECDEYTHTILI  262

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
               +C +G    A++ + E+   G + + +   +++    ++   +  L+  E M      
Sbjct  263   DNMCKTGNIQGAQQHMKEM---GLHSHLVALNSVIDGLGKAGEIDHALKKFESMEAA---  316

Query  1544  FDSFAYCTVISFLIKAGR  1491
              DSF Y ++I  L KA R
Sbjct  317   -DSFTYSSLIHNLCKARR  333



>ref|XP_002450407.1| hypothetical protein SORBIDRAFT_05g004830 [Sorghum bicolor]
 gb|EES09395.1| hypothetical protein SORBIDRAFT_05g004830 [Sorghum bicolor]
Length=462

 Score =   463 bits (1192),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 221/456 (48%), Positives = 309/456 (68%), Gaps = 0/456 (0%)
 Frame = -1

Query  2294  RIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGID  2115
             R +  LST+L+N+ +A LC+   L++AE+V++D IR+G+P DVVTYNTL+ A+C   G+D
Sbjct  5     RAQLALSTRLMNVGLAALCRGGWLDRAESVVVDAIRLGLPPDVVTYNTLLAAHCRVAGLD  64

Query  2114  AGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLM  1935
             AG +++HRM E G++PD +TYNSLI  A R G+  R LDL +EML  G+ PD+WSYN LM
Sbjct  65    AGIAVVHRMREAGVRPDAVTYNSLITGADRSGLTVRALDLFDEMLRSGVAPDSWSYNALM  124

Query  1934  HCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFI  1755
             HCLFR G P+ AYR F D+    + PC  T+N LL GL   G+   A  +FR L+ +G  
Sbjct  125   HCLFRSGHPEHAYRVFADMADKGVAPCATTYNTLLDGLFKAGHATNAYRMFRYLQRAGLP  184

Query  1754  PQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQI  1575
               +VTYN +I+GLC SG+   AR +L EL    + PNA+TYTT+MKCCFR  RFE+GL+ 
Sbjct  185   VGIVTYNTMINGLCKSGKVGYARMVLKELGRTEHAPNAVTYTTVMKCCFRYGRFEQGLET  244

Query  1574  LEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCK  1395
                +   GYI D+F Y TVIS L+K GRM++A      MI +G  LD   YNTLI+L C+
Sbjct  245   FLSLLEGGYISDAFPYTTVISALVKKGRMQEANTYCELMIQSGSTLDNACYNTLIHLRCQ  304

Query  1394  EGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVA  1215
             EGK+D+A+ L+   E  G + D+YT +I+++GLCK G ++ A + +   ++M   SN+VA
Sbjct  305   EGKIDDAFELLNMMEEGGLESDEYTFSILVNGLCKMGQIEAAEKQIWSMEMMDMQSNVVA  364

Query  1214  FNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGM  1035
             +NC ID LCK  EVD A+ +  SM  KD FTY+SLVHGLCK GR+ +AS+ L  C+  G 
Sbjct  365   YNCLIDALCKCHEVDAAIKILHSMRLKDDFTYTSLVHGLCKVGRYHMASKFLRICLHEGN  424

Query  1034  KILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              +L S ++AVI GL+ +GF  + RK+ S L ++++L
Sbjct  425   NVLASAKRAVISGLRSAGFKNDLRKVRSALYMARLL  460



>gb|KFK28477.1| hypothetical protein AALP_AA7G001300 [Arabis alpina]
Length=458

 Score =   463 bits (1191),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 237/453 (52%), Positives = 313/453 (69%), Gaps = 4/453 (1%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI V  LCK ++LEKAE++IIDGI++GV  DV+TYNTLI  YCCFVGI   Y +
Sbjct  8     LSTRLLNICVDSLCKFRKLEKAESLIIDGIKLGVSPDVITYNTLINGYCCFVGIKQAYDV  67

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM E GI+PD++TYNSLI  A R  ML R L L +EMLE GI PD WSYNTLM C F+
Sbjct  68    TLRMREAGIRPDIVTYNSLITGAARRLMLDRVLYLFDEMLEWGIYPDLWSYNTLMCCYFK  127

Query  1919  LGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK +EA+R  ++D+    + P   T+N+LL  LC  GY + AL LF+E+  S F P+L+
Sbjct  128   LGKQEEAFRVLYKDLELAGLCPGLDTYNVLLDALCKCGYIDNALELFKEM-QSKFKPELM  186

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S R   A+ +L EL   GY PNA+TYTTI+K  F++RR   GLQ+  EM
Sbjct  187   TYNILINGLCKSRRVGTAKWMLTELKKSGYTPNAVTYTTILKLYFKTRRIRRGLQLFLEM  246

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R+GY +D +AY  V+S LIK GR K+AY+ +  ++  G   D+V+YNTL+NLY ++G L
Sbjct  247   KREGYTYDGYAYFAVVSALIKTGRTKEAYEYMQELVRKGRRHDIVSYNTLLNLYFRDGNL  306

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D    L+ E ERKG   D+YTHTII++GL K G  + A RH      MG   NLV  NC 
Sbjct  307   DAVDELLGEIERKGMKADEYTHTIIVNGLLKTGQTRRAERHFVSMGEMGM--NLVTCNCL  364

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             +DGLCK G VD A+ +F+SM+ KD +TY+S+VH LCK  RF  AS+LLLSC   G+K+  
Sbjct  365   VDGLCKAGYVDRAMRLFESMEVKDEYTYTSVVHNLCKDMRFVCASKLLLSCYNKGIKVPT  424

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             S R+AV+ GL+ SG   EA+   +++KL+++ N
Sbjct  425   SARRAVLSGLRMSGCYGEAKIAKAKMKLTQVGN  457



>ref|XP_006414172.1| hypothetical protein EUTSA_v10025145mg [Eutrema salsugineum]
 gb|ESQ55625.1| hypothetical protein EUTSA_v10025145mg [Eutrema salsugineum]
Length=461

 Score =   463 bits (1192),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 235/452 (52%), Positives = 316/452 (70%), Gaps = 3/452 (1%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI V  LCK ++LEKAE++I DGIR+GV  DVVTYNTLI+ YC FVGI+  Y++
Sbjct  11    LSTRLLNICVDSLCKFRKLEKAESLITDGIRLGVAPDVVTYNTLISGYCRFVGIEEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM + GI+PDV TYNSLIA A R  ML R L L +EMLE GI PD WSYNTLM C F+
Sbjct  71    TRRMRDAGIRPDVATYNSLIAGAARRLMLDRVLYLFDEMLEWGIYPDLWSYNTLMCCYFK  130

Query  1919  LGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK +EA+R  ++D+    + P P T+N+LL  LC  GY + AL LF+E++ S F P+L+
Sbjct  131   LGKQEEAFRVLYKDLHLAGLNPGPDTYNVLLDALCKCGYIDNALELFKEMQ-SKFKPELM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             T+NILI+GLC S R   A+ +L EL   GY PNA+TYTTI+K  F++RR   GLQ+  EM
Sbjct  190   TFNILINGLCKSRRVGTAKWMLTELKKSGYTPNAVTYTTILKLYFKTRRIRRGLQLFLEM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R+GY +D +AY  VIS LIK GR ++AY+ +  ++  G   D+V+YNTL+NLY ++G L
Sbjct  250   KREGYTYDGYAYFAVISALIKTGRTREAYEYMEELVRKGRRHDIVSYNTLLNLYFRDGNL  309

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRH-LNCTKLMGFDSNLVAFNC  1206
                  L+ E ER+G   D+YTHTII++GL + G  +EA R  ++  + MG   NLV  NC
Sbjct  310   KAVDDLLKEIERRGLKADEYTHTIIVNGLLRTGQSREAERRFVSMGREMGIGLNLVTCNC  369

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              +DGLCK G VD A+ +F SM+ KD +TY+S+VH LCK  RF  AS+LLLSC   G+KI 
Sbjct  370   LVDGLCKAGHVDRAMRLFDSMEVKDEYTYTSVVHSLCKDMRFVCASKLLLSCYSKGIKIP  429

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
              S R+AV+ GL+ SG   EA+   +++KL+++
Sbjct  430   ASARRAVLSGLRMSGCYGEAKMAKAKMKLTQV  461



>ref|NP_001170632.1| uncharacterized protein LOC100384682 [Zea mays]
 ref|XP_008677701.1| PREDICTED: uncharacterized protein LOC100384682 isoform X1 [Zea 
mays]
 gb|ACR34279.1| unknown [Zea mays]
 gb|AFW65395.1| hypothetical protein ZEAMMB73_565010 [Zea mays]
Length=462

 Score =   463 bits (1191),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 222/459 (48%), Positives = 312/459 (68%), Gaps = 4/459 (1%)
 Frame = -1

Query  2291  IKSR----LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFV  2124
             ++SR    LST+L+N+ +A LC+   L++AE+V++D IR+G+P DVVTYNTL+ AYC   
Sbjct  2     VRSRGHLALSTRLMNVGLASLCRGGWLDRAESVLVDAIRLGLPPDVVTYNTLLAAYCRVD  61

Query  2123  GIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYN  1944
             G+DAG +++HRM E G++PD +TYNSLI  A R G+  R LDL +EML  G+ PD+WSYN
Sbjct  62    GLDAGLAVVHRMREAGVRPDAVTYNSLITGADRSGLTVRALDLFDEMLRSGVAPDSWSYN  121

Query  1943  TLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHS  1764
              LMHCLFR G P+ AYR F D+    + PC  T+N LL GL   G+   A  +FR L+ +
Sbjct  122   ALMHCLFRSGHPEHAYRVFADMADRGVAPCATTYNTLLDGLLKAGHVTNAFRMFRYLQRA  181

Query  1763  GFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEG  1584
             G    +VTYN +I+GLC SG+   AR +L EL    + PNA+TYTT+MKCCFR  RFE+G
Sbjct  182   GLPVGIVTYNTMINGLCKSGKVGYARMVLKELGRTEHAPNAVTYTTVMKCCFRYGRFEQG  241

Query  1583  LQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINL  1404
             L+    +   GYI D+F Y TVIS L+K GRM++A      MI +G  LD   YNTLI+L
Sbjct  242   LETFLSLLEGGYISDAFPYTTVISALVKKGRMQEANTYCELMIQSGSTLDNACYNTLIHL  301

Query  1403  YCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSN  1224
              C+EGK+++A+ L+   E  G + D+YT +I+++GLCK G ++ A + +   ++MG  SN
Sbjct  302   RCQEGKINDAFELLNMMEEGGLESDEYTFSILVNGLCKMGQIEAAEKQIWSMEMMGMQSN  361

Query  1223  LVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCII  1044
             +VA+NC ID LCK  EVD A+ +  SM  KD F+Y+SLVHGLCK GR+ +AS+ L  C+ 
Sbjct  362   VVAYNCLIDALCKCHEVDAAIKILHSMKLKDDFSYTSLVHGLCKVGRYHMASKFLRICLH  421

Query  1043  GGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              G  +L S ++AVI GL+ +GF  + RK+ S L ++++L
Sbjct  422   EGNNVLASAKRAVISGLRSAGFKNDLRKVRSALYMARLL  460



>dbj|BAK08037.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   462 bits (1188),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 219/455 (48%), Positives = 310/455 (68%), Gaps = 0/455 (0%)
 Frame = -1

Query  2288  KSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAG  2109
             +++LST+L+N+ +A LC+   + +AE+V++D IR+G+P DVVTYNTL+ A+C   G+DAG
Sbjct  5     RTQLSTRLMNVCLAALCRGGGIARAESVLVDAIRLGMPPDVVTYNTLLAAHCRASGLDAG  64

Query  2108  YSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHC  1929
             +++LHRM E G+ PD ITYNSLIA A R G+  R LDL +EML+ G+ PD WSYN LMHC
Sbjct  65    FAVLHRMREAGVSPDAITYNSLIAGAARRGLTMRALDLFDEMLQAGVAPDAWSYNALMHC  124

Query  1928  LFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQ  1749
             LFR G P++AYR F D+    + PC  T+N LL GL   G+   A  +FR L+ +G    
Sbjct  125   LFRSGHPEDAYRVFADMAEKGVAPCATTYNTLLDGLFRFGHATNAYRMFRYLQRTGLPVG  184

Query  1748  LVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILE  1569
             +VTYN +I+GLC SG+   AR +L EL    + PN +TYTT+MKCCF+  RF++GL+   
Sbjct  185   IVTYNTMINGLCKSGKVGYARMVLRELGRTEHAPNVVTYTTVMKCCFKYGRFDQGLETFL  244

Query  1568  EMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEG  1389
              +   GYI D F YCTVIS L+K GRM++A      MI +G  LD   YNTLI L CKEG
Sbjct  245   SLLEGGYIPDLFPYCTVISALVKKGRMEEANTYSELMIRSGFRLDSACYNTLIYLRCKEG  304

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
             KLD+A+ L+   E  G + D+YT +I+++GLCK G+ + A + L   ++   +SN++A+N
Sbjct  305   KLDDAFELLSMMEEGGLESDEYTFSILVNGLCKMGHFEAAHKQLCYMEIRDMESNVIAYN  364

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             C +D LCK  EVD A+ +  +M  KD FTY+SLVHGLCK GR+ +AS+ L  C+  G  I
Sbjct  365   CLVDALCKSDEVDAAIKLLHNMKLKDDFTYTSLVHGLCKVGRYHMASKFLRICLREGNSI  424

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             L S ++AVI GL+ +GF  + RK+ + L+++++L 
Sbjct  425   LASAKRAVIAGLRSAGFQNDVRKVRAALRMARLLK  459



>ref|XP_006833205.1| hypothetical protein AMTR_s00072p00167120 [Amborella trichopoda]
 gb|ERM98483.1| hypothetical protein AMTR_s00072p00167120 [Amborella trichopoda]
Length=452

 Score =   457 bits (1176),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 229/454 (50%), Positives = 313/454 (69%), Gaps = 5/454 (1%)
 Frame = -1

Query  2285  SRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGY  2106
             S LST+LLNI ++  CKA+ LEKAE +I+DGIR+G   D+VTYNTLI AYC F+G+DA Y
Sbjct  3     SGLSTRLLNICISSFCKARNLEKAEALIMDGIRLGYLPDIVTYNTLIAAYCRFLGVDAAY  62

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
             S+L +M E GI PDVITYN+LI  AT+  ++SR LDL  EMLE  I+PD WSYN+++HC 
Sbjct  63    SVLDKMKEAGIHPDVITYNTLITCATKKKLISRTLDLFHEMLESEIVPDAWSYNSMIHCY  122

Query  1925  FRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             F+ G+ D+AY+  Q++F  +I P   T+N +++GLC  G    AL LFR+L      P+L
Sbjct  123   FKAGRSDDAYQIIQEMFSRNIAPTLATYNTIINGLCKAGDIGDALRLFRKLDVLCCPPEL  182

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             +TYNILI GLC  G+   ARR+L EL  +GY PNAITYTT++  CFRS +   G+++  E
Sbjct  183   ITYNILIDGLCKCGKVPEARRVLKELGILGYTPNAITYTTVITGCFRSGQANLGVELFSE  242

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGK  1386
             M+ KGY  D+FAYCT+IS   K G  ++AY     M+  G  +D+V+YNT++N YCK G 
Sbjct  243   MKHKGYNIDAFAYCTMISAFSKLGMTEEAYAYTDQMLGCGAPIDIVSYNTMMNSYCKAGD  302

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
             L +A+ L+ E E  G   D+YTHTI+IDGLCK G++  A RH    +  G  S++VA NC
Sbjct  303   LVSAFRLLNEIEDGGQKSDEYTHTILIDGLCKIGDVDAARRHFRYMETRGLGSSIVARNC  362

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              I GL K G+VD A+ +F  M  KD +TY+S++HGLCKA RF VA  LL +C+  G+K+L
Sbjct  363   LIHGLFKAGQVDLAIKLFSEMKVKDSYTYTSVLHGLCKAKRFNVAVRLLSACLKDGVKVL  422

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             +S R+AV+     +GF +E+RKL S + L+K L+
Sbjct  423   RSARRAVL-----AGFRKESRKLKSTICLAKGLH  451



>ref|XP_003578548.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Brachypodium distachyon]
 ref|XP_010238438.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Brachypodium distachyon]
Length=460

 Score =   456 bits (1174),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 218/458 (48%), Positives = 312/458 (68%), Gaps = 0/458 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M R +++LST+L+N+ +A LC++  LE+AE+V+ID I +G+P DVVTYNTL+ A+C   G
Sbjct  1     MARARAQLSTRLMNVCLAALCRSGSLERAESVLIDAILLGMPPDVVTYNTLLAAHCRAAG  60

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +DAG+++L RM E G+ P+ +TYNSLI +A+R G+  R LDL +EML  GI PD WSYN 
Sbjct  61    LDAGFAVLRRMREAGVWPNAVTYNSLIVAASRVGLTMRALDLFDEMLRAGIAPDAWSYNV  120

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LMHCLFR G P++AYR F D+    + PC  T+N LL GL   G+   A  +FR L+  G
Sbjct  121   LMHCLFRSGHPEDAYRVFADMAEKGVTPCTTTYNTLLDGLFKAGHATNAYRMFRYLQRVG  180

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
                 +VTYN +I+GLC SG+   AR +L EL    + PNA+TYTT+MKCCFR  RF++GL
Sbjct  181   LPVGIVTYNTMINGLCRSGKVGYARMILRELGRTEHTPNAVTYTTVMKCCFRYGRFDQGL  240

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             +    +   G+I D F YCTVIS L+K GR+++A      MI +G  LD   YNTLI+L 
Sbjct  241   ETFLSLLEGGHIPDVFPYCTVISALVKKGRVEEANAYSELMIQSGSRLDTACYNTLIHLR  300

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             C+EGKLD+A+ L+   E  G + D+YT +I+++GLCK G+++ A + L   ++   +SN+
Sbjct  301   CQEGKLDDAFELLSMMEEGGLESDEYTFSILVNGLCKLGHIEAAEKQLCYMEMRDMESNV  360

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA+NC +D LCK  +VD A+ +   M  KD FTY+SLVHGLC+ GR+ +AS+ L  C+  
Sbjct  361   VAYNCLVDALCKSDQVDAAIRLLHDMKLKDDFTYTSLVHGLCRVGRYHMASKFLRICLRE  420

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             G  +L S ++AVI GL+ +GF  + RK+ S L ++++L
Sbjct  421   GNNVLASAKRAVIAGLRSAGFKNDVRKVRSALYMARLL  458



>gb|AAM67288.1| unknown [Arabidopsis thaliana]
Length=463

 Score =   452 bits (1163),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 229/448 (51%), Positives = 308/448 (69%), Gaps = 3/448 (1%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             +STKLLNI+V  LCK + LE+AET++IDGIR+GV  DV+TYNTLI  Y  F+GID  Y++
Sbjct  6     ISTKLLNISVNSLCKFRNLERAETLLIDGIRLGVLPDVITYNTLIKGYTRFIGIDEAYAV  65

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM E GI+PDV TYNSLI+ A ++ ML+R L L +EML  G+ PD WSYNTLM C F+
Sbjct  66    TRRMREAGIEPDVTTYNSLISGAAKNLMLNRVLQLFDEMLHSGLSPDMWSYNTLMSCYFK  125

Query  1919  LGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LG+  EA++   +DI    + P   T+NILL  LC +G+T+ A+ LF+ LK S   P+L+
Sbjct  126   LGRHGEAFKILHEDIHLAGLVPGIDTYNILLDALCKSGHTDNAIELFKHLK-SRVKPELM  184

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S R      ++ EL   GY PNA+TYTT++K  F+++R E+GLQ+  +M
Sbjct  185   TYNILINGLCKSRRVGSVDWMMRELKKSGYTPNAVTYTTMLKMYFKTKRIEKGLQLFLKM  244

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE-LDLVAYNTLINLYCKEGK  1386
             +++GY FD FA C V+S LIK GR ++AY+C+  ++ +G    D+V+YNTL+NLY K+G 
Sbjct  245   KKEGYTFDGFANCAVVSALIKTGRAEEAYECMHELVRSGTRSQDIVSYNTLLNLYFKDGN  304

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
             LD    L+ E E KG   D YTHTII++GL   GN   A +HL C   MG   ++V  NC
Sbjct  305   LDAVDDLLEEIEMKGLKPDDYTHTIIVNGLLNIGNTGGAEKHLACIGEMGMQPSVVTCNC  364

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              IDGLCK G VD A+ +F SM+ +D FTY+S+VH LCK GR   AS+LLLSC   GMKI 
Sbjct  365   LIDGLCKAGHVDRAMRLFASMEVRDEFTYTSVVHNLCKDGRLVCASKLLLSCYNKGMKIP  424

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELK  942
              S R+AV+ G++ +   Q ARK H ++K
Sbjct  425   SSARRAVLSGIRETVSYQAARKTHIKIK  452


 Score =   117 bits (292),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 92/366 (25%), Positives = 178/366 (49%), Gaps = 9/366 (2%)
 Frame = -1

Query  2015  LSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNI  1836
             L R   LL + + +G+LPD  +YNTL+    R    DEAY   + +    I P   T+N 
Sbjct  24    LERAETLLIDGIRLGVLPDVITYNTLIKGYTRFIGIDEAYAVTRRMREAGIEPDVTTYNS  83

Query  1835  LLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDI-  1659
             L+SG   N    + L LF E+ HSG  P + +YN L+      GR   A ++L+E + + 
Sbjct  84    LISGAAKNLMLNRVLQLFDEMLHSGLSPDMWSYNTLMSCYFKLGRHGEAFKILHEDIHLA  143

Query  1658  GYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDA  1479
             G  P   TY  ++    +S   +  +++ + ++ +    +   Y  +I+ L K+ R+   
Sbjct  144   GLVPGIDTYNILLDALCKSGHTDNAIELFKHLKSR-VKPELMTYNILINGLCKSRRVGSV  202

Query  1478  YDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDG  1299
                +  +  +G   + V Y T++ +Y K  +++    L ++ +++G+  D + +  ++  
Sbjct  203   DWMMRELKKSGYTPNAVTYTTMLKMYFKTKRIEKGLQLFLKMKKEGYTFDGFANCAVVSA  262

Query  1298  LCKAGNMKEALRHLNCTKLMGFDS-NLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----  1134
             L K G  +EA   ++     G  S ++V++N  ++   K G +D    + + ++ K    
Sbjct  263   LIKTGRAEEAYECMHELVRSGTRSQDIVSYNTLLNLYFKDGNLDAVDDLLEEIEMKGLKP  322

Query  1133  DCFTYSSLVHGLCKAGRFRVASELLLSCIIG-GMKILKSDRQAVIDGLQHSGFIQEARKL  957
             D +T++ +V+GL   G     +E  L+CI   GM+        +IDGL  +G +  A +L
Sbjct  323   DDYTHTIIVNGLLNIGNTG-GAEKHLACIGEMGMQPSVVTCNCLIDGLCKAGHVDRAMRL  381

Query  956   HSELKL  939
              + +++
Sbjct  382   FASMEV  387



>ref|NP_568665.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q56XR6.2|PP421_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g46680 
[Arabidopsis thaliana]
 gb|AED95413.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=468

 Score =   452 bits (1163),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 229/448 (51%), Positives = 308/448 (69%), Gaps = 3/448 (1%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             +STKLLNI+V  LCK + LE+AET++IDGIR+GV  DV+TYNTLI  Y  F+GID  Y++
Sbjct  11    ISTKLLNISVNSLCKFRNLERAETLLIDGIRLGVLPDVITYNTLIKGYTRFIGIDEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM E GI+PDV TYNSLI+ A ++ ML+R L L +EML  G+ PD WSYNTLM C F+
Sbjct  71    TRRMREAGIEPDVTTYNSLISGAAKNLMLNRVLQLFDEMLHSGLSPDMWSYNTLMSCYFK  130

Query  1919  LGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LG+  EA++   +DI    + P   T+NILL  LC +G+T+ A+ LF+ LK S   P+L+
Sbjct  131   LGRHGEAFKILHEDIHLAGLVPGIDTYNILLDALCKSGHTDNAIELFKHLK-SRVKPELM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S R      ++ EL   GY PNA+TYTT++K  F+++R E+GLQ+  +M
Sbjct  190   TYNILINGLCKSRRVGSVDWMMRELKKSGYTPNAVTYTTMLKMYFKTKRIEKGLQLFLKM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE-LDLVAYNTLINLYCKEGK  1386
             +++GY FD FA C V+S LIK GR ++AY+C+  ++ +G    D+V+YNTL+NLY K+G 
Sbjct  250   KKEGYTFDGFANCAVVSALIKTGRAEEAYECMHELVRSGTRSQDIVSYNTLLNLYFKDGN  309

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
             LD    L+ E E KG   D YTHTII++GL   GN   A +HL C   MG   ++V  NC
Sbjct  310   LDAVDDLLEEIEMKGLKPDDYTHTIIVNGLLNIGNTGGAEKHLACIGEMGMQPSVVTCNC  369

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              IDGLCK G VD A+ +F SM+ +D FTY+S+VH LCK GR   AS+LLLSC   GMKI 
Sbjct  370   LIDGLCKAGHVDRAMRLFASMEVRDEFTYTSVVHNLCKDGRLVCASKLLLSCYNKGMKIP  429

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELK  942
              S R+AV+ G++ +   Q ARK H ++K
Sbjct  430   SSARRAVLSGIRETVSYQAARKTHIKIK  457


 Score =   117 bits (292),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 92/366 (25%), Positives = 178/366 (49%), Gaps = 9/366 (2%)
 Frame = -1

Query  2015  LSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNI  1836
             L R   LL + + +G+LPD  +YNTL+    R    DEAY   + +    I P   T+N 
Sbjct  29    LERAETLLIDGIRLGVLPDVITYNTLIKGYTRFIGIDEAYAVTRRMREAGIEPDVTTYNS  88

Query  1835  LLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDI-  1659
             L+SG   N    + L LF E+ HSG  P + +YN L+      GR   A ++L+E + + 
Sbjct  89    LISGAAKNLMLNRVLQLFDEMLHSGLSPDMWSYNTLMSCYFKLGRHGEAFKILHEDIHLA  148

Query  1658  GYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDA  1479
             G  P   TY  ++    +S   +  +++ + ++ +    +   Y  +I+ L K+ R+   
Sbjct  149   GLVPGIDTYNILLDALCKSGHTDNAIELFKHLKSR-VKPELMTYNILINGLCKSRRVGSV  207

Query  1478  YDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDG  1299
                +  +  +G   + V Y T++ +Y K  +++    L ++ +++G+  D + +  ++  
Sbjct  208   DWMMRELKKSGYTPNAVTYTTMLKMYFKTKRIEKGLQLFLKMKKEGYTFDGFANCAVVSA  267

Query  1298  LCKAGNMKEALRHLNCTKLMGFDS-NLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----  1134
             L K G  +EA   ++     G  S ++V++N  ++   K G +D    + + ++ K    
Sbjct  268   LIKTGRAEEAYECMHELVRSGTRSQDIVSYNTLLNLYFKDGNLDAVDDLLEEIEMKGLKP  327

Query  1133  DCFTYSSLVHGLCKAGRFRVASELLLSCIIG-GMKILKSDRQAVIDGLQHSGFIQEARKL  957
             D +T++ +V+GL   G     +E  L+CI   GM+        +IDGL  +G +  A +L
Sbjct  328   DDYTHTIIVNGLLNIGNTG-GAEKHLACIGEMGMQPSVVTCNCLIDGLCKAGHVDRAMRL  386

Query  956   HSELKL  939
              + +++
Sbjct  387   FASMEV  392



>ref|XP_008467270.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Cucumis melo]
 ref|XP_008467271.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Cucumis melo]
 ref|XP_008467272.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Cucumis melo]
 ref|XP_008467273.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Cucumis melo]
 ref|XP_008467274.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Cucumis melo]
 ref|XP_008467275.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 [Cucumis melo]
Length=458

 Score =   451 bits (1159),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 218/451 (48%), Positives = 302/451 (67%), Gaps = 8/451 (2%)
 Frame = -1

Query  2285  SRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGY  2106
             S+ STKLL I VA  CK++Q +KAE  I D IR+GV  D++TYN L+  YC F  +DA Y
Sbjct  3     SKYSTKLLTICVASFCKSQQFQKAEIAIKDAIRLGVVPDILTYNILVNGYCQFSDMDAAY  62

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
             S+L++M E GI P+V  Y SL+A+A+R+  L +CL+L +EML++ I PD WSY TL+HC 
Sbjct  63    SVLYKMREAGITPNVFIYTSLMAAASRNSSLEQCLNLFDEMLQLRINPDIWSYTTLIHCF  122

Query  1925  FRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
              ++GKP+EA   F DI   D  P P TF++++ GLC  GYT  A+ LFR L+  GF+P+ 
Sbjct  123   LKVGKPNEANSIFLDIILKDHCPNPATFDVMIFGLCSCGYTSNAIALFRNLQSHGFVPKF  182

Query  1745  VTYNILIHGLCNSGR-------WAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEE  1587
             VTYNIL+ GLC + R       +  A  + +E +D+G+ P+  TY  +MKCCF+ R ++ 
Sbjct  183   VTYNILLTGLCKAARLNVSMSMFNEAMSMFDEAIDLGFEPDYTTYIALMKCCFKFREYQH  242

Query  1586  GLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
             G +I  EM+ KG  F+ F Y T I  L++ GR+++A   +  MI NG+  DLV YNT++N
Sbjct  243   GFEIFFEMKNKGLAFNGFGYYTAIGALLRLGRLEEANFFMVEMIKNGVVFDLVFYNTVVN  302

Query  1406  LYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF-D  1230
             LYCK GKL+ A+ ++ + E +G  CD YTH II DGLCK GN + A RHLN     GF +
Sbjct  303   LYCKHGKLEAAHKMLDKIESRGLQCDDYTHAIITDGLCKVGNFEGARRHLNYMYPTGFTN  362

Query  1229  SNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSC  1050
             SN+VA +C ID LCK G++D A+ +F+ M+ KD +TY+SL+H LCKA RF  AS+LLL C
Sbjct  363   SNVVASSCLIDRLCKAGQIDQAMKLFELMETKDPYTYTSLMHNLCKARRFLCASKLLLDC  422

Query  1049  IIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
             +  G+ + +S + AVI GL   GF  EARKL
Sbjct  423   LRSGISVFRSTQCAVIFGLCSLGFTSEARKL  453



>dbj|BAD95174.1| hypothetical protein [Arabidopsis thaliana]
Length=468

 Score =   451 bits (1159),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 228/448 (51%), Positives = 308/448 (69%), Gaps = 3/448 (1%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             +STKLLNI+V  LCK + LE+AET++IDGIR+GV  DV+TYNTLI  Y  F+GID  Y++
Sbjct  11    ISTKLLNISVNSLCKFRNLERAETLLIDGIRLGVLPDVITYNTLIKGYTRFIGIDEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM E GI+PDV TYNSLI+ A ++ +L+R L L +EML  G+ PD WSYNTLM C F+
Sbjct  71    TRRMREAGIEPDVTTYNSLISGAAKNLVLNRVLQLFDEMLHSGLSPDMWSYNTLMSCYFK  130

Query  1919  LGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LG+  EA++   +DI    + P   T+NILL  LC +G+T+ A+ LF+ LK S   P+L+
Sbjct  131   LGRHGEAFKILHEDIHLAGLVPGIDTYNILLDALCKSGHTDNAIELFKHLK-SRVKPELM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S R      ++ EL   GY PNA+TYTT++K  F+++R E+GLQ+  +M
Sbjct  190   TYNILINGLCKSRRVGSVDWMMRELKKSGYTPNAVTYTTMLKMYFKTKRIEKGLQLFLKM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE-LDLVAYNTLINLYCKEGK  1386
             +++GY FD FA C V+S LIK GR ++AY+C+  ++ +G    D+V+YNTL+NLY K+G 
Sbjct  250   KKEGYTFDGFANCAVVSALIKTGRAEEAYECMHELVRSGTRSQDIVSYNTLLNLYFKDGN  309

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
             LD    L+ E E KG   D YTHTII++GL   GN   A +HL C   MG   ++V  NC
Sbjct  310   LDAVDDLLEEIEMKGLKPDDYTHTIIVNGLLNIGNTGGAEKHLACIGEMGMQPSVVTCNC  369

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              IDGLCK G VD A+ +F SM+ +D FTY+S+VH LCK GR   AS+LLLSC   GMKI 
Sbjct  370   LIDGLCKAGHVDRAMRLFASMEVRDEFTYTSVVHNLCKDGRLVCASKLLLSCYNKGMKIP  429

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELK  942
              S R+AV+ G++ +   Q ARK H ++K
Sbjct  430   SSARRAVLSGIRETVSYQAARKTHIKIK  457


 Score =   117 bits (292),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 92/366 (25%), Positives = 178/366 (49%), Gaps = 9/366 (2%)
 Frame = -1

Query  2015  LSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNI  1836
             L R   LL + + +G+LPD  +YNTL+    R    DEAY   + +    I P   T+N 
Sbjct  29    LERAETLLIDGIRLGVLPDVITYNTLIKGYTRFIGIDEAYAVTRRMREAGIEPDVTTYNS  88

Query  1835  LLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDI-  1659
             L+SG   N    + L LF E+ HSG  P + +YN L+      GR   A ++L+E + + 
Sbjct  89    LISGAAKNLVLNRVLQLFDEMLHSGLSPDMWSYNTLMSCYFKLGRHGEAFKILHEDIHLA  148

Query  1658  GYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDA  1479
             G  P   TY  ++    +S   +  +++ + ++ +    +   Y  +I+ L K+ R+   
Sbjct  149   GLVPGIDTYNILLDALCKSGHTDNAIELFKHLKSR-VKPELMTYNILINGLCKSRRVGSV  207

Query  1478  YDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDG  1299
                +  +  +G   + V Y T++ +Y K  +++    L ++ +++G+  D + +  ++  
Sbjct  208   DWMMRELKKSGYTPNAVTYTTMLKMYFKTKRIEKGLQLFLKMKKEGYTFDGFANCAVVSA  267

Query  1298  LCKAGNMKEALRHLNCTKLMGFDS-NLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----  1134
             L K G  +EA   ++     G  S ++V++N  ++   K G +D    + + ++ K    
Sbjct  268   LIKTGRAEEAYECMHELVRSGTRSQDIVSYNTLLNLYFKDGNLDAVDDLLEEIEMKGLKP  327

Query  1133  DCFTYSSLVHGLCKAGRFRVASELLLSCIIG-GMKILKSDRQAVIDGLQHSGFIQEARKL  957
             D +T++ +V+GL   G     +E  L+CI   GM+        +IDGL  +G +  A +L
Sbjct  328   DDYTHTIIVNGLLNIGNTG-GAEKHLACIGEMGMQPSVVTCNCLIDGLCKAGHVDRAMRL  386

Query  956   HSELKL  939
              + +++
Sbjct  387   FASMEV  392



>ref|XP_006648038.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like [Oryza brachyantha]
Length=475

 Score =   451 bits (1159),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 218/451 (48%), Positives = 302/451 (67%), Gaps = 0/451 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             L T+LLN+ +A LC+   L  AE++++D IR+G+P D VTYNTL+ A+C   G++AG ++
Sbjct  23    LPTRLLNVCLAALCRGGSLALAESMLVDAIRLGLPPDAVTYNTLLAAHCRAAGLEAGIAV  82

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             + RM E G++PD +TYNSLIA A+R G+    LDL +EML  GI PD+WSYN LMHCLFR
Sbjct  83    MGRMREAGVEPDTVTYNSLIAGASRRGLPIHALDLFDEMLRAGIAPDSWSYNALMHCLFR  142

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
              G P++AYR F D+    I PC  T+N LL G+   GY   A  +FR L+ +G    +VT
Sbjct  143   SGHPEDAYRVFADMAEKGIAPCGTTYNTLLDGMLRAGYAMNAYRMFRYLQRAGLPVGIVT  202

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YN +I GLC SG+   AR +L EL    + PN +TYT +MKCCFR  RF++GL     + 
Sbjct  203   YNTMISGLCRSGKVGYARMVLRELGRTDHAPNVVTYTAVMKCCFRYGRFQQGLDTFLSLL  262

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              KG I D F YCTVIS L+K GRM++A      M+ NG  LD V YN LI++ C+EGKLD
Sbjct  263   DKGCISDVFPYCTVISALVKKGRMEEANTYSDLMLKNGSRLDSVCYNMLIHMRCQEGKLD  322

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
             +A+ LV   E  G + D+YT  I+++GLCK G+++ A +HL   ++ G  SN+VA+NC +
Sbjct  323   DAFELVSMMEDGGLESDEYTFAILVNGLCKMGHIEAAEKHLCYMEMRGMQSNVVAYNCLV  382

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             D LCK+ EVD A+ + + M  KD FTY+SLVHGLC+ GR+ +AS+ L  C+  G  +L S
Sbjct  383   DALCKLQEVDAAIRLLQCMKLKDDFTYTSLVHGLCRVGRYHMASKFLRICLHEGNNVLAS  442

Query  1019  DRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              ++AVIDGL+ SGF  + RK+   L ++K+L
Sbjct  443   AKRAVIDGLRSSGFKNDLRKVQVALNMAKLL  473



>ref|XP_010932325.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915 isoform X1 [Elaeis guineensis]
Length=400

 Score =   447 bits (1150),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 219/397 (55%), Positives = 284/397 (72%), Gaps = 0/397 (0%)
 Frame = -1

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +D  YSIL+RM EVGIKPDVITYNSLIA ATR+ + SR L+L +EML++G+ PD WSYNT
Sbjct  1     MDEAYSILYRMREVGIKPDVITYNSLIAGATRYCLPSRALELFDEMLQIGLAPDEWSYNT  60

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             LMHCLF+ G P+EAY+ + D+   +I P   T+N L++GLC  G    A+ LFR L+  G
Sbjct  61    LMHCLFKTGYPEEAYKIYLDMILKNITPSSATYNTLINGLCKMGKAVYAVRLFRNLQKLG  120

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
             F   LVTYN +I GLC  GR   ARR+L EL + G  PN ITYTT+MKCCFR  +FE+G 
Sbjct  121   FSAGLVTYNTIIDGLCKCGRIDQARRILKELGESGCAPNVITYTTVMKCCFRCGKFEQGF  180

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             +I  EM  KGY  D FAYCTVIS L K G + DA  CV  M+ NGI LD   YNTL+ L 
Sbjct  181   EIFYEMMNKGYNSDVFAYCTVISTLTKKGMLTDANACVEQMLGNGIGLDKACYNTLLYLL  240

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             C+EGKL+ A+ L+ E E  G + D+YT++I+++GLCK G +  A + L   ++  F SNL
Sbjct  241   CREGKLEIAFQLLNEMEEGGLEGDEYTYSILVNGLCKMGYIDAAFKQLRLMEVRDFKSNL  300

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
             VA+NC IDGLCKVGEVD A+ +F  M  KD FTY+SL+HGLC+ GRFRVAS+LLL+C+  
Sbjct  301   VAYNCLIDGLCKVGEVDSAMKLFNKMKSKDPFTYTSLLHGLCRKGRFRVASKLLLTCLRE  360

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
             GM +L+S ++AVI GLQ SGF ++A KL + L+L+++
Sbjct  361   GMNVLRSAQRAVITGLQSSGFKRDAGKLRTALRLAQL  397


 Score =   119 bits (298),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/263 (31%), Positives = 133/263 (51%), Gaps = 8/263 (3%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFV--GIDAGYSILHRM  2088
             N  +  LCK  ++++A  ++ +    G   +V+TY T++   CCF     + G+ I + M
Sbjct  129   NTIIDGLCKCGRIDQARRILKELGESGCAPNVITYTTVMK--CCFRCGKFEQGFEIFYEM  186

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
                G   DV  Y ++I++ T+ GML+     +E+ML  GI  D   YNTL++ L R GK 
Sbjct  187   MNKGYNSDVFAYCTVISTLTKKGMLTDANACVEQMLGNGIGLDKACYNTLLYLLCREGKL  246

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             + A++   ++  G +     T++IL++GLC  GY + A    R ++   F   LV YN L
Sbjct  247   EIAFQLLNEMEEGGLEGDEYTYSILVNGLCKMGYIDAAFKQLRLMEVRDFKSNLVAYNCL  306

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             I GLC  G    A +L N++     + +  TYT+++    R  RF    ++L    R+G 
Sbjct  307   IDGLCKVGEVDSAMKLFNKMK----SKDPFTYTSLLHGLCRKGRFRVASKLLLTCLREGM  362

Query  1547  IFDSFAYCTVISFLIKAGRMKDA  1479
                  A   VI+ L  +G  +DA
Sbjct  363   NVLRSAQRAVITGLQSSGFKRDA  385


 Score =   107 bits (267),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/331 (24%), Positives = 144/331 (44%), Gaps = 4/331 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  + CL K    E+A  + +D I   +     TYNTLI   C          +   + +
Sbjct  59    NTLMHCLFKTGYPEEAYKIYLDMILKNITPSSATYNTLINGLCKMGKAVYAVRLFRNLQK  118

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G    ++TYN++I    + G + +   +L+E+ E G  P+  +Y T+M C FR GK ++
Sbjct  119   LGFSAGLVTYNTIIDGLCKCGRIDQARRILKELGESGCAPNVITYTTVMKCCFRCGKFEQ  178

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
              +  F ++           +  ++S L   G    A     ++  +G       YN L++
Sbjct  179   GFEIFYEMMNKGYNSDVFAYCTVISTLTKKGMLTDANACVEQMLGNGIGLDKACYNTLLY  238

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LC  G+   A +LLNE+ + G   +  TY+ ++    +    +   + L  M  + +  
Sbjct  239   LLCREGKLEIAFQLLNEMEEGGLEGDEYTYSILVNGLCKMGYIDAAFKQLRLMEVRDFKS  298

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             +  AY  +I  L K G +  A      M       D   Y +L++  C++G+   A  L+
Sbjct  299   NLVAYNCLIDGLCKVGEVDSAMKLFNKMKSK----DPFTYTSLLHGLCRKGRFRVASKLL  354

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
             +   R+G +  +     +I GL  +G  ++A
Sbjct  355   LTCLREGMNVLRSAQRAVITGLQSSGFKRDA  385


 Score =   100 bits (249),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 120/266 (45%), Gaps = 4/266 (2%)
 Frame = -1

Query  2276  STKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSIL  2097
             S+   N  +  LCK  +   A  +  +  ++G  A +VTYNT+I   C    ID    IL
Sbjct  89    SSATYNTLINGLCKMGKAVYAVRLFRNLQKLGFSAGLVTYNTIIDGLCKCGRIDQARRIL  148

Query  2096  HRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRL  1917
               + E G  P+VITY +++    R G   +  ++  EM+  G   D ++Y T++  L + 
Sbjct  149   KELGESGCAPNVITYTTVMKCCFRCGKFEQGFEIFYEMMNKGYNSDVFAYCTVISTLTKK  208

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTY  1737
             G   +A    + +    I      +N LL  LC  G  E A  L  E++  G      TY
Sbjct  209   GMLTDANACVEQMLGNGIGLDKACYNTLLYLLCREGKLEIAFQLLNEMEEGGLEGDEYTY  268

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRR  1557
             +IL++GLC  G    A + L  +    +  N + Y  ++    +    +  +++  +M+ 
Sbjct  269   SILVNGLCKMGYIDAAFKQLRLMEVRDFKSNLVAYNCLIDGLCKVGEVDSAMKLFNKMKS  328

Query  1556  KGYIFDSFAYCTVISFLIKAGRMKDA  1479
             K    D F Y +++  L + GR + A
Sbjct  329   K----DPFTYTSLLHGLCRKGRFRVA  350



>dbj|BAD19190.1| zinc finger (CCCH-type) protein-like [Oryza sativa Japonica Group]
 dbj|BAD19658.1| zinc finger (CCCH-type) protein-like [Oryza sativa Japonica Group]
Length=462

 Score =   449 bits (1154),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 306/460 (67%), Gaps = 2/460 (0%)
 Frame = -1

Query  2300  MFRIKSR--LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCF  2127
             M R + R  L T+LLN+ +A LC+   L  AE+V++D IR+G+P DVVTYNTL+ A+C  
Sbjct  1     MARGRGRWLLPTRLLNVCLAALCRGGSLAAAESVLVDAIRLGLPPDVVTYNTLLAAHCRA  60

Query  2126  VGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSY  1947
              G++AG  ++ RM E G++PD +TYNSLIA A R G+    LDL +EML  GI PD+WSY
Sbjct  61    AGLEAGLVVMGRMREAGVEPDAVTYNSLIAGAARRGLPIHALDLFDEMLRSGIAPDSWSY  120

Query  1946  NTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKH  1767
             N LMHCLFR G P++AYR F D+    I PC  T+N LL G+   GY   A  +FR L+ 
Sbjct  121   NPLMHCLFRSGHPEDAYRVFADMAEKGIAPCDTTYNTLLDGMFRAGYAMNAYRMFRYLQR  180

Query  1766  SGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEE  1587
             +G    +VTYN +I+GLC+SG+   AR +L EL    + PN ITYT +MKCCF+  RFE+
Sbjct  181   AGLPVSIVTYNTMINGLCSSGKVGYARMVLRELGRTDHAPNIITYTAVMKCCFKYGRFEQ  240

Query  1586  GLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
             GL     +  +GYI D + YCTVIS L+K GR+ +A +    M+ NG  LD V YNTLI+
Sbjct  241   GLDTFLSLLDRGYISDVYPYCTVISALVKKGRLGEANNYCDLMLQNGSRLDSVCYNTLIH  300

Query  1406  LYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDS  1227
             + C+EGKLD+A+ LV   E  G + D+YT  I+++GLCK G+++ A + L   ++ G  S
Sbjct  301   MRCQEGKLDDAFELVSMMEDGGLESDEYTFAILVNGLCKMGHIEAAEKQLFYMEIKGMQS  360

Query  1226  NLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCI  1047
             N+VA+NC +D LCK  EVD A+ + + M  KD FTY+SLVHGLC+ GR+ +AS+ L  C+
Sbjct  361   NVVAYNCLVDALCKFQEVDAAIRLLQCMKLKDDFTYTSLVHGLCRVGRYHMASKFLRICL  420

Query  1046  IGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
               G  +L S ++AVI GL+ SGF  + RK+   L ++K+L
Sbjct  421   HEGNNVLASAKRAVIAGLRSSGFKNDLRKVRVALNMAKLL  460



>ref|NP_001048367.1| Os02g0793200 [Oryza sativa Japonica Group]
 dbj|BAF10281.1| Os02g0793200 [Oryza sativa Japonica Group]
 dbj|BAG94932.1| unnamed protein product [Oryza sativa Japonica Group]
Length=473

 Score =   449 bits (1155),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 306/460 (67%), Gaps = 2/460 (0%)
 Frame = -1

Query  2300  MFRIKSR--LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCF  2127
             M R + R  L T+LLN+ +A LC+   L  AE+V++D IR+G+P DVVTYNTL+ A+C  
Sbjct  12    MARGRGRWLLPTRLLNVCLAALCRGGSLAAAESVLVDAIRLGLPPDVVTYNTLLAAHCRA  71

Query  2126  VGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSY  1947
              G++AG  ++ RM E G++PD +TYNSLIA A R G+    LDL +EML  GI PD+WSY
Sbjct  72    AGLEAGLVVMGRMREAGVEPDAVTYNSLIAGAARRGLPIHALDLFDEMLRSGIAPDSWSY  131

Query  1946  NTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKH  1767
             N LMHCLFR G P++AYR F D+    I PC  T+N LL G+   GY   A  +FR L+ 
Sbjct  132   NPLMHCLFRSGHPEDAYRVFADMAEKGIAPCDTTYNTLLDGMFRAGYAMNAYRMFRYLQR  191

Query  1766  SGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEE  1587
             +G    +VTYN +I+GLC+SG+   AR +L EL    + PN ITYT +MKCCF+  RFE+
Sbjct  192   AGLPVSIVTYNTMINGLCSSGKVGYARMVLRELGRTDHAPNIITYTAVMKCCFKYGRFEQ  251

Query  1586  GLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
             GL     +  +GYI D + YCTVIS L+K GR+ +A +    M+ NG  LD V YNTLI+
Sbjct  252   GLDTFLSLLDRGYISDVYPYCTVISALVKKGRLGEANNYCDLMLQNGSRLDSVCYNTLIH  311

Query  1406  LYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDS  1227
             + C+EGKLD+A+ LV   E  G + D+YT  I+++GLCK G+++ A + L   ++ G  S
Sbjct  312   MRCQEGKLDDAFELVSMMEDGGLESDEYTFAILVNGLCKMGHIEAAEKQLFYMEIKGMQS  371

Query  1226  NLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCI  1047
             N+VA+NC +D LCK  EVD A+ + + M  KD FTY+SLVHGLC+ GR+ +AS+ L  C+
Sbjct  372   NVVAYNCLVDALCKFQEVDAAIRLLQCMKLKDDFTYTSLVHGLCRVGRYHMASKFLRICL  431

Query  1046  IGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
               G  +L S ++AVI GL+ SGF  + RK+   L ++K+L
Sbjct  432   HEGNNVLASAKRAVIAGLRSSGFKNDLRKVRVALNMAKLL  471



>ref|XP_002865170.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41429.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=468

 Score =   449 bits (1154),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 230/448 (51%), Positives = 306/448 (68%), Gaps = 3/448 (1%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             +STKLLNI+V  LCK + LEKAET++IDGIR+GV  DV+TYNTLI  Y  F+GID  Y++
Sbjct  11    ISTKLLNISVDSLCKFRNLEKAETLLIDGIRLGVLPDVITYNTLIKGYSRFIGIDEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM E GI+PDV TYNSLI+ A ++ ML+R L L +EML  G+ PD WSYNTLM C FR
Sbjct  71    TRRMREAGIEPDVATYNSLISGAAKNLMLNRVLQLFDEMLHSGLSPDMWSYNTLMSCYFR  130

Query  1919  LGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK  EA+R   +DI    + P   T+NILL  LC +G+T+ A+ LF+ LK S   P+L+
Sbjct  131   LGKHGEAFRILHEDIRLAGLVPGVDTYNILLDALCKSGHTDNAIELFKHLK-SRVKPELM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S R      +L EL   GY PNA+TYTT++K  F+++R E+GL++  +M
Sbjct  190   TYNILINGLCKSRRVGSVNWMLRELRKAGYTPNAVTYTTMLKMYFKTKRIEKGLELFLKM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE-LDLVAYNTLINLYCKEGK  1386
             +++GY FD +A C V+S LIK GR ++AY C+  ++ +G    D+V+YNTL+N+Y K+G 
Sbjct  250   KKEGYTFDGYANCAVVSALIKTGRAEEAYGCMNELVRSGTRSQDIVSYNTLLNMYFKDGN  309

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
             LD    L+ E E KG   D YTHTII++GL K G+   A +HL     MG   ++   NC
Sbjct  310   LDAVDDLLEEIEMKGLKPDDYTHTIIVNGLLKIGHTGGAEKHLARIGEMGMQPSIATCNC  369

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              IDGLCK G VD A+ +F SM+ +D FTY+S+VH LCK GR   AS+LLLSC   GMKI 
Sbjct  370   LIDGLCKAGHVDRAMRLFASMEVRDEFTYTSVVHNLCKDGRLVCASKLLLSCYNKGMKIP  429

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELK  942
              S R+AV+ GL+ +   Q ARK H ++K
Sbjct  430   SSARRAVLSGLRETVSHQAARKTHFKIK  457


 Score =   120 bits (301),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 92/365 (25%), Positives = 176/365 (48%), Gaps = 7/365 (2%)
 Frame = -1

Query  2015  LSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNI  1836
             L +   LL + + +G+LPD  +YNTL+    R    DEAY   + +    I P   T+N 
Sbjct  29    LEKAETLLIDGIRLGVLPDVITYNTLIKGYSRFIGIDEAYAVTRRMREAGIEPDVATYNS  88

Query  1835  LLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDI-  1659
             L+SG   N    + L LF E+ HSG  P + +YN L+      G+   A R+L+E + + 
Sbjct  89    LISGAAKNLMLNRVLQLFDEMLHSGLSPDMWSYNTLMSCYFRLGKHGEAFRILHEDIRLA  148

Query  1658  GYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDA  1479
             G  P   TY  ++    +S   +  +++ + ++ +    +   Y  +I+ L K+ R+   
Sbjct  149   GLVPGVDTYNILLDALCKSGHTDNAIELFKHLKSR-VKPELMTYNILINGLCKSRRVGSV  207

Query  1478  YDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDG  1299
                +  +   G   + V Y T++ +Y K  +++    L ++ +++G+  D Y +  ++  
Sbjct  208   NWMLRELRKAGYTPNAVTYTTMLKMYFKTKRIEKGLELFLKMKKEGYTFDGYANCAVVSA  267

Query  1298  LCKAGNMKEALRHLNCTKLMGFDS-NLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----  1134
             L K G  +EA   +N     G  S ++V++N  ++   K G +D    + + ++ K    
Sbjct  268   LIKTGRAEEAYGCMNELVRSGTRSQDIVSYNTLLNMYFKDGNLDAVDDLLEEIEMKGLKP  327

Query  1133  DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLH  954
             D +T++ +V+GL K G    A + L      GM+   +    +IDGL  +G +  A +L 
Sbjct  328   DDYTHTIIVNGLLKIGHTGGAEKHLARIGEMGMQPSIATCNCLIDGLCKAGHVDRAMRLF  387

Query  953   SELKL  939
             + +++
Sbjct  388   ASMEV  392



>ref|XP_004143717.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At4g17915-like [Cucumis sativus]
Length=460

 Score =   448 bits (1152),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 216/458 (47%), Positives = 298/458 (65%), Gaps = 8/458 (2%)
 Frame = -1

Query  2285  SRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGY  2106
             S+ STKLL I VA  CK+ Q +KAE  I D IR+GV  D++TYN LI  YC F  +DA Y
Sbjct  3     SKYSTKLLTICVASFCKSHQFQKAEIAIKDAIRLGVVPDILTYNILINGYCQFSDMDAAY  62

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
             S+ H+M + GI P+V  Y SL+A+A+R+  L +CL+L  EML++GI PD WSY TL HC 
Sbjct  63    SVFHKMRDAGITPNVFIYTSLMAAASRNSSLEQCLNLFHEMLQLGITPDVWSYTTLTHCF  122

Query  1925  FRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
              ++GKPDEA   F D    D  P P TF++++ G C  GYT  A+ LFR L+  G +P+ 
Sbjct  123   LKVGKPDEANSIFLDFILKDHSPNPATFDVMIFGFCSCGYTSNAITLFRNLQSHGLVPKF  182

Query  1745  VTYNILIHGLCNSGR-------WAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEE  1587
             VTY+IL+ GLC + R       +  A  + NE +D G+ P++ TY  +MKCCF+ R ++ 
Sbjct  183   VTYDILLTGLCKAARLNVSVSMFNEAMSMFNEAIDSGFEPDSTTYIALMKCCFKFREYQH  242

Query  1586  GLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
             G +I  EM+ KG  F+ F Y T I  L++ GR+++A   +  MI NG+  +LV YNT++N
Sbjct  243   GFEIFFEMKNKGLAFNGFGYYTAIGALLRLGRLEEAKFFMVEMIKNGVVFNLVFYNTVVN  302

Query  1406  LYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF-D  1230
             LYCK GKL+ A+ ++ + E +G  C+ YTH II DGLCK GN + A RHLN     GF +
Sbjct  303   LYCKHGKLEAAHKMLDKIESRGLQCNDYTHAIITDGLCKVGNFEGARRHLNYIYPTGFTN  362

Query  1229  SNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSC  1050
             SN+VA +C ID LCK G++D A+ +F+ M+ KD + Y+SL+H LCKA RF  AS+LLL C
Sbjct  363   SNVVASSCLIDRLCKAGQIDQAMQLFELMETKDPYVYTSLMHNLCKARRFLCASKLLLDC  422

Query  1049  IIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
             +  G+ + +S + AVI GL   GF  EARKL   + LS
Sbjct  423   LRSGISVFRSTQCAVIFGLCSFGFTSEARKLKPFIHLS  460



>gb|KFK31411.1| hypothetical protein AALP_AA6G108500 [Arabis alpina]
Length=468

 Score =   447 bits (1151),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 228/448 (51%), Positives = 307/448 (69%), Gaps = 3/448 (1%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             +STKLLNI+V  LCK + LEKAE++IIDGIR+GV  DVVTYNTLI  Y  FVGID  Y++
Sbjct  11    ISTKLLNISVGSLCKFRNLEKAESLIIDGIRLGVLPDVVTYNTLINGYSRFVGIDEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM E GI+PDV TYNSLI+ A RH ML+R   L +EML  G+ PD WSYNTLM C F+
Sbjct  71    TRRMREAGIEPDVATYNSLISGAARHLMLNRVHQLFDEMLHSGLSPDMWSYNTLMSCYFK  130

Query  1919  LGKPDEAYRFFQD-IFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LG+  EA+R   + +    + P   T+NILL  LC +G+T+ A+ LF+ LK +   P+L+
Sbjct  131   LGRHGEAFRILHEHVHLAGLSPGVDTYNILLDALCKSGHTDNAIELFKHLK-TRVKPELM  189

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S R   A  +  EL   GY PNA+TYTT++K  F+++R E+GLQ+  +M
Sbjct  190   TYNILINGLCKSRRVGYANWMFRELKKSGYTPNAVTYTTMLKLYFKTKRIEKGLQLFLKM  249

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE-LDLVAYNTLINLYCKEGK  1386
             +++G+ FD +A C V+S LIK GR ++AY+C+  ++ +G    D+V+YNTL+NLY K+G 
Sbjct  250   KKEGHTFDGYANCAVVSALIKTGRAEEAYECMKELMRSGTRSKDIVSYNTLLNLYFKDGN  309

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
             LD    L+ E E KGF  D YTHTII++GL   G++  A +HL C   +G   ++V  NC
Sbjct  310   LDAVDDLLEEIELKGFKPDDYTHTIIVNGLLSLGHIGGAEKHLACIGELGMQPSIVTCNC  369

Query  1205  CIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              IDGLCK G VD A+ +F SM  +D +TY+S+VH LCK G+   AS+LLLSC   GMKI 
Sbjct  370   MIDGLCKAGHVDRAMRLFASMKVRDEYTYTSVVHNLCKDGQLVCASKLLLSCYNEGMKIP  429

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELK  942
              S R+AV+ GL+ +   Q ARK H ++K
Sbjct  430   SSARRAVLSGLRMTVSNQAARKTHIKMK  457



>gb|EAY87834.1| hypothetical protein OsI_09254 [Oryza sativa Indica Group]
Length=502

 Score =   446 bits (1147),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 219/452 (48%), Positives = 302/452 (67%), Gaps = 2/452 (0%)
 Frame = -1

Query  2300  MFRIKSR--LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCF  2127
             M R + R  L T+LLN+ +A LC+   L  AE+V++D IR+G+P DVVTYNTL+ A+C  
Sbjct  1     MARGRGRWLLPTRLLNVCLAALCRGGSLAAAESVLVDAIRLGLPPDVVTYNTLLAAHCRA  60

Query  2126  VGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSY  1947
              G++AG +++ RM E G++PD +TYNSLIA A R G+    LDL +EML  GI PD+WSY
Sbjct  61    AGLEAGLAVMGRMREAGVEPDAVTYNSLIAGAARRGLPIHALDLFDEMLRAGIAPDSWSY  120

Query  1946  NTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKH  1767
             N LMHCLFR G P++AYR F D+    I PC  T+N LL G+   GY   A  +FR L+ 
Sbjct  121   NPLMHCLFRSGHPEDAYRVFADMAEKGIAPCDTTYNTLLDGMFRAGYAMNAYRMFRYLQR  180

Query  1766  SGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEE  1587
             +G    +VTYN +I+GLC+SG+   AR +L EL    + PN ITYT +MKCCF+  RFE+
Sbjct  181   AGLPVSIVTYNTMINGLCSSGKVGYARMVLRELGRTDHAPNIITYTAVMKCCFKYGRFEQ  240

Query  1586  GLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
             GL     +  +GYI D + YCTVIS L+K GR+ +A +    M+ NG  LD V YNTLI+
Sbjct  241   GLDTFLSLLDRGYISDVYPYCTVISALVKKGRLGEANNYCDLMLQNGSRLDSVCYNTLIH  300

Query  1406  LYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDS  1227
             + C+EGKLD+A+ LV   E  G + D+YT  I+++GLCK G+++ A + L   ++ G  S
Sbjct  301   MRCQEGKLDDAFELVSMMEDGGLESDEYTFAILVNGLCKMGHIEAAEKQLFYMEIKGMQS  360

Query  1226  NLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCI  1047
             N+VA+NC +D LCK  EVD A+ + + M  KD FTY+SLVHGLC+ GR+ +AS+ L  C+
Sbjct  361   NVVAYNCLVDALCKFQEVDAAIRLLQCMKLKDDFTYTSLVHGLCRVGRYHMASKFLRICL  420

Query  1046  IGGMKILKSDRQAVIDGLQHSGFIQEARKLHS  951
               G  +L S ++AVI GL+ SGF  + RK+ S
Sbjct  421   REGNNVLASAKRAVIAGLRSSGFKNDLRKVRS  452



>ref|XP_006282167.1| hypothetical protein CARUB_v10028426mg [Capsella rubella]
 gb|EOA15065.1| hypothetical protein CARUB_v10028426mg [Capsella rubella]
Length=468

 Score =   442 bits (1137),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 229/449 (51%), Positives = 302/449 (67%), Gaps = 3/449 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             ++STKL+NI V   CK + LEKAE++++D IR+GV  DVVTYNTLI  Y  F GID  Y+
Sbjct  10    KISTKLMNICVDSFCKFRNLEKAESLLVDAIRLGVLPDVVTYNTLIKGYSRFSGIDEAYA  69

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +  RM E GI+PDV TYNSLI+ A +  MLSR L L +EML  G+ PD WSYNTLM C F
Sbjct  70    VTRRMREAGIEPDVATYNSLISGAAKQLMLSRVLQLFDEMLHSGLSPDMWSYNTLMSCYF  129

Query  1922  RLGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             +LGK  EA+R   +DI      P   T+NILL  LC +G+T  A+ LF+ LK S   P+L
Sbjct  130   KLGKHGEAFRILNEDIQLAGFVPGVDTYNILLDALCKSGHTGNAIELFKNLK-SRVKPEL  188

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             +TYNILI+GLC S R      +L EL   GY PNA+TYTT++K  F++RR E+GLQ+  +
Sbjct  189   MTYNILINGLCKSRRVGSLNWMLRELKKSGYTPNAVTYTTMLKMYFKTRRIEKGLQLFLK  248

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE-LDLVAYNTLINLYCKEG  1389
             M+++G+ FD +A C V+S LIK GR ++AY+C+  ++ +G   LD+V+YNTL+NLY K+G
Sbjct  249   MKKEGHTFDGYANCAVVSALIKTGRAEEAYECMEELVRSGTRSLDIVSYNTLLNLYFKDG  308

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
              LD    L+ E E KG   D YTHTII++GL   G+   A +H+ C   MG   ++V  N
Sbjct  309   NLDAVDDLLDEIELKGLKPDDYTHTIIVNGLLNIGHTGGAEKHMACMGEMGTQPSVVTCN  368

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             C IDGLCK G VD A+ +F SM  KD FTY+S+VH LCK G+   AS+LLLSC   GMKI
Sbjct  369   CMIDGLCKAGHVDRAMRLFASMKVKDEFTYTSVVHNLCKDGQLVCASKLLLSCYNKGMKI  428

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELK  942
               S R+AV+ GL+ +   Q ARK H ++K
Sbjct  429   PSSARRAVLSGLRETVSYQAARKTHIKIK  457



>ref|XP_010445785.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46680-like 
[Camelina sativa]
Length=468

 Score =   442 bits (1136),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 225/449 (50%), Positives = 306/449 (68%), Gaps = 3/449 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             R+STKL+NI +  LCK + LEKAE++++DGIR+GV  +V+TYNTLI  Y  FVGID  Y+
Sbjct  10    RISTKLMNICLDSLCKFRNLEKAESLLVDGIRLGVLPNVITYNTLIKGYSRFVGIDEAYA  69

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +  RM E GI+PDV TYNSLI+ A +  ML+R L L +EML  G+ PD WSYNTLM C F
Sbjct  70    VTRRMREAGIEPDVATYNSLISGAAKQLMLNRVLQLFDEMLHSGLSPDIWSYNTLMSCYF  129

Query  1922  RLGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             +LGK  EA+R   +DI    + P   T+NILL  LC +G+T  A+ LF+ L+ +   P+L
Sbjct  130   KLGKHGEAFRILNEDIELAGLVPGVDTYNILLDALCKSGHTGNAIELFKHLR-TRVKPEL  188

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             +TYNILI+GLC + R      +L EL   GY PNA+TYTT++K  F++RR E+GLQ+  +
Sbjct  189   MTYNILINGLCKARRVGSLNWMLRELKKSGYTPNAVTYTTMLKMYFKTRRIEKGLQLFMK  248

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE-LDLVAYNTLINLYCKEG  1389
             M+++GY FD +A C V+S LIK GR ++AY+C+  ++ +G    D+V+YNTL+NLY K+G
Sbjct  249   MKKEGYTFDGYANCAVVSALIKTGRAEEAYECMQELVRSGTRSQDIVSYNTLLNLYFKDG  308

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
              LD    L+ E E KG   D YTHTII++GL   G+   A +H+ C   MG   ++V  N
Sbjct  309   NLDAVEDLLEEIEVKGLKLDDYTHTIIVNGLLNIGHTGGAEKHMACMGEMGTLPSVVTCN  368

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             C IDGLCK G VD A+ +F SM+ +D FTY+S+VH LCK G+   AS+LLLSC   GMKI
Sbjct  369   CMIDGLCKAGHVDRAMRLFASMEVRDEFTYTSVVHNLCKDGQLVCASKLLLSCYNKGMKI  428

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELK  942
               S R+AV+ GL+ +   Q ARK H ++K
Sbjct  429   PSSARRAVLSGLRTTVSYQAARKTHFKIK  457



>ref|XP_010495770.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46680 
[Camelina sativa]
Length=468

 Score =   439 bits (1130),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 224/449 (50%), Positives = 306/449 (68%), Gaps = 3/449 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             R+STKL+NI +  LCK + LEKAE++++DGIR+GV  +V+TYNTLI  Y  FVGID  Y+
Sbjct  10    RISTKLMNICLDSLCKFRNLEKAESLLVDGIRLGVLPNVITYNTLIKGYSRFVGIDEAYA  69

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +  RM E GI+PDV TYNSLI+ A +  ML+R L L +EML  G+ PD WSYNTLM C F
Sbjct  70    VTRRMREAGIEPDVATYNSLISGAAKQLMLNRVLQLFDEMLHSGLSPDMWSYNTLMSCYF  129

Query  1922  RLGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             +LGK  EA+R   +DI    + P   T+NILL  LC +G+T  A+ LF+ L+ +   P+L
Sbjct  130   KLGKHGEAFRILNEDIELAGLVPGVDTYNILLDALCKSGHTGNAIELFKHLR-TRVKPEL  188

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             +TYNILI+GLC + R      +L EL   GY PNA+TYTT++K  F++RR E+GLQ+  +
Sbjct  189   MTYNILINGLCKARRVGSLNWMLRELKKSGYTPNAVTYTTMLKMYFKTRRIEKGLQLFMK  248

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE-LDLVAYNTLINLYCKEG  1389
             M+++GY FD +A C V+S LIK GR ++AY+C+  ++ +G    D+V+YNTL+NLY K+G
Sbjct  249   MKKEGYTFDGYANCAVVSALIKTGRAEEAYECMEELVRSGTRSQDIVSYNTLLNLYFKDG  308

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
              LD    L+ E E KG   D +THTII++GL   G+   A +H+ C   MG   ++V  N
Sbjct  309   NLDAVEDLLEEIEVKGLKLDDHTHTIIVNGLLNIGHTGGAEKHMACMGEMGTLPSVVTCN  368

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             C IDGLCK G VD A+ +F SM+ +D FTY+S+VH LCK G+   AS+LLLSC   GMKI
Sbjct  369   CMIDGLCKAGHVDRAMRLFASMEVRDEFTYTSVVHNLCKDGQLVCASKLLLSCYNKGMKI  428

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELK  942
               S R+AV+ GL+ +   Q ARK H ++K
Sbjct  429   PSSARRAVLSGLRTTVSYQAARKTHFKIK  457



>ref|XP_010484763.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46680-like 
[Camelina sativa]
Length=468

 Score =   439 bits (1128),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 224/449 (50%), Positives = 305/449 (68%), Gaps = 3/449 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             R+STKL+NI +  LCK + LEKAE++++DGIR+GV  +V+TYNTLI  Y  FVGID  Y+
Sbjct  10    RISTKLMNICLDSLCKFRNLEKAESLLVDGIRLGVLPNVITYNTLIKGYSRFVGIDEAYA  69

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +  RM E GI+PDV TYNSLI+ A +  ML+R L L +EML  G+ PD W YNTLM C F
Sbjct  70    VTRRMREAGIEPDVATYNSLISGAAKQLMLNRVLQLFDEMLHSGLSPDIWCYNTLMSCYF  129

Query  1922  RLGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             +LGK  EA+R   +DI    + P   T+NILL  LC +G+T  A+ LF+ L+ +   P+L
Sbjct  130   KLGKHGEAFRILNEDIELAGLVPGVDTYNILLDALCKSGHTGNAIELFKHLR-TRVKPEL  188

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             +TYNILI+GLC + R      +L EL   GY PNA+TYTT++K  F++RR E+GLQ+  +
Sbjct  189   MTYNILINGLCKARRVGSLNWMLRELKKSGYTPNAVTYTTMLKMYFKTRRIEKGLQLFMK  248

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE-LDLVAYNTLINLYCKEG  1389
             M+++GY FD +A C V+S LIK GR ++AY+C+  ++ +G    D+V+YNTL+NLY K+G
Sbjct  249   MKKEGYTFDGYANCAVVSALIKTGRAEEAYECMQELVRSGTRSQDIVSYNTLLNLYFKDG  308

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
              LD    L+ E E KG   D YTHTII++GL   G+   A +H+ C   MG   ++V  N
Sbjct  309   NLDAVEDLLEEIEVKGLKLDDYTHTIIVNGLLNIGHTGGAEKHMACMGEMGTLPSVVTCN  368

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             C IDGLCK G VD A+ +F SM+ +D FTY+S+VH LCK G+   AS+LLLSC   GMKI
Sbjct  369   CMIDGLCKAGHVDRAMRLFASMEVRDEFTYTSVVHNLCKDGQLVCASKLLLSCYNKGMKI  428

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELK  942
               S R+AV+ GL+ +   Q ARK H ++K
Sbjct  429   PSSARRAVLSGLRTTVSYQAARKTHFKIK  457



>gb|EPS66616.1| hypothetical protein M569_08159, partial [Genlisea aurea]
Length=451

 Score =   437 bits (1123),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 225/448 (50%), Positives = 293/448 (65%), Gaps = 3/448 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             RLSTKLLNI+VA LC+AKQ+EKAE  IID I +G+  +VVTYNTLI  Y       AGYS
Sbjct  4     RLSTKLLNISVASLCRAKQMEKAEAAIIDAISLGILPNVVTYNTLIRGYS-ESSFAAGYS  62

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             ++ RM E GI P++IT+NSL+A+A+R  +L  C  +L +ML +G +PD WSYNTL+HC F
Sbjct  63    VVFRMRESGIPPNLITFNSLLAAASRRHLLPHCFAVLSQMLVMGFVPDIWSYNTLLHCFF  122

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
              LG+  +AY+ F  I   ++ PC VT  I++ GLC NG    AL LFR LK+ G  PQL 
Sbjct  123   DLGRCFDAYKVFGAILSKNVVPCQVTCGIMIYGLCRNGCIGSALGLFRYLKNRGHAPQLA  182

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYN LI  L N+  W    R+ +EL   G+ PNA+TYT+++K CFR     EGL++  EM
Sbjct  183   TYNALIKSLGNARSWKRMMRVFDELRRSGHRPNAVTYTSLIKGCFRCGEVREGLEMFAEM  242

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R GY +D F+YCTV++ L+K  R  DA  CV ++   G ELD+ +YNTLIN+ CKEGK 
Sbjct  243   KRNGYAYDQFSYCTVVAGLVKWNRTADARVCVSHIFKLGFELDIASYNTLINMCCKEGKT  302

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
                  L+  AER G  CD Y+HTI + GLC+AG+ + ALRH+      GFD  L AFNC 
Sbjct  303   GTVPRLLAMAERNGVKCDAYSHTIYVGGLCRAGDFRGALRHIAWMDATGFDC-LAAFNCL  361

Query  1202  IDGLCKVGEVDYALSVFKSM-DEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
             ID L K G +D A+  F S    KD FTYSSLV GLC+ G+ R+ASE+LLSC   G + L
Sbjct  362   IDRLGKSGHLDSAVKAFDSTGGTKDGFTYSSLVQGLCRVGKVRLASEVLLSCAREGHRYL  421

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELK  942
             K DR  V+ GL+ +    EAR+   EL+
Sbjct  422   KMDRDVVLWGLRITYLPNEARRFKRELR  449



>emb|CDX87688.1| BnaC02g32610D [Brassica napus]
Length=465

 Score =   428 bits (1101),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 220/449 (49%), Positives = 301/449 (67%), Gaps = 3/449 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             + STKLLNI +  LCK++ L+KAE+++IDGIRVGV  +V+TYNTLI  Y  FVGID  Y+
Sbjct  7     KTSTKLLNICIDSLCKSRNLQKAESLLIDGIRVGVFPNVITYNTLINGYSRFVGIDEAYA  66

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             + HRM E GIKPDV TYNSLI+ A +  +L+R   L +EML  G+ PD  SYNT M   F
Sbjct  67    VTHRMREAGIKPDVSTYNSLISGAAKQLLLTRAHQLFDEMLRSGLSPDMRSYNTFMSLYF  126

Query  1922  RLGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             +LG+  +A+R   +D+    + P   T+NILL  LC +G+ + A+ LF+ +K+    P+L
Sbjct  127   KLGRHGDAFRILNEDVHLAGLSPRVDTYNILLDALCKSGHIDNAVELFKYIKNR-VKPEL  185

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             +TYNILI+GLC S R + A  +L EL   GY PNA+TYTT++K  F+S+  E+GL++  +
Sbjct  186   MTYNILINGLCKSRRVSSANWMLRELERAGYAPNAVTYTTMLKMYFKSKMVEKGLKLFLK  245

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIEL-DLVAYNTLINLYCKEG  1389
             M+ +GY FD +A C V+S LIK GR ++AY C+  ++ +G    D+V+YNTL+NLY K+G
Sbjct  246   MKNEGYTFDGYASCAVVSALIKTGRAEEAYQCMHELVRSGRRSGDIVSYNTLLNLYFKDG  305

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
              LD    L+ E ERKG   D YTHTII++GL   G+   A +HL C   MG   ++V  N
Sbjct  306   NLDAVDDLLEEIERKGLKPDDYTHTIIVNGLLSIGHTGGAEKHLACLGEMGMQPSVVTCN  365

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             C IDGLCK G VD A+ +F SM+ +D +TY+S+VH LCK GR   AS+LLL C   GMKI
Sbjct  366   CLIDGLCKAGHVDRAMRLFASMEIRDEYTYTSVVHNLCKDGRLVCASKLLLLCYNKGMKI  425

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELK  942
               S R+AV+ GL+ +   Q ARK H + K
Sbjct  426   PSSARRAVLSGLRMTVSYQAARKTHHKFK  454


 Score =   112 bits (279),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 90/365 (25%), Positives = 170/365 (47%), Gaps = 7/365 (2%)
 Frame = -1

Query  2015  LSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNI  1836
             L +   LL + + VG+ P+  +YNTL++   R    DEAY     +    I P   T+N 
Sbjct  26    LQKAESLLIDGIRVGVFPNVITYNTLINGYSRFVGIDEAYAVTHRMREAGIKPDVSTYNS  85

Query  1835  LLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDI-  1659
             L+SG        +A  LF E+  SG  P + +YN  +      GR   A R+LNE V + 
Sbjct  86    LISGAAKQLLLTRAHQLFDEMLRSGLSPDMRSYNTFMSLYFKLGRHGDAFRILNEDVHLA  145

Query  1658  GYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDA  1479
             G +P   TY  ++    +S   +  +++ + ++ +    +   Y  +I+ L K+ R+  A
Sbjct  146   GLSPRVDTYNILLDALCKSGHIDNAVELFKYIKNR-VKPELMTYNILINGLCKSRRVSSA  204

Query  1478  YDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDG  1299
                +  +   G   + V Y T++ +Y K   ++    L ++ + +G+  D Y    ++  
Sbjct  205   NWMLRELERAGYAPNAVTYTTMLKMYFKSKMVEKGLKLFLKMKNEGYTFDGYASCAVVSA  264

Query  1298  LCKAGNMKEALRHLNCTKLMGFDS-NLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----  1134
             L K G  +EA + ++     G  S ++V++N  ++   K G +D    + + ++ K    
Sbjct  265   LIKTGRAEEAYQCMHELVRSGRRSGDIVSYNTLLNLYFKDGNLDAVDDLLEEIERKGLKP  324

Query  1133  DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLH  954
             D +T++ +V+GL   G    A + L      GM+        +IDGL  +G +  A +L 
Sbjct  325   DDYTHTIIVNGLLSIGHTGGAEKHLACLGEMGMQPSVVTCNCLIDGLCKAGHVDRAMRLF  384

Query  953   SELKL  939
             + +++
Sbjct  385   ASMEI  389



>ref|XP_009128889.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46680 
[Brassica rapa]
Length=465

 Score =   425 bits (1092),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 216/449 (48%), Positives = 303/449 (67%), Gaps = 3/449 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             + STKLLNI +  LCK++ L+KAE+++IDGIR+GV  +VVTYN+LI  Y  FVGID  Y+
Sbjct  7     KTSTKLLNICIDSLCKSRNLQKAESLLIDGIRLGVLPNVVTYNSLINGYSRFVGIDEAYA  66

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             + HRM E GIKPDV TYNSLI+ A +  +++R   L +EML  G+ PD  SYNTL+   F
Sbjct  67    VTHRMREAGIKPDVSTYNSLISGAAKQLLITRAHQLFDEMLRSGLSPDMLSYNTLISLYF  126

Query  1922  RLGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             R+G+  +A+R   +++    + P   T+NILL  LC +G+ + A+ LF+ +K S   P+L
Sbjct  127   RVGRHGDAFRILNENVHDAGLSPGVDTYNILLDALCKSGHIDNAIELFKHVK-SRVKPEL  185

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             +TYNILI+GLC S R + A  +L EL   GY PNA+TYTT++K  F+++  E+GL++  +
Sbjct  186   MTYNILINGLCKSRRVSSANWMLRELERAGYTPNAVTYTTMLKMYFKTKMIEKGLKLFLK  245

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIEL-DLVAYNTLINLYCKEG  1389
             M+++GY FD +A C V+S LIK GR ++AY C+  ++ +G    D+V+YNTL+NLY K+G
Sbjct  246   MKKEGYTFDGYASCAVVSALIKTGRAEEAYQCMHELVRSGRRSGDIVSYNTLLNLYFKDG  305

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
              LD    L+ E E KG   D YTHTII++GL   G+   A +HL C   MG   ++V  N
Sbjct  306   DLDAVDDLLEEIESKGLKPDDYTHTIIVNGLLSIGHTGGAEKHLACLGEMGMQPSVVTCN  365

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             C IDGLCK G VD A+ +F SM+ +D +TY+S+VH LCK GR   AS+LLL C   GMKI
Sbjct  366   CLIDGLCKAGHVDRAMRLFSSMEIRDEYTYTSVVHNLCKDGRLVCASKLLLLCYNKGMKI  425

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELK  942
               S R+AV+ GL+ +   Q ARK H ++K
Sbjct  426   PSSARRAVLSGLRMTVSYQAARKTHHKIK  454


 Score =   121 bits (303),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 93/365 (25%), Positives = 175/365 (48%), Gaps = 7/365 (2%)
 Frame = -1

Query  2015  LSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNI  1836
             L +   LL + + +G+LP+  +YN+L++   R    DEAY     +    I P   T+N 
Sbjct  26    LQKAESLLIDGIRLGVLPNVVTYNSLINGYSRFVGIDEAYAVTHRMREAGIKPDVSTYNS  85

Query  1835  LLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELV-DI  1659
             L+SG        +A  LF E+  SG  P +++YN LI      GR   A R+LNE V D 
Sbjct  86    LISGAAKQLLITRAHQLFDEMLRSGLSPDMLSYNTLISLYFRVGRHGDAFRILNENVHDA  145

Query  1658  GYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDA  1479
             G +P   TY  ++    +S   +  +++ + ++ +    +   Y  +I+ L K+ R+  A
Sbjct  146   GLSPGVDTYNILLDALCKSGHIDNAIELFKHVKSR-VKPELMTYNILINGLCKSRRVSSA  204

Query  1478  YDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDG  1299
                +  +   G   + V Y T++ +Y K   ++    L ++ +++G+  D Y    ++  
Sbjct  205   NWMLRELERAGYTPNAVTYTTMLKMYFKTKMIEKGLKLFLKMKKEGYTFDGYASCAVVSA  264

Query  1298  LCKAGNMKEALRHLNCTKLMGFDS-NLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----  1134
             L K G  +EA + ++     G  S ++V++N  ++   K G++D    + + ++ K    
Sbjct  265   LIKTGRAEEAYQCMHELVRSGRRSGDIVSYNTLLNLYFKDGDLDAVDDLLEEIESKGLKP  324

Query  1133  DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLH  954
             D +T++ +V+GL   G    A + L      GM+        +IDGL  +G +  A +L 
Sbjct  325   DDYTHTIIVNGLLSIGHTGGAEKHLACLGEMGMQPSVVTCNCLIDGLCKAGHVDRAMRLF  384

Query  953   SELKL  939
             S +++
Sbjct  385   SSMEI  389



>emb|CDY66747.1| BnaA02g36820D [Brassica napus]
Length=465

 Score =   422 bits (1086),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 216/449 (48%), Positives = 301/449 (67%), Gaps = 3/449 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             + STKLLNI +  LCK++ L+KAE+++IDGIR+GV  +VVTYNTLI  Y   VGID  Y+
Sbjct  7     KTSTKLLNICIDSLCKSRNLQKAESLLIDGIRLGVLPNVVTYNTLINGYSRLVGIDEAYA  66

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             + HRM + GIKPDV TYNSLI+ A +   L+R   L +EML  G+ PD  SYNTL+   F
Sbjct  67    VTHRMRDAGIKPDVSTYNSLISGAAKQLSLTRAHQLFDEMLRSGLSPDMLSYNTLISLYF  126

Query  1922  RLGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             R+G+  +A+R   +++    + P   T+NILL  LC +G+ + A+ LF+ +K S   P+L
Sbjct  127   RVGRHGDAFRILNENVHDAGLSPGVDTYNILLDALCKSGHIDNAIELFKHVK-SRVKPEL  185

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             +TYNILI+GLC S R + A  +L EL   GY PNA+TYTT++K  F+++  E+GL++  +
Sbjct  186   MTYNILINGLCKSRRVSSANWMLRELERAGYTPNAVTYTTMLKMYFKTKMIEKGLKLFLK  245

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIEL-DLVAYNTLINLYCKEG  1389
             M+++GY FD +A C V+S LIK GR ++AY C+  ++ +G    D+V+YNTL+NLY K+G
Sbjct  246   MKKEGYTFDGYASCAVVSALIKTGRAEEAYQCMHELVRSGRRSGDIVSYNTLLNLYFKDG  305

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
              LD    L+ E E KG   D YTHTII++GL   G+   A +HL C   MG   ++V  N
Sbjct  306   DLDAVDDLLEEIESKGLKPDDYTHTIIVNGLLSIGHTGGAEKHLACLGEMGMQPSVVTCN  365

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             C IDGLCK G VD A+ +F SM+ +D +TY+S+VH LCK GR   AS+LLL C   GMKI
Sbjct  366   CLIDGLCKAGHVDRAMRLFSSMEIRDEYTYTSVVHNLCKDGRLVCASKLLLLCYNKGMKI  425

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELK  942
               S R+AV+ GL+ +   Q ARK H ++K
Sbjct  426   PSSARRAVLSGLRMTVSYQAARKTHHKIK  454


 Score =   122 bits (307),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 95/365 (26%), Positives = 176/365 (48%), Gaps = 7/365 (2%)
 Frame = -1

Query  2015  LSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNI  1836
             L +   LL + + +G+LP+  +YNTL++   RL   DEAY     +    I P   T+N 
Sbjct  26    LQKAESLLIDGIRLGVLPNVVTYNTLINGYSRLVGIDEAYAVTHRMRDAGIKPDVSTYNS  85

Query  1835  LLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELV-DI  1659
             L+SG        +A  LF E+  SG  P +++YN LI      GR   A R+LNE V D 
Sbjct  86    LISGAAKQLSLTRAHQLFDEMLRSGLSPDMLSYNTLISLYFRVGRHGDAFRILNENVHDA  145

Query  1658  GYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDA  1479
             G +P   TY  ++    +S   +  +++ + ++ +    +   Y  +I+ L K+ R+  A
Sbjct  146   GLSPGVDTYNILLDALCKSGHIDNAIELFKHVKSR-VKPELMTYNILINGLCKSRRVSSA  204

Query  1478  YDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDG  1299
                +  +   G   + V Y T++ +Y K   ++    L ++ +++G+  D Y    ++  
Sbjct  205   NWMLRELERAGYTPNAVTYTTMLKMYFKTKMIEKGLKLFLKMKKEGYTFDGYASCAVVSA  264

Query  1298  LCKAGNMKEALRHLNCTKLMGFDS-NLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----  1134
             L K G  +EA + ++     G  S ++V++N  ++   K G++D    + + ++ K    
Sbjct  265   LIKTGRAEEAYQCMHELVRSGRRSGDIVSYNTLLNLYFKDGDLDAVDDLLEEIESKGLKP  324

Query  1133  DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLH  954
             D +T++ +V+GL   G    A + L      GM+        +IDGL  +G +  A +L 
Sbjct  325   DDYTHTIIVNGLLSIGHTGGAEKHLACLGEMGMQPSVVTCNCLIDGLCKAGHVDRAMRLF  384

Query  953   SELKL  939
             S +++
Sbjct  385   SSMEI  389



>ref|XP_006398363.1| hypothetical protein EUTSA_v10001221mg [Eutrema salsugineum]
 gb|ESQ39816.1| hypothetical protein EUTSA_v10001221mg [Eutrema salsugineum]
Length=471

 Score =   418 bits (1075),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 218/449 (49%), Positives = 303/449 (67%), Gaps = 3/449 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             + STKLLNI V  LCK + LEK E++IIDGIR+GV  DVVTYNTLI  Y  FVGID  Y+
Sbjct  10    KFSTKLLNICVDSLCKFRNLEKVESLIIDGIRLGVLPDVVTYNTLIKGYTRFVGIDEAYA  69

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +  RM E GIKPD++TYNSLI+ A +H +L+R   L +EM +  + PD WSYN LM C F
Sbjct  70    VTRRMREAGIKPDIVTYNSLISGAAKHLLLNRVHQLFDEMRQSLLSPDIWSYNILMSCYF  129

Query  1922  RLGKPDEAYRFF-QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
             +LG+  +A++   +D++   + P   TFNILL  L  +G+T+ A+ LF++LK S   P+L
Sbjct  130   KLGRHGDAFQILNEDVYRAGLSPGVDTFNILLDALFKSGHTDNAIELFKQLK-SRVKPEL  188

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             +TYNILI+GLC S R      +L EL   GY PNA+TYTT++K  F+++R E+GL++  +
Sbjct  189   MTYNILINGLCKSRRMNCVNWMLRELKKSGYTPNAVTYTTMLKLYFKTKRIEKGLELFLK  248

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE-LDLVAYNTLINLYCKEG  1389
             M+ +GY FD +A C V+S LIK GR ++AY+C+  ++ +G    D+V+YNTL+NLY KEG
Sbjct  249   MKEEGYTFDGYANCAVVSALIKTGRAEEAYECMVELVRSGTRSQDIVSYNTLLNLYFKEG  308

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
              LD    ++ E E KG   D YT+TII++GL   G+M+ A +HL C +  G   ++V  N
Sbjct  309   NLDAVDDVLEEIEMKGLKHDDYTNTIIVNGLLSLGHMRGAEKHLACIEERGEQPSVVTCN  368

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             C IDGLCK G VD AL +F+SM  K+ +  +S+VH LCK GR   AS++LLSC   GMKI
Sbjct  369   CLIDGLCKAGHVDRALMLFRSMTVKNEYACTSVVHNLCKDGRIVCASKVLLSCYEMGMKI  428

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELK  942
               S R+AV+ GL+ +   Q AR+   +L+
Sbjct  429   PSSARRAVLSGLRITVSNQAARETDIKLQ  457



>ref|XP_006450549.1| hypothetical protein CICLE_v10008244mg [Citrus clementina]
 gb|ESR63789.1| hypothetical protein CICLE_v10008244mg [Citrus clementina]
 gb|KDO79613.1| hypothetical protein CISIN_1g012782mg [Citrus sinensis]
Length=319

 Score =   402 bits (1032),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 251/314 (80%), Gaps = 0/314 (0%)
 Frame = -1

Query  1871  GDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAP  1692
             GD+ PC  TFNI+L+GLC N YT+ AL +FR L+  GF+P+LVTYNILI GLC +GR   
Sbjct  4     GDLTPCTATFNIMLNGLCKNRYTDNALRMFRGLQKHGFVPELVTYNILIKGLCKAGRLRT  63

Query  1691  ARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVIS  1512
             AR +L EL D G+ PNAITYTTIMKCCFR+R+++ GL+IL  M+RKGY FD F YCTVI+
Sbjct  64    ARWILKELGDSGHAPNAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFGYCTVIA  123

Query  1511  FLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDC  1332
               +K GR+K+A D +  M+ +G++LD+V+YNTLINLYCKEGKL+ AY+L+ E E++GF+C
Sbjct  124   AFVKIGRLKEATDYMEQMVTDGVQLDIVSYNTLINLYCKEGKLEAAYLLLDEMEKQGFEC  183

Query  1331  DKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVF  1152
             DKYTHTI+IDGLCKAGN+K A  HL     +GFDSNL A+NC +D L K G++D+A++VF
Sbjct  184   DKYTHTILIDGLCKAGNIKGARLHLEYMNKIGFDSNLEAYNCIVDRLGKDGKIDHAINVF  243

Query  1151  KSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQ  972
             +SM+ KD FTYSS+VH LCKA R   AS+LLLSC+  G++ILKS ++AV+DGL+HSG  +
Sbjct  244   ESMEVKDSFTYSSMVHNLCKAKRLPSASKLLLSCLKSGVRILKSAQKAVVDGLRHSGCRR  303

Query  971   EARKLHSELKLSKI  930
             EA+K+ S+++++KI
Sbjct  304   EAKKIQSKIRMAKI  317


 Score =   108 bits (269),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 74/289 (26%), Positives = 132/289 (46%), Gaps = 4/289 (1%)
 Frame = -1

Query  2273  TKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILH  2094
             T   NI +  LCK +  + A  +     + G   ++VTYN LI   C    +     IL 
Sbjct  10    TATFNIMLNGLCKNRYTDNALRMFRGLQKHGFVPELVTYNILIKGLCKAGRLRTARWILK  69

Query  2093  RMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLG  1914
              + + G  P+ ITY +++    R+      L++L  M   G   D + Y T++    ++G
Sbjct  70    ELGDSGHAPNAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFGYCTVIAAFVKIG  129

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             +  EA  + + +    +    V++N L++  C  G  E A +L  E++  GF     T+ 
Sbjct  130   RLKEATDYMEQMVTDGVQLDIVSYNTLINLYCKEGKLEAAYLLLDEMEKQGFECDKYTHT  189

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             ILI GLC +G    AR  L  +  IG++ N   Y  I+    +  + +  + + E M  K
Sbjct  190   ILIDGLCKAGNIKGARLHLEYMNKIGFDSNLEAYNCIVDRLGKDGKIDHAINVFESMEVK  249

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
                 DSF Y +++  L KA R+  A   + + + +G+ +   A   +++
Sbjct  250   ----DSFTYSSMVHNLCKAKRLPSASKLLLSCLKSGVRILKSAQKAVVD  294



>gb|KCW47360.1| hypothetical protein EUGRSUZ_K01145 [Eucalyptus grandis]
Length=402

 Score =   402 bits (1034),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/341 (54%), Positives = 252/341 (74%), Gaps = 0/341 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI +A +CK +QL++AE ++ID IR+GV  +VVTYN L+ AYC FVG+ A   +
Sbjct  5     LSTRLLNICIASVCKTQQLQRAEVLLIDAIRLGVLPNVVTYNILVDAYCRFVGMGAALDV  64

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             + RM E GI PDVITYNSL+A +TR   LS  LDL +EMLE+ I PD WSYNTLMHC F+
Sbjct  65    IPRMREAGISPDVITYNSLVAGSTRKRSLSLTLDLFDEMLELSIHPDRWSYNTLMHCFFK  124

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
             +G PDE Y  F+++   +I P   TFNIL++GLC NGY    LMLFR L+  G +P+LVT
Sbjct  125   VGNPDEGYNVFRNLVLSEITPGQDTFNILINGLCKNGYAMHGLMLFRNLQRHGVVPELVT  184

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YN+LI GLC +G+W  A+ ++ EL++   NPNAIT+TT+MKCCF+ +++E+GL++  EM 
Sbjct  185   YNLLIDGLCKAGQWRAAKTMIMELLETDENPNAITFTTVMKCCFKFQKYEQGLEVFLEMA  244

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              +G+ FD F YCT +  LIK GR+++A   +  M+ NGI LDLV+YNTLINL+C+EG+L 
Sbjct  245   NRGHTFDGFGYCTAVGGLIKIGRIEEANRWMDRMLKNGIGLDLVSYNTLINLHCREGRLG  304

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHL  1257
              AY +V E E++G +CD YTH IIIDGLC+A +++  L +L
Sbjct  305   AAYAVVEELEKRGLECDAYTHAIIIDGLCRADHVRRQLCYL  345


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 103/245 (42%), Gaps = 48/245 (20%)
 Frame = -1

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRR  1557
             NI I  +C + +   A  LL + + +G  PN +TY  ++    R       L ++  MR 
Sbjct  11    NICIASVCKTQQLQRAEVLLIDAIRLGVLPNVVTYNILVDAYCRFVGMGAALDVIPRMRE  70

Query  1556  KGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDN  1377
              G   D   Y ++++   +   +    D    M+   I  D  +YNTL++ + K G  D 
Sbjct  71    AGISPDVITYNSLVAGSTRKRSLSLTLDLFDEMLELSIHPDRWSYNTLMHCFFKVGNPDE  130

Query  1376  AYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLM-GFDSNLVAFNCCI  1200
              Y                                   R+L  +++  G D+    FN  I
Sbjct  131   GY--------------------------------NVFRNLVLSEITPGQDT----FNILI  154

Query  1199  DGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             +GLCK G   + L +F+++       +  TY+ L+ GLCKAG++R A  ++       M+
Sbjct  155   NGLCKNGYAMHGLMLFRNLQRHGVVPELVTYNLLIDGLCKAGQWRAAKTMI-------ME  207

Query  1031  ILKSD  1017
             +L++D
Sbjct  208   LLETD  212



>dbj|BAB08912.1| unnamed protein product [Arabidopsis thaliana]
Length=431

 Score =   401 bits (1030),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 211/446 (47%), Positives = 286/446 (64%), Gaps = 36/446 (8%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             +STKLLNI+V  LCK + LE+AET++IDGIR+GV  DV+TYNTLI  Y  F+GID  Y++
Sbjct  11    ISTKLLNISVNSLCKFRNLERAETLLIDGIRLGVLPDVITYNTLIKGYTRFIGIDEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM E GI+PDV TYNSLI+ A ++ ML+R L L +EML  G+ PD WSYNTLM C F+
Sbjct  71    TRRMREAGIEPDVTTYNSLISGAAKNLMLNRVLQLFDEMLHSGLSPDMWSYNTLMSCYFK  130

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
             LG+  EA++   +             +I L+G    G+T+ A+ LF+ LK S   P+L+T
Sbjct  131   LGRHGEAFKILHE-------------DIHLAG----GHTDNAIELFKHLK-SRVKPELMT  172

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YNILI+GLC S R      ++ EL   GY PNA+TYTT++K  F+++R E+GLQ+  +M+
Sbjct  173   YNILINGLCKSRRVGSVDWMMRELKKSGYTPNAVTYTTMLKMYFKTKRIEKGLQLFLKMK  232

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
             ++GY FD FA C V+S LIK GR ++AY+C+  ++ +                  +G LD
Sbjct  233   KEGYTFDGFANCAVVSALIKTGRAEEAYECMHELVRS------------------DGNLD  274

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
                 L+ E E KG   D YTHTII++GL   GN   A +HL C   MG   ++V  NC I
Sbjct  275   AVDDLLEEIEMKGLKPDDYTHTIIVNGLLNIGNTGGAEKHLACIGEMGMQPSVVTCNCLI  334

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             DGLCK G VD A+ +F SM+ +D FTY+S+VH LCK GR   AS+LLLSC   GMKI  S
Sbjct  335   DGLCKAGHVDRAMRLFASMEVRDEFTYTSVVHNLCKDGRLVCASKLLLSCYNKGMKIPSS  394

Query  1019  DRQAVIDGLQHSGFIQEARKLHSELK  942
              R+AV+ G++ +   Q ARK H ++K
Sbjct  395   ARRAVLSGIRETVSYQAARKTHIKIK  420


 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 86/356 (24%), Positives = 162/356 (46%), Gaps = 37/356 (10%)
 Frame = -1

Query  1952  SYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFREL  1773
             S N+L  C FR    + A     D     + P  +T+N L+ G       ++A  + R +
Sbjct  19    SVNSL--CKFR--NLERAETLLIDGIRLGVLPDVITYNTLIKGYTRFIGIDEAYAVTRRM  74

Query  1772  KHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRF  1593
             + +G  P + TYN LI G   +       +L +E++  G +P+  +Y T+M C F+  R 
Sbjct  75    REAGIEPDVTTYNSLISGAAKNLMLNRVLQLFDEMLHSGLSPDMWSYNTLMSCYFKLGRH  134

Query  1592  EEGLQIL-EEMRRKGYIFDS----------------FAYCTVISFLIKAGRMKDAYDCVG  1464
              E  +IL E++   G   D+                  Y  +I+ L K+ R+      + 
Sbjct  135   GEAFKILHEDIHLAGGHTDNAIELFKHLKSRVKPELMTYNILINGLCKSRRVGSVDWMMR  194

Query  1463  NMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAG  1284
              +  +G   + V Y T++ +Y K  +++    L ++ +++G+  D + +  ++  L K G
Sbjct  195   ELKKSGYTPNAVTYTTMLKMYFKTKRIEKGLQLFLKMKKEGYTFDGFANCAVVSALIKTG  254

Query  1283  NMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVH  1104
               +EA   ++  +L+  D NL A    +D L +  E+       K +   D +T++ +V+
Sbjct  255   RAEEAYECMH--ELVRSDGNLDA----VDDLLEEIEM-------KGLKPDD-YTHTIIVN  300

Query  1103  GLCKAGRFRVASELLLSCIIG-GMKILKSDRQAVIDGLQHSGFIQEARKLHSELKL  939
             GL   G     +E  L+CI   GM+        +IDGL  +G +  A +L + +++
Sbjct  301   GLLNIGNTG-GAEKHLACIGEMGMQPSVVTCNCLIDGLCKAGHVDRAMRLFASMEV  355



>gb|KGN50380.1| hypothetical protein Csa_5G171145 [Cucumis sativus]
Length=403

 Score =   389 bits (1000),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 262/403 (65%), Gaps = 8/403 (2%)
 Frame = -1

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +DA YS+ H+M + GI P+V  Y SL+A+A+R+  L +CL+L  EML++GI PD WSY T
Sbjct  1     MDAAYSVFHKMRDAGITPNVFIYTSLMAAASRNSSLEQCLNLFHEMLQLGITPDVWSYTT  60

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             L HC  ++GKPDEA   F D    D  P P TF++++ G C  GYT  A+ LFR L+  G
Sbjct  61    LTHCFLKVGKPDEANSIFLDFILKDHSPNPATFDVMIFGFCSCGYTSNAITLFRNLQSHG  120

Query  1760  FIPQLVTYNILIHGLCNSGR-------WAPARRLLNELVDIGYNPNAITYTTIMKCCFRS  1602
              +P+ VTY+IL+ GLC + R       +  A  + NE +D G+ P++ TY  +MKCCF+ 
Sbjct  121   LVPKFVTYDILLTGLCKAARLNVSVSMFNEAMSMFNEAIDSGFEPDSTTYIALMKCCFKF  180

Query  1601  RRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAY  1422
             R ++ G +I  EM+ KG  F+ F Y T I  L++ GR+++A   +  MI NG+  +LV Y
Sbjct  181   REYQHGFEIFFEMKNKGLAFNGFGYYTAIGALLRLGRLEEAKFFMVEMIKNGVVFNLVFY  240

Query  1421  NTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKL  1242
             NT++NLYCK GKL+ A+ ++ + E +G  C+ YTH II DGLCK GN + A RHLN    
Sbjct  241   NTVVNLYCKHGKLEAAHKMLDKIESRGLQCNDYTHAIITDGLCKVGNFEGARRHLNYIYP  300

Query  1241  MGF-DSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASE  1065
              GF +SN+VA +C ID LCK G++D A+ +F+ M+ KD + Y+SL+H LCKA RF  AS+
Sbjct  301   TGFTNSNVVASSCLIDRLCKAGQIDQAMQLFELMETKDPYVYTSLMHNLCKARRFLCASK  360

Query  1064  LLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
             LLL C+  G+ + +S + AVI GL   GF  EARKL   + LS
Sbjct  361   LLLDCLRSGISVFRSTQCAVIFGLCSFGFTSEARKLKPFIHLS  403


 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 73/340 (21%), Positives = 139/340 (41%), Gaps = 20/340 (6%)
 Frame = -1

Query  2246  CLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKP  2067
             C  K  + ++A ++ +D I      +  T++ +I  +C         ++   +   G+ P
Sbjct  64    CFLKVGKPDEANSIFLDFILKDHSPNPATFDVMIFGFCSCGYTSNAITLFRNLQSHGLVP  123

Query  2066  DVITYNSLIASATRHG-------MLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
               +TY+ L+    +         M +  + +  E ++ G  PD+ +Y  LM C F+  + 
Sbjct  124   KFVTYDILLTGLCKAARLNVSVSMFNEAMSMFNEAIDSGFEPDSTTYIALMKCCFKFREY  183

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
                +  F ++    +      +   +  L   G  E+A     E+  +G +  LV YN +
Sbjct  184   QHGFEIFFEMKNKGLAFNGFGYYTAIGALLRLGRLEEAKFFMVEMIKNGVVFNLVFYNTV  243

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             ++  C  G+   A ++L+++   G   N  T+  I     +   FE   + L  +   G+
Sbjct  244   VNLYCKHGKLEAAHKMLDKIESRGLQCNDYTHAIITDGLCKVGNFEGARRHLNYIYPTGF  303

Query  1547  IFDS-FAYCTVISFLIKAGRMKDAYDCVGNMIMNGIEL----DLVAYNTLINLYCKEGKL  1383
                +  A   +I  L KAG++  A        M   EL    D   Y +L++  CK  + 
Sbjct  304   TNSNVVASSCLIDRLCKAGQIDQA--------MQLFELMETKDPYVYTSLMHNLCKARRF  355

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALR  1263
               A  L+++  R G    + T   +I GLC  G   EA +
Sbjct  356   LCASKLLLDCLRSGISVFRSTQCAVIFGLCSFGFTSEARK  395


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 70/271 (26%), Positives = 116/271 (43%), Gaps = 16/271 (6%)
 Frame = -1

Query  2261  NITVACLCKAKQLE-------KAETVIIDGIRVGVPADVVTYNTLITAYCCFV--GIDAG  2109
             +I +  LCKA +L        +A ++  + I  G   D  TY  L+   CCF       G
Sbjct  129   DILLTGLCKAARLNVSVSMFNEAMSMFNEAIDSGFEPDSTTYIALMK--CCFKFREYQHG  186

Query  2108  YSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHC  1929
             + I   M   G+  +   Y + I +  R G L      + EM++ G++ +   YNT+++ 
Sbjct  187   FEIFFEMKNKGLAFNGFGYYTAIGALLRLGRLEEAKFFMVEMIKNGVVFNLVFYNTVVNL  246

Query  1928  LFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFI-P  1752
               + GK + A++    I    +     T  I+  GLC  G  E A      +  +GF   
Sbjct  247   YCKHGKLEAAHKMLDKIESRGLQCNDYTHAIITDGLCKVGNFEGARRHLNYIYPTGFTNS  306

Query  1751  QLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQIL  1572
              +V  + LI  LC +G+   A +L  EL++     +   YT++M    ++RRF    ++L
Sbjct  307   NVVASSCLIDRLCKAGQIDQAMQLF-ELME---TKDPYVYTSLMHNLCKARRFLCASKLL  362

Query  1571  EEMRRKGYIFDSFAYCTVISFLIKAGRMKDA  1479
              +  R G        C VI  L   G   +A
Sbjct  363   LDCLRSGISVFRSTQCAVIFGLCSFGFTSEA  393



>emb|CAA17134.1| putative protein [Arabidopsis thaliana]
 emb|CAB78793.1| putative protein [Arabidopsis thaliana]
Length=1208

 Score =   411 bits (1056),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 221/452 (49%), Positives = 290/452 (64%), Gaps = 38/452 (8%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LST+LLNI V  LCK ++LEKAE++IIDGIR+GV  DVVTYNTLI+ YC FVGI+  Y++
Sbjct  11    LSTRLLNICVDSLCKFRKLEKAESLIIDGIRLGVDPDVVTYNTLISGYCRFVGIEEAYAV  70

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
               RM + GI+PDV TYNSLIA A R  ML   L L +EMLE GI PD WSYNTLM C F+
Sbjct  71    TRRMRDAGIRPDVATYNSLIAGAARRLMLDHVLYLFDEMLEWGIYPDLWSYNTLMCCYFK  130

Query  1919  LGKPDEAYR-FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             LGK +EA+R  ++D+    + P                  + AL LF+E++ S F P+L+
Sbjct  131   LGKHEEAFRVLYKDLQLAGLNP------------------DNALELFKEMQ-SRFKPELM  171

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TYNILI+GLC S R   A+ +L EL   GY PNA+TYTTI+K  F++RR   GLQ+  EM
Sbjct  172   TYNILINGLCKSRRVGTAKWMLTELKKSGYTPNAVTYTTILKLYFKTRRIRRGLQLFLEM  231

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
             +R+GY +D +AY  V+S LIK GR K+AY+ +  ++                   K+G L
Sbjct  232   KREGYTYDGYAYFAVVSALIKTGRTKEAYEYMQELVR------------------KDGNL  273

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D    L+ E ER+G   D+YTHTII++GL + G  + A  H      MG   NLV  NC 
Sbjct  274   DAVDDLLGEIERRGMKADEYTHTIIVNGLLRTGQTRRAEEHFVSMGEMGIGLNLVTCNCL  333

Query  1202  IDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             +DGLCK G VD A+  F+SM+ KD +TY+S+VH LCK  RF  AS+LLLSC   G+KI  
Sbjct  334   VDGLCKAGHVDRAMRYFESMEVKDEYTYTSVVHNLCKDMRFVCASKLLLSCYNKGIKIPT  393

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             S R+AV+ GL+ SG   EARK  +E+KL+ ++
Sbjct  394   SARRAVLSGLRMSGCYGEARKAKAEMKLTLVI  425



>gb|EMT13221.1| hypothetical protein F775_05352 [Aegilops tauschii]
Length=390

 Score =   375 bits (962),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/389 (47%), Positives = 254/389 (65%), Gaps = 0/389 (0%)
 Frame = -1

Query  2090  MNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGK  1911
             M E G+ PD +TYNSLIA A R G+  R LDL +EML+ G+ PD WSYN LMHCLFR G 
Sbjct  1     MREAGVSPDAVTYNSLIAGAARRGLTMRALDLFDEMLQAGVAPDAWSYNALMHCLFRSGH  60

Query  1910  PDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNI  1731
             P++AYR F D+    + PC  T+N LL GL   G+   A  +FR L+ +G    +VTYN 
Sbjct  61    PEDAYRVFADMAEKGVAPCATTYNTLLDGLFRFGHATNAYRMFRYLQRTGLPVGIVTYNT  120

Query  1730  LIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKG  1551
             +I+GLC SG+   AR +L EL    + PN +TYTT+MKCCF+  RF++GL+    +   G
Sbjct  121   MINGLCKSGKVGYARMVLRELGRTEHAPNVVTYTTVMKCCFKYGRFDQGLETFLSLLDGG  180

Query  1550  YIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAY  1371
             YI D F YCTVIS L+K GRM++A      MI +G  LD   YNTLI L  +EGKLD+A+
Sbjct  181   YIPDLFPYCTVISALVKKGRMEEANTYSELMIRSGFRLDSACYNTLIYLRFQEGKLDDAF  240

Query  1370  MLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGL  1191
              L+   E  G + D+YT +I+++GL K G+ + A + L   ++   +SN+VA+NC +D L
Sbjct  241   ELLSMMEEGGLESDEYTFSILVNGLSKMGHFEAAHKQLCYMEIRDMESNIVAYNCLVDAL  300

Query  1190  CKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQ  1011
             CK  EVD A+ +  +M  KD FTY+SLVHGLCK GR+ +AS+ L  C+  G  +L S ++
Sbjct  301   CKSDEVDAAIKLLHNMKLKDDFTYTSLVHGLCKVGRYHMASKFLRICLREGNSVLASAKR  360

Query  1010  AVIDGLQHSGFIQEARKLHSELKLSKILN  924
             AVI GL+ +GF  + RK+ + L+++++L 
Sbjct  361   AVIAGLRSAGFQNDVRKVRAALRMARLLK  389


 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/335 (24%), Positives = 141/335 (42%), Gaps = 39/335 (12%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  + CL ++   E A  V  D    GV     TYNTL+     F      Y +   +  
Sbjct  49    NALMHCLFRSGHPEDAYRVFADMAEKGVAPCATTYNTLLDGLFRFGHATNAYRMFRYLQR  108

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G+   ++TYN++I    + G +     +L E+      P+  +Y T+M C F+ G+ D+
Sbjct  109   TGLPVGIVTYNTMINGLCKSGKVGYARMVLRELGRTEHAPNVVTYTTVMKCCFKYGRFDQ  168

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
                               TF  LL G                    G+IP L  Y  +I 
Sbjct  169   GLE---------------TFLSLLDG--------------------GYIPDLFPYCTVIS  193

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              L   GR   A      ++  G+  ++  Y T++   F+  + ++  ++L  M   G   
Sbjct  194   ALVKKGRMEEANTYSELMIRSGFRLDSACYNTLIYLRFQEGKLDDAFELLSMMEEGGLES  253

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D + +  +++ L K G  + A+  +  M +  +E ++VAYN L++  CK  ++D A  L+
Sbjct  254   DEYTFSILVNGLSKMGHFEAAHKQLCYMEIRDMESNIVAYNCLVDALCKSDEVDAAIKLL  313

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHL  1257
                + K    D +T+T ++ GLCK G    A + L
Sbjct  314   HNMKLK----DDFTYTSLVHGLCKVGRYHMASKFL  344



>gb|KHN26225.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=431

 Score =   342 bits (877),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 197/521 (38%), Positives = 285/521 (55%), Gaps = 106/521 (20%)
 Frame = -1

Query  2489  SRRLLSHINLLNSPAGQPSPADMFVCYLRRSQSSPRLPLAASALQLATRTCPMLRLGD*H  2310
             SR +L  +  L++P+     +     +L+R      L +A  +L   ++T P+       
Sbjct  16    SRTMLPRVFRLSTPSAPQRLSLSLFPFLKR------LVVAPLSLWGDSKTMPLWA-----  64

Query  2309  LE*MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCC  2130
                   +K  L+TK LNITV+ LCKAKQ+ KA+T I+DGIR+G+  D VTYN LI AYC 
Sbjct  65    -----PLKPTLNTKPLNITVSSLCKAKQIPKAKTAIVDGIRLGLLPDAVTYNPLIDAYCR  119

Query  2129  FVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWS  1950
             F  +D  YS+L  M++ GI  D++++N LI+ A R  + S+ LDL +EML  GI PD WS
Sbjct  120   FATLDVAYSVLAPMHDAGIPHDIVSFNMLISGAVRKSLFSKSLDLFDEMLNRGIWPDAWS  179

Query  1949  YNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELK  1770
             +  LMHC                                      NG     L LFR L+
Sbjct  180   HTILMHC--------------------------------------NG-----LSLFRNLQ  196

Query  1769  HSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFE  1590
               GF+PQ++TYN LI+GLC + R   +R+++ E  + GY P+A                 
Sbjct  197   RHGFVPQVLTYNALINGLCKARRLKDSRKVMKEFGEYGYEPDA-----------------  239

Query  1589  EGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLI  1410
                     MR  G+ FD FAYC VI+ +IK GRM++A +    M                
Sbjct  240   --------MRSLGFAFDGFAYCMVIAAMIKTGRMQEAEEIFEMM----------------  275

Query  1409  NLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFD  1230
                   G+LD+   L+ E E KG +CD+YTHTII+DGLC+AGN   A RHLN    +GF 
Sbjct  276   ------GRLDDVLRLLDEIEGKGLECDQYTHTIIVDGLCQAGNFVGAQRHLNYMNTLGFG  329

Query  1229  SNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSC  1050
              NLVAFNC ++GL KVG +D+AL +FK M+ KD FTY+ +VH LC+A +F  AS++L+SC
Sbjct  330   YNLVAFNCLLNGLGKVGYIDHALRLFKVMEVKDSFTYTIVVHNLCRAKQFLCASKVLVSC  389

Query  1049  IIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             +  G ++L++ ++ VI  LQ  G+  EAR++ S ++L++ +
Sbjct  390   LKCGYQVLRATQREVIVCLQSIGYANEARRVKSRIRLAQFV  430



>ref|XP_002308767.2| hypothetical protein POPTR_0006s00830g, partial [Populus trichocarpa]
 gb|EEE92290.2| hypothetical protein POPTR_0006s00830g, partial [Populus trichocarpa]
Length=342

 Score =   273 bits (697),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 210/348 (60%), Gaps = 39/348 (11%)
 Frame = -1

Query  2051  NSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFW  1872
             N  IAS  +   L R   ++ + + +G+LPD  +YNTL++   R    D AY     +  
Sbjct  32    NICIASFCKAKHLQRAETVIIDGVRLGVLPDVVTYNTLINAYSRFVSFDAAYSVLDRMKE  91

Query  1871  GDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAP  1692
               I P                          +++H GF+P LVTYNILI+GLC + +   
Sbjct  92    ASIKP--------------------------DIRH-GFVPSLVTYNILINGLCKAWKLKT  124

Query  1691  ARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVIS  1512
             AR +L EL   G  PN ITYTT+M+CCFRSRRFE+GL+I EEM  KGY FD FAYCTV+ 
Sbjct  125   ARWMLKELGASGLVPNVITYTTVMRCCFRSRRFEQGLEIFEEMIDKGYTFDGFAYCTVVG  184

Query  1511  FLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDC  1332
              L+K  R+++A   +  M+   I LD+ +YNTLINLYCK GKL+ A+ ++ + E++GF+ 
Sbjct  185   ALVKTCRIEEASHYMERMVNTDIGLDMASYNTLINLYCKGGKLEMAHGVLDKMEKEGFER  244

Query  1331  DKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVF  1152
             D+YT+TI+++GLC+ G+++ A+ ++N   + GF+SNLVA N  +D  CK  ++DYA  +F
Sbjct  245   DEYTNTILMNGLCEEGDVEGAMEYMN---VAGFNSNLVALNTMVDRWCKADQIDYAFKIF  301

Query  1151  KSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQA  1008
              SMD +D FTYSSL+H LCK GR           I+  M+ L  DR+ 
Sbjct  302   DSMDMRDSFTYSSLIHNLCKVGR---------KDILPTMQTLMDDRRT  340


 Score =   160 bits (406),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/345 (30%), Positives = 171/345 (50%), Gaps = 50/345 (14%)
 Frame = -1

Query  2294  RIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGID  2115
             R+  R ST+ LNI +A  CKAK L++AETVIIDG+R+GV  DVVTYNTLI AY  FV  D
Sbjct  21    RLFVRSSTRFLNICIASFCKAKHLQRAETVIIDGVRLGVLPDVVTYNTLINAYSRFVSFD  80

Query  2114  AGYSILHRMNEVGIKPDV--------ITYNSLIASATRHGMLSRCLDLLEEMLEVGILPD  1959
             A YS+L RM E  IKPD+        +TYN LI    +   L     +L+E+   G++P+
Sbjct  81    AAYSVLDRMKEASIKPDIRHGFVPSLVTYNILINGLCKAWKLKTARWMLKELGASGLVPN  140

Query  1958  TWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFR  1779
               +Y T+M C FR      + RF                             E+ L +F 
Sbjct  141   VITYTTVMRCCFR------SRRF-----------------------------EQGLEIFE  165

Query  1778  ELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSR  1599
             E+   G+      Y  ++  L  + R   A   +  +V+     +  +Y T++    +  
Sbjct  166   EMIDKGYTFDGFAYCTVVGALVKTCRIEEASHYMERMVNTDIGLDMASYNTLINLYCKGG  225

Query  1598  RFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYN  1419
             + E    +L++M ++G+  D +    +++ L + G ++ A +    M + G   +LVA N
Sbjct  226   KLEMAHGVLDKMEKEGFERDEYTNTILMNGLCEEGDVEGAME---YMNVAGFNSNLVALN  282

Query  1418  TLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAG  1284
             T+++ +CK  ++D A+ +    + +    D +T++ +I  LCK G
Sbjct  283   TMVDRWCKADQIDYAFKIFDSMDMR----DSFTYSSLIHNLCKVG  323



>ref|XP_002991129.1| hypothetical protein SELMODRAFT_236212 [Selaginella moellendorffii]
 gb|EFJ07775.1| hypothetical protein SELMODRAFT_236212 [Selaginella moellendorffii]
Length=614

 Score =   239 bits (610),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 156/462 (34%), Positives = 238/462 (52%), Gaps = 25/462 (5%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRV-------GVPADVVTYNTLITAYCCFVGIDAG  2109
             L +I +  LCKAK+        ID +R        G+ AD V Y  L++       +D  
Sbjct  46    LCSILIDGLCKAKR-------SIDALRCFRAMQGSGIVADTVIYTALLSGLWKEKRLDQA  98

Query  2108  YSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHC  1929
              +ILH M + G +P+V+TYNSLI    ++    R  +L E M  V   P   +YNTL+  
Sbjct  99    LAILHEMRDHGCEPNVVTYNSLIDGLCKNNEPDRAQELFEHMKSVECSPSMVTYNTLLDG  158

Query  1928  LFRLGKPDEAYRFFQDIF---WGDI----PPCPVTFNILLSGLCMNGYTEKALMLFRELK  1770
             LFR GK + A   FQ++      D+     P  +T+++L+ GLC      +A+ L   +K
Sbjct  159   LFRTGKLERAMALFQEMLDRRSHDMDDRCSPNVITYSVLIDGLCKANRVSQAVELLESMK  218

Query  1769  HSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFE  1590
               G  P ++TY IL+ GLC   + A A  +L E++D G  PN +TY +++    R+RR  
Sbjct  219   ARGCSPDVITYTILVDGLCKESKVAAAWEVLREMLDAGCVPNLVTYNSLLHGLCRARRVS  278

Query  1589  EGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLI  1410
             + L ++ +M  +G   +   Y T+I  L K GR+KDA   + +MI  G   DL+ YN LI
Sbjct  279   DALALMRDMTCRGCTPNVVTYGTLIDGLCKVGRVKDACAMLADMIDKGGTPDLMIYNMLI  338

Query  1409  NLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFD  1230
             N  CK  ++D +  L+  A   G   D  T++ +I GLC++  + EA R L   K  G  
Sbjct  339   NGLCKADQVDESIALLRRAVSGGIKPDVVTYSSVIYGLCRSNRLDEACRLLLYVKSRGCP  398

Query  1229  SNLVAFNCCIDGLCKVGEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASEL  1062
              +++ ++  IDGLCK G+VD A  +++ M     + D  TYS+L+ GLCKAGR   A  L
Sbjct  399   PDVILYSTLIDGLCKAGKVDEAFDLYEVMAGDGCDADVVTYSTLIDGLCKAGRVDEAHLL  458

Query  1061  LLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
             L   +  G         ++I GL     + EA +L  E++ S
Sbjct  459   LARMVRMGTPPSTMTYNSLIKGLCDLNHLDEAIELVEEMERS  500


 Score =   204 bits (520),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 124/414 (30%), Positives = 208/414 (50%), Gaps = 9/414 (2%)
 Frame = -1

Query  2171  DVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLL  1992
             +V+TY+ LI   C    +     +L  M   G  PDVITY  L+    +   ++   ++L
Sbjct  190   NVITYSVLIDGLCKANRVSQAVELLESMKARGCSPDVITYTILVDGLCKESKVAAAWEVL  249

Query  1991  EEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMN  1812
              EML+ G +P+  +YN+L+H L R  +  +A    +D+      P  VT+  L+ GLC  
Sbjct  250   REMLDAGCVPNLVTYNSLLHGLCRARRVSDALALMRDMTCRGCTPNVVTYGTLIDGLCKV  309

Query  1811  GYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITY  1632
             G  + A  +  ++   G  P L+ YN+LI+GLC + +   +  LL   V  G  P+ +TY
Sbjct  310   GRVKDACAMLADMIDKGGTPDLMIYNMLINGLCKADQVDESIALLRRAVSGGIKPDVVTY  369

Query  1631  TTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIM  1452
             ++++    RS R +E  ++L  ++ +G   D   Y T+I  L KAG++ +A+D    M  
Sbjct  370   SSVIYGLCRSNRLDEACRLLLYVKSRGCPPDVILYSTLIDGLCKAGKVDEAFDLYEVMAG  429

Query  1451  NGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKE  1272
             +G + D+V Y+TLI+  CK G++D A++L+    R G      T+  +I GLC   ++ E
Sbjct  430   DGCDADVVTYSTLIDGLCKAGRVDEAHLLLARMVRMGTPPSTMTYNSLIKGLCDLNHLDE  489

Query  1271  ALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK---------DCFTY  1119
             A+  +   +      + V +N  I G+C++  VD A+ + +    +         D   Y
Sbjct  490   AIELVEEMERSNCAPSAVTYNILIHGMCRMERVDSAVVLLEQAKARCVAAGGTALDTIAY  549

Query  1118  SSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
             SSL+ GLCKAGR   A +     I  G+         +++GL+ S  + E R L
Sbjct  550   SSLIDGLCKAGRVAEALDYFQEMIDNGVIPDHITYSILLEGLKKSKDLHELRHL  603


 Score =   193 bits (490),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 139/484 (29%), Positives = 224/484 (46%), Gaps = 51/484 (11%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             L K K+L++A  ++ +    G   +VVTYN+LI   C     D    +   M  V   P 
Sbjct  89    LWKEKRLDQALAILHEMRDHGCEPNVVTYNSLIDGLCKNNEPDRAQELFEHMKSVECSPS  148

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVG-------ILPDTWSYNTLMHCLFRLGKPD  1905
             ++TYN+L+    R G L R + L +EML+           P+  +Y+ L+  L +  +  
Sbjct  149   MVTYNTLLDGLFRTGKLERAMALFQEMLDRRSHDMDDRCSPNVITYSVLIDGLCKANRVS  208

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             +A    + +      P  +T+ IL+ GLC       A  + RE+  +G +P LVTYN L+
Sbjct  209   QAVELLESMKARGCSPDVITYTILVDGLCKESKVAAAWEVLREMLDAGCVPNLVTYNSLL  268

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             HGLC + R + A  L+ ++   G  PN +TY T++    +  R ++   +L +M  KG  
Sbjct  269   HGLCRARRVSDALALMRDMTCRGCTPNVVTYGTLIDGLCKVGRVKDACAMLADMIDKGGT  328

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYN------------------  1419
              D   Y  +I+ L KA ++ ++   +   +  GI+ D+V Y+                  
Sbjct  329   PDLMIYNMLINGLCKADQVDESIALLRRAVSGGIKPDVVTYSSVIYGLCRSNRLDEACRL  388

Query  1418  -----------------TLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCK  1290
                              TLI+  CK GK+D A+ L       G D D  T++ +IDGLCK
Sbjct  389   LLYVKSRGCPPDVILYSTLIDGLCKAGKVDEAFDLYEVMAGDGCDADVVTYSTLIDGLCK  448

Query  1289  AGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDC----FT  1122
             AG + EA   L     MG   + + +N  I GLC +  +D A+ + + M+  +C     T
Sbjct  449   AGRVDEAHLLLARMVRMGTPPSTMTYNSLIKGLCDLNHLDEAIELVEEMERSNCAPSAVT  508

Query  1121  YSSLVHGLCKAGRFRVASELL----LSCIIGGMKILKS-DRQAVIDGLQHSGFIQEARKL  957
             Y+ L+HG+C+  R   A  LL      C+  G   L +    ++IDGL  +G + EA   
Sbjct  509   YNILIHGMCRMERVDSAVVLLEQAKARCVAAGGTALDTIAYSSLIDGLCKAGRVAEALDY  568

Query  956   HSEL  945
               E+
Sbjct  569   FQEM  572


 Score =   171 bits (434),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 119/417 (29%), Positives = 200/417 (48%), Gaps = 11/417 (3%)
 Frame = -1

Query  2171  DVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLL  1992
             DV TY  L+  +C    ID        M    + P+V   + LI    +       L   
Sbjct  8     DVYTYAALLRGFCRGGEIDQAQRCFDEMRSKNLVPNVFLCSILIDGLCKAKRSIDALRCF  67

Query  1991  EEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMN  1812
               M   GI+ DT  Y  L+  L++  + D+A     ++      P  VT+N L+ GLC N
Sbjct  68    RAMQGSGIVADTVIYTALLSGLWKEKRLDQALAILHEMRDHGCEPNVVTYNSLIDGLCKN  127

Query  1811  GYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGY-------  1653
                ++A  LF  +K     P +VTYN L+ GL  +G+   A  L  E++D          
Sbjct  128   NEPDRAQELFEHMKSVECSPSMVTYNTLLDGLFRTGKLERAMALFQEMLDRRSHDMDDRC  187

Query  1652  NPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYD  1473
             +PN ITY+ ++    ++ R  + +++LE M+ +G   D   Y  ++  L K  ++  A++
Sbjct  188   SPNVITYSVLIDGLCKANRVSQAVELLESMKARGCSPDVITYTILVDGLCKESKVAAAWE  247

Query  1472  CVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLC  1293
              +  M+  G   +LV YN+L++  C+  ++ +A  L+ +   +G   +  T+  +IDGLC
Sbjct  248   VLREMLDAGCVPNLVTYNSLLHGLCRARRVSDALALMRDMTCRGCTPNVVTYGTLIDGLC  307

Query  1292  KAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMD----EKDCF  1125
             K G +K+A   L      G   +L+ +N  I+GLCK  +VD ++++ +       + D  
Sbjct  308   KVGRVKDACAMLADMIDKGGTPDLMIYNMLINGLCKADQVDESIALLRRAVSGGIKPDVV  367

Query  1124  TYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLH  954
             TYSS+++GLC++ R   A  LLL     G          +IDGL  +G + EA  L+
Sbjct  368   TYSSVIYGLCRSNRLDEACRLLLYVKSRGCPPDVILYSTLIDGLCKAGKVDEAFDLY  424


 Score =   163 bits (413),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 112/383 (29%), Positives = 188/383 (49%), Gaps = 11/383 (3%)
 Frame = -1

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             +PDV TY +L+    R G + +     +EM    ++P+ +  + L+  L +  +  +A R
Sbjct  6     QPDVYTYAALLRGFCRGGEIDQAQRCFDEMRSKNLVPNVFLCSILIDGLCKAKRSIDALR  65

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
              F+ +    I    V +  LLSGL      ++AL +  E++  G  P +VTYN LI GLC
Sbjct  66    CFRAMQGSGIVADTVIYTALLSGLWKEKRLDQALAILHEMRDHGCEPNVVTYNSLIDGLC  125

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM-RRKGYIFDS  1536
              +     A+ L   +  +  +P+ +TY T++   FR+ + E  + + +EM  R+ +  D 
Sbjct  126   KNNEPDRAQELFEHMKSVECSPSMVTYNTLLDGLFRTGKLERAMALFQEMLDRRSHDMDD  185

Query  1535  ------FAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
                     Y  +I  L KA R+  A + + +M   G   D++ Y  L++  CKE K+  A
Sbjct  186   RCSPNVITYSVLIDGLCKANRVSQAVELLESMKARGCSPDVITYTILVDGLCKESKVAAA  245

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
             + ++ E    G   +  T+  ++ GLC+A  + +AL  +      G   N+V +   IDG
Sbjct  246   WEVLREMLDAGCVPNLVTYNSLLHGLCRARRVSDALALMRDMTCRGCTPNVVTYGTLIDG  305

Query  1193  LCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
             LCKVG V  A ++   M +K    D   Y+ L++GLCKA +   +  LL   + GG+K  
Sbjct  306   LCKVGRVKDACAMLADMIDKGGTPDLMIYNMLINGLCKADQVDESIALLRRAVSGGIKPD  365

Query  1025  KSDRQAVIDGLQHSGFIQEARKL  957
                  +VI GL  S  + EA +L
Sbjct  366   VVTYSSVIYGLCRSNRLDEACRL  388


 Score =   144 bits (364),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/301 (32%), Positives = 148/301 (49%), Gaps = 5/301 (2%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             LCK  +++ A  ++ D I  G   D++ YN LI   C    +D   ++L R    GIKPD
Sbjct  306   LCKVGRVKDACAMLADMIDKGGTPDLMIYNMLINGLCKADQVDESIALLRRAVSGGIKPD  365

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             V+TY+S+I    R   L     LL  +   G  PD   Y+TL+  L + GK DEA+  ++
Sbjct  366   VVTYSSVIYGLCRSNRLDEACRLLLYVKSRGCPPDVILYSTLIDGLCKAGKVDEAFDLYE  425

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
              +         VT++ L+ GLC  G  ++A +L   +   G  P  +TYN LI GLC+  
Sbjct  426   VMAGDGCDADVVTYSTLIDGLCKAGRVDEAHLLLARMVRMGTPPSTMTYNSLIKGLCDLN  485

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK-----GYIFD  1539
                 A  L+ E+      P+A+TY  ++    R  R +  + +LE+ + +     G   D
Sbjct  486   HLDEAIELVEEMERSNCAPSAVTYNILIHGMCRMERVDSAVVLLEQAKARCVAAGGTALD  545

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVV  1359
             + AY ++I  L KAGR+ +A D    MI NG+  D + Y+ L+    K   L     LV+
Sbjct  546   TIAYSSLIDGLCKAGRVAEALDYFQEMIDNGVIPDHITYSILLEGLKKSKDLHELRHLVL  605

Query  1358  E  1356
             +
Sbjct  606   D  606


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (47%), Gaps = 5/130 (4%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M R+ +  ST   N  +  LC    L++A  ++ +  R       VTYN LI   C    
Sbjct  462   MVRMGTPPSTMTYNSLIKGLCDLNHLDEAIELVEEMERSNCAPSAVTYNILIHGMCRMER  521

Query  2120  IDAGYSILHRMNEV-----GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDT  1956
             +D+   +L +         G   D I Y+SLI    + G ++  LD  +EM++ G++PD 
Sbjct  522   VDSAVVLLEQAKARCVAAGGTALDTIAYSSLIDGLCKAGRVAEALDYFQEMIDNGVIPDH  581

Query  1955  WSYNTLMHCL  1926
              +Y+ L+  L
Sbjct  582   ITYSILLEGL  591



>ref|XP_002968810.1| hypothetical protein SELMODRAFT_91015 [Selaginella moellendorffii]
 gb|EFJ29926.1| hypothetical protein SELMODRAFT_91015 [Selaginella moellendorffii]
Length=545

 Score =   229 bits (585),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 135/452 (30%), Positives = 233/452 (52%), Gaps = 14/452 (3%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
               + +  LC+ K+L++A +V+   +R G   D VTYN  I   C    +D  + +L +M+
Sbjct  10    FTVVINGLCREKRLDEAFSVLERAVRAGCEPDYVTYNVFIDGLCKAERVDDAFQLLKKMD  69

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             E    P  +TY +L+    + G L   + +LE+M+E G  P   +Y  ++  L + G+ +
Sbjct  70    EKKCLPTTVTYTALVDGLLKAGRLDEAMAVLEQMVEKGNSPTLKTYTVVIDGLSKAGRVE  129

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELK----HSGFIPQLVTY  1737
             EA R F D+      P    +  L+ GLC +G  E+A  L++E      H+  +P +VTY
Sbjct  130   EARRIFVDMLGNGCRPDAFVYTALIKGLCKSGKPEEAYALYKEANARKHHATAVPDVVTY  189

Query  1736  NILIHGLCNSGRWAPARRLLN-ELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
               LI GLC +GR   AR++ + E V+ G+ P+A+TYT+I+    +  R EEG +   EMR
Sbjct  190   TSLIDGLCKAGRILEARQVFDDEAVERGFIPDAVTYTSIIDGLCKLGRVEEGCERFHEMR  249

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              +GY  D+  Y  +I   +KA  +  A+     M+ +G  +  V YN +++  CK G++ 
Sbjct  250   NRGYEPDAVTYAALIDGFMKAKMIPKAHRVYRQMLQSGTVVSTVTYNIILDGLCKAGRVA  309

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              AY   +  E +G      T++ ++DG C  GN+  A+         G + NLV++N  I
Sbjct  310   EAYATFLAMEERGCVATVVTYSALMDGFCSEGNVSAAVELFRRMLDRGCEPNLVSYNIII  369

Query  1199  DGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVAS---ELLLSCIIG  1041
              GLC+ G++  A   F+ + ++    D +T+++ +HGLC+  R    S   EL  S +  
Sbjct  370   RGLCRAGKLAKAYFYFEKLLQRRLCPDVYTFNAFLHGLCQ--RLDTVSDGVELFESMVSQ  427

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             G          ++DG+  +G ++ A ++  E+
Sbjct  428   GTSPNLHSYSILMDGICRAGGLEVALEIFREM  459


 Score =   162 bits (409),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 105/377 (28%), Positives = 179/377 (47%), Gaps = 9/377 (2%)
 Frame = -1

Query  2069  PDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRF  1890
             PD++ +  +I    R   L     +LE  +  G  PD  +YN  +  L +  + D+A++ 
Sbjct  5     PDMVAFTVVINGLCREKRLDEAFSVLERAVRAGCEPDYVTYNVFIDGLCKAERVDDAFQL  64

Query  1889  FQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCN  1710
              + +      P  VT+  L+ GL   G  ++A+ +  ++   G  P L TY ++I GL  
Sbjct  65    LKKMDEKKCLPTTVTYTALVDGLLKAGRLDEAMAVLEQMVEKGNSPTLKTYTVVIDGLSK  124

Query  1709  SGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY----IF  1542
             +GR   ARR+  +++  G  P+A  YT ++K   +S + EE   + +E   + +    + 
Sbjct  125   AGRVEEARRIFVDMLGNGCRPDAFVYTALIKGLCKSGKPEEAYALYKEANARKHHATAVP  184

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGN-MIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
             D   Y ++I  L KAGR+ +A     +  +  G   D V Y ++I+  CK G+++     
Sbjct  185   DVVTYTSLIDGLCKAGRILEARQVFDDEAVERGFIPDAVTYTSIIDGLCKLGRVEEGCER  244

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E   +G++ D  T+  +IDG  KA  + +A R        G   + V +N  +DGLCK
Sbjct  245   FHEMRNRGYEPDAVTYAALIDGFMKAKMIPKAHRVYRQMLQSGTVVSTVTYNIILDGLCK  304

Query  1184  VGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G V  A + F +M+E+ C     TYS+L+ G C  G    A EL    +  G +     
Sbjct  305   AGRVAEAYATFLAMEERGCVATVVTYSALMDGFCSEGNVSAAVELFRRMLDRGCEPNLVS  364

Query  1016  RQAVIDGLQHSGFIQEA  966
                +I GL  +G + +A
Sbjct  365   YNIIIRGLCRAGKLAKA  381


 Score =   156 bits (395),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 96/327 (29%), Positives = 163/327 (50%), Gaps = 3/327 (1%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIID-GIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKP  2067
             LCKA ++ +A  V  D  +  G   D VTY ++I   C    ++ G    H M   G +P
Sbjct  196   LCKAGRILEARQVFDDEAVERGFIPDAVTYTSIIDGLCKLGRVEEGCERFHEMRNRGYEP  255

Query  2066  DVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFF  1887
             D +TY +LI    +  M+ +   +  +ML+ G +  T +YN ++  L + G+  EAY  F
Sbjct  256   DAVTYAALIDGFMKAKMIPKAHRVYRQMLQSGTVVSTVTYNIILDGLCKAGRVAEAYATF  315

Query  1886  QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNS  1707
               +         VT++ L+ G C  G    A+ LFR +   G  P LV+YNI+I GLC +
Sbjct  316   LAMEERGCVATVVTYSALMDGFCSEGNVSAAVELFRRMLDRGCEPNLVSYNIIIRGLCRA  375

Query  1706  GRWAPARRLLNELVDIGYNPNAITYTTIMK-CCFRSRRFEEGLQILEEMRRKGYIFDSFA  1530
             G+ A A     +L+     P+  T+   +   C R     +G+++ E M  +G   +  +
Sbjct  376   GKLAKAYFYFEKLLQRRLCPDVYTFNAFLHGLCQRLDTVSDGVELFESMVSQGTSPNLHS  435

Query  1529  YCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAE  1350
             Y  ++  + +AG ++ A +    M+  G+  D+V +NTLI   C  G++D A  +  E E
Sbjct  436   YSILMDGICRAGGLEVALEIFREMVSRGVAPDVVVFNTLIRWLCIAGRVDEALEVFRELE  495

Query  1349  RKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
             R+    D +++  ++DGL +   M+EA
Sbjct  496   RRSAP-DAWSYWSLLDGLSRCERMEEA  521


 Score =   149 bits (375),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/349 (29%), Positives = 165/349 (47%), Gaps = 9/349 (3%)
 Frame = -1

Query  1964  PDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALML  1785
             PD  ++  +++ L R  + DEA+   +        P  VT+N+ + GLC     + A  L
Sbjct  5     PDMVAFTVVINGLCREKRLDEAFSVLERAVRAGCEPDYVTYNVFIDGLCKAERVDDAFQL  64

Query  1784  FRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFR  1605
              +++     +P  VTY  L+ GL  +GR   A  +L ++V+ G +P   TYT ++    +
Sbjct  65    LKKMDEKKCLPTTVTYTALVDGLLKAGRLDEAMAVLEQMVEKGNSPTLKTYTVVIDGLSK  124

Query  1604  SRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAY----DCVGNMIMNGIEL  1437
             + R EE  +I  +M   G   D+F Y  +I  L K+G+ ++AY    +            
Sbjct  125   AGRVEEARRIFVDMLGNGCRPDAFVYTALIKGLCKSGKPEEAYALYKEANARKHHATAVP  184

Query  1436  DLVAYNTLINLYCKEGKLDNAYMLV-VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRH  1260
             D+V Y +LI+  CK G++  A  +   EA  +GF  D  T+T IIDGLCK G ++E    
Sbjct  185   DVVTYTSLIDGLCKAGRILEARQVFDDEAVERGFIPDAVTYTSIIDGLCKLGRVEEGCER  244

Query  1259  LNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCK  1092
              +  +  G++ + V +   IDG  K   +  A  V++ M +        TY+ ++ GLCK
Sbjct  245   FHEMRNRGYEPDAVTYAALIDGFMKAKMIPKAHRVYRQMLQSGTVVSTVTYNIILDGLCK  304

Query  1091  AGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             AGR   A    L+    G         A++DG    G +  A +L   +
Sbjct  305   AGRVAEAYATFLAMEERGCVATVVTYSALMDGFCSEGNVSAAVELFRRM  353


 Score =   118 bits (296),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 126/251 (50%), Gaps = 2/251 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M +  + +ST   NI +  LCKA ++ +A    +     G  A VVTY+ L+  +C    
Sbjct  283   MLQSGTVVSTVTYNIILDGLCKAGRVAEAYATFLAMEERGCVATVVTYSALMDGFCSEGN  342

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             + A   +  RM + G +P++++YN +I    R G L++     E++L+  + PD +++N 
Sbjct  343   VSAAVELFRRMLDRGCEPNLVSYNIIIRGLCRAGKLAKAYFYFEKLLQRRLCPDVYTFNA  402

Query  1940  LMHCL-FRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHS  1764
              +H L  RL    +    F+ +      P   +++IL+ G+C  G  E AL +FRE+   
Sbjct  403   FLHGLCQRLDTVSDGVELFESMVSQGTSPNLHSYSILMDGICRAGGLEVALEIFREMVSR  462

Query  1763  GFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEG  1584
             G  P +V +N LI  LC +GR   A  +  EL +    P+A +Y +++    R  R EE 
Sbjct  463   GVAPDVVVFNTLIRWLCIAGRVDEALEVFREL-ERRSAPDAWSYWSLLDGLSRCERMEEA  521

Query  1583  LQILEEMRRKG  1551
               +   M+ +G
Sbjct  522   RLLSFHMKLQG  532


 Score =   101 bits (252),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 71/246 (29%), Positives = 115/246 (47%), Gaps = 9/246 (4%)
 Frame = -1

Query  1652  NPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYD  1473
             +P+ + +T ++    R +R +E   +LE   R G   D   Y   I  L KA R+ DA+ 
Sbjct  4     SPDMVAFTVVINGLCREKRLDEAFSVLERAVRAGCEPDYVTYNVFIDGLCKAERVDDAFQ  63

Query  1472  CVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLC  1293
              +  M         V Y  L++   K G+LD A  ++ +   KG      T+T++IDGL 
Sbjct  64    LLKKMDEKKCLPTTVTYTALVDGLLKAGRLDEAMAVLEQMVEKGNSPTLKTYTVVIDGLS  123

Query  1292  KAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK-------  1134
             KAG ++EA R        G   +   +   I GLCK G+ + A +++K  + +       
Sbjct  124   KAGRVEEARRIFVDMLGNGCRPDAFVYTALIKGLCKSGKPEEAYALYKEANARKHHATAV  183

Query  1133  -DCFTYSSLVHGLCKAGRFRVASELL-LSCIIGGMKILKSDRQAVIDGLQHSGFIQEARK  960
              D  TY+SL+ GLCKAGR   A ++     +  G         ++IDGL   G ++E  +
Sbjct  184   PDVVTYTSLIDGLCKAGRILEARQVFDDEAVERGFIPDAVTYTSIIDGLCKLGRVEEGCE  243

Query  959   LHSELK  942
                E++
Sbjct  244   RFHEMR  249



>ref|XP_002968311.1| hypothetical protein SELMODRAFT_89033, partial [Selaginella moellendorffii]
 gb|EFJ30565.1| hypothetical protein SELMODRAFT_89033, partial [Selaginella moellendorffii]
Length=600

 Score =   231 bits (588),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 143/445 (32%), Positives = 239/445 (54%), Gaps = 13/445 (3%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRV-GVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
              NI ++ LC+A ++  A+TV  DG+R  G   + +TYN L++  C    +    ++  RM
Sbjct  53    FNIYISGLCRASRIGDAQTVF-DGMRKHGFWPNRITYNALLSGLCNGGRMSDAQALYERM  111

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
              + G  PDV+TYN+L+    + G L   L + +  ++ G +PD  +YN L++   +  K 
Sbjct  112   IKAGYSPDVVTYNTLLHGFCKVGKLDEALKIFDGAVKRGFVPDVVTYNALINGFCKADKL  171

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             DEA R  Q +    + P  VT+N L++GLC NG  ++A ML  +    GF P ++TY+ L
Sbjct  172   DEAQRILQRMVSESLVPDVVTYNSLVNGLCKNGRVDEARMLIVD---KGFSPNVITYSTL  228

Query  1727  IHGLCNS-GRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKG  1551
             I GLC    R   AR+LL ++V  G  P+ ++Y  ++    R +   E L++   + R+G
Sbjct  229   ISGLCRELRRLESARQLLEKMVLNGCKPDIVSYNALIHGLAREQGVSEALKLFGSVLRQG  288

Query  1550  YIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAY  1371
             Y  +   Y  +I  L+K  R+ +A++    ++ +G+E D + Y   I+  CK G++++A 
Sbjct  289   YEPEVPTYNILIDGLLKEDRVNEAFELFSGLVKHGLEPDAITYTVFIDGLCKAGRVEDAL  348

Query  1370  MLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGL  1191
             +++ + + KG   D  +H  +I+GLCK   + EA   L+  +  G   N ++FN  I G 
Sbjct  349   LMLKDMDEKGCVPDVVSHNAVINGLCKEKRVDEAEVLLSGMEAKGCSPNAISFNTLICGQ  408

Query  1190  CKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKA---GRFRVASELLLSCIIGGMK  1032
             C+ G+   A++ FK M ++       TY+ LV GLCKA   GR + A  L  + I  G  
Sbjct  409   CRAGKWKKAMTTFKEMLKRGVKPTVVTYNILVDGLCKARQEGRIKEAITLFDAMIEKGRV  468

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKL  957
                    A+IDGL  +G + +AR+L
Sbjct  469   PDVVTYSALIDGLGKAGKLDDARRL  493


 Score =   222 bits (566),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 141/445 (32%), Positives = 232/445 (52%), Gaps = 20/445 (4%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKA----ETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSIL  2097
             + I +  L K+ ++EKA    E +++ G+      D+ T+N  I+  C    I    ++ 
Sbjct  19    VGILLRSLLKSGKIEKAHRFVEQLLVKGL-----CDISTFNIYISGLCRASRIGDAQTVF  73

Query  2096  HRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRL  1917
               M + G  P+ ITYN+L++     G +S    L E M++ G  PD  +YNTL+H   ++
Sbjct  74    DGMRKHGFWPNRITYNALLSGLCNGGRMSDAQALYERMIKAGYSPDVVTYNTLLHGFCKV  133

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTY  1737
             GK DEA + F         P  VT+N L++G C     ++A  + + +     +P +VTY
Sbjct  134   GKLDEALKIFDGAVKRGFVPDVVTYNALINGFCKADKLDEAQRILQRMVSESLVPDVVTY  193

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMK-CCFRSRRFEEGLQILEEMR  1560
             N L++GLC +GR   AR L   +VD G++PN ITY+T++   C   RR E   Q+LE+M 
Sbjct  194   NSLVNGLCKNGRVDEARML---IVDKGFSPNVITYSTLISGLCRELRRLESARQLLEKMV  250

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
               G   D  +Y  +I  L +   + +A    G+++  G E ++  YN LI+   KE +++
Sbjct  251   LNGCKPDIVSYNALIHGLAREQGVSEALKLFGSVLRQGYEPEVPTYNILIDGLLKEDRVN  310

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              A+ L     + G + D  T+T+ IDGLCKAG +++AL  L      G   ++V+ N  I
Sbjct  311   EAFELFSGLVKHGLEPDAITYTVFIDGLCKAGRVEDALLMLKDMDEKGCVPDVVSHNAVI  370

Query  1199  DGLCKVGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             +GLCK   VD A  +   M+ K C     ++++L+ G C+AG+++ A       +  G+K
Sbjct  371   NGLCKEKRVDEAEVLLSGMEAKGCSPNAISFNTLICGQCRAGKWKKAMTTFKEMLKRGVK  430

Query  1031  ILKSDRQAVIDGL---QHSGFIQEA  966
                     ++DGL   +  G I+EA
Sbjct  431   PTVVTYNILVDGLCKARQEGRIKEA  455


 Score =   204 bits (518),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 133/416 (32%), Positives = 213/416 (51%), Gaps = 11/416 (3%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +   CK  +L++A  +    ++ G   DVVTYN LI  +C    +D    IL RM  
Sbjct  124   NTLLHGFCKVGKLDEALKIFDGAVKRGFVPDVVTYNALINGFCKADKLDEAQRILQRMVS  183

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR-LGKPD  1905
               + PDV+TYNSL+    ++G +     L+   ++ G  P+  +Y+TL+  L R L + +
Sbjct  184   ESLVPDVVTYNSLVNGLCKNGRVDEARMLI---VDKGFSPNVITYSTLISGLCRELRRLE  240

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A +  + +      P  V++N L+ GL       +AL LF  +   G+ P++ TYNILI
Sbjct  241   SARQLLEKMVLNGCKPDIVSYNALIHGLAREQGVSEALKLFGSVLRQGYEPEVPTYNILI  300

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
              GL    R   A  L + LV  G  P+AITYT  +    ++ R E+ L +L++M  KG +
Sbjct  301   DGLLKEDRVNEAFELFSGLVKHGLEPDAITYTVFIDGLCKAGRVEDALLMLKDMDEKGCV  360

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D  ++  VI+ L K  R+ +A   +  M   G   + +++NTLI   C+ GK   A   
Sbjct  361   PDVVSHNAVINGLCKEKRVDEAEVLLSGMEAKGCSPNAISFNTLICGQCRAGKWKKAMTT  420

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKA---GNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               E  ++G      T+ I++DGLCKA   G +KEA+   +     G   ++V ++  IDG
Sbjct  421   FKEMLKRGVKPTVVTYNILVDGLCKARQEGRIKEAITLFDAMIEKGRVPDVVTYSALIDG  480

Query  1193  LCKVGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGG  1038
             L K G++D A  +  +M+ K C    +TY+SL+ GLC   +   A EL ++ +  G
Sbjct  481   LGKAGKLDDARRLLGAMEAKGCIPNVYTYNSLISGLCGLDKVDEALELFVAMVEKG  536


 Score =   194 bits (494),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 127/409 (31%), Positives = 208/409 (51%), Gaps = 11/409 (3%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCC-FVGIDAGYSILHRMN  2085
             N  V  LCK  ++++A  +I+D    G   +V+TY+TLI+  C     +++   +L +M 
Sbjct  194   NSLVNGLCKNGRVDEARMLIVDK---GFSPNVITYSTLISGLCRELRRLESARQLLEKMV  250

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
               G KPD+++YN+LI    R   +S  L L   +L  G  P+  +YN L+  L +  + +
Sbjct  251   LNGCKPDIVSYNALIHGLAREQGVSEALKLFGSVLRQGYEPEVPTYNILIDGLLKEDRVN  310

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             EA+  F  +    + P  +T+ + + GLC  G  E AL++ +++   G +P +V++N +I
Sbjct  311   EAFELFSGLVKHGLEPDAITYTVFIDGLCKAGRVEDALLMLKDMDEKGCVPDVVSHNAVI  370

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLC   R   A  LL+ +   G +PNAI++ T++    R+ ++++ +   +EM ++G  
Sbjct  371   NGLCKEKRVDEAEVLLSGMEAKGCSPNAISFNTLICGQCRAGKWKKAMTTFKEMLKRGVK  430

Query  1544  FDSFAYCTVISFLIKA---GRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
                  Y  ++  L KA   GR+K+A      MI  G   D+V Y+ LI+   K GKLD+A
Sbjct  431   PTVVTYNILVDGLCKARQEGRIKEAITLFDAMIEKGRVPDVVTYSALIDGLGKAGKLDDA  490

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               L+   E KG   + YT+  +I GLC    + EAL         G   + + +   I  
Sbjct  491   RRLLGAMEAKGCIPNVYTYNSLISGLCGLDKVDEALELFVAMVEKGCVPDTITYGTIISA  550

Query  1193  LCKVGEVDYALSVFKSMDEKDCFT----YSSLVHGLCKAGRFRVASELL  1059
             LCK   VD AL++F    E         Y SL+ GLC   R   A +LL
Sbjct  551   LCKQEMVDKALALFDGSLEAGVVPTSGMYFSLIDGLCAVARVDEALKLL  599


 Score =   178 bits (451),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 107/339 (32%), Positives = 180/339 (53%), Gaps = 11/339 (3%)
 Frame = -1

Query  1964  PDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPV-TFNILLSGLCMNGYTEKALM  1788
             PD ++   L+  L + GK ++A+RF + +    +  C + TFNI +SGLC       A  
Sbjct  14    PDAYTVGILLRSLLKSGKIEKAHRFVEQLLVKGL--CDISTFNIYISGLCRASRIGDAQT  71

Query  1787  LFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCF  1608
             +F  ++  GF P  +TYN L+ GLCN GR + A+ L   ++  GY+P+ +TY T++    
Sbjct  72    VFDGMRKHGFWPNRITYNALLSGLCNGGRMSDAQALYERMIKAGYSPDVVTYNTLLHGFC  131

Query  1607  RSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLV  1428
             +  + +E L+I +   ++G++ D   Y  +I+   KA ++ +A   +  M+   +  D+V
Sbjct  132   KVGKLDEALKIFDGAVKRGFVPDVVTYNALINGFCKADKLDEAQRILQRMVSESLVPDVV  191

Query  1427  AYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRH-LNC  1251
              YN+L+N  CK G++D A ML+V+   KGF  +  T++ +I GLC+     E+ R  L  
Sbjct  192   TYNSLVNGLCKNGRVDEARMLIVD---KGFSPNVITYSTLISGLCRELRRLESARQLLEK  248

Query  1250  TKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSM----DEKDCFTYSSLVHGLCKAGR  1083
               L G   ++V++N  I GL +   V  AL +F S+     E +  TY+ L+ GL K  R
Sbjct  249   MVLNGCKPDIVSYNALIHGLAREQGVSEALKLFGSVLRQGYEPEVPTYNILIDGLLKEDR  308

Query  1082  FRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEA  966
                A EL    +  G++         IDGL  +G +++A
Sbjct  309   VNEAFELFSGLVKHGLEPDAITYTVFIDGLCKAGRVEDA  347


 Score =   126 bits (317),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 92/310 (30%), Positives = 145/310 (47%), Gaps = 9/310 (3%)
 Frame = -1

Query  1859  PCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRL  1680
             P   T  ILL  L  +G  EKA     +L   G    + T+NI I GLC + R   A+ +
Sbjct  14    PDAYTVGILLRSLLKSGKIEKAHRFVEQLLVKGLC-DISTFNIYISGLCRASRIGDAQTV  72

Query  1679  LNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIK  1500
              + +   G+ PN ITY  ++       R  +   + E M + GY  D   Y T++    K
Sbjct  73    FDGMRKHGFWPNRITYNALLSGLCNGGRMSDAQALYERMIKAGYSPDVVTYNTLLHGFCK  132

Query  1499  AGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYT  1320
              G++ +A       +  G   D+V YN LIN +CK  KLD A  ++     +    D  T
Sbjct  133   VGKLDEALKIFDGAVKRGFVPDVVTYNALINGFCKADKLDEAQRILQRMVSESLVPDVVT  192

Query  1319  HTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK-VGEVDYALSVFKSM  1143
             +  +++GLCK G + EA R L   K  GF  N++ ++  I GLC+ +  ++ A  + + M
Sbjct  193   YNSLVNGLCKNGRVDEA-RMLIVDK--GFSPNVITYSTLISGLCRELRRLESARQLLEKM  249

Query  1142  D----EKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFI  975
                  + D  +Y++L+HGL +      A +L  S +  G +        +IDGL     +
Sbjct  250   VLNGCKPDIVSYNALIHGLAREQGVSEALKLFGSVLRQGYEPEVPTYNILIDGLLKEDRV  309

Query  974   QEARKLHSEL  945
              EA +L S L
Sbjct  310   NEAFELFSGL  319


 Score =   106 bits (265),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/235 (29%), Positives = 116/235 (49%), Gaps = 5/235 (2%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRV-GVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             N  +  LCK K++++AE V++ G+   G   + +++NTLI   C         +    M 
Sbjct  367   NAVINGLCKEKRVDEAE-VLLSGMEAKGCSPNAISFNTLICGQCRAGKWKKAMTTFKEML  425

Query  2084  EVGIKPDVITYNSLIAS---ATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLG  1914
             + G+KP V+TYN L+     A + G +   + L + M+E G +PD  +Y+ L+  L + G
Sbjct  426   KRGVKPTVVTYNILVDGLCKARQEGRIKEAITLFDAMIEKGRVPDVVTYSALIDGLGKAG  485

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             K D+A R    +      P   T+N L+SGLC     ++AL LF  +   G +P  +TY 
Sbjct  486   KLDDARRLLGAMEAKGCIPNVYTYNSLISGLCGLDKVDEALELFVAMVEKGCVPDTITYG  545

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILE  1569
              +I  LC       A  L +  ++ G  P +  Y +++       R +E L++L+
Sbjct  546   TIISALCKQEMVDKALALFDGSLEAGVVPTSGMYFSLIDGLCAVARVDEALKLLQ  600



>ref|XP_002977337.1| hypothetical protein SELMODRAFT_107186 [Selaginella moellendorffii]
 gb|EFJ21341.1| hypothetical protein SELMODRAFT_107186 [Selaginella moellendorffii]
Length=636

 Score =   231 bits (588),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 136/438 (31%), Positives = 224/438 (51%), Gaps = 4/438 (1%)
 Frame = -1

Query  2258  ITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEV  2079
             I +  LCKA +L +A T      + G   +  TYN LI  +C    +   Y +L  M E 
Sbjct  12    IMIDGLCKANRLPEATTYFAKMKKKGTVPNEWTYNVLINGFCKVHKVHRAYLLLKEMKES  71

Query  2078  GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEA  1899
             G+ P+V+TY+++I    R   +     L  +M+E G +P+  +YNTL+  L R G  DEA
Sbjct  72    GLAPNVVTYSTVIHGFCRQTKVDTAYKLFRQMVENGCMPNLVTYNTLLSGLCRNGLMDEA  131

Query  1898  YRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
             Y    ++    + P   +++ L++GLC  G  + AL +F +  +    P +V Y+ LI G
Sbjct  132   YELLDEMRERGLQPDKFSYDTLMAGLCKTGKIDMALKVFEDNSNGDCPPDVVAYSTLIAG  191

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFD  1539
             LC +GR   A +L  ++ +    P+ +T+T +M    +  R +E  Q+LE M  +    +
Sbjct  192   LCKTGRLDEACKLFEKMRENSCEPDVVTFTALMDGLCKGDRLQEAQQVLETMEDRNCTPN  251

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVV  1359
                Y ++I  L K G+++DA +    MI+ GIE ++V YN+LI+ +C    +D+A +L+ 
Sbjct  252   VITYSSLIDGLCKTGQVRDAQEVFKRMIVRGIEPNVVTYNSLIHGFCMTNGVDSALLLME  311

Query  1358  EAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVG  1179
             E    G   D  T+  +IDGLCK G   EA R     K    + +++ ++C I G CK+ 
Sbjct  312   EMTATGCLPDIITYNTLIDGLCKTGRAPEANRLFGDMKAKFCNPDVITYSCLIGGFCKLE  371

Query  1178  EVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQ  1011
              +D A ++F  M ++    D  T+S+LV G C AG    A  LL   +            
Sbjct  372   RIDMARTLFDDMLKQAVLPDVVTFSTLVEGYCNAGLVDDAERLLEEMVASDCSPDVYTYT  431

Query  1010  AVIDGLQHSGFIQEARKL  957
             +++DG    G + EAR++
Sbjct  432   SLVDGFCKVGRMVEARRV  449


 Score =   202 bits (514),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 122/445 (27%), Positives = 217/445 (49%), Gaps = 5/445 (1%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             +A LCK  +++ A  V  D      P DVV Y+TLI   C    +D    +  +M E   
Sbjct  154   MAGLCKTGKIDMALKVFEDNSNGDCPPDVVAYSTLIAGLCKTGRLDEACKLFEKMRENSC  213

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             +PDV+T+ +L+    +   L     +LE M +    P+  +Y++L+  L + G+  +A  
Sbjct  214   EPDVVTFTALMDGLCKGDRLQEAQQVLETMEDRNCTPNVITYSSLIDGLCKTGQVRDAQE  273

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
              F+ +    I P  VT+N L+ G CM    + AL+L  E+  +G +P ++TYN LI GLC
Sbjct  274   VFKRMIVRGIEPNVVTYNSLIHGFCMTNGVDSALLLMEEMTATGCLPDIITYNTLIDGLC  333

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
              +GR   A RL  ++     NP+ ITY+ ++    +  R +    + ++M ++  + D  
Sbjct  334   KTGRAPEANRLFGDMKAKFCNPDVITYSCLIGGFCKLERIDMARTLFDDMLKQAVLPDVV  393

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              + T++     AG + DA   +  M+ +    D+  Y +L++ +CK G++  A  ++   
Sbjct  394   TFSTLVEGYCNAGLVDDAERLLEEMVASDCSPDVYTYTSLVDGFCKVGRMVEARRVLKRM  453

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEV  1173
              ++G   +  T+T +ID  C+AG    A + L      G   N++ +   I G C  G++
Sbjct  454   AKRGCQPNVVTYTALIDAFCRAGKPTVAYKLLEEMVGNGVQPNVITYRSLIGGFCGTGDL  513

Query  1172  DYALSVFKSMD-----EKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQA  1008
             + A  + + ++     + D F Y  ++ GLC+ GR   A ELL +    G         A
Sbjct  514   EEARKMLERLERDENCKADMFAYRVMMDGLCRTGRMSAALELLEAIKQSGTPPRHDIYVA  573

Query  1007  VIDGLQHSGFIQEARKLHSELKLSK  933
             +I GL     + +A ++  E+ LS+
Sbjct  574   LIRGLCQGKELGKAMEVLEEMTLSR  598


 Score =   179 bits (454),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 117/416 (28%), Positives = 199/416 (48%), Gaps = 39/416 (9%)
 Frame = -1

Query  2066  DVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFF  1887
             +VIT+  +I    +   L        +M + G +P+ W+YN L++   ++ K   AY   
Sbjct  6     NVITWTIMIDGLCKANRLPEATTYFAKMKKKGTVPNEWTYNVLINGFCKVHKVHRAYLLL  65

Query  1886  QDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNS  1707
             +++    + P  VT++ ++ G C     + A  LFR++  +G +P LVTYN L+ GLC +
Sbjct  66    KEMKESGLAPNVVTYSTVIHGFCRQTKVDTAYKLFRQMVENGCMPNLVTYNTLLSGLCRN  125

Query  1706  GRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAY  1527
             G    A  LL+E+ + G  P+  +Y T+M    ++ + +  L++ E+        D  AY
Sbjct  126   GLMDEAYELLDEMRERGLQPDKFSYDTLMAGLCKTGKIDMALKVFEDNSNGDCPPDVVAY  185

Query  1526  CTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAER  1347
              T+I+ L K GR+ +A      M  N  E D+V +  L++  CK  +L  A  ++   E 
Sbjct  186   STLIAGLCKTGRLDEACKLFEKMRENSCEPDVVTFTALMDGLCKGDRLQEAQQVLETMED  245

Query  1346  KGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDY  1167
             +    +  T++ +IDGLCK G +++A        + G + N+V +N  I G C    VD 
Sbjct  246   RNCTPNVITYSSLIDGLCKTGQVRDAQEVFKRMIVRGIEPNVVTYNSLIHGFCMTNGVDS  305

Query  1166  ALSVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASELL--------------LSCIIG  1041
             AL + + M    C     TY++L+ GLCK GR   A+ L                SC+IG
Sbjct  306   ALLLMEEMTATGCLPDIITYNTLIDGLCKTGRAPEANRLFGDMKAKFCNPDVITYSCLIG  365

Query  1040  GM-KILKSD----------RQAV----------IDGLQHSGFIQEARKLHSELKLS  936
             G  K+ + D          +QAV          ++G  ++G + +A +L  E+  S
Sbjct  366   GFCKLERIDMARTLFDDMLKQAVLPDVVTFSTLVEGYCNAGLVDDAERLLEEMVAS  421


 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 84/169 (50%), Gaps = 4/169 (2%)
 Frame = -1

Query  1442  ELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALR  1263
             E +++ +  +I+  CK  +L  A     + ++KG   +++T+ ++I+G CK   +  A  
Sbjct  4     EKNVITWTIMIDGLCKANRLPEATTYFAKMKKKGTVPNEWTYNVLINGFCKVHKVHRAYL  63

Query  1262  HLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCF----TYSSLVHGLC  1095
              L   K  G   N+V ++  I G C+  +VD A  +F+ M E  C     TY++L+ GLC
Sbjct  64    LLKEMKESGLAPNVVTYSTVIHGFCRQTKVDTAYKLFRQMVENGCMPNLVTYNTLLSGLC  123

Query  1094  KAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSE  948
             + G    A ELL      G++  K     ++ GL  +G I  A K+  +
Sbjct  124   RNGLMDEAYELLDEMRERGLQPDKFSYDTLMAGLCKTGKIDMALKVFED  172



>ref|XP_010530463.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Tarenaya hassleriana]
Length=558

 Score =   228 bits (581),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 130/449 (29%), Positives = 233/449 (52%), Gaps = 4/449 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             L+I + C C+++Q+    +V+   +++G   DV+T+NTLI   C    + A  S++ RM 
Sbjct  107   LSILINCFCRSRQVGLGFSVLGKIMKLGYEPDVITFNTLINGLCIEGKLSAALSLVERMV  166

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             + G  PDV+T  +++      G +   + L+++M + G +P+  +Y  +++ + + G   
Sbjct  167   KDGYTPDVVTCTTVVNGLCLQGRIHEAVTLVDQMPKKGHIPNVITYGAIVNGICKSGDSA  226

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A      +    +    V +N ++  LC +G  + AL LF+++   G  P +VTY+ LI
Sbjct  227   LALNLLIKMEERRVEVNVVVYNTIIDCLCKDGRVDDALNLFKKMDDRGVAPDVVTYSTLI  286

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLC  GRW    RLLN+++     PN +++  ++    +  +F E  ++ E+M ++G +
Sbjct  287   NGLCCYGRWTDVARLLNDMIXRNITPNVVSFNGLIDNFVKEGKFLEARELYEQMVQRGLV  346

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
               +F Y ++I  L    R+ +A     +M   G   D+V ++ LIN YCK G++D    L
Sbjct  347   PSTFTYTSLIVGLCMQNRLDEAKKMFDSMATKGCPPDVVTFSALINGYCKSGRVDQGLKL  406

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E  R+G   D  T+T +I G C+A N+  A +     +  G   NLV FN  +DGLCK
Sbjct  407   FSEMFRRGVVADTPTYTSLIQGFCRADNLAVAQKLFLEMQCQGQYPNLVTFNVLLDGLCK  466

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G+++ AL ++  M++     D   ++ ++HGLC   +   A  L       G++     
Sbjct  467   NGKLEEALCLYNKMEKSGMNLDIIAHTIIIHGLCMDDKVEDALRLFNGLFDRGVEPNVKT  526

Query  1016  RQAVIDGLQHSGFIQEARKLHSELKLSKI  930
               A+I GL   G + EA KL  E+K++ +
Sbjct  527   YTAMISGLCRKGLLDEAEKLFREMKVAGV  555


 Score =   169 bits (427),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 116/415 (28%), Positives = 203/415 (49%), Gaps = 4/415 (1%)
 Frame = -1

Query  2168  VVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLE  1989
             +V ++ L++A           S+  +M   GI     + + LI    R   +     +L 
Sbjct  69    IVDFSKLLSAIAKMKRYGIVISLCKKMELHGISHSNYSLSILINCFCRSRQVGLGFSVLG  128

Query  1988  EMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNG  1809
             +++++G  PD  ++NTL++ L   GK   A    + +      P  VT   +++GLC+ G
Sbjct  129   KIMKLGYEPDVITFNTLINGLCIEGKLSAALSLVERMVKDGYTPDVVTCTTVVNGLCLQG  188

Query  1808  YTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYT  1629
                +A+ L  ++   G IP ++TY  +++G+C SG  A A  LL ++ +     N + Y 
Sbjct  189   RIHEAVTLVDQMPKKGHIPNVITYGAIVNGICKSGDSALALNLLIKMEERRVEVNVVVYN  248

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
             TI+ C  +  R ++ L + ++M  +G   D   Y T+I+ L   GR  D    + +MI  
Sbjct  249   TIIDCLCKDGRVDDALNLFKKMDDRGVAPDVVTYSTLINGLCCYGRWTDVARLLNDMIXR  308

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
              I  ++V++N LI+ + KEGK   A  L  +  ++G     +T+T +I GLC    + EA
Sbjct  309   NITPNVVSFNGLIDNFVKEGKFLEARELYEQMVQRGLVPSTFTYTSLIVGLCMQNRLDEA  368

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHG  1101
              +  +     G   ++V F+  I+G CK G VD  L +F  M  +    D  TY+SL+ G
Sbjct  369   KKMFDSMATKGCPPDVVTFSALINGYCKSGRVDQGLKLFSEMFRRGVVADTPTYTSLIQG  428

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
              C+A    VA +L L     G          ++DGL  +G ++EA  L+++++ S
Sbjct  429   FCRADNLAVAQKLFLEMQCQGQYPNLVTFNVLLDGLCKNGKLEEALCLYNKMEKS  483


 Score =   120 bits (301),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/294 (29%), Positives = 150/294 (51%), Gaps = 4/294 (1%)
 Frame = -1

Query  1814  NGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAIT  1635
             N   + A+ +F ++  S  +P +V ++ L+  +    R+     L  ++   G + +  +
Sbjct  47    NSNVKDAVDVFDQMVRSRPLPSIVDFSKLLSAIAKMKRYGIVISLCKKMELHGISHSNYS  106

Query  1634  YTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMI  1455
              + ++ C  RSR+   G  +L ++ + GY  D   + T+I+ L   G++  A   V  M+
Sbjct  107   LSILINCFCRSRQVGLGFSVLGKIMKLGYEPDVITFNTLINGLCIEGKLSAALSLVERMV  166

Query  1454  MNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMK  1275
              +G   D+V   T++N  C +G++  A  LV +  +KG   +  T+  I++G+CK+G+  
Sbjct  167   KDGYTPDVVTCTTVVNGLCLQGRIHEAVTLVDQMPKKGHIPNVITYGAIVNGICKSGDSA  226

Query  1274  EALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLV  1107
              AL  L   +    + N+V +N  ID LCK G VD AL++FK MD++    D  TYS+L+
Sbjct  227   LALNLLIKMEERRVEVNVVVYNTIIDCLCKDGRVDDALNLFKKMDDRGVAPDVVTYSTLI  286

Query  1106  HGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             +GLC  GR+   + LL   I   +         +ID     G   EAR+L+ ++
Sbjct  287   NGLCCYGRWTDVARLLNDMIXRNITPNVVSFNGLIDNFVKEGKFLEARELYEQM  340


 Score =   116 bits (291),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 105/404 (26%), Positives = 171/404 (42%), Gaps = 45/404 (11%)
 Frame = -1

Query  2039  ASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIP  1860
              SA  H  LS CL L            + SY   +   F      +A   F  +      
Sbjct  13    TSAFVHSHLSSCLSLRLR------FSSSVSYRERLRSGFGNSNVKDAVDVFDQMVRSRPL  66

Query  1859  PCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRL  1680
             P  V F+ LLS +         + L ++++  G      + +ILI+  C S +      +
Sbjct  67    PSIVDFSKLLSAIAKMKRYGIVISLCKKMELHGISHSNYSLSILINCFCRSRQVGLGFSV  126

Query  1679  LNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIK  1500
             L +++ +GY P+ IT+ T++       +    L ++E M + GY  D     TV++ L  
Sbjct  127   LGKIMKLGYEPDVITFNTLINGLCIEGKLSAALSLVERMVKDGYTPDVVTCTTVVNGLCL  186

Query  1499  AGRMKDAYDCVGNM--------------IMNGI--------ELDLV-------------A  1425
              GR+ +A   V  M              I+NGI         L+L+              
Sbjct  187   QGRIHEAVTLVDQMPKKGHIPNVITYGAIVNGICKSGDSALALNLLIKMEERRVEVNVVV  246

Query  1424  YNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTK  1245
             YNT+I+  CK+G++D+A  L  + + +G   D  T++ +I+GLC  G   +  R LN   
Sbjct  247   YNTIIDCLCKDGRVDDALNLFKKMDDRGVAPDVVTYSTLINGLCCYGRWTDVARLLNDMI  306

Query  1244  LMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFR  1077
                   N+V+FN  ID   K G+   A  +++ M ++      FTY+SL+ GLC   R  
Sbjct  307   XRNITPNVVSFNGLIDNFVKEGKFLEARELYEQMVQRGLVPSTFTYTSLIVGLCMQNRLD  366

Query  1076  VASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
              A ++  S    G         A+I+G   SG + +  KL SE+
Sbjct  367   EAKKMFDSMATKGCPPDVVTFSALINGYCKSGRVDQGLKLFSEM  410



>ref|XP_008806535.1| PREDICTED: protein Rf1, mitochondrial-like [Phoenix dactylifera]
Length=673

 Score =   230 bits (587),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 141/448 (31%), Positives = 225/448 (50%), Gaps = 6/448 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             R +T   N+ +  LC  K++++A  V       G   DVV+Y TLI    C      G  
Sbjct  26    RPNTLTFNLLLKGLCSEKKIDEAAVVFDRMPLSGCAPDVVSYTTLIKGLTCNGKTGLGLE  85

Query  2102  ILHRMNEVG--IKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHC  1929
             +L +M  +G   KPDV+TYN +I    + G + +   L EEM+  G+ PD  +YN ++  
Sbjct  86    LLRKMVTLGGGCKPDVVTYNIIINGLCKDGAMEKASKLFEEMVAQGVTPDVVTYNCIIRE  145

Query  1928  LFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQ  1749
                LG   EA   F+ +    + P  VTFN L+S LC    +++A  +   +   G  P 
Sbjct  146   HSVLGHWKEAIGIFKKMVDQGLSPNVVTFNTLMSSLCKQRKSDEAHKILNLMAERGEKPD  205

Query  1748  LVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILE  1569
             ++++NIL+HG    GR   A   +N +V  G  PN  +Y+ ++    +++  ++ + +L+
Sbjct  206   IISHNILLHGYILEGRLDDAMDFVNAMVLKGLEPNIYSYSILISAYSKNQTMDKAMYVLK  265

Query  1568  EMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEG  1389
              MR++G   D   Y TV+  L K GR+++       M+  GI  D++ YNTL+N +CK G
Sbjct  266   RMRQEGMEPDVVTYNTVLDGLCKTGRLQEVQYLFDQMVSQGISPDIITYNTLVNGFCKLG  325

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
             K   A   + E    G   D  T +++ID LCK G  KEA + L+    +G + N V + 
Sbjct  326   KWKEASRFLYEMMDHGIRPDVITLSVLIDALCKEGMTKEAHKLLDVMVRIGEEPNAVTYT  385

Query  1208  CCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIG  1041
               IDG C +G++  A+ VF  M  K    +  TYSSL++G CK GR   A   L      
Sbjct  386   TIIDGYCLIGQIYEAIKVFHFMTSKGHAPNVVTYSSLINGYCKIGRTDKAVGFLDEMYRN  445

Query  1040  GMKILKSDRQAVIDGLQHSGFIQEARKL  957
             G++        +I+ L   G + +A++L
Sbjct  446   GLRPTTITYNTIINALFRVGRVGDAKEL  473


 Score =   186 bits (473),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 127/481 (26%), Positives = 222/481 (46%), Gaps = 39/481 (8%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI +  LCK   +EKA  +  + +  GV  DVVTYN +I  +           I  +M +
Sbjct  105   NIIINGLCKDGAMEKASKLFEEMVAQGVTPDVVTYNCIIREHSVLGHWKEAIGIFKKMVD  164

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G+ P+V+T+N+L++S  +         +L  M E G  PD  S+N L+H     G+ D+
Sbjct  165   QGLSPNVVTFNTLMSSLCKQRKSDEAHKILNLMAERGEKPDIISHNILLHGYILEGRLDD  224

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A  F   +    + P   +++IL+S    N   +KA+ + + ++  G  P +VTYN ++ 
Sbjct  225   AMDFVNAMVLKGLEPNIYSYSILISAYSKNQTMDKAMYVLKRMRQEGMEPDVVTYNTVLD  284

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC +GR    + L +++V  G +P+ ITY T++    +  +++E  + L EM   G   
Sbjct  285   GLCKTGRLQEVQYLFDQMVSQGISPDIITYNTLVNGFCKLGKWKEASRFLYEMMDHGIRP  344

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D      +I  L K G  K+A+  +  M+  G E + V Y T+I+ YC  G++  A  + 
Sbjct  345   DVITLSVLIDALCKEGMTKEAHKLLDVMVRIGEEPNAVTYTTIIDGYCLIGQIYEAIKVF  404

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
                  KG   +  T++ +I+G CK G   +A+  L+     G     + +N  I+ L +V
Sbjct  405   HFMTSKGHAPNVVTYSSLINGYCKIGRTDKAVGFLDEMYRNGLRPTTITYNTIINALFRV  464

Query  1181  GEV-----------------------------------DYALSVFKSMDEK----DCFTY  1119
             G V                                   D A+ VF+ +  +    +  T+
Sbjct  465   GRVGDAKELLGKMIAAGVCPDLSTCHIMLGGLCKNRYIDEAMDVFQYISSQNYKLEVTTF  524

Query  1118  SSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKL  939
             + L+ G+ +AG+F+ A +L  +    G+         ++ GL   G + EA +L  +L+ 
Sbjct  525   NILIDGMLRAGKFKGARDLFNAITSKGLMPNVVTYTIMMKGLIEKGLLDEAEELFLQLEK  584

Query  938   S  936
             S
Sbjct  585   S  585


 Score =   183 bits (464),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/394 (29%), Positives = 194/394 (49%), Gaps = 6/394 (2%)
 Frame = -1

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +D G+ I   + + G +P+ +T+N L+        +     + + M   G  PD  SY T
Sbjct  10    MDLGFGIFGGLLKRGWRPNTLTFNLLLKGLCSEKKIDEAAVVFDRMPLSGCAPDVVSYTT  69

Query  1940  LMHCLFRLGKPDEAYRFFQDI--FWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKH  1767
             L+  L   GK        + +    G   P  VT+NI+++GLC +G  EKA  LF E+  
Sbjct  70    LIKGLTCNGKTGLGLELLRKMVTLGGGCKPDVVTYNIIINGLCKDGAMEKASKLFEEMVA  129

Query  1766  SGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEE  1587
              G  P +VTYN +I      G W  A  +  ++VD G +PN +T+ T+M    + R+ +E
Sbjct  130   QGVTPDVVTYNCIIREHSVLGHWKEAIGIFKKMVDQGLSPNVVTFNTLMSSLCKQRKSDE  189

Query  1586  GLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
               +IL  M  +G   D  ++  ++   I  GR+ DA D V  M++ G+E ++ +Y+ LI+
Sbjct  190   AHKILNLMAERGEKPDIISHNILLHGYILEGRLDDAMDFVNAMVLKGLEPNIYSYSILIS  249

Query  1406  LYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDS  1227
              Y K   +D A  ++    ++G + D  T+  ++DGLCK G ++E     +     G   
Sbjct  250   AYSKNQTMDKAMYVLKRMRQEGMEPDVVTYNTVLDGLCKTGRLQEVQYLFDQMVSQGISP  309

Query  1226  NLVAFNCCIDGLCKVGEVDYALS-VFKSMDE---KDCFTYSSLVHGLCKAGRFRVASELL  1059
             +++ +N  ++G CK+G+   A   +++ MD     D  T S L+  LCK G  + A +LL
Sbjct  310   DIITYNTLVNGFCKLGKWKEASRFLYEMMDHGIRPDVITLSVLIDALCKEGMTKEAHKLL  369

Query  1058  LSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
                +  G +        +IDG    G I EA K+
Sbjct  370   DVMVRIGEEPNAVTYTTIIDGYCLIGQIYEAIKV  403


 Score =   181 bits (458),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/371 (30%), Positives = 188/371 (51%), Gaps = 4/371 (1%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC  2004
             G+  ++ +Y+ LI+AY     +D    +L RM + G++PDV+TYN+++    + G L   
Sbjct  236   GLEPNIYSYSILISAYSKNQTMDKAMYVLKRMRQEGMEPDVVTYNTVLDGLCKTGRLQEV  295

Query  2003  LDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSG  1824
               L ++M+  GI PD  +YNTL++   +LGK  EA RF  ++    I P  +T ++L+  
Sbjct  296   QYLFDQMVSQGISPDIITYNTLVNGFCKLGKWKEASRFLYEMMDHGIRPDVITLSVLIDA  355

Query  1823  LCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPN  1644
             LC  G T++A  L   +   G  P  VTY  +I G C  G+   A ++ + +   G+ PN
Sbjct  356   LCKEGMTKEAHKLLDVMVRIGEEPNAVTYTTIIDGYCLIGQIYEAIKVFHFMTSKGHAPN  415

Query  1643  AITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVG  1464
              +TY++++    +  R ++ +  L+EM R G    +  Y T+I+ L + GR+ DA + +G
Sbjct  416   VVTYSSLINGYCKIGRTDKAVGFLDEMYRNGLRPTTITYNTIINALFRVGRVGDAKELLG  475

Query  1463  NMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAG  1284
              MI  G+  DL   + ++   CK   +D A  +      + +  +  T  I+IDG+ +AG
Sbjct  476   KMIAAGVCPDLSTCHIMLGGLCKNRYIDEAMDVFQYISSQNYKLEVTTFNILIDGMLRAG  535

Query  1283  NMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVF----KSMDEKDCFTYS  1116
               K A    N     G   N+V +   + GL + G +D A  +F    KS    D    +
Sbjct  536   KFKGARDLFNAITSKGLMPNVVTYTIMMKGLIEKGLLDEAEELFLQLEKSGYPSDSIMLN  595

Query  1115  SLVHGLCKAGR  1083
             ++V  L + G 
Sbjct  596   AIVRSLLEKGE  606


 Score =   179 bits (453),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 115/437 (26%), Positives = 211/437 (48%), Gaps = 4/437 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              N  ++ LCK ++ ++A  ++      G   D++++N L+  Y     +D     ++ M 
Sbjct  174   FNTLMSSLCKQRKSDEAHKILNLMAERGEKPDIISHNILLHGYILEGRLDDAMDFVNAMV  233

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
               G++P++ +Y+ LI++ +++  + + + +L+ M + G+ PD  +YNT++  L + G+  
Sbjct  234   LKGLEPNIYSYSILISAYSKNQTMDKAMYVLKRMRQEGMEPDVVTYNTVLDGLCKTGRLQ  293

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             E    F  +    I P  +T+N L++G C  G  ++A     E+   G  P ++T ++LI
Sbjct  294   EVQYLFDQMVSQGISPDIITYNTLVNGFCKLGKWKEASRFLYEMMDHGIRPDVITLSVLI  353

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
               LC  G    A +LL+ +V IG  PNA+TYTTI+       +  E +++   M  KG+ 
Sbjct  354   DALCKEGMTKEAHKLLDVMVRIGEEPNAVTYTTIIDGYCLIGQIYEAIKVFHFMTSKGHA  413

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              +   Y ++I+   K GR   A   +  M  NG+    + YNT+IN   + G++ +A  L
Sbjct  414   PNVVTYSSLINGYCKIGRTDKAVGFLDEMYRNGLRPTTITYNTIINALFRVGRVGDAKEL  473

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
             + +    G   D  T  I++ GLCK   + EA+          +   +  FN  IDG+ +
Sbjct  474   LGKMIAAGVCPDLSTCHIMLGGLCKNRYIDEAMDVFQYISSQNYKLEVTTFNILIDGMLR  533

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G+   A  +F ++  K    +  TY+ ++ GL + G    A EL L     G       
Sbjct  534   AGKFKGARDLFNAITSKGLMPNVVTYTIMMKGLIEKGLLDEAEELFLQLEKSGYPSDSIM  593

Query  1016  RQAVIDGLQHSGFIQEA  966
               A++  L   G + +A
Sbjct  594   LNAIVRSLLEKGEVWKA  610


 Score =   154 bits (390),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/293 (29%), Positives = 150/293 (51%), Gaps = 0/293 (0%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             L++ +  LCK    ++A  ++   +R+G   + VTY T+I  YC    I     + H M 
Sbjct  349   LSVLIDALCKEGMTKEAHKLLDVMVRIGEEPNAVTYTTIIDGYCLIGQIYEAIKVFHFMT  408

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
               G  P+V+TY+SLI    + G   + +  L+EM   G+ P T +YNT+++ LFR+G+  
Sbjct  409   SKGHAPNVVTYSSLINGYCKIGRTDKAVGFLDEMYRNGLRPTTITYNTIINALFRVGRVG  468

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             +A      +    + P   T +I+L GLC N Y ++A+ +F+ +    +  ++ T+NILI
Sbjct  469   DAKELLGKMIAAGVCPDLSTCHIMLGGLCKNRYIDEAMDVFQYISSQNYKLEVTTFNILI  528

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
              G+  +G++  AR L N +   G  PN +TYT +MK        +E  ++  ++ + GY 
Sbjct  529   DGMLRAGKFKGARDLFNAITSKGLMPNVVTYTIMMKGLIEKGLLDEAEELFLQLEKSGYP  588

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGK  1386
              DS     ++  L++ G +  A   +  +      L+    + LI+L+ K+ K
Sbjct  589   SDSIMLNAIVRSLLEKGEVWKAIGFLDKIKERCFSLEASTTSLLIDLFSKDAK  641


 Score =   153 bits (387),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 106/383 (28%), Positives = 179/383 (47%), Gaps = 1/383 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             +I ++   K + ++KA  V+    + G+  DVVTYNT++   C    +     +  +M  
Sbjct  245   SILISAYSKNQTMDKAMYVLKRMRQEGMEPDVVTYNTVLDGLCKTGRLQEVQYLFDQMVS  304

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              GI PD+ITYN+L+    + G        L EM++ GI PD  + + L+  L + G   E
Sbjct  305   QGISPDIITYNTLVNGFCKLGKWKEASRFLYEMMDHGIRPDVITLSVLIDALCKEGMTKE  364

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A++    +      P  VT+  ++ G C+ G   +A+ +F  +   G  P +VTY+ LI+
Sbjct  365   AHKLLDVMVRIGEEPNAVTYTTIIDGYCLIGQIYEAIKVFHFMTSKGHAPNVVTYSSLIN  424

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G C  GR   A   L+E+   G  P  ITY TI+   FR  R  +  ++L +M   G   
Sbjct  425   GYCKIGRTDKAVGFLDEMYRNGLRPTTITYNTIINALFRVGRVGDAKELLGKMIAAGVCP  484

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D      ++  L K   + +A D    +     +L++  +N LI+   + GK   A  L 
Sbjct  485   DLSTCHIMLGGLCKNRYIDEAMDVFQYISSQNYKLEVTTFNILIDGMLRAGKFKGARDLF  544

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
                  KG   +  T+TI++ GL + G + EA       +  G+ S+ +  N  +  L + 
Sbjct  545   NAITSKGLMPNVVTYTIMMKGLIEKGLLDEAEELFLQLEKSGYPSDSIMLNAIVRSLLEK  604

Query  1181  GEVDYALSVFKSMDEKDCFTYSS  1113
             GEV  A+     + E+ CF+  +
Sbjct  605   GEVWKAIGFLDKIKER-CFSLEA  626


 Score =   147 bits (370),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 99/368 (27%), Positives = 172/368 (47%), Gaps = 41/368 (11%)
 Frame = -1

Query  1937  MHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGF  1758
             M+C  ++ + D  +  F  +      P  +TFN+LL GLC     ++A ++F  +  SG 
Sbjct  1     MNCCSQMNRMDLGFGIFGGLLKRGWRPNTLTFNLLLKGLCSEKKIDEAAVVFDRMPLSGC  60

Query  1757  I-------------------------------------PQLVTYNILIHGLCNSGRWAPA  1689
                                                   P +VTYNI+I+GLC  G    A
Sbjct  61    APDVVSYTTLIKGLTCNGKTGLGLELLRKMVTLGGGCKPDVVTYNIIINGLCKDGAMEKA  120

Query  1688  RRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISF  1509
              +L  E+V  G  P+ +TY  I++       ++E + I ++M  +G   +   + T++S 
Sbjct  121   SKLFEEMVAQGVTPDVVTYNCIIREHSVLGHWKEAIGIFKKMVDQGLSPNVVTFNTLMSS  180

Query  1508  LIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCD  1329
             L K  +  +A+  +  M   G + D++++N L++ Y  EG+LD+A   V     KG + +
Sbjct  181   LCKQRKSDEAHKILNLMAERGEKPDIISHNILLHGYILEGRLDDAMDFVNAMVLKGLEPN  240

Query  1328  KYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFK  1149
              Y+++I+I    K   M +A+  L   +  G + ++V +N  +DGLCK G +     +F 
Sbjct  241   IYSYSILISAYSKNQTMDKAMYVLKRMRQEGMEPDVVTYNTVLDGLCKTGRLQEVQYLFD  300

Query  1148  SMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSG  981
              M  +    D  TY++LV+G CK G+++ AS  L   +  G++        +ID L   G
Sbjct  301   QMVSQGISPDIITYNTLVNGFCKLGKWKEASRFLYEMMDHGIRPDVITLSVLIDALCKEG  360

Query  980   FIQEARKL  957
               +EA KL
Sbjct  361   MTKEAHKL  368


 Score = 71.2 bits (173),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/230 (22%), Positives = 104/230 (45%), Gaps = 0/230 (0%)
 Frame = -1

Query  2240  CKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDV  2061
             CK  + +KA   + +  R G+    +TYNT+I A      +     +L +M   G+ PD+
Sbjct  427   CKIGRTDKAVGFLDEMYRNGLRPTTITYNTIINALFRVGRVGDAKELLGKMIAAGVCPDL  486

Query  2060  ITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQD  1881
              T + ++    ++  +   +D+ + +       +  ++N L+  + R GK   A   F  
Sbjct  487   STCHIMLGGLCKNRYIDEAMDVFQYISSQNYKLEVTTFNILIDGMLRAGKFKGARDLFNA  546

Query  1880  IFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGR  1701
             I    + P  VT+ I++ GL   G  ++A  LF +L+ SG+    +  N ++  L   G 
Sbjct  547   ITSKGLMPNVVTYTIMMKGLIEKGLLDEAEELFLQLEKSGYPSDSIMLNAIVRSLLEKGE  606

Query  1700  WAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKG  1551
                A   L+++ +  ++  A T + ++    +  ++ E + +L    + G
Sbjct  607   VWKAIGFLDKIKERCFSLEASTTSLLIDLFSKDAKYHEHMNLLPIFSQYG  656



>emb|CDP10983.1| unnamed protein product [Coffea canephora]
Length=775

 Score =   232 bits (591),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 135/449 (30%), Positives = 229/449 (51%), Gaps = 4/449 (1%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             LS    NI +   CK   LE A+ +     ++GV  D +TYNTL+  Y  F  ++  + +
Sbjct  273   LSVYTYNIMIDIFCKEGDLESAQRLFARMKQMGVSPDTITYNTLLDGYGKFGHLEDVFGL  332

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
                M + G  PDVITYN+LI  + +   + +  D L +M + G+ PDT +Y+T +    +
Sbjct  333   YEEMKDAGCPPDVITYNTLINCSCKSEKMPKAFDFLRQMKDSGLKPDTVTYSTFVDAFCK  392

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
              G   +A +F+ D++   + P   T+  L+   C  G  + AL L +E+   G    +VT
Sbjct  393   EGLLQQALKFYLDMWRVGLTPNEFTYTSLIDANCKAGKLDDALKLLKEMLEMGCKLNIVT  452

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             Y +L+ GLC  G+   A  +   +   G  PN   YT ++    ++ R E  +++L +M+
Sbjct  453   YTVLVDGLCEEGKMKEAEEVFIAMEKDGIIPNEKIYTALIHGYIKANRIEHAMEVLNQMK  512

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
                   D F Y T++  +   G + +A   +  M  +G++++ V Y TL++ Y K GK  
Sbjct  513   ENQIEHDLFLYATIVWGVCSQGNLAEAKRLLDEMKGHGVKVNHVIYTTLVDAYFKAGKSA  572

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              A  L+ + +RKG      T++++IDG C+ G+++EA+   +  + +G   N+V +   I
Sbjct  573   EACSLLDKMKRKGISPTIVTYSVLIDGYCRLGSIQEAVDCFSRMQQIGLQPNVVVYTALI  632

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             DGLCK   ++ A S+F  M +K  F     Y++L+ G  K+G+   A EL    +  G+K
Sbjct  633   DGLCKSKRIEDAESLFDEMIDKGIFPDKIAYTALMDGNLKSGKVEDALELRNRMVETGLK  692

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             +       +I GL   G IQ AR L  E+
Sbjct  693   LDLHAYTTLISGLSRCGDIQRARNLFDEM  721


 Score =   208 bits (530),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/422 (29%), Positives = 208/422 (49%), Gaps = 4/422 (1%)
 Frame = -1

Query  2198  DGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHG  2019
             D I  G+   V TYN +I  +C    +++   +  RM ++G+ PD ITYN+L+    + G
Sbjct  265   DVIDAGIVLSVYTYNIMIDIFCKEGDLESAQRLFARMKQMGVSPDTITYNTLLDGYGKFG  324

Query  2018  MLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFN  1839
              L     L EEM + G  PD  +YNTL++C  +  K  +A+ F + +    + P  VT++
Sbjct  325   HLEDVFGLYEEMKDAGCPPDVITYNTLINCSCKSEKMPKAFDFLRQMKDSGLKPDTVTYS  384

Query  1838  ILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDI  1659
               +   C  G  ++AL  + ++   G  P   TY  LI   C +G+   A +LL E++++
Sbjct  385   TFVDAFCKEGLLQQALKFYLDMWRVGLTPNEFTYTSLIDANCKAGKLDDALKLLKEMLEM  444

Query  1658  GYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDA  1479
             G   N +TYT ++       + +E  ++   M + G I +   Y  +I   IKA R++ A
Sbjct  445   GCKLNIVTYTVLVDGLCEEGKMKEAEEVFIAMEKDGIIPNEKIYTALIHGYIKANRIEHA  504

Query  1478  YDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDG  1299
              + +  M  N IE DL  Y T++   C +G L  A  L+ E +  G   +   +T ++D 
Sbjct  505   MEVLNQMKENQIEHDLFLYATIVWGVCSQGNLAEAKRLLDEMKGHGVKVNHVIYTTLVDA  564

Query  1298  LCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMD----EKD  1131
               KAG   EA   L+  K  G    +V ++  IDG C++G +  A+  F  M     + +
Sbjct  565   YFKAGKSAEACSLLDKMKRKGISPTIVTYSVLIDGYCRLGSIQEAVDCFSRMQQIGLQPN  624

Query  1130  CFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHS  951
                Y++L+ GLCK+ R   A  L    I  G+   K    A++DG   SG +++A +L +
Sbjct  625   VVVYTALIDGLCKSKRIEDAESLFDEMIDKGIFPDKIAYTALMDGNLKSGKVEDALELRN  684

Query  950   EL  945
              +
Sbjct  685   RM  686


 Score =   174 bits (440),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/375 (30%), Positives = 184/375 (49%), Gaps = 0/375 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  + C CK++++ KA   +      G+  D VTY+T + A+C    +         M  
Sbjct  349   NTLINCSCKSEKMPKAFDFLRQMKDSGLKPDTVTYSTFVDAFCKEGLLQQALKFYLDMWR  408

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             VG+ P+  TY SLI +  + G L   L LL+EMLE+G   +  +Y  L+  L   GK  E
Sbjct  409   VGLTPNEFTYTSLIDANCKAGKLDDALKLLKEMLEMGCKLNIVTYTVLVDGLCEEGKMKE  468

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F  +    I P    +  L+ G       E A+ +  ++K +     L  Y  ++ 
Sbjct  469   AEEVFIAMEKDGIIPNEKIYTALIHGYIKANRIEHAMEVLNQMKENQIEHDLFLYATIVW  528

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G+C+ G  A A+RLL+E+   G   N + YTT++   F++ +  E   +L++M+RKG   
Sbjct  529   GVCSQGNLAEAKRLLDEMKGHGVKVNHVIYTTLVDAYFKAGKSAEACSLLDKMKRKGISP  588

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
                 Y  +I    + G +++A DC   M   G++ ++V Y  LI+  CK  ++++A  L 
Sbjct  589   TIVTYSVLIDGYCRLGSIQEAVDCFSRMQQIGLQPNVVVYTALIDGLCKSKRIEDAESLF  648

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E   KG   DK  +T ++DG  K+G +++AL   N     G   +L A+   I GL + 
Sbjct  649   DEMIDKGIFPDKIAYTALMDGNLKSGKVEDALELRNRMVETGLKLDLHAYTTLISGLSRC  708

Query  1181  GEVDYALSVFKSMDE  1137
             G++  A ++F  M E
Sbjct  709   GDIQRARNLFDEMIE  723


 Score =   160 bits (405),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 112/387 (29%), Positives = 172/387 (44%), Gaps = 10/387 (3%)
 Frame = -1

Query  2069  PDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAY--  1896
             P    +++L +     G+L    +    M    +LP   S N L+H   RL K D+A   
Sbjct  203   PGYGVFDALFSVFVELGLLEEASECFLRMRGYRVLPKLRSCNHLLH---RLSKKDDAIMA  259

Query  1895  -RFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
              +FF D+    I     T+NI++   C  G  E A  LF  +K  G  P  +TYN L+ G
Sbjct  260   NKFFGDVIDAGIVLSVYTYNIMIDIFCKEGDLESAQRLFARMKQMGVSPDTITYNTLLDG  319

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFD  1539
                 G       L  E+ D G  P+ ITY T++ C  +S +  +    L +M+  G   D
Sbjct  320   YGKFGHLEDVFGLYEEMKDAGCPPDVITYNTLINCSCKSEKMPKAFDFLRQMKDSGLKPD  379

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVV  1359
             +  Y T +    K G ++ A     +M   G+  +   Y +LI+  CK GKLD+A  L+ 
Sbjct  380   TVTYSTFVDAFCKEGLLQQALKFYLDMWRVGLTPNEFTYTSLIDANCKAGKLDDALKLLK  439

Query  1358  EAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVG  1179
             E    G   +  T+T+++DGLC+ G MKEA       +  G   N   +   I G  K  
Sbjct  440   EMLEMGCKLNIVTYTVLVDGLCEEGKMKEAEEVFIAMEKDGIIPNEKIYTALIHGYIKAN  499

Query  1178  EVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQ  1011
              +++A+ V   M E     D F Y+++V G+C  G    A  LL      G+K+      
Sbjct  500   RIEHAMEVLNQMKENQIEHDLFLYATIVWGVCSQGNLAEAKRLLDEMKGHGVKVNHVIYT  559

Query  1010  AVIDGLQHSGFIQEARKLHSELKLSKI  930
              ++D    +G   EA  L  ++K   I
Sbjct  560   TLVDAYFKAGKSAEACSLLDKMKRKGI  586


 Score =   153 bits (387),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 97/324 (30%), Positives = 158/324 (49%), Gaps = 0/324 (0%)
 Frame = -1

Query  2309  LE*MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCC  2130
             L+ M  +  +L+     + V  LC+  ++++AE V I   + G+  +   Y  LI  Y  
Sbjct  438   LKEMLEMGCKLNIVTYTVLVDGLCEEGKMKEAEEVFIAMEKDGIIPNEKIYTALIHGYIK  497

Query  2129  FVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWS  1950
                I+    +L++M E  I+ D+  Y +++      G L+    LL+EM   G+  +   
Sbjct  498   ANRIEHAMEVLNQMKENQIEHDLFLYATIVWGVCSQGNLAEAKRLLDEMKGHGVKVNHVI  557

Query  1949  YNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELK  1770
             Y TL+   F+ GK  EA      +    I P  VT+++L+ G C  G  ++A+  F  ++
Sbjct  558   YTTLVDAYFKAGKSAEACSLLDKMKRKGISPTIVTYSVLIDGYCRLGSIQEAVDCFSRMQ  617

Query  1769  HSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFE  1590
               G  P +V Y  LI GLC S R   A  L +E++D G  P+ I YT +M    +S + E
Sbjct  618   QIGLQPNVVVYTALIDGLCKSKRIEDAESLFDEMIDKGIFPDKIAYTALMDGNLKSGKVE  677

Query  1589  EGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLI  1410
             + L++   M   G   D  AY T+IS L + G ++ A +    MI NG+  D++ Y  LI
Sbjct  678   DALELRNRMVETGLKLDLHAYTTLISGLSRCGDIQRARNLFDEMIENGVLPDVIIYGCLI  737

Query  1409  NLYCKEGKLDNAYMLVVEAERKGF  1338
               Y + G ++ A  L  E  R+G 
Sbjct  738   RKYHELGDVNEALFLQNEMTRRGL  761


 Score =   131 bits (330),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 94/364 (26%), Positives = 157/364 (43%), Gaps = 35/364 (10%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             V   CK   L++A    +D  RVG+  +  TY +LI A C    +D    +L  M E+G 
Sbjct  387   VDAFCKEGLLQQALKFYLDMWRVGLTPNEFTYTSLIDANCKAGKLDDALKLLKEMLEMGC  446

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             K +++TY  L+      G +    ++   M + GI+P+   Y  L+H   +  + + A  
Sbjct  447   KLNIVTYTVLVDGLCEEGKMKEAEEVFIAMEKDGIIPNEKIYTALIHGYIKANRIEHAME  506

Query  1892  ---------------FFQDIFWG--------------------DIPPCPVTFNILLSGLC  1818
                             +  I WG                     +    V +  L+    
Sbjct  507   VLNQMKENQIEHDLFLYATIVWGVCSQGNLAEAKRLLDEMKGHGVKVNHVIYTTLVDAYF  566

Query  1817  MNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAI  1638
               G + +A  L  ++K  G  P +VTY++LI G C  G    A    + +  IG  PN +
Sbjct  567   KAGKSAEACSLLDKMKRKGISPTIVTYSVLIDGYCRLGSIQEAVDCFSRMQQIGLQPNVV  626

Query  1637  TYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNM  1458
              YT ++    +S+R E+   + +EM  KG   D  AY  ++   +K+G+++DA +    M
Sbjct  627   VYTALIDGLCKSKRIEDAESLFDEMIDKGIFPDKIAYTALMDGNLKSGKVEDALELRNRM  686

Query  1457  IMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNM  1278
             +  G++LDL AY TLI+   + G +  A  L  E    G   D   +  +I    + G++
Sbjct  687   VETGLKLDLHAYTTLISGLSRCGDIQRARNLFDEMIENGVLPDVIIYGCLIRKYHELGDV  746

Query  1277  KEAL  1266
              EAL
Sbjct  747   NEAL  750


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 126/316 (40%), Gaps = 42/316 (13%)
 Frame = -1

Query  1883  DIFWGDIP---PCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
             D+ W       P    F+ L S     G  E+A   F  ++    +P+L + N L+H L 
Sbjct  192   DVLWATRNICFPGYGVFDALFSVFVELGLLEEASECFLRMRGYRVLPKLRSCNHLLHRLS  251

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
                    A +   +++D                                    G +   +
Sbjct  252   KKDDAIMANKFFGDVID-----------------------------------AGIVLSVY  276

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              Y  +I    K G ++ A      M   G+  D + YNTL++ Y K G L++ + L  E 
Sbjct  277   TYNIMIDIFCKEGDLESAQRLFARMKQMGVSPDTITYNTLLDGYGKFGHLEDVFGLYEEM  336

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEV  1173
             +  G   D  T+  +I+  CK+  M +A   L   K  G   + V ++  +D  CK G +
Sbjct  337   KDAGCPPDVITYNTLINCSCKSEKMPKAFDFLRQMKDSGLKPDTVTYSTFVDAFCKEGLL  396

Query  1172  DYALSVFKSMDE----KDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAV  1005
               AL  +  M       + FTY+SL+   CKAG+   A +LL   +  G K+       +
Sbjct  397   QQALKFYLDMWRVGLTPNEFTYTSLIDANCKAGKLDDALKLLKEMLEMGCKLNIVTYTVL  456

Query  1004  IDGLQHSGFIQEARKL  957
             +DGL   G ++EA ++
Sbjct  457   VDGLCEEGKMKEAEEV  472



>ref|XP_002970774.1| hypothetical protein SELMODRAFT_94312 [Selaginella moellendorffii]
 gb|EFJ28100.1| hypothetical protein SELMODRAFT_94312 [Selaginella moellendorffii]
Length=497

 Score =   226 bits (576),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 143/420 (34%), Positives = 218/420 (52%), Gaps = 6/420 (1%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC  2004
             G   +VVTYN+LI   C     D    +   M  V   P ++TYN+L+    R G L R 
Sbjct  5     GCEPNVVTYNSLIDGLCKNNEPDRAQELFEHMKSVECSPSMVTYNTLLDGLFRTGKLERA  64

Query  2003  LDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSG  1824
             + L +EML+     D  S+N L+  L R GK + A  FF+ +      P  +T+++L+ G
Sbjct  65    MALFQEMLDRRS-HDVISFNILVTGLCRAGKIETALEFFRKM-DDRCSPNVITYSVLIDG  122

Query  1823  LCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPN  1644
             LC      +A+ L   +K  G  P ++TY IL+ GLC   + A A  +L E++D G  PN
Sbjct  123   LCKANRVSQAVELLESMKARGCSPDVITYTILVDGLCKESKVAAAWEVLREMLDAGCVPN  182

Query  1643  AITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVG  1464
              +TY +++    R+RR  + L ++ +M  +G   +   Y T+I  L K GR+KDA   + 
Sbjct  183   LVTYNSLLHGLCRARRVSDALALMRDMTCRGCTPNVVTYGTLIDGLCKVGRVKDACAMLA  242

Query  1463  NMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAG  1284
             +MI  G   DL+ YN LIN  CK  ++D +  L+  A   G   D  T++ +I GLC++ 
Sbjct  243   DMIDKGGTPDLMIYNMLINGLCKADQVDESIALLRRAVSGGIKPDVVTYSSVIYGLCRSN  302

Query  1283  NMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMD----EKDCFTYS  1116
              + EA R L   K  G   +++ ++  IDGLCK G+VD A  +++ M     + D  TYS
Sbjct  303   RLDEACRLLLYVKSRGCPPDVILYSTLIDGLCKAGKVDEAFDLYEVMTGDGCDADVVTYS  362

Query  1115  SLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
             +L+ GLCKAGR   A  LL   +  G         ++I GL     + EA +L  E++ S
Sbjct  363   TLIDGLCKAGRVDEAHLLLARMVRMGTPPSTMTYNSLIKGLCDLNHLDEAIELVEEMERS  422


 Score =   194 bits (493),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 125/411 (30%), Positives = 207/411 (50%), Gaps = 6/411 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI V  LC+A ++E A            P +V+TY+ LI   C    +     +L  M  
Sbjct  83    NILVTGLCRAGKIETALEFFRKMDDRCSP-NVITYSVLIDGLCKANRVSQAVELLESMKA  141

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G  PDVITY  L+    +   ++   ++L EML+ G +P+  +YN+L+H L R  +  +
Sbjct  142   RGCSPDVITYTILVDGLCKESKVAAAWEVLREMLDAGCVPNLVTYNSLLHGLCRARRVSD  201

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A    +D+      P  VT+  L+ GLC  G  + A  +  ++   G  P L+ YN+LI+
Sbjct  202   ALALMRDMTCRGCTPNVVTYGTLIDGLCKVGRVKDACAMLADMIDKGGTPDLMIYNMLIN  261

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC + +   +  LL   V  G  P+ +TY++++    RS R +E  ++L  ++ +G   
Sbjct  262   GLCKADQVDESIALLRRAVSGGIKPDVVTYSSVIYGLCRSNRLDEACRLLLYVKSRGCPP  321

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y T+I  L KAG++ +A+D    M  +G + D+V Y+TLI+  CK G++D A++L+
Sbjct  322   DVILYSTLIDGLCKAGKVDEAFDLYEVMTGDGCDADVVTYSTLIDGLCKAGRVDEAHLLL  381

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
                 R G      T+  +I GLC   ++ EA+  +   +      + V +N  I G+C++
Sbjct  382   ARMVRMGTPPSTMTYNSLIKGLCDLNHLDEAIELVEEMERSNCAPSAVTYNILIHGMCRM  441

Query  1181  GEVDY-ALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCII  1044
               VD  AL  F+ M +     D  TYS L+ GL K+        L+L  ++
Sbjct  442   ERVDSAALDYFQEMIDNGVIPDHITYSILLEGLKKSKDLHELRHLVLDQMV  492


 Score =   129 bits (324),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 128/240 (53%), Gaps = 2/240 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N+ +  LCKA Q++++  ++   +  G+  DVVTY+++I   C    +D    +L  +  
Sbjct  257   NMLINGLCKADQVDESIALLRRAVSGGIKPDVVTYSSVIYGLCRSNRLDEACRLLLYVKS  316

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G  PDVI Y++LI    + G +    DL E M   G   D  +Y+TL+  L + G+ DE
Sbjct  317   RGCPPDVILYSTLIDGLCKAGKVDEAFDLYEVMTGDGCDADVVTYSTLIDGLCKAGRVDE  376

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A+     +     PP  +T+N L+ GLC   + ++A+ L  E++ S   P  VTYNILIH
Sbjct  377   AHLLLARMVRMGTPPSTMTYNSLIKGLCDLNHLDEAIELVEEMERSNCAPSAVTYNILIH  436

Query  1721  GLCNSGRW-APARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQ-ILEEMRRKGY  1548
             G+C   R  + A     E++D G  P+ ITY+ +++   +S+   E    +L++M + GY
Sbjct  437   GMCRMERVDSAALDYFQEMIDNGVIPDHITYSILLEGLKKSKDLHELRHLVLDQMVQLGY  496



>ref|XP_010530278.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010530280.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
isoform X2 [Tarenaya hassleriana]
Length=608

 Score =   229 bits (583),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 126/445 (28%), Positives = 228/445 (51%), Gaps = 4/445 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             LNI + C C+++Q+    +V+   I++G   +VVT+ TLI   C    + A  S++ RM 
Sbjct  97    LNILINCFCRSRQVGLGFSVLGKIIKMGYEPNVVTFTTLINGLCLEGKLSAALSLVERMV  156

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             E G  P+V+T  +++      G + +   L+++M E G  P+ ++Y  +++ + +LG   
Sbjct  157   EDGYTPNVVTCTTVVNGLCLQGRIRKAFTLVDQMSEKGYQPNVFTYGAIVNGICKLGDSA  216

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A      +    +    V +N ++  LC  G  + A+ LFR++   G  P +VTYN L+
Sbjct  217   LALNLITKMEERHVEINVVVYNTIIDCLCKGGLIDDAINLFRKMDDRGVTPNIVTYNTLV  276

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLC+ GRW    R LN+++     P  +T+T ++    +  +F E  ++ E+M + G +
Sbjct  277   NGLCSYGRWGDVARSLNDMIKRKIIPEVVTFTRLIDNFVKEGKFLEASKLYEQMVQTGLV  336

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              ++F Y ++I       R+ +A      M   G   ++V +NTLI+ +CK  ++D+   L
Sbjct  337   PNTFTYNSLIKGFCMQNRLDEAKKMFDFMATKGCSPNVVTFNTLIDGFCKSSRVDDGMKL  396

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E  ++G   D +T+  +I   C+ GN+  A +H   T+  G   +L+ FN  +DGLCK
Sbjct  397   FSEMSQRGVVADTHTYNTLIQWFCRVGNLDAARKHFLETQGHGPHPDLITFNVLLDGLCK  456

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G ++ ALS++  M++     D   ++ ++HGLC   +   A  L       G++     
Sbjct  457   NGNLEKALSLYNKMEKSGMNLDIIAHTIIIHGLCMDDKVEDALRLFNGLFDRGVEPNVKT  516

Query  1016  RQAVIDGLQHSGFIQEARKLHSELK  942
               A+I GL   G + EA  L  ++K
Sbjct  517   YTAMISGLCRKGLLDEAGNLFRDMK  541


 Score =   160 bits (404),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 105/420 (25%), Positives = 189/420 (45%), Gaps = 39/420 (9%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC  2004
             G+     + N LI  +C    +  G+S+L ++ ++G +P+V+T+ +LI      G LS  
Sbjct  89    GISHSNYSLNILINCFCRSRQVGLGFSVLGKIIKMGYEPNVVTFTTLINGLCLEGKLSAA  148

Query  2003  LDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSG  1824
             L L+E M+E G  P+                                    VT   +++G
Sbjct  149   LSLVERMVEDGYTPNV-----------------------------------VTCTTVVNG  173

Query  1823  LCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPN  1644
             LC+ G   KA  L  ++   G+ P + TY  +++G+C  G  A A  L+ ++ +     N
Sbjct  174   LCLQGRIRKAFTLVDQMSEKGYQPNVFTYGAIVNGICKLGDSALALNLITKMEERHVEIN  233

Query  1643  AITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVG  1464
              + Y TI+ C  +    ++ + +  +M  +G   +   Y T+++ L   GR  D    + 
Sbjct  234   VVVYNTIIDCLCKGGLIDDAINLFRKMDDRGVTPNIVTYNTLVNGLCSYGRWGDVARSLN  293

Query  1463  NMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAG  1284
             +MI   I  ++V +  LI+ + KEGK   A  L  +  + G   + +T+  +I G C   
Sbjct  294   DMIKRKIIPEVVTFTRLIDNFVKEGKFLEASKLYEQMVQTGLVPNTFTYNSLIKGFCMQN  353

Query  1283  NMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYS  1116
              + EA +  +     G   N+V FN  IDG CK   VD  + +F  M ++    D  TY+
Sbjct  354   RLDEAKKMFDFMATKGCSPNVVTFNTLIDGFCKSSRVDDGMKLFSEMSQRGVVADTHTYN  413

Query  1115  SLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
             +L+   C+ G    A +  L     G          ++DGL  +G +++A  L+++++ S
Sbjct  414   TLIQWFCRVGNLDAARKHFLETQGHGPHPDLITFNVLLDGLCKNGNLEKALSLYNKMEKS  473


 Score =   144 bits (362),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/321 (27%), Positives = 151/321 (47%), Gaps = 0/321 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  + CLCK   ++ A  +       GV  ++VTYNTL+   C +         L+ M +
Sbjct  238   NTIIDCLCKGGLIDDAINLFRKMDDRGVTPNIVTYNTLVNGLCSYGRWGDVARSLNDMIK  297

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I P+V+T+  LI +  + G       L E+M++ G++P+T++YN+L+       + DE
Sbjct  298   RKIIPEVVTFTRLIDNFVKEGKFLEASKLYEQMVQTGLVPNTFTYNSLIKGFCMQNRLDE  357

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A + F  +      P  VTFN L+ G C +   +  + LF E+   G +    TYN LI 
Sbjct  358   AKKMFDFMATKGCSPNVVTFNTLIDGFCKSSRVDDGMKLFSEMSQRGVVADTHTYNTLIQ  417

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
               C  G    AR+   E    G +P+ IT+  ++    ++   E+ L +  +M + G   
Sbjct  418   WFCRVGNLDAARKHFLETQGHGPHPDLITFNVLLDGLCKNGNLEKALSLYNKMEKSGMNL  477

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D  A+  +I  L    +++DA      +   G+E ++  Y  +I+  C++G LD A  L 
Sbjct  478   DIIAHTIIIHGLCMDDKVEDALRLFNGLFDRGVEPNVKTYTAMISGLCRKGLLDEAGNLF  537

Query  1361  VEAERKGFDCDKYTHTIIIDG  1299
              + +  G   +  T+  +I G
Sbjct  538   RDMKEAGCFPNDRTYNALIRG  558


 Score =   135 bits (339),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/310 (28%), Positives = 146/310 (47%), Gaps = 3/310 (1%)
 Frame = -1

Query  2291  IKSRLSTKLLNIT--VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGI  2118
             IK ++  +++  T  +    K  +  +A  +    ++ G+  +  TYN+LI  +C    +
Sbjct  296   IKRKIIPEVVTFTRLIDNFVKEGKFLEASKLYEQMVQTGLVPNTFTYNSLIKGFCMQNRL  355

Query  2117  DAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTL  1938
             D    +   M   G  P+V+T+N+LI    +   +   + L  EM + G++ DT +YNTL
Sbjct  356   DEAKKMFDFMATKGCSPNVVTFNTLIDGFCKSSRVDDGMKLFSEMSQRGVVADTHTYNTL  415

Query  1937  MHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGF  1758
             +    R+G  D A + F +       P  +TFN+LL GLC NG  EKAL L+ +++ SG 
Sbjct  416   IQWFCRVGNLDAARKHFLETQGHGPHPDLITFNVLLDGLCKNGNLEKALSLYNKMEKSGM  475

Query  1757  IPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQ  1578
                ++ + I+IHGLC   +   A RL N L D G  PN  TYT ++    R    +E   
Sbjct  476   NLDIIAHTIIIHGLCMDDKVEDALRLFNGLFDRGVEPNVKTYTAMISGLCRKGLLDEAGN  535

Query  1577  ILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYC  1398
             +  +M+  G   +   Y  +I   +  G      + V  M   G   D      ++++  
Sbjct  536   LFRDMKEAGCFPNDRTYNALIRGHLINGYTSMGVELVREMRSCGFSADASTTEIIVDM-I  594

Query  1397  KEGKLDNAYM  1368
              +G LD  ++
Sbjct  595   YDGGLDKKFV  604


 Score =   114 bits (284),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 77/289 (27%), Positives = 150/289 (52%), Gaps = 12/289 (4%)
 Frame = -1

Query  1787  LFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCF  1608
             +F ++  S  +P +V +N L+  +    R+     L   +   G + +  +   ++ C  
Sbjct  46    VFDQMVRSRPLPSIVDFNKLLSAIAKMKRYDIVISLCKRMELHGISHSNYSLNILINCFC  105

Query  1607  RSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLV  1428
             RSR+   G  +L ++ + GY  +   + T+I+ L   G++  A   V  M+ +G   ++V
Sbjct  106   RSRQVGLGFSVLGKIIKMGYEPNVVTFTTLINGLCLEGKLSAALSLVERMVEDGYTPNVV  165

Query  1427  AYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCT  1248
                T++N  C +G++  A+ LV +   KG+  + +T+  I++G+CK G+   AL  +   
Sbjct  166   TCTTVVNGLCLQGRIRKAFTLVDQMSEKGYQPNVFTYGAIVNGICKLGDSALALNLITKM  225

Query  1247  KLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRF  1080
             +    + N+V +N  ID LCK G +D A+++F+ MD++    +  TY++LV+GLC  GR+
Sbjct  226   EERHVEINVVVYNTIIDCLCKGGLIDDAINLFRKMDDRGVTPNIVTYNTLVNGLCSYGRW  285

Query  1079  ----RVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
                 R  ++++   II   +++   R  +ID     G   EA KL+ ++
Sbjct  286   GDVARSLNDMIKRKIIP--EVVTFTR--LIDNFVKEGKFLEASKLYEQM  330


 Score =   111 bits (278),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 79/305 (26%), Positives = 139/305 (46%), Gaps = 4/305 (1%)
 Frame = -1

Query  1859  PCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRL  1680
             P  V FN LLS +      +  + L + ++  G      + NILI+  C S +      +
Sbjct  57    PSIVDFNKLLSAIAKMKRYDIVISLCKRMELHGISHSNYSLNILINCFCRSRQVGLGFSV  116

Query  1679  LNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIK  1500
             L +++ +GY PN +T+TT++       +    L ++E M   GY  +     TV++ L  
Sbjct  117   LGKIIKMGYEPNVVTFTTLINGLCLEGKLSAALSLVERMVEDGYTPNVVTCTTVVNGLCL  176

Query  1499  AGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYT  1320
              GR++ A+  V  M   G + ++  Y  ++N  CK G    A  L+ + E +  + +   
Sbjct  177   QGRIRKAFTLVDQMSEKGYQPNVFTYGAIVNGICKLGDSALALNLITKMEERHVEINVVV  236

Query  1319  HTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEV-DYALSVFKSM  1143
             +  IID LCK G + +A+         G   N+V +N  ++GLC  G   D A S+   +
Sbjct  237   YNTIIDCLCKGGLIDDAINLFRKMDDRGVTPNIVTYNTLVNGLCSYGRWGDVARSLNDMI  296

Query  1142  DEK---DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQ  972
               K   +  T++ L+    K G+F  AS+L    +  G+        ++I G      + 
Sbjct  297   KRKIIPEVVTFTRLIDNFVKEGKFLEASKLYEQMVQTGLVPNTFTYNSLIKGFCMQNRLD  356

Query  971   EARKL  957
             EA+K+
Sbjct  357   EAKKM  361


 Score = 69.3 bits (168),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/217 (24%), Positives = 100/217 (46%), Gaps = 4/217 (2%)
 Frame = -1

Query  1583  LQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINL  1404
             + + ++M R   +     +  ++S + K  R          M ++GI     + N LIN 
Sbjct  44    VDVFDQMVRSRPLPSIVDFNKLLSAIAKMKRYDIVISLCKRMELHGISHSNYSLNILINC  103

Query  1403  YCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSN  1224
             +C+  ++   + ++ +  + G++ +  T T +I+GLC  G +  AL  +      G+  N
Sbjct  104   FCRSRQVGLGFSVLGKIIKMGYEPNVVTFTTLINGLCLEGKLSAALSLVERMVEDGYTPN  163

Query  1223  LVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLL  1056
             +V     ++GLC  G +  A ++   M EK    + FTY ++V+G+CK G   +A  L+ 
Sbjct  164   VVTCTTVVNGLCLQGRIRKAFTLVDQMSEKGYQPNVFTYGAIVNGICKLGDSALALNLIT  223

Query  1055  SCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
                   ++I       +ID L   G I +A  L  ++
Sbjct  224   KMEERHVEINVVVYNTIIDCLCKGGLIDDAINLFRKM  260


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 78/173 (45%), Gaps = 8/173 (5%)
 Frame = -1

Query  1553  GYIFDSFAYCTVI----SFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGK  1386
             G++    + C  +    S  +    +KD  D    M+ +     +V +N L++   K  +
Sbjct  15    GFVHSHLSSCLYLRPRFSSSVPYSNVKDVVDVFDQMVRSRPLPSIVDFNKLLSAIAKMKR  74

Query  1385  LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNC  1206
              D    L    E  G     Y+  I+I+  C++  +      L     MG++ N+V F  
Sbjct  75    YDIVISLCKRMELHGISHSNYSLNILINCFCRSRQVGLGFSVLGKIIKMGYEPNVVTFTT  134

Query  1205  CIDGLCKVGEVDYALSVFKSMDE----KDCFTYSSLVHGLCKAGRFRVASELL  1059
              I+GLC  G++  ALS+ + M E     +  T +++V+GLC  GR R A  L+
Sbjct  135   LINGLCLEGKLSAALSLVERMVEDGYTPNVVTCTTVVNGLCLQGRIRKAFTLV  187



>ref|XP_010540327.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010540328.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=636

 Score =   228 bits (582),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 132/445 (30%), Positives = 232/445 (52%), Gaps = 4/445 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             LNI +   C++ Q+    +V+   +++G   DVVT+ TLI  +C    +        +M 
Sbjct  124   LNILINSFCRSGQVVLGLSVLGKILKLGYEPDVVTFTTLINGFCIQRMLSVALIWFDQMV  183

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
               G +PDV+++ +L+    + G +S  + L+++ML++G  P+  +Y  +++ + + G   
Sbjct  184   HEGYEPDVVSFTTLVNGLCKEGRVSEAVSLVDKMLKMGYQPNVVTYGAVVNGICKSGDSA  243

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A      +   +I    + +N ++ GLC  G+ + AL LF  + + GF+P +VTYN LI
Sbjct  244   LALNLLMKMEEMNIEVNVIMYNTIIDGLCKGGHIDDALNLFEMMDNKGFVPNVVTYNCLI  303

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLC  GRW  A  LLNE+V    +P+ +T+  ++    +  +F E  ++ EEM R+G +
Sbjct  304   NGLCVFGRWKGAVLLLNEMVKRKISPDVVTFNGLIDALSKEGKFLETKELYEEMIRRGLV  363

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D+  Y ++I  L    R+ +A     +MI  G   ++V +N LIN YCK  K+D    L
Sbjct  364   PDTITYTSLIDGLCMQNRLDEARRMFDSMINKGCFPNVVTFNCLINGYCKCNKVDEGMKL  423

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
             + E  R+G   +  T++ +I G  +AGN K A +     +  G D N+V +   +DGLCK
Sbjct  424   LHEMSRRGLVGNTCTYSTLIQGFFRAGNPKVAQKLFGEMQRQGVDPNIVTYTVMLDGLCK  483

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G++D AL ++  ++      D F ++ +++GLCK  +   A  L       G++   + 
Sbjct  484   NGKLDQALEMYCKLETSGIDLDIFVHTVIMNGLCKGDKVDEALRLFNKLSDKGIEPNVNT  543

Query  1016  RQAVIDGLQHSGFIQEARKLHSELK  942
                +I G    G + EA KL   +K
Sbjct  544   YNTMITGFCGKGILNEADKLFKNMK  568


 Score =   214 bits (544),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 123/402 (31%), Positives = 205/402 (51%), Gaps = 4/402 (1%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             V  LCK  ++ +A +++   +++G   +VVTY  ++   C         ++L +M E+ I
Sbjct  198   VNGLCKEGRVSEAVSLVDKMLKMGYQPNVVTYGAVVNGICKSGDSALALNLLMKMEEMNI  257

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             + +VI YN++I    + G +   L+L E M   G +P+  +YN L++ L   G+   A  
Sbjct  258   EVNVIMYNTIIDGLCKGGHIDDALNLFEMMDNKGFVPNVVTYNCLINGLCVFGRWKGAVL  317

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
                ++    I P  VTFN L+  L   G   +   L+ E+   G +P  +TY  LI GLC
Sbjct  318   LLNEMVKRKISPDVVTFNGLIDALSKEGKFLETKELYEEMIRRGLVPDTITYTSLIDGLC  377

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
                R   ARR+ + +++ G  PN +T+  ++    +  + +EG+++L EM R+G + ++ 
Sbjct  378   MQNRLDEARRMFDSMINKGCFPNVVTFNCLINGYCKCNKVDEGMKLLHEMSRRGLVGNTC  437

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              Y T+I    +AG  K A    G M   G++ ++V Y  +++  CK GKLD A  +  + 
Sbjct  438   TYSTLIQGFFRAGNPKVAQKLFGEMQRQGVDPNIVTYTVMLDGLCKNGKLDQALEMYCKL  497

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEV  1173
             E  G D D + HT+I++GLCK   + EALR  N     G + N+  +N  I G C  G +
Sbjct  498   ETSGIDLDIFVHTVIMNGLCKGDKVDEALRLFNKLSDKGIEPNVNTYNTMITGFCGKGIL  557

Query  1172  DYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASELL  1059
             + A  +FK+M E  C     TY+ L+    K G      EL+
Sbjct  558   NEADKLFKNMKEVGCMPDDCTYNVLIRAHLKGGHVATVIELI  599


 Score =   157 bits (398),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 103/382 (27%), Positives = 185/382 (48%), Gaps = 3/382 (1%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             V  +CK+     A  +++    + +  +V+ YNT+I   C    ID   ++   M+  G 
Sbjct  233   VNGICKSGDSALALNLLMKMEEMNIEVNVIMYNTIIDGLCKGGHIDDALNLFEMMDNKGF  292

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
              P+V+TYN LI      G     + LL EM++  I PD  ++N L+  L + GK  E   
Sbjct  293   VPNVVTYNCLINGLCVFGRWKGAVLLLNEMVKRKISPDVVTFNGLIDALSKEGKFLETKE  352

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
              ++++    + P  +T+  L+ GLCM    ++A  +F  + + G  P +VT+N LI+G C
Sbjct  353   LYEEMIRRGLVPDTITYTSLIDGLCMQNRLDEARRMFDSMINKGCFPNVVTFNCLINGYC  412

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
                +     +LL+E+   G   N  TY+T+++  FR+   +   ++  EM+R+G   +  
Sbjct  413   KCNKVDEGMKLLHEMSRRGLVGNTCTYSTLIQGFFRAGNPKVAQKLFGEMQRQGVDPNIV  472

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              Y  ++  L K G++  A +    +  +GI+LD+  +  ++N  CK  K+D A  L  + 
Sbjct  473   TYTVMLDGLCKNGKLDQALEMYCKLETSGIDLDIFVHTVIMNGLCKGDKVDEALRLFNKL  532

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEV  1173
               KG + +  T+  +I G C  G + EA +     K +G   +   +N  I    K G V
Sbjct  533   SDKGIEPNVNTYNTMITGFCGKGILNEADKLFKNMKEVGCMPDDCTYNVLIRAHLKGGHV  592

Query  1172  DYALSVFKSMDEKDCFTYSSLV  1107
                + + + M     +++SS V
Sbjct  593   ATVIELIREMRS---YSFSSHV  611


 Score =   157 bits (397),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 171/359 (48%), Gaps = 0/359 (0%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
             + N  +  LCK   ++ A  +       G   +VVTYN LI   C F        +L+ M
Sbjct  263   MYNTIIDGLCKGGHIDDALNLFEMMDNKGFVPNVVTYNCLINGLCVFGRWKGAVLLLNEM  322

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
              +  I PDV+T+N LI + ++ G      +L EEM+  G++PDT +Y +L+  L    + 
Sbjct  323   VKRKISPDVVTFNGLIDALSKEGKFLETKELYEEMIRRGLVPDTITYTSLIDGLCMQNRL  382

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             DEA R F  +      P  VTFN L++G C     ++ + L  E+   G +    TY+ L
Sbjct  383   DEARRMFDSMINKGCFPNVVTFNCLINGYCKCNKVDEGMKLLHEMSRRGLVGNTCTYSTL  442

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             I G   +G    A++L  E+   G +PN +TYT ++    ++ + ++ L++  ++   G 
Sbjct  443   IQGFFRAGNPKVAQKLFGEMQRQGVDPNIVTYTVMLDGLCKNGKLDQALEMYCKLETSGI  502

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
               D F +  +++ L K  ++ +A      +   GIE ++  YNT+I  +C +G L+ A  
Sbjct  503   DLDIFVHTVIMNGLCKGDKVDEALRLFNKLSDKGIEPNVNTYNTMITGFCGKGILNEADK  562

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGL  1191
             L    +  G   D  T+ ++I    K G++   +  +   +   F S++      +D L
Sbjct  563   LFKNMKEVGCMPDDCTYNVLIRAHLKGGHVATVIELIREMRSYSFSSHVSTMEMVVDML  621


 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/296 (24%), Positives = 133/296 (45%), Gaps = 42/296 (14%)
 Frame = -1

Query  1715  CNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDS  1536
             CN G    A  L +++V     P  + ++ ++    + +R++  + + + M       + 
Sbjct  65    CNVGE---AVALFDQMVGTRPLPPIVDFSKLLTAIAKMKRYDVVISLCKRMELLRVSHNG  121

Query  1535  FAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVE  1356
             +    +I+   ++G++      +G ++  G E D+V + TLIN +C +  L  A +   +
Sbjct  122   YTLNILINSFCRSGQVVLGLSVLGKILKLGYEPDVVTFTTLINGFCIQRMLSVALIWFDQ  181

Query  1355  AERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVA-------------  1215
                +G++ D  + T +++GLCK G + EA+  ++    MG+  N+V              
Sbjct  182   MVHEGYEPDVVSFTTLVNGLCKEGRVSEAVSLVDKMLKMGYQPNVVTYGAVVNGICKSGD  241

Query  1214  ----------------------FNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSS  1113
                                   +N  IDGLCK G +D AL++F+ MD K    +  TY+ 
Sbjct  242   SALALNLLMKMEEMNIEVNVIMYNTIIDGLCKGGHIDDALNLFEMMDNKGFVPNVVTYNC  301

Query  1112  LVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             L++GLC  GR++ A  LL   +   +         +ID L   G   E ++L+ E+
Sbjct  302   LINGLCVFGRWKGAVLLLNEMVKRKISPDVVTFNGLIDALSKEGKFLETKELYEEM  357



>ref|XP_002971975.1| hypothetical protein SELMODRAFT_96626 [Selaginella moellendorffii]
 gb|EFJ26892.1| hypothetical protein SELMODRAFT_96626 [Selaginella moellendorffii]
Length=755

 Score =   230 bits (586),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/438 (31%), Positives = 224/438 (51%), Gaps = 4/438 (1%)
 Frame = -1

Query  2258  ITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEV  2079
             I +  LCKA +L +A T      + G   +  TYN LI  +C    +   Y +L  M E 
Sbjct  131   IMIDGLCKANRLPEATTYFAKMKKKGTVPNEWTYNVLINGFCKVHKVHRAYLLLKEMKES  190

Query  2078  GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEA  1899
             G+ P+V+TY+++I    R   +     L  +M+E G +P+  +YNTL+  L R G  DEA
Sbjct  191   GLAPNVVTYSTVIHGFCRQTKVDTAYKLFRQMVENGCMPNLVTYNTLLSGLCRNGLMDEA  250

Query  1898  YRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
             Y    ++    + P   +++ L++GLC  G  + AL +F +  +    P +V Y+ LI G
Sbjct  251   YELLDEMRERGLQPDKFSYDTLMAGLCKTGKIDMALKVFEDNSNGDCPPDVVAYSTLIAG  310

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFD  1539
             LC +GR   A +L  ++ +    P+ +T+T +M    +  R +E  Q+LE M  +    +
Sbjct  311   LCKAGRLDEACKLFEKMRENSCEPDVVTFTALMDGLCKGDRLQEAQQVLETMEDRNCTPN  370

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVV  1359
                Y ++I  L K G+++DA +    MI+ GIE ++V YN+LI+ +C    +D+A +L+ 
Sbjct  371   VITYSSLIDGLCKTGQVRDAQEVFKRMIVRGIEPNVVTYNSLIHGFCMTNGVDSALLLME  430

Query  1358  EAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVG  1179
             E    G   D  T+  +IDGLCK G   EA R     K    + +++ ++C I G CK+ 
Sbjct  431   EMTATGCLPDIITYNTLIDGLCKTGRAPEANRLFGDMKAKFCNPDVITYSCLIGGFCKLE  490

Query  1178  EVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQ  1011
              +D A ++F  M ++    D  T+S+LV G C AG    A  LL   +            
Sbjct  491   RIDMARTLFDDMLKQAVLPDVVTFSTLVEGYCNAGLVDDAERLLEEMVASDCSPDVYTYT  550

Query  1010  AVIDGLQHSGFIQEARKL  957
             +++DG    G + EAR++
Sbjct  551   SLVDGFCKVGRMVEARRV  568


 Score =   205 bits (522),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 141/450 (31%), Positives = 212/450 (47%), Gaps = 36/450 (8%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC  2004
             G   +V TYN L  A      ID    IL      GI P+V TY  +I    + G L + 
Sbjct  19    GFDHNVYTYNRLFEALLRARRIDETCHILKNGWPPGITPNVFTYAVVIQGLCKSGDLDKA  78

Query  2003  LDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQD-------IFW---------  1872
              +LLEEM E G +PD   YN ++H L +     +A  +F+        I W         
Sbjct  79    CELLEEMRESGPVPDAAIYNFVIHALCKARNTAKALDYFRSMECEKNVITWTIMIDGLCK  138

Query  1871  -GDIP---------------PCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
                +P               P   T+N+L++G C      +A +L +E+K SG  P +VT
Sbjct  139   ANRLPEATTYFAKMKKKGTVPNEWTYNVLINGFCKVHKVHRAYLLLKEMKESGLAPNVVT  198

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             Y+ +IHG C   +   A +L  ++V+ G  PN +TY T++    R+   +E  ++L+EMR
Sbjct  199   YSTVIHGFCRQTKVDTAYKLFRQMVENGCMPNLVTYNTLLSGLCRNGLMDEAYELLDEMR  258

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              +G   D F+Y T+++ L K G++  A     +        D+VAY+TLI   CK G+LD
Sbjct  259   ERGLQPDKFSYDTLMAGLCKTGKIDMALKVFEDNSNGDCPPDVVAYSTLIAGLCKAGRLD  318

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              A  L  +      + D  T T ++DGLCK   ++EA + L   +      N++ ++  I
Sbjct  319   EACKLFEKMRENSCEPDVVTFTALMDGLCKGDRLQEAQQVLETMEDRNCTPNVITYSSLI  378

Query  1199  DGLCKVGEVDYALSVFKSM----DEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             DGLCK G+V  A  VFK M     E +  TY+SL+HG C       A  L+      G  
Sbjct  379   DGLCKTGQVRDAQEVFKRMIVRGIEPNVVTYNSLIHGFCMTNGVDSALLLMEEMTATGCL  438

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKLHSELK  942
                     +IDGL  +G   EA +L  ++K
Sbjct  439   PDIITYNTLIDGLCKTGRAPEANRLFGDMK  468


 Score =   204 bits (518),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 123/445 (28%), Positives = 217/445 (49%), Gaps = 5/445 (1%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             +A LCK  +++ A  V  D      P DVV Y+TLI   C    +D    +  +M E   
Sbjct  273   MAGLCKTGKIDMALKVFEDNSNGDCPPDVVAYSTLIAGLCKAGRLDEACKLFEKMRENSC  332

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             +PDV+T+ +L+    +   L     +LE M +    P+  +Y++L+  L + G+  +A  
Sbjct  333   EPDVVTFTALMDGLCKGDRLQEAQQVLETMEDRNCTPNVITYSSLIDGLCKTGQVRDAQE  392

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
              F+ +    I P  VT+N L+ G CM    + AL+L  E+  +G +P ++TYN LI GLC
Sbjct  393   VFKRMIVRGIEPNVVTYNSLIHGFCMTNGVDSALLLMEEMTATGCLPDIITYNTLIDGLC  452

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
              +GR   A RL  ++     NP+ ITY+ ++    +  R +    + ++M ++  + D  
Sbjct  453   KTGRAPEANRLFGDMKAKFCNPDVITYSCLIGGFCKLERIDMARTLFDDMLKQAVLPDVV  512

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              + T++     AG + DA   +  M+ +    D+  Y +L++ +CK G++  A  ++   
Sbjct  513   TFSTLVEGYCNAGLVDDAERLLEEMVASDCSPDVYTYTSLVDGFCKVGRMVEARRVLKRM  572

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEV  1173
              ++G   +  T+T +ID  C+AG    A R L      G   N++ +   I G C  G++
Sbjct  573   AKRGCQPNVVTYTALIDAFCRAGKPTVAYRLLEEMVGNGVQPNVITYRSLIGGFCGTGDL  632

Query  1172  DYALSVFKSMD-----EKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQA  1008
             + A  + + ++     + D F Y  ++ GLC+ GR   A ELL +    G         A
Sbjct  633   EEARKILERLERDENCKADMFAYRVMMDGLCRTGRMSAALELLEAIKQSGTPPRHDIYVA  692

Query  1007  VIDGLQHSGFIQEARKLHSELKLSK  933
             +I GL     + +A ++  E+ LS+
Sbjct  693   LIRGLCQGKELGKAMEVLEEMTLSR  717


 Score =   192 bits (489),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 134/507 (26%), Positives = 231/507 (46%), Gaps = 71/507 (14%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             L +A+++++   ++ +G   G+  +V TY  +I   C    +D    +L  M E G  PD
Sbjct  34    LLRARRIDETCHILKNGWPPGITPNVFTYAVVIQGLCKSGDLDKACELLEEMRESGPVPD  93

Query  2063  VITYNSLIASATRHGMLSRCLDLLE--------------------------------EML  1980
                YN +I +  +    ++ LD                                   +M 
Sbjct  94    AAIYNFVIHALCKARNTAKALDYFRSMECEKNVITWTIMIDGLCKANRLPEATTYFAKMK  153

Query  1979  EVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTE  1800
             + G +P+ W+YN L++   ++ K   AY   +++    + P  VT++ ++ G C     +
Sbjct  154   KKGTVPNEWTYNVLINGFCKVHKVHRAYLLLKEMKESGLAPNVVTYSTVIHGFCRQTKVD  213

Query  1799  KALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIM  1620
              A  LFR++  +G +P LVTYN L+ GLC +G    A  LL+E+ + G  P+  +Y T+M
Sbjct  214   TAYKLFRQMVENGCMPNLVTYNTLLSGLCRNGLMDEAYELLDEMRERGLQPDKFSYDTLM  273

Query  1619  KCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE  1440
                 ++ + +  L++ E+        D  AY T+I+ L KAGR+ +A      M  N  E
Sbjct  274   AGLCKTGKIDMALKVFEDNSNGDCPPDVVAYSTLIAGLCKAGRLDEACKLFEKMRENSCE  333

Query  1439  LDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRH  1260
              D+V +  L++  CK  +L  A  ++   E +    +  T++ +IDGLCK G +++A   
Sbjct  334   PDVVTFTALMDGLCKGDRLQEAQQVLETMEDRNCTPNVITYSSLIDGLCKTGQVRDAQEV  393

Query  1259  LNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCF----TYSSLVHGLCK  1092
                  + G + N+V +N  I G C    VD AL + + M    C     TY++L+ GLCK
Sbjct  394   FKRMIVRGIEPNVVTYNSLIHGFCMTNGVDSALLLMEEMTATGCLPDIITYNTLIDGLCK  453

Query  1091  AGRFRVASELL--------------LSCIIGGM-KILKSD----------RQAV------  1005
              GR   A+ L                SC+IGG  K+ + D          +QAV      
Sbjct  454   TGRAPEANRLFGDMKAKFCNPDVITYSCLIGGFCKLERIDMARTLFDDMLKQAVLPDVVT  513

Query  1004  ----IDGLQHSGFIQEARKLHSELKLS  936
                 ++G  ++G + +A +L  E+  S
Sbjct  514   FSTLVEGYCNAGLVDDAERLLEEMVAS  540


 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/279 (29%), Positives = 130/279 (47%), Gaps = 7/279 (3%)
 Frame = -1

Query  1772  KHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRF  1593
             K  GF   + TYN L   L  + R      +L      G  PN  TY  +++   +S   
Sbjct  16    KQQGFDHNVYTYNRLFEALLRARRIDETCHILKNGWPPGITPNVFTYAVVIQGLCKSGDL  75

Query  1592  EEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTL  1413
             ++  ++LEEMR  G + D+  Y  VI  L KA     A D   +M     E +++ +  +
Sbjct  76    DKACELLEEMRESGPVPDAAIYNFVIHALCKARNTAKALDYFRSM---ECEKNVITWTIM  132

Query  1412  INLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF  1233
             I+  CK  +L  A     + ++KG   +++T+ ++I+G CK   +  A   L   K  G 
Sbjct  133   IDGLCKANRLPEATTYFAKMKKKGTVPNEWTYNVLINGFCKVHKVHRAYLLLKEMKESGL  192

Query  1232  DSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASE  1065
               N+V ++  I G C+  +VD A  +F+ M E  C     TY++L+ GLC+ G    A E
Sbjct  193   APNVVTYSTVIHGFCRQTKVDTAYKLFRQMVENGCMPNLVTYNTLLSGLCRNGLMDEAYE  252

Query  1064  LLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSE  948
             LL      G++  K     ++ GL  +G I  A K+  +
Sbjct  253   LLDEMRERGLQPDKFSYDTLMAGLCKTGKIDMALKVFED  291



>ref|XP_010530283.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X2 [Tarenaya hassleriana]
Length=559

 Score =   226 bits (575),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 130/445 (29%), Positives = 223/445 (50%), Gaps = 4/445 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             L+I + C C++ Q+    +V+   +++G   DVVT+NTLI   C    +    S+  RM 
Sbjct  48    LSILINCFCRSSQVGLGFSVLGKIMKMGYDPDVVTFNTLINGLCMDGKLSTALSLAERMV  107

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             + G  PDV+T N+++      G +   + L+++M E G  PD ++Y  ++  + +LG   
Sbjct  108   KDGYTPDVVTCNTVVNGLCLQGRIREAVTLVDQMSEKGYQPDVFTYGAVVKGICKLGDSA  167

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A      +    +    V +N ++  LC  G+ + A+ LFR++     +P +VTYN L+
Sbjct  168   LALNLLAKVEERHVQVNVVVYNTVIDCLCKCGHIDDAINLFRKMDDREVVPNVVTYNTLV  227

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLC  GRW  A R LNE++     PN +T+T ++    +  +F E   + E+M ++  +
Sbjct  228   NGLCCYGRWVDAARFLNEMIKRKITPNVVTFTGLIDNFIKEGKFLEARDVYEQMVQRDLV  287

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              ++  Y ++I  L    R+ +A      M   G   + V +N LIN YCK G++D    L
Sbjct  288   PNTITYTSLIDGLCMQNRLDEAKKMFDFMATKGCSPNAVTFNVLINGYCKSGRVDEGMKL  347

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E  R+G   D  T+  +I G C+AGN+  A +     +  G   +LV F   +DGLCK
Sbjct  348   FSEMFRRGVVADTCTYNSLIQGFCRAGNICAAQKLFLEIQCHGQYPDLVTFKVLLDGLCK  407

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G+++ AL ++  M++     D   ++ ++HGLC  G+   A  L +     G++     
Sbjct  408   NGKLEEALILYNKMEKSEMNLDITAHNIIIHGLCMNGKVEDALRLFIGLFDRGVEPDVKT  467

Query  1016  RQAVIDGLQHSGFIQEARKLHSELK  942
                +I G      + EA KL  E+K
Sbjct  468   YTTMISGFCRKSLLDEAEKLFREMK  492


 Score =   167 bits (424),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 113/417 (27%), Positives = 201/417 (48%), Gaps = 4/417 (1%)
 Frame = -1

Query  2168  VVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLE  1989
             +V +N L++A       D   S+  RM   GI  D  + + LI    R   +     +L 
Sbjct  10    IVDFNKLLSAIAKMKRYDIVISLCKRMELHGISHDNYSLSILINCFCRSSQVGLGFSVLG  69

Query  1988  EMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNG  1809
             +++++G  PD  ++NTL++ L   GK   A    + +      P  VT N +++GLC+ G
Sbjct  70    KIMKMGYDPDVVTFNTLINGLCMDGKLSTALSLAERMVKDGYTPDVVTCNTVVNGLCLQG  129

Query  1808  YTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYT  1629
                +A+ L  ++   G+ P + TY  ++ G+C  G  A A  LL ++ +     N + Y 
Sbjct  130   RIREAVTLVDQMSEKGYQPDVFTYGAVVKGICKLGDSALALNLLAKVEERHVQVNVVVYN  189

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
             T++ C  +    ++ + +  +M  +  + +   Y T+++ L   GR  DA   +  MI  
Sbjct  190   TVIDCLCKCGHIDDAINLFRKMDDREVVPNVVTYNTLVNGLCCYGRWVDAARFLNEMIKR  249

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
              I  ++V +  LI+ + KEGK   A  +  +  ++    +  T+T +IDGLC    + EA
Sbjct  250   KITPNVVTFTGLIDNFIKEGKFLEARDVYEQMVQRDLVPNTITYTSLIDGLCMQNRLDEA  309

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHG  1101
              +  +     G   N V FN  I+G CK G VD  + +F  M  +    D  TY+SL+ G
Sbjct  310   KKMFDFMATKGCSPNAVTFNVLINGYCKSGRVDEGMKLFSEMFRRGVVADTCTYNSLIQG  369

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
              C+AG    A +L L     G        + ++DGL  +G ++EA  L+++++ S++
Sbjct  370   FCRAGNICAAQKLFLEIQCHGQYPDLVTFKVLLDGLCKNGKLEEALILYNKMEKSEM  426


 Score =   132 bits (332),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 146/310 (47%), Gaps = 3/310 (1%)
 Frame = -1

Query  2291  IKSRLSTKLLNIT--VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGI  2118
             IK +++  ++  T  +    K  +  +A  V    ++  +  + +TY +LI   C    +
Sbjct  247   IKRKITPNVVTFTGLIDNFIKEGKFLEARDVYEQMVQRDLVPNTITYTSLIDGLCMQNRL  306

Query  2117  DAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTL  1938
             D    +   M   G  P+ +T+N LI    + G +   + L  EM   G++ DT +YN+L
Sbjct  307   DEAKKMFDFMATKGCSPNAVTFNVLINGYCKSGRVDEGMKLFSEMFRRGVVADTCTYNSL  366

Query  1937  MHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGF  1758
             +    R G    A + F +I      P  VTF +LL GLC NG  E+AL+L+ +++ S  
Sbjct  367   IQGFCRAGNICAAQKLFLEIQCHGQYPDLVTFKVLLDGLCKNGKLEEALILYNKMEKSEM  426

Query  1757  IPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQ  1578
                +  +NI+IHGLC +G+   A RL   L D G  P+  TYTT++    R    +E  +
Sbjct  427   NLDITAHNIIIHGLCMNGKVEDALRLFIGLFDRGVEPDVKTYTTMISGFCRKSLLDEAEK  486

Query  1577  ILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYC  1398
             +  EM++ G + +   Y  +I   ++ G      + V  M   G   D      ++++  
Sbjct  487   LFREMKKAGCLPNDRTYNALIQGHLRNGCTSTGVELVREMCSCGFSADASTTEIIVDMI-  545

Query  1397  KEGKLDNAYM  1368
               G+LD  +M
Sbjct  546   HNGRLDKKFM  555


 Score =   122 bits (305),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 90/355 (25%), Positives = 151/355 (43%), Gaps = 35/355 (10%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  + CLCK   ++ A  +        V  +VVTYNTL+   CC+         L+ M +
Sbjct  189   NTVIDCLCKCGHIDDAINLFRKMDDREVVPNVVTYNTLVNGLCCYGRWVDAARFLNEMIK  248

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I P+V+T+  LI +  + G      D+ E+M++  ++P+T +Y +L+  L    + DE
Sbjct  249   RKITPNVVTFTGLIDNFIKEGKFLEARDVYEQMVQRDLVPNTITYTSLIDGLCMQNRLDE  308

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFI-----------  1755
             A + F  +      P  VTFN+L++G C +G  ++ + LF E+   G +           
Sbjct  309   AKKMFDFMATKGCSPNAVTFNVLINGYCKSGRVDEGMKLFSEMFRRGVVADTCTYNSLIQ  368

Query  1754  ------------------------PQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNP  1647
                                     P LVT+ +L+ GLC +G+   A  L N++     N 
Sbjct  369   GFCRAGNICAAQKLFLEIQCHGQYPDLVTFKVLLDGLCKNGKLEEALILYNKMEKSEMNL  428

Query  1646  NAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCV  1467
             +   +  I+     + + E+ L++   +  +G   D   Y T+IS   +   + +A    
Sbjct  429   DITAHNIIIHGLCMNGKVEDALRLFIGLFDRGVEPDVKTYTTMISGFCRKSLLDEAEKLF  488

Query  1466  GNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIID  1302
               M   G   +   YN LI  + + G       LV E    GF  D  T  II+D
Sbjct  489   REMKKAGCLPNDRTYNALIQGHLRNGCTSTGVELVREMCSCGFSADASTTEIIVD  543


 Score =   116 bits (291),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 136/275 (49%), Gaps = 4/275 (1%)
 Frame = -1

Query  1757  IPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQ  1578
             +P +V +N L+  +    R+     L   +   G + +  + + ++ C  RS +   G  
Sbjct  7     LPSIVDFNKLLSAIAKMKRYDIVISLCKRMELHGISHDNYSLSILINCFCRSSQVGLGFS  66

Query  1577  ILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYC  1398
             +L ++ + GY  D   + T+I+ L   G++  A      M+ +G   D+V  NT++N  C
Sbjct  67    VLGKIMKMGYDPDVVTFNTLINGLCMDGKLSTALSLAERMVKDGYTPDVVTCNTVVNGLC  126

Query  1397  KEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLV  1218
              +G++  A  LV +   KG+  D +T+  ++ G+CK G+   AL  L   +      N+V
Sbjct  127   LQGRIREAVTLVDQMSEKGYQPDVFTYGAVVKGICKLGDSALALNLLAKVEERHVQVNVV  186

Query  1217  AFNCCIDGLCKVGEVDYALSVFKSMDEKD----CFTYSSLVHGLCKAGRFRVASELLLSC  1050
              +N  ID LCK G +D A+++F+ MD+++      TY++LV+GLC  GR+  A+  L   
Sbjct  187   VYNTVIDCLCKCGHIDDAINLFRKMDDREVVPNVVTYNTLVNGLCCYGRWVDAARFLNEM  246

Query  1049  IIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             I   +         +ID     G   EAR ++ ++
Sbjct  247   IKRKITPNVVTFTGLIDNFIKEGKFLEARDVYEQM  281



>ref|XP_010278102.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
isoform X2 [Nelumbo nucifera]
Length=702

 Score =   229 bits (583),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/451 (31%), Positives = 231/451 (51%), Gaps = 4/451 (1%)
 Frame = -1

Query  2276  STKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSIL  2097
             +T+  NI +   CK   +++A  ++   I+ G   +V+TY  L+   C    ++    + 
Sbjct  226   NTRTFNILIKAHCKKGDIKEAGALMKVMIQRGQKPNVITYTCLVHGLCNSDQLEEATMLF  285

Query  2096  HRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRL  1917
               M E GI PDVI + +++ +  + GM+++   LL+ M++ GI PD  +YN+L+H L   
Sbjct  286   SEMVEQGISPDVIIFTTMVDALCKEGMINKAYQLLDVMIQRGIRPDNVTYNSLIHGLCSA  345

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTY  1737
             G+  EA R   ++    + P  VTFN+L+ GLC  G T KA  L   +      P   TY
Sbjct  346   GQWKEATRILNEMVGQGVSPNVVTFNVLIDGLCKEGMTRKACELLDIMIQRSVKPNRFTY  405

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRR  1557
             N LIHGLCNSG+   A RLLNE+V  G  P+ +T+ T++    +     E  ++LE M +
Sbjct  406   NSLIHGLCNSGQRKEAVRLLNEMVLQGTLPDVVTFNTLVDDLSKEGMAREAYELLELMIQ  465

Query  1556  KGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDN  1377
             +G   ++  Y  ++      G+M++A +   +M   G + D+V YN LIN +CK  K+D 
Sbjct  466   RGEKPNTTTYNALMDGYCLQGQMEEAREVFVSMCNRGCQPDVVTYNILINGHCKNRKIDE  525

Query  1376  AYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCID  1197
                +  E   +G   +  T+  +I GLC AG +  A    +  ++ G +  L  ++  +D
Sbjct  526   GMKIFREMTLRGVMPNTTTYNSLIAGLCHAGRIVSAQELFSEMQVCGQNPCLYTYSILMD  585

Query  1196  GLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             GLC    +  A+ +F  M+ K    D   Y+ L++GLCKAG+   A EL  +    G++ 
Sbjct  586   GLCNNNCLVEAIKLFHEMETKGLIPDIVIYTILINGLCKAGKLEDARELFGTITSKGLEP  645

Query  1028  LKSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
                    +I+G    G  +EA  L  +++ S
Sbjct  646   NVKTYNTMINGFCREGLFKEAEDLLLKMERS  676


 Score =   207 bits (528),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 130/449 (29%), Positives = 222/449 (49%), Gaps = 4/449 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCK +  ++   +  + I  G+  +V+TYN LI   C     +    I   M +
Sbjct  161   NTIIDGLCKDRLADEGLQLFSEMIAKGILPNVITYNCLIHGLCNLDLWEEAGKIFKDMMD  220

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              GI P+  T+N LI +  + G +     L++ M++ G  P+  +Y  L+H L    + +E
Sbjct  221   RGISPNTRTFNILIKAHCKKGDIKEAGALMKVMIQRGQKPNVITYTCLVHGLCNSDQLEE  280

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F ++    I P  + F  ++  LC  G   KA  L   +   G  P  VTYN LIH
Sbjct  281   ATMLFSEMVEQGISPDVIIFTTMVDALCKEGMINKAYQLLDVMIQRGIRPDNVTYNSLIH  340

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC++G+W  A R+LNE+V  G +PN +T+  ++    +     +  ++L+ M ++    
Sbjct  341   GLCSAGQWKEATRILNEMVGQGVSPNVVTFNVLIDGLCKEGMTRKACELLDIMIQRSVKP  400

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             + F Y ++I  L  +G+ K+A   +  M++ G   D+V +NTL++   KEG    AY L+
Sbjct  401   NRFTYNSLIHGLCNSGQRKEAVRLLNEMVLQGTLPDVVTFNTLVDDLSKEGMAREAYELL  460

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
                 ++G   +  T+  ++DG C  G M+EA          G   ++V +N  I+G CK 
Sbjct  461   ELMIQRGEKPNTTTYNALMDGYCLQGQMEEAREVFVSMCNRGCQPDVVTYNILINGHCKN  520

Query  1181  GEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
              ++D  + +F+ M  +    +  TY+SL+ GLC AGR   A EL     + G        
Sbjct  521   RKIDEGMKIFREMTLRGVMPNTTTYNSLIAGLCHAGRIVSAQELFSEMQVCGQNPCLYTY  580

Query  1013  QAVIDGLQHSGFIQEARKLHSELKLSKIL  927
               ++DGL ++  + EA KL  E++   ++
Sbjct  581   SILMDGLCNNNCLVEAIKLFHEMETKGLI  609


 Score =   202 bits (514),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 122/453 (27%), Positives = 222/453 (49%), Gaps = 5/453 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M +++   S    N  +A + K KQ     ++        +  D  T N L+  +C    
Sbjct  7     MIQMRPTPSVFAFNHILAAIAKMKQYPSVLSLYKKMGYCQIQPDACTLNILVNCFCHLNR  66

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +D G+S+   + + G  P  +  N+LI        +   +++++++ + G   D  +Y  
Sbjct  67    VDFGFSVFGNILKRGYGPGFVIINTLIKGLVMEDKVVEAMEMIKKIEDNGYACDEVTYGI  126

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGD-IPPCPVTFNILLSGLCMNGYTEKALMLFRELKHS  1764
             +++ L + G+   A +  + +   +      +T+N ++ GLC +   ++ L LF E+   
Sbjct  127   IVNGLCKTGRTSVALKLLRKMEGKENFKVDAITYNTIIDGLCKDRLADEGLQLFSEMIAK  186

Query  1763  GFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEG  1584
             G +P ++TYN LIHGLCN   W  A ++  +++D G +PN  T+  ++K   +    +E 
Sbjct  187   GILPNVITYNCLIHGLCNLDLWEEAGKIFKDMMDRGISPNTRTFNILIKAHCKKGDIKEA  246

Query  1583  LQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINL  1404
               +++ M ++G   +   Y  ++  L  + ++++A      M+  GI  D++ + T+++ 
Sbjct  247   GALMKVMIQRGQKPNVITYTCLVHGLCNSDQLEEATMLFSEMVEQGISPDVIIFTTMVDA  306

Query  1403  YCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSN  1224
              CKEG ++ AY L+    ++G   D  T+  +I GLC AG  KEA R LN     G   N
Sbjct  307   LCKEGMINKAYQLLDVMIQRGIRPDNVTYNSLIHGLCSAGQWKEATRILNEMVGQGVSPN  366

Query  1223  LVAFNCCIDGLCKVGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLL  1056
             +V FN  IDGLCK G    A  +   M ++      FTY+SL+HGLC +G+ + A  LL 
Sbjct  367   VVTFNVLIDGLCKEGMTRKACELLDIMIQRSVKPNRFTYNSLIHGLCNSGQRKEAVRLLN  426

Query  1055  SCIIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
               ++ G          ++D L   G  +EA +L
Sbjct  427   EMVLQGTLPDVVTFNTLVDDLSKEGMAREAYEL  459


 Score =   199 bits (506),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 135/455 (30%), Positives = 221/455 (49%), Gaps = 40/455 (9%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMN-EVGIKPDVITYNSLIASATRHGMLSR  2007
             G   D VTY  ++   C          +L +M  +   K D ITYN++I    +  +   
Sbjct  116   GYACDEVTYGIIVNGLCKTGRTSVALKLLRKMEGKENFKVDAITYNTIIDGLCKDRLADE  175

Query  2006  CLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLS  1827
              L L  EM+  GILP+  +YN L+H L  L   +EA + F+D+    I P   TFNIL+ 
Sbjct  176   GLQLFSEMIAKGILPNVITYNCLIHGLCNLDLWEEAGKIFKDMMDRGISPNTRTFNILIK  235

Query  1826  GLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNP  1647
               C  G  ++A  L + +   G  P ++TY  L+HGLCNS +   A  L +E+V+ G +P
Sbjct  236   AHCKKGDIKEAGALMKVMIQRGQKPNVITYTCLVHGLCNSDQLEEATMLFSEMVEQGISP  295

Query  1646  NAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCV  1467
             + I +TT++    +     +  Q+L+ M ++G   D+  Y ++I  L  AG+ K+A   +
Sbjct  296   DVIIFTTMVDALCKEGMINKAYQLLDVMIQRGIRPDNVTYNSLIHGLCSAGQWKEATRIL  355

Query  1466  GNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKA  1287
               M+  G+  ++V +N LI+  CKEG    A  L+    ++    +++T+  +I GLC +
Sbjct  356   NEMVGQGVSPNVVTFNVLIDGLCKEGMTRKACELLDIMIQRSVKPNRFTYNSLIHGLCNS  415

Query  1286  GNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSM----DEKDCFTY  1119
             G  KEA+R LN   L G   ++V FN  +D L K G    A  + + M    ++ +  TY
Sbjct  416   GQRKEAVRLLNEMVLQGTLPDVVTFNTLVDDLSKEGMAREAYELLELMIQRGEKPNTTTY  475

Query  1118  SSLVHGLCKAGRFRVASELLLSC------------------------IIGGMKILK----  1023
             ++L+ G C  G+   A E+ +S                         I  GMKI +    
Sbjct  476   NALMDGYCLQGQMEEAREVFVSMCNRGCQPDVVTYNILINGHCKNRKIDEGMKIFREMTL  535

Query  1022  -------SDRQAVIDGLQHSGFIQEARKLHSELKL  939
                    +   ++I GL H+G I  A++L SE+++
Sbjct  536   RGVMPNTTTYNSLIAGLCHAGRIVSAQELFSEMQV  570


 Score =   196 bits (497),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 130/439 (30%), Positives = 213/439 (49%), Gaps = 4/439 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LC     E+A  +  D +  G+  +  T+N LI A+C    I    +++  M +
Sbjct  196   NCLIHGLCNLDLWEEAGKIFKDMMDRGISPNTRTFNILIKAHCKKGDIKEAGALMKVMIQ  255

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G KP+VITY  L+        L     L  EM+E GI PD   + T++  L + G  ++
Sbjct  256   RGQKPNVITYTCLVHGLCNSDQLEEATMLFSEMVEQGISPDVIIFTTMVDALCKEGMINK  315

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             AY+    +    I P  VT+N L+ GLC  G  ++A  +  E+   G  P +VT+N+LI 
Sbjct  316   AYQLLDVMIQRGIRPDNVTYNSLIHGLCSAGQWKEATRILNEMVGQGVSPNVVTFNVLID  375

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC  G    A  LL+ ++     PN  TY +++     S + +E +++L EM  +G + 
Sbjct  376   GLCKEGMTRKACELLDIMIQRSVKPNRFTYNSLIHGLCNSGQRKEAVRLLNEMVLQGTLP  435

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   + T++  L K G  ++AY+ +  MI  G + +   YN L++ YC +G+++ A  + 
Sbjct  436   DVVTFNTLVDDLSKEGMAREAYELLELMIQRGEKPNTTTYNALMDGYCLQGQMEEAREVF  495

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
             V    +G   D  T+ I+I+G CK   + E ++      L G   N   +N  I GLC  
Sbjct  496   VSMCNRGCQPDVVTYNILINGHCKNRKIDEGMKIFREMTLRGVMPNTTTYNSLIAGLCHA  555

Query  1181  GEVDYALSVFKSMD---EKDC-FTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G +  A  +F  M    +  C +TYS L+ GLC       A +L       G+       
Sbjct  556   GRIVSAQELFSEMQVCGQNPCLYTYSILMDGLCNNNCLVEAIKLFHEMETKGLIPDIVIY  615

Query  1013  QAVIDGLQHSGFIQEARKL  957
               +I+GL  +G +++AR+L
Sbjct  616   TILINGLCKAGKLEDAREL  634


 Score =   184 bits (467),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/333 (32%), Positives = 172/333 (52%), Gaps = 0/333 (0%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              N+ +  LCK     KA  ++   I+  V  +  TYN+LI   C          +L+ M 
Sbjct  370   FNVLIDGLCKEGMTRKACELLDIMIQRSVKPNRFTYNSLIHGLCNSGQRKEAVRLLNEMV  429

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
               G  PDV+T+N+L+   ++ GM     +LLE M++ G  P+T +YN LM      G+ +
Sbjct  430   LQGTLPDVVTFNTLVDDLSKEGMAREAYELLELMIQRGEKPNTTTYNALMDGYCLQGQME  489

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             EA   F  +      P  VT+NIL++G C N   ++ + +FRE+   G +P   TYN LI
Sbjct  490   EAREVFVSMCNRGCQPDVVTYNILINGHCKNRKIDEGMKIFREMTLRGVMPNTTTYNSLI  549

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
              GLC++GR   A+ L +E+   G NP   TY+ +M     +    E +++  EM  KG I
Sbjct  550   AGLCHAGRIVSAQELFSEMQVCGQNPCLYTYSILMDGLCNNNCLVEAIKLFHEMETKGLI  609

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D   Y  +I+ L KAG+++DA +  G +   G+E ++  YNT+IN +C+EG    A  L
Sbjct  610   PDIVIYTILINGLCKAGKLEDARELFGTITSKGLEPNVKTYNTMINGFCREGLFKEAEDL  669

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEAL  1266
             +++ ER G+  D  T   ++ G  +     + L
Sbjct  670   LLKMERSGYAPDDVTLNTMVRGFIRVNETSKTL  702


 Score =   166 bits (420),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/386 (28%), Positives = 193/386 (50%), Gaps = 5/386 (1%)
 Frame = -1

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
              +RM ++   P V  +N ++A+  +       L L ++M    I PD  + N L++C   
Sbjct  4     FNRMIQMRPTPSVFAFNHILAAIAKMKQYPSVLSLYKKMGYCQIQPDACTLNILVNCFCH  63

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
             L + D  +  F +I      P  V  N L+ GL M     +A+ + ++++ +G+    VT
Sbjct  64    LNRVDFGFSVFGNILKRGYGPGFVIINTLIKGLVMEDKVVEAMEMIKKIEDNGYACDEVT  123

Query  1739  YNILIHGLCNSGRWAPARRLLNELV-DIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             Y I+++GLC +GR + A +LL ++     +  +AITY TI+    + R  +EGLQ+  EM
Sbjct  124   YGIIVNGLCKTGRTSVALKLLRKMEGKENFKVDAITYNTIIDGLCKDRLADEGLQLFSEM  183

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
               KG + +   Y  +I  L      ++A     +M+  GI  +   +N LI  +CK+G +
Sbjct  184   IAKGILPNVITYNCLIHGLCNLDLWEEAGKIFKDMMDRGISPNTRTFNILIKAHCKKGDI  243

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
               A  L+    ++G   +  T+T ++ GLC +  ++EA    +     G   +++ F   
Sbjct  244   KEAGALMKVMIQRGQKPNVITYTCLVHGLCNSDQLEEATMLFSEMVEQGISPDVIIFTTM  303

Query  1202  IDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGM  1035
             +D LCK G ++ A  +   M ++    D  TY+SL+HGLC AG+++ A+ +L   +  G+
Sbjct  304   VDALCKEGMINKAYQLLDVMIQRGIRPDNVTYNSLIHGLCSAGQWKEATRILNEMVGQGV  363

Query  1034  KILKSDRQAVIDGLQHSGFIQEARKL  957
                      +IDGL   G  ++A +L
Sbjct  364   SPNVVTFNVLIDGLCKEGMTRKACEL  389


 Score =   126 bits (317),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 118/271 (44%), Gaps = 35/271 (13%)
 Frame = -1

Query  2309  LE*MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCC  2130
             LE M +   + +T   N  +   C   Q+E+A  V +     G   DVVTYN LI  +C 
Sbjct  460   LELMIQRGEKPNTTTYNALMDGYCLQGQMEEAREVFVSMCNRGCQPDVVTYNILINGHCK  519

Query  2129  FVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWS  1950
                ID G  I   M   G+ P+  TYNSLIA     G +    +L  EM   G  P    
Sbjct  520   NRKIDEGMKIFREMTLRGVMPNTTTYNSLIAGLCHAGRIVSAQELFSEMQVCGQNP----  575

Query  1949  YNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELK  1770
                   CL+                         T++IL+ GLC N    +A+ LF E++
Sbjct  576   ------CLY-------------------------TYSILMDGLCNNNCLVEAIKLFHEME  604

Query  1769  HSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFE  1590
               G IP +V Y ILI+GLC +G+   AR L   +   G  PN  TY T++    R   F+
Sbjct  605   TKGLIPDIVIYTILINGLCKAGKLEDARELFGTITSKGLEPNVKTYNTMINGFCREGLFK  664

Query  1589  EGLQILEEMRRKGYIFDSFAYCTVISFLIKA  1497
             E   +L +M R GY  D     T++   I+ 
Sbjct  665   EAEDLLLKMERSGYAPDDVTLNTMVRGFIRV  695


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 67/162 (41%), Gaps = 0/162 (0%)
 Frame = -1

Query  2276  STKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSIL  2097
             +T   N  +A LC A ++  A+ +  +    G    + TY+ L+   C    +     + 
Sbjct  541   NTTTYNSLIAGLCHAGRIVSAQELFSEMQVCGQNPCLYTYSILMDGLCNNNCLVEAIKLF  600

Query  2096  HRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRL  1917
             H M   G+ PD++ Y  LI    + G L    +L   +   G+ P+  +YNT+++   R 
Sbjct  601   HEMETKGLIPDIVIYTILINGLCKAGKLEDARELFGTITSKGLEPNVKTYNTMINGFCRE  660

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKAL  1791
             G   EA      +      P  VT N ++ G      T K L
Sbjct  661   GLFKEAEDLLLKMERSGYAPDDVTLNTMVRGFIRVNETSKTL  702



>ref|XP_010530356.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530357.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530358.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=640

 Score =   227 bits (579),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 138/445 (31%), Positives = 225/445 (51%), Gaps = 4/445 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             L+I V   C++ Q+    +V+   +++G   DVVT+ TLI  +C    +    S + +M 
Sbjct  128   LSILVNSFCRSGQVVLGLSVLGKILKLGYEPDVVTFTTLINGFCIQKKLSVALSWVDQMV  187

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             + G KPDV+TYN+L+    R G +S  + L+++ML++G  P+  +Y  +++ + + G   
Sbjct  188   QEGYKPDVVTYNTLVNGLCREGRVSEAVSLVDKMLKMGYQPNVVTYGAVVNGICKSGDSA  247

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A      +   +I    + +N ++ GLC  G+ + AL LF ++   G  P +VTYN LI
Sbjct  248   LALNLLMRMEEKNIEVDVIMYNTIIDGLCKGGHIDVALSLFEKMDSKGIAPNVVTYNCLI  307

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLC   RW  A  LLN++       N +T+  ++    +  +F E  ++ EE+ R+G +
Sbjct  308   NGLCVFNRWNDAVLLLNDMAKRKIFSNVVTFNILIDAFVKEGKFLEAKELCEEIIRRGLV  367

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D+  Y T+I  L    R+ +A   + +MI  G   + V +N LIN YCK  K+D    L
Sbjct  368   PDTITYNTLIDGLCMQNRLDEARQMIDSMINKGCYPNAVTFNCLINGYCKCNKVDEGMKL  427

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E  R+G   D  TH  +I G  +AGN K A +     +  G D +LV +   +DGLCK
Sbjct  428   FHEMSRRGLVGDTCTHNTLIQGFFRAGNAKVAYKLFLEMQSQGVDLDLVTYTIMLDGLCK  487

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G++D AL ++  ++      D F +S ++HGLCKA     A  L       G+      
Sbjct  488   NGKLDEALELYCELETSGIDLDIFVHSVMMHGLCKADMVDEALRLFNKLSDKGVDPDVKT  547

Query  1016  RQAVIDGLQHSGFIQEARKLHSELK  942
                +I G      + EA KL   +K
Sbjct  548   YTTMITGFCGKSLLSEAVKLFKNMK  572


 Score =   218 bits (555),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 134/428 (31%), Positives = 214/428 (50%), Gaps = 4/428 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  V  LC+  ++ +A +++   +++G   +VVTY  ++   C         ++L RM E
Sbjct  199   NTLVNGLCREGRVSEAVSLVDKMLKMGYQPNVVTYGAVVNGICKSGDSALALNLLMRMEE  258

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I+ DVI YN++I    + G +   L L E+M   GI P+  +YN L++ L    + ++
Sbjct  259   KNIEVDVIMYNTIIDGLCKGGHIDVALSLFEKMDSKGIAPNVVTYNCLINGLCVFNRWND  318

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A     D+    I    VTFNIL+      G   +A  L  E+   G +P  +TYN LI 
Sbjct  319   AVLLLNDMAKRKIFSNVVTFNILIDAFVKEGKFLEAKELCEEIIRRGLVPDTITYNTLID  378

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC   R   AR++++ +++ G  PNA+T+  ++    +  + +EG+++  EM R+G + 
Sbjct  379   GLCMQNRLDEARQMIDSMINKGCYPNAVTFNCLINGYCKCNKVDEGMKLFHEMSRRGLVG  438

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D+  + T+I    +AG  K AY     M   G++LDLV Y  +++  CK GKLD A  L 
Sbjct  439   DTCTHNTLIQGFFRAGNAKVAYKLFLEMQSQGVDLDLVTYTIMLDGLCKNGKLDEALELY  498

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E E  G D D + H++++ GLCKA  + EALR  N     G D ++  +   I G C  
Sbjct  499   CELETSGIDLDIFVHSVMMHGLCKADMVDEALRLFNKLSDKGVDPDVKTYTTMITGFCGK  558

Query  1181  GEVDYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
               +  A+ +FK+M E  C     TY+ L+ G  K G      EL+      G     S  
Sbjct  559   SLLSEAVKLFKNMKEVGCMPDDCTYNVLIRGHLKDGHVVTVIELIREMRSCGFSSDVSTM  618

Query  1013  QAVIDGLQ  990
             + V+D L 
Sbjct  619   EMVVDMLS  626


 Score =   173 bits (438),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 122/417 (29%), Positives = 202/417 (48%), Gaps = 4/417 (1%)
 Frame = -1

Query  2168  VVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLE  1989
             +V ++ L+ A       D   S+  RM  + +  D  T + L+ S  R G +   L +L 
Sbjct  90    IVDFSKLLAAIAKMKRYDVVISLCKRMELLRVPHDDYTLSILVNSFCRSGQVVLGLSVLG  149

Query  1988  EMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNG  1809
             ++L++G  PD  ++ TL++      K   A  +   +      P  VT+N L++GLC  G
Sbjct  150   KILKLGYEPDVVTFTTLINGFCIQKKLSVALSWVDQMVQEGYKPDVVTYNTLVNGLCREG  209

Query  1808  YTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYT  1629
                +A+ L  ++   G+ P +VTY  +++G+C SG  A A  LL  + +     + I Y 
Sbjct  210   RVSEAVSLVDKMLKMGYQPNVVTYGAVVNGICKSGDSALALNLLMRMEEKNIEVDVIMYN  269

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
             TI+    +    +  L + E+M  KG   +   Y  +I+ L    R  DA   + +M   
Sbjct  270   TIIDGLCKGGHIDVALSLFEKMDSKGIAPNVVTYNCLINGLCVFNRWNDAVLLLNDMAKR  329

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
              I  ++V +N LI+ + KEGK   A  L  E  R+G   D  T+  +IDGLC    + EA
Sbjct  330   KIFSNVVTFNILIDAFVKEGKFLEAKELCEEIIRRGLVPDTITYNTLIDGLCMQNRLDEA  389

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHG  1101
              + ++     G   N V FNC I+G CK  +VD  + +F  M  +    D  T+++L+ G
Sbjct  390   RQMIDSMINKGCYPNAVTFNCLINGYCKCNKVDEGMKLFHEMSRRGLVGDTCTHNTLIQG  449

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
               +AG  +VA +L L     G+ +       ++DGL  +G + EA +L+ EL+ S I
Sbjct  450   FFRAGNAKVAYKLFLEMQSQGVDLDLVTYTIMLDGLCKNGKLDEALELYCELETSGI  506


 Score =   145 bits (365),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/359 (26%), Positives = 169/359 (47%), Gaps = 0/359 (0%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
             + N  +  LCK   ++ A ++       G+  +VVTYN LI   C F   +    +L+ M
Sbjct  267   MYNTIIDGLCKGGHIDVALSLFEKMDSKGIAPNVVTYNCLINGLCVFNRWNDAVLLLNDM  326

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
              +  I  +V+T+N LI +  + G      +L EE++  G++PDT +YNTL+  L    + 
Sbjct  327   AKRKIFSNVVTFNILIDAFVKEGKFLEAKELCEEIIRRGLVPDTITYNTLIDGLCMQNRL  386

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             DEA +    +      P  VTFN L++G C     ++ + LF E+   G +    T+N L
Sbjct  387   DEARQMIDSMINKGCYPNAVTFNCLINGYCKCNKVDEGMKLFHEMSRRGLVGDTCTHNTL  446

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             I G   +G    A +L  E+   G + + +TYT ++    ++ + +E L++  E+   G 
Sbjct  447   IQGFFRAGNAKVAYKLFLEMQSQGVDLDLVTYTIMLDGLCKNGKLDEALELYCELETSGI  506

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
               D F +  ++  L KA  + +A      +   G++ D+  Y T+I  +C +  L  A  
Sbjct  507   DLDIFVHSVMMHGLCKADMVDEALRLFNKLSDKGVDPDVKTYTTMITGFCGKSLLSEAVK  566

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGL  1191
             L    +  G   D  T+ ++I G  K G++   +  +   +  GF S++      +D L
Sbjct  567   LFKNMKEVGCMPDDCTYNVLIRGHLKDGHVVTVIELIREMRSCGFSSDVSTMEMVVDML  625


 Score = 98.2 bits (243),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 112/215 (52%), Gaps = 4/215 (2%)
 Frame = -1

Query  1691  ARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVIS  1512
             A  L +++V     P+ + ++ ++    + +R++  + + + M       D +    +++
Sbjct  74    AVALFDQMVGTRPLPSIVDFSKLLAAIAKMKRYDVVISLCKRMELLRVPHDDYTLSILVN  133

Query  1511  FLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDC  1332
                ++G++      +G ++  G E D+V + TLIN +C + KL  A   V +  ++G+  
Sbjct  134   SFCRSGQVVLGLSVLGKILKLGYEPDVVTFTTLINGFCIQKKLSVALSWVDQMVQEGYKP  193

Query  1331  DKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVF  1152
             D  T+  +++GLC+ G + EA+  ++    MG+  N+V +   ++G+CK G+   AL++ 
Sbjct  194   DVVTYNTLVNGLCREGRVSEAVSLVDKMLKMGYQPNVVTYGAVVNGICKSGDSALALNLL  253

Query  1151  KSMDEK----DCFTYSSLVHGLCKAGRFRVASELL  1059
               M+EK    D   Y++++ GLCK G   VA  L 
Sbjct  254   MRMEEKNIEVDVIMYNTIIDGLCKGGHIDVALSLF  288



>ref|XP_010530282.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
isoform X1 [Tarenaya hassleriana]
Length=608

 Score =   226 bits (575),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 130/445 (29%), Positives = 223/445 (50%), Gaps = 4/445 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             L+I + C C++ Q+    +V+   +++G   DVVT+NTLI   C    +    S+  RM 
Sbjct  97    LSILINCFCRSSQVGLGFSVLGKIMKMGYDPDVVTFNTLINGLCMDGKLSTALSLAERMV  156

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             + G  PDV+T N+++      G +   + L+++M E G  PD ++Y  ++  + +LG   
Sbjct  157   KDGYTPDVVTCNTVVNGLCLQGRIREAVTLVDQMSEKGYQPDVFTYGAVVKGICKLGDSA  216

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A      +    +    V +N ++  LC  G+ + A+ LFR++     +P +VTYN L+
Sbjct  217   LALNLLAKVEERHVQVNVVVYNTVIDCLCKCGHIDDAINLFRKMDDREVVPNVVTYNTLV  276

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLC  GRW  A R LNE++     PN +T+T ++    +  +F E   + E+M ++  +
Sbjct  277   NGLCCYGRWVDAARFLNEMIKRKITPNVVTFTGLIDNFIKEGKFLEARDVYEQMVQRDLV  336

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              ++  Y ++I  L    R+ +A      M   G   + V +N LIN YCK G++D    L
Sbjct  337   PNTITYTSLIDGLCMQNRLDEAKKMFDFMATKGCSPNAVTFNVLINGYCKSGRVDEGMKL  396

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E  R+G   D  T+  +I G C+AGN+  A +     +  G   +LV F   +DGLCK
Sbjct  397   FSEMFRRGVVADTCTYNSLIQGFCRAGNICAAQKLFLEIQCHGQYPDLVTFKVLLDGLCK  456

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G+++ AL ++  M++     D   ++ ++HGLC  G+   A  L +     G++     
Sbjct  457   NGKLEEALILYNKMEKSEMNLDITAHNIIIHGLCMNGKVEDALRLFIGLFDRGVEPDVKT  516

Query  1016  RQAVIDGLQHSGFIQEARKLHSELK  942
                +I G      + EA KL  E+K
Sbjct  517   YTTMISGFCRKSLLDEAEKLFREMK  541


 Score =   167 bits (422),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 113/417 (27%), Positives = 201/417 (48%), Gaps = 4/417 (1%)
 Frame = -1

Query  2168  VVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLE  1989
             +V +N L++A       D   S+  RM   GI  D  + + LI    R   +     +L 
Sbjct  59    IVDFNKLLSAIAKMKRYDIVISLCKRMELHGISHDNYSLSILINCFCRSSQVGLGFSVLG  118

Query  1988  EMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNG  1809
             +++++G  PD  ++NTL++ L   GK   A    + +      P  VT N +++GLC+ G
Sbjct  119   KIMKMGYDPDVVTFNTLINGLCMDGKLSTALSLAERMVKDGYTPDVVTCNTVVNGLCLQG  178

Query  1808  YTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYT  1629
                +A+ L  ++   G+ P + TY  ++ G+C  G  A A  LL ++ +     N + Y 
Sbjct  179   RIREAVTLVDQMSEKGYQPDVFTYGAVVKGICKLGDSALALNLLAKVEERHVQVNVVVYN  238

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
             T++ C  +    ++ + +  +M  +  + +   Y T+++ L   GR  DA   +  MI  
Sbjct  239   TVIDCLCKCGHIDDAINLFRKMDDREVVPNVVTYNTLVNGLCCYGRWVDAARFLNEMIKR  298

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
              I  ++V +  LI+ + KEGK   A  +  +  ++    +  T+T +IDGLC    + EA
Sbjct  299   KITPNVVTFTGLIDNFIKEGKFLEARDVYEQMVQRDLVPNTITYTSLIDGLCMQNRLDEA  358

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHG  1101
              +  +     G   N V FN  I+G CK G VD  + +F  M  +    D  TY+SL+ G
Sbjct  359   KKMFDFMATKGCSPNAVTFNVLINGYCKSGRVDEGMKLFSEMFRRGVVADTCTYNSLIQG  418

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
              C+AG    A +L L     G        + ++DGL  +G ++EA  L+++++ S++
Sbjct  419   FCRAGNICAAQKLFLEIQCHGQYPDLVTFKVLLDGLCKNGKLEEALILYNKMEKSEM  475


 Score =   132 bits (332),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 146/310 (47%), Gaps = 3/310 (1%)
 Frame = -1

Query  2291  IKSRLSTKLLNIT--VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGI  2118
             IK +++  ++  T  +    K  +  +A  V    ++  +  + +TY +LI   C    +
Sbjct  296   IKRKITPNVVTFTGLIDNFIKEGKFLEARDVYEQMVQRDLVPNTITYTSLIDGLCMQNRL  355

Query  2117  DAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTL  1938
             D    +   M   G  P+ +T+N LI    + G +   + L  EM   G++ DT +YN+L
Sbjct  356   DEAKKMFDFMATKGCSPNAVTFNVLINGYCKSGRVDEGMKLFSEMFRRGVVADTCTYNSL  415

Query  1937  MHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGF  1758
             +    R G    A + F +I      P  VTF +LL GLC NG  E+AL+L+ +++ S  
Sbjct  416   IQGFCRAGNICAAQKLFLEIQCHGQYPDLVTFKVLLDGLCKNGKLEEALILYNKMEKSEM  475

Query  1757  IPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQ  1578
                +  +NI+IHGLC +G+   A RL   L D G  P+  TYTT++    R    +E  +
Sbjct  476   NLDITAHNIIIHGLCMNGKVEDALRLFIGLFDRGVEPDVKTYTTMISGFCRKSLLDEAEK  535

Query  1577  ILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYC  1398
             +  EM++ G + +   Y  +I   ++ G      + V  M   G   D      ++++  
Sbjct  536   LFREMKKAGCLPNDRTYNALIQGHLRNGCTSTGVELVREMCSCGFSADASTTEIIVDMI-  594

Query  1397  KEGKLDNAYM  1368
               G+LD  +M
Sbjct  595   HNGRLDKKFM  604


 Score =   121 bits (304),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 90/355 (25%), Positives = 151/355 (43%), Gaps = 35/355 (10%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  + CLCK   ++ A  +        V  +VVTYNTL+   CC+         L+ M +
Sbjct  238   NTVIDCLCKCGHIDDAINLFRKMDDREVVPNVVTYNTLVNGLCCYGRWVDAARFLNEMIK  297

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I P+V+T+  LI +  + G      D+ E+M++  ++P+T +Y +L+  L    + DE
Sbjct  298   RKITPNVVTFTGLIDNFIKEGKFLEARDVYEQMVQRDLVPNTITYTSLIDGLCMQNRLDE  357

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFI-----------  1755
             A + F  +      P  VTFN+L++G C +G  ++ + LF E+   G +           
Sbjct  358   AKKMFDFMATKGCSPNAVTFNVLINGYCKSGRVDEGMKLFSEMFRRGVVADTCTYNSLIQ  417

Query  1754  ------------------------PQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNP  1647
                                     P LVT+ +L+ GLC +G+   A  L N++     N 
Sbjct  418   GFCRAGNICAAQKLFLEIQCHGQYPDLVTFKVLLDGLCKNGKLEEALILYNKMEKSEMNL  477

Query  1646  NAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCV  1467
             +   +  I+     + + E+ L++   +  +G   D   Y T+IS   +   + +A    
Sbjct  478   DITAHNIIIHGLCMNGKVEDALRLFIGLFDRGVEPDVKTYTTMISGFCRKSLLDEAEKLF  537

Query  1466  GNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIID  1302
               M   G   +   YN LI  + + G       LV E    GF  D  T  II+D
Sbjct  538   REMKKAGCLPNDRTYNALIQGHLRNGCTSTGVELVREMCSCGFSADASTTEIIVD  592


 Score =   120 bits (300),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/290 (27%), Positives = 144/290 (50%), Gaps = 4/290 (1%)
 Frame = -1

Query  1802  EKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTI  1623
             + A+ +F ++  S  +P +V +N L+  +    R+     L   +   G + +  + + +
Sbjct  41    KDAVDVFDQMVRSRPLPSIVDFNKLLSAIAKMKRYDIVISLCKRMELHGISHDNYSLSIL  100

Query  1622  MKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGI  1443
             + C  RS +   G  +L ++ + GY  D   + T+I+ L   G++  A      M+ +G 
Sbjct  101   INCFCRSSQVGLGFSVLGKIMKMGYDPDVVTFNTLINGLCMDGKLSTALSLAERMVKDGY  160

Query  1442  ELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALR  1263
               D+V  NT++N  C +G++  A  LV +   KG+  D +T+  ++ G+CK G+   AL 
Sbjct  161   TPDVVTCNTVVNGLCLQGRIREAVTLVDQMSEKGYQPDVFTYGAVVKGICKLGDSALALN  220

Query  1262  HLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKD----CFTYSSLVHGLC  1095
              L   +      N+V +N  ID LCK G +D A+++F+ MD+++      TY++LV+GLC
Sbjct  221   LLAKVEERHVQVNVVVYNTVIDCLCKCGHIDDAINLFRKMDDREVVPNVVTYNTLVNGLC  280

Query  1094  KAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
               GR+  A+  L   I   +         +ID     G   EAR ++ ++
Sbjct  281   CYGRWVDAARFLNEMIKRKITPNVVTFTGLIDNFIKEGKFLEARDVYEQM  330


 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 118/264 (45%), Gaps = 19/264 (7%)
 Frame = -1

Query  1697  APARRLLNELVDIGYNPNAITYTTIMKCCFRSRRF---------EEGLQILEEMRRKGYI  1545
             A ARR+ +       + +   ++ +  C FR  RF         ++ + + ++M R   +
Sbjct  3     AMARRVASA------STSGFVHSHLSSCLFRRPRFSSSVSYSNVKDAVDVFDQMVRSRPL  56

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
                  +  ++S + K  R          M ++GI  D  + + LIN +C+  ++   + +
Sbjct  57    PSIVDFNKLLSAIAKMKRYDIVISLCKRMELHGISHDNYSLSILINCFCRSSQVGLGFSV  116

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
             + +  + G+D D  T   +I+GLC  G +  AL         G+  ++V  N  ++GLC 
Sbjct  117   LGKIMKMGYDPDVVTFNTLINGLCMDGKLSTALSLAERMVKDGYTPDVVTCNTVVNGLCL  176

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G +  A+++   M EK    D FTY ++V G+CK G   +A  LL       +++    
Sbjct  177   QGRIREAVTLVDQMSEKGYQPDVFTYGAVVKGICKLGDSALALNLLAKVEERHVQVNVVV  236

Query  1016  RQAVIDGLQHSGFIQEARKLHSEL  945
                VID L   G I +A  L  ++
Sbjct  237   YNTVIDCLCKCGHIDDAINLFRKM  260



>ref|XP_006470579.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Citrus sinensis]
Length=752

 Score =   228 bits (581),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 141/484 (29%), Positives = 243/484 (50%), Gaps = 39/484 (8%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             L+   LNI V  LCK  +++ A+  + +  + GV  D VTYNTLI AYC    ++  + +
Sbjct  258   LNVYTLNIMVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQL  317

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             ++ M+  G+KP V TYNSLI    + G   R  ++L+EML++G+ PDT +YNTL+    R
Sbjct  318   MNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCR  377

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
                  EA   F ++    + P  V+F+ L+     NG  ++ALM FRE+K +G +P  V 
Sbjct  378   KENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVL  437

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             Y I+I+G C +G    A ++ +E+++ G   + +TY TI+    R++   E   +  EM 
Sbjct  438   YTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEML  497

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              +G   D + + T+I    K G M  A +    M    I+ D+V YNTLI+ +CK G+++
Sbjct  498   ERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEME  557

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALR-------------HLNCTKLM  1239
              A  L  +   +    +  ++ I+I+G C  G++ EA R             H++C  ++
Sbjct  558   KANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGEGIKPTHVSCNTII  617

Query  1238  ----------------------GFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK---  1134
                                   G D + +++N  I+G  +   +D A ++ + M+ +   
Sbjct  618   KGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVRKMENQGLV  677

Query  1133  -DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
              D  TY+ ++ G C+ GR   +  +L   I  G+   +S    +I+G      ++EA + 
Sbjct  678   PDVITYNVIMTGFCRQGRMHDSELILRRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRF  737

Query  956   HSEL  945
             H E+
Sbjct  738   HDEM  741


 Score =   172 bits (436),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 115/435 (26%), Positives = 203/435 (47%), Gaps = 9/435 (2%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  L K   ++ A  V  + +R G+  +V T N ++ A C    ID+    L  M +
Sbjct  229   NSLLGGLVKIGWVDLAREVYAEVVRSGIELNVYTLNIMVNALCKDHKIDSAKMFLCEMEQ  288

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G+ PD +TYN+LI +  R G L     L+  M   G+ P  ++YN+L++ L + G+ D 
Sbjct  289   KGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDR  348

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A     ++    + P   T+N LL   C      +A  +F E+   G  P +V+++ LI 
Sbjct  349   AKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIG  408

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
                 +G+   A     E+   G  P+ + YT I+    R+    E L++ +EM  KG + 
Sbjct  409   IFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVM  468

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y T+++ L +A  + +A D    M+  G+  D   + TLI+ +CK+G ++ A  L 
Sbjct  469   DVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLF  528

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
                 +K    D  T+  +IDG CK G M++A +            N +++   I+G C +
Sbjct  529   DIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSM  588

Query  1181  GEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G V  A  ++  M     +    + ++++ G C++G    A E L   +  G+     D 
Sbjct  589   GHVTEAFRLWYEMVGEGIKPTHVSCNTIIKGYCRSGDASKADEFLSKMVSEGV-----DP  643

Query  1013  QAVIDGLQHSGFIQE  969
              ++      +GF++E
Sbjct  644   DSISYNTLINGFVRE  658


 Score =   165 bits (418),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 113/445 (25%), Positives = 203/445 (46%), Gaps = 4/445 (1%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
             + ++ +    +A++L +   V       G+   +   N+L+        +D    +   +
Sbjct  192   IFDLVIRTYVQARKLREGSEVFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEV  251

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
                GI+ +V T N ++ +  +   +      L EM + G+ PDT +YNTL++   R G  
Sbjct  252   VRSGIELNVYTLNIMVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFL  311

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             +EA++    +    + P   T+N L++GLC  G  ++A  +  E+   G  P   TYN L
Sbjct  312   EEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTL  371

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             +   C     + A  +  E+   G  P+ ++++T++    R+ + +  L    EM+  G 
Sbjct  372   LVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGL  431

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
             + D+  Y  +I+   + G + +A      M+  G  +D+V YNT++N  C+   L  A  
Sbjct  432   VPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADD  491

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLC  1188
             L  E   +G   D YT T +I G CK GNM +AL   +         ++V +N  IDG C
Sbjct  492   LFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFC  551

Query  1187  KVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             KVGE++ A  ++  M  +    +  +Y  L++G C  G    A  L    +  G+K    
Sbjct  552   KVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGEGIKPTHV  611

Query  1019  DRQAVIDGLQHSGFIQEARKLHSEL  945
                 +I G   SG   +A +  S++
Sbjct  612   SCNTIIKGYCRSGDASKADEFLSKM  636


 Score =   161 bits (408),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 102/372 (27%), Positives = 175/372 (47%), Gaps = 0/372 (0%)
 Frame = -1

Query  2309  LE*MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCC  2130
             L+ M ++     T   N  +   C+ + + +AE +  +  R GV  D+V+++TLI  +  
Sbjct  353   LDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSR  412

Query  2129  FVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWS  1950
                +D        M   G+ PD + Y  +I    R+G +   L + +EMLE G + D  +
Sbjct  413   NGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVT  472

Query  1949  YNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELK  1770
             YNT+++ L R     EA   F ++    + P   TF  L+ G C +G   KAL LF  + 
Sbjct  473   YNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMT  532

Query  1769  HSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFE  1590
                  P +VTYN LI G C  G    A +L  +++    +PN I+Y  ++          
Sbjct  533   QKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVT  592

Query  1589  EGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLI  1410
             E  ++  EM  +G      +  T+I    ++G    A + +  M+  G++ D ++YNTLI
Sbjct  593   EAFRLWYEMVGEGIKPTHVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLI  652

Query  1409  NLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFD  1230
             N + +E  +D A+ LV + E +G   D  T+ +I+ G C+ G M ++   L      G +
Sbjct  653   NGFVREENMDKAFALVRKMENQGLVPDVITYNVIMTGFCRQGRMHDSELILRRMIEKGLN  712

Query  1229  SNLVAFNCCIDG  1194
              +   +   I+G
Sbjct  713   PDRSTYTTLING  724


 Score =   151 bits (381),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/285 (29%), Positives = 147/285 (52%), Gaps = 0/285 (0%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC  2004
             G   DVVTYNT++   C    +     + + M E G+ PD  T+ +LI    + G +++ 
Sbjct  465   GCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKA  524

Query  2003  LDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSG  1824
             L+L + M +  I PD  +YNTL+    ++G+ ++A + + D+    I P  +++ IL++G
Sbjct  525   LNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILING  584

Query  1823  LCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPN  1644
              C  G+  +A  L+ E+   G  P  V+ N +I G C SG  + A   L+++V  G +P+
Sbjct  585   YCSMGHVTEAFRLWYEMVGEGIKPTHVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPD  644

Query  1643  AITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVG  1464
             +I+Y T++    R    ++   ++ +M  +G + D   Y  +++   + GRM D+   + 
Sbjct  645   SISYNTLINGFVREENMDKAFALVRKMENQGLVPDVITYNVIMTGFCRQGRMHDSELILR  704

Query  1463  NMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCD  1329
              MI  G+  D   Y TLIN +  +  L  A+    E  ++GF  D
Sbjct  705   RMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPD  749


 Score =   125 bits (313),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 130/276 (47%), Gaps = 0/276 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LC+AK L +A+ +  + +  GV  D  T+ TLI  +C    ++   ++   M +
Sbjct  474   NTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQ  533

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               IKPD++TYN+LI    + G + +   L  +M+   I P+  SY  L++    +G   E
Sbjct  534   KSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTE  593

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A+R + ++    I P  V+ N ++ G C +G   KA     ++   G  P  ++YN LI+
Sbjct  594   AFRLWYEMVGEGIKPTHVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLIN  653

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G         A  L+ ++ + G  P+ ITY  IM    R  R  +   IL  M  KG   
Sbjct  654   GFVREENMDKAFALVRKMENQGLVPDVITYNVIMTGFCRQGRMHDSELILRRMIEKGLNP  713

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELD  1434
             D   Y T+I+  +    +K+A+     M+  G   D
Sbjct  714   DRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPD  749


 Score =   103 bits (256),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/263 (27%), Positives = 128/263 (49%), Gaps = 26/263 (10%)
 Frame = -1

Query  1784  FRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLN-----------ELVDI---GYNP  1647
             F  +KHS      ++ + +IH L    R + A+ L+            E+VD     Y+P
Sbjct  131   FPNVKHSS-----MSLSAMIHFLVRGRRISDAQALILRMVRKSGVSRLEIVDSFVSTYSP  185

Query  1646  ---NAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAY  1476
                N++ +  +++   ++R+  EG ++   +R KG  F   A  +++  L+K G +  A 
Sbjct  186   CGSNSLIFDLVIRTYVQARKLREGSEVFRLLRNKGICFSINACNSLLGGLVKIGWVDLAR  245

Query  1475  DCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGL  1296
             +    ++ +GIEL++   N ++N  CK+ K+D+A M + E E+KG   D  T+  +I+  
Sbjct  246   EVYAEVVRSGIELNVYTLNIMVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAY  305

Query  1295  CKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE----KDC  1128
             C+ G ++EA + +N     G    +  +N  I+GLCK G  D A  V   M +     D 
Sbjct  306   CREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDT  365

Query  1127  FTYSSLVHGLCKAGRFRVASELL  1059
              TY++L+   C+      A E+ 
Sbjct  366   ATYNTLLVESCRKENMSEAEEIF  388



>ref|XP_002972017.1| hypothetical protein SELMODRAFT_96794 [Selaginella moellendorffii]
 gb|EFJ26934.1| hypothetical protein SELMODRAFT_96794 [Selaginella moellendorffii]
Length=1116

 Score =   231 bits (589),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 152/475 (32%), Positives = 235/475 (49%), Gaps = 43/475 (9%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  V  LCKA ++E+A  +I   +  GV  DV+TY+ L+ A+C    +D    +LH M  
Sbjct  399   NALVNGLCKADKMERAHAMIESMVDKGVTPDVITYSVLVDAFCKASRVDEALELLHGMAS  458

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEM-LEVGILPDTWSYNTLMHCLFRLGK--  1911
              G  P+V+T+NS+I    +         + ++M L+ G++PD  +Y TL+  LFR G+  
Sbjct  459   RGCTPNVVTFNSIIDGLCKSDRSGEAFQMFDDMALKHGLVPDKITYCTLIDGLFRTGRAG  518

Query  1910  -----------PD------------------EAYRFFQDIFWGDIPPCPVTFNILLSGLC  1818
                        PD                   A + +  +   ++ P  VTFNIL++G C
Sbjct  519   QAEALLDAMPDPDTYAFNCCINGLSKLGDVSRALQVYNRMLELELVPDKVTFNILIAGAC  578

Query  1817  MNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAI  1638
               G  E+A  LF E+      P ++T+  LI GLC +G+   AR +L+ + ++G  PN +
Sbjct  579   KAGNFEQASALFEEMVAKNLQPDVMTFGALIDGLCKAGQVEAARDILDLMGNLGVPPNVV  638

Query  1637  TYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNM  1458
             TY  ++    +S R EE  Q LEEM   G + DS  Y +++  L +A R  DA   V  +
Sbjct  639   TYNALVHGLCKSGRIEEACQFLEEMVSSGCVPDSITYGSLVYALCRASRTDDALQLVSEL  698

Query  1457  IMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNM  1278
                G + D V YN L++   K G+ + A  ++ E   KG   D  T+  +ID LCKAG++
Sbjct  699   KSFGWDPDTVTYNILVDGLWKSGQTEQAITVLEEMVGKGHHPDVVTYNTLIDSLCKAGDL  758

Query  1277  KEALR-HLNCTKLMGF--DSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDC------F  1125
             +EA R H + +  +      N+V ++  I+GLCKVG +D A  + + M  K C       
Sbjct  759   EEARRLHGDMSSRVSRCCVPNVVTYSVLINGLCKVGRIDEARELIQEMMRKSCDVLPNII  818

Query  1124  TYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR--QAVIDGLQHSGFIQEA  966
             TY+S + GLCK      A EL+ S   G +++         +IDGL   G   EA
Sbjct  819   TYNSFLDGLCKQSMMAEACELMRSLRDGSLRVSPDTVTFSTLIDGLCKCGQTDEA  873


 Score =   215 bits (547),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 141/445 (32%), Positives = 224/445 (50%), Gaps = 14/445 (3%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKA-ETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             NI +  LC+A +  +A E    +  R GV   +VTYNT+I   C    + AG  +   + 
Sbjct  184   NIVLQSLCRAGETARALEIFRGEMARDGVAPTIVTYNTIINGLCKSNELGAGMELFEELV  243

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             E G  PDV+TYN+LI S  + G L     L  +M     +P+  +Y+ L++ L ++G+ D
Sbjct  244   ERGHHPDVVTYNTLIDSLCKAGDLEEARRLHGDMSSRSCVPNVVTYSVLINGLCKVGRID  303

Query  1904  EAYRFFQDIFWG--DIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGF--IPQLVTY  1737
             EA    Q++     D+ P  +T+N  L GLC    T +A  L R L+       P  VT+
Sbjct  304   EARELIQEMTRKSCDVLPNIITYNSFLDGLCKQSMTAEACELMRSLRDGSLRVSPDTVTF  363

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRR  1557
             + LI GLC  G+   A  + ++++  GY PN ITY  ++    ++ + E    ++E M  
Sbjct  364   STLIDGLCKCGQIDEACSVFDDMIAGGYVPNVITYNALVNGLCKADKMERAHAMIESMVD  423

Query  1556  KGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDN  1377
             KG   D   Y  ++    KA R+ +A + +  M   G   ++V +N++I+  CK  +   
Sbjct  424   KGVTPDVITYSVLVDAFCKASRVDEALELLHGMASRGCTPNVVTFNSIIDGLCKSDRSGE  483

Query  1376  AYMLVVE-AERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
             A+ +  + A + G   DK T+  +IDGL + G   +A   L+       D +  AFNCCI
Sbjct  484   AFQMFDDMALKHGLVPDKITYCTLIDGLFRTGRAGQAEALLDAMP----DPDTYAFNCCI  539

Query  1199  DGLCKVGEVDYALSVFKSMDE----KDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             +GL K+G+V  AL V+  M E     D  T++ L+ G CKAG F  AS L    +   ++
Sbjct  540   NGLSKLGDVSRALQVYNRMLELELVPDKVTFNILIAGACKAGNFEQASALFEEMVAKNLQ  599

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKL  957
                    A+IDGL  +G ++ AR +
Sbjct  600   PDVMTFGALIDGLCKAGQVEAARDI  624


 Score =   210 bits (535),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 146/492 (30%), Positives = 235/492 (48%), Gaps = 59/492 (12%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              NI +A  CKA   E+A  +  + +   +  DV+T+  LI   C    ++A   IL  M 
Sbjct  570   FNILIAGACKAGNFEQASALFEEMVAKNLQPDVMTFGALIDGLCKAGQVEAARDILDLMG  629

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
              +G+ P+V+TYN+L+    + G +      LEEM+  G +PD+ +Y +L++ L R  + D
Sbjct  630   NLGVPPNVVTYNALVHGLCKSGRIEEACQFLEEMVSSGCVPDSITYGSLVYALCRASRTD  689

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             +A +   ++      P  VT+NIL+ GL  +G TE+A+ +  E+   G  P +VTYN LI
Sbjct  690   DALQLVSELKSFGWDPDTVTYNILVDGLWKSGQTEQAITVLEEMVGKGHHPDVVTYNTLI  749

Query  1724  HGLCNSGRWAPARRL---LNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
               LC +G    ARRL   ++  V     PN +TY+ ++    +  R +E  ++++EM RK
Sbjct  750   DSLCKAGDLEEARRLHGDMSSRVSRCCVPNVVTYSVLINGLCKVGRIDEARELIQEMMRK  809

Query  1553  G-------YIFDSF--------------------------------AYCTVISFLIKAGR  1491
                       ++SF                                 + T+I  L K G+
Sbjct  810   SCDVLPNIITYNSFLDGLCKQSMMAEACELMRSLRDGSLRVSPDTVTFSTLIDGLCKCGQ  869

Query  1490  MKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTI  1311
               +A +   +MI  G   ++V YN L+N  CK  K++ A+ ++     KG   D  T+++
Sbjct  870   TDEACNVFDDMIAGGYVPNVVTYNVLMNGLCKTDKMERAHAMIESMVDKGVTPDVITYSV  929

Query  1310  IIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK-  1134
             ++D  CKA ++ EAL  L+     G   N+V FN  IDGLCK  +   A  +F  M  K 
Sbjct  930   LVDAFCKASHVDEALELLHGMASRGCTPNVVTFNSIIDGLCKSDQSGEAFQMFDDMTLKH  989

Query  1133  ----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAV---IDGLQHSGFI  975
                 D  TY +L+ GL + G +   +E+LL  +         D  A    I+GL   G +
Sbjct  990   GLAPDKITYCTLIDGLFRTG-WAGQAEVLLDAMP------DPDTYAFNCCINGLSKLGDV  1042

Query  974   QEARKLHSELKL  939
               +R LH  L+L
Sbjct  1043  --SRALHRMLEL  1052


 Score =   194 bits (494),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 132/470 (28%), Positives = 227/470 (48%), Gaps = 40/470 (9%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  V  LCK+ ++E+A   + + +  G   D +TY +L+ A C     D    ++  +  
Sbjct  641   NALVHGLCKSGRIEEACQFLEEMVSSGCVPDSITYGSLVYALCRASRTDDALQLVSELKS  700

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G  PD +TYN L+    + G   + + +LEEM+  G  PD  +YNTL+  L + G  +E
Sbjct  701   FGWDPDTVTYNILVDGLWKSGQTEQAITVLEEMVGKGHHPDVVTYNTLIDSLCKAGDLEE  760

Query  1901  AYRFFQDIFWGDIP---PCPVTFNILLSGLCMNGYTEKALMLFREL--KHSGFIPQLVTY  1737
             A R   D+         P  VT+++L++GLC  G  ++A  L +E+  K    +P ++TY
Sbjct  761   ARRLHGDMSSRVSRCCVPNVVTYSVLINGLCKVGRIDEARELIQEMMRKSCDVLPNIITY  820

Query  1736  NILIHGLCNSGRWAPARRLLNELVD--IGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             N  + GLC     A A  L+  L D  +  +P+ +T++T++    +  + +E   + ++M
Sbjct  821   NSFLDGLCKQSMMAEACELMRSLRDGSLRVSPDTVTFSTLIDGLCKCGQTDEACNVFDDM  880

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
                GY+ +   Y  +++ L K  +M+ A+  + +M+  G+  D++ Y+ L++ +CK   +
Sbjct  881   IAGGYVPNVVTYNVLMNGLCKTDKMERAHAMIESMVDKGVTPDVITYSVLVDAFCKASHV  940

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLN---------------CT  1248
             D A  L+     +G   +  T   IIDGLCK+    EA +  +               CT
Sbjct  941   DEALELLHGMASRGCTPNVVTFNSIIDGLCKSDQSGEAFQMFDDMTLKHGLAPDKITYCT  1000

Query  1247  KLMGF-----------------DSNLVAFNCCIDGLCKVGEVDYALSVFKSMD-EKDCFT  1122
              + G                  D +  AFNCCI+GL K+G+V  AL     ++   D  T
Sbjct  1001  LIDGLFRTGWAGQAEVLLDAMPDPDTYAFNCCINGLSKLGDVSRALHRMLELELVPDKVT  1060

Query  1121  YSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQ  972
             ++ L+ G CKAG F  AS L    +   ++       A+IDGL  +G ++
Sbjct  1061  FNILIAGACKAGNFEQASALFEEMVAKNLQPDVMTFGALIDGLCKAGQVE  1110


 Score =   191 bits (484),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 132/457 (29%), Positives = 226/457 (49%), Gaps = 13/457 (3%)
 Frame = -1

Query  2273  TKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILH  2094
             T   N  +  L K   + +A  V    + + +  D VT+N LI   C     +   ++  
Sbjct  532   TYAFNCCINGLSKLGDVSRALQVYNRMLELELVPDKVTFNILIAGACKAGNFEQASALFE  591

Query  2093  RMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLG  1914
              M    ++PDV+T+ +LI    + G +    D+L+ M  +G+ P+  +YN L+H L + G
Sbjct  592   EMVAKNLQPDVMTFGALIDGLCKAGQVEAARDILDLMGNLGVPPNVVTYNALVHGLCKSG  651

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             + +EA +F +++      P  +T+  L+  LC    T+ AL L  ELK  G+ P  VTYN
Sbjct  652   RIEEACQFLEEMVSSGCVPDSITYGSLVYALCRASRTDDALQLVSELKSFGWDPDTVTYN  711

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             IL+ GL  SG+   A  +L E+V  G++P+ +TY T++    ++   EE  ++  +M  +
Sbjct  712   ILVDGLWKSGQTEQAITVLEEMVGKGHHPDVVTYNTLIDSLCKAGDLEEARRLHGDMSSR  771

Query  1553  GY---IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIEL--DLVAYNTLINLYCKEG  1389
                  + +   Y  +I+ L K GR+ +A + +  M+    ++  +++ YN+ ++  CK+ 
Sbjct  772   VSRCCVPNVVTYSVLINGLCKVGRIDEARELIQEMMRKSCDVLPNIITYNSFLDGLCKQS  831

Query  1388  KLDNAYMLVVEAERKG---FDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLV  1218
              +  A  L + + R G      D  T + +IDGLCK G   EA    +     G+  N+V
Sbjct  832   MMAEACEL-MRSLRDGSLRVSPDTVTFSTLIDGLCKCGQTDEACNVFDDMIAGGYVPNVV  890

Query  1217  AFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSC  1050
              +N  ++GLCK  +++ A ++ +SM +K    D  TYS LV   CKA     A ELL   
Sbjct  891   TYNVLMNGLCKTDKMERAHAMIESMVDKGVTPDVITYSVLVDAFCKASHVDEALELLHGM  950

Query  1049  IIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKL  939
                G         ++IDGL  S    EA ++  ++ L
Sbjct  951   ASRGCTPNVVTFNSIIDGLCKSDQSGEAFQMFDDMTL  987


 Score =   160 bits (405),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 112/391 (29%), Positives = 191/391 (49%), Gaps = 14/391 (4%)
 Frame = -1

Query  2078  GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE-  1902
             G K  + ++N  +    + G  ++ +DL    L     P+ ++Y+TL+   ++ G   E 
Sbjct  106   GFKHTIFSFNKYLNLLVKSGSPAKAIDLFRSRLPPRCRPNHFTYSTLLRATYKAGGDVER  165

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFR-ELKHSGFIPQLVTYNILI  1725
                FF+ I           +NI+L  LC  G T +AL +FR E+   G  P +VTYN +I
Sbjct  166   TLGFFRRIRSSSR--SVADYNIVLQSLCRAGETARALEIFRGEMARDGVAPTIVTYNTII  223

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLC S        L  ELV+ G++P+ +TY T++    ++   EE  ++  +M  +  +
Sbjct  224   NGLCKSNELGAGMELFEELVERGHHPDVVTYNTLIDSLCKAGDLEEARRLHGDMSSRSCV  283

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIEL--DLVAYNTLINLYCKEGKLDNAY  1371
              +   Y  +I+ L K GR+ +A + +  M     ++  +++ YN+ ++  CK+     A 
Sbjct  284   PNVVTYSVLINGLCKVGRIDEARELIQEMTRKSCDVLPNIITYNSFLDGLCKQSMTAEAC  343

Query  1370  MLVVEAERKG---FDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              L + + R G      D  T + +IDGLCK G + EA    +     G+  N++ +N  +
Sbjct  344   EL-MRSLRDGSLRVSPDTVTFSTLIDGLCKCGQIDEACSVFDDMIAGGYVPNVITYNALV  402

Query  1199  DGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             +GLCK  +++ A ++ +SM +K    D  TYS LV   CKA R   A ELL      G  
Sbjct  403   NGLCKADKMERAHAMIESMVDKGVTPDVITYSVLVDAFCKASRVDEALELLHGMASRGCT  462

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKLHSELKL  939
                    ++IDGL  S    EA ++  ++ L
Sbjct  463   PNVVTFNSIIDGLCKSDRSGEAFQMFDDMAL  493


 Score =   152 bits (383),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 109/384 (28%), Positives = 171/384 (45%), Gaps = 48/384 (13%)
 Frame = -1

Query  2072  KPDVITYNSLI-ASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAY  1896
             +P+  TY++L+ A+    G + R L     +           YN ++  L R G+   A 
Sbjct  143   RPNHFTYSTLLRATYKAGGDVERTLGFFRRIRSSSRS--VADYNIVLQSLCRAGETARAL  200

Query  1895  RFFQDIFWGD-IPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
               F+     D + P  VT+N +++GLC +      + LF EL   G  P +VTYN LI  
Sbjct  201   EIFRGEMARDGVAPTIVTYNTIINGLCKSNELGAGMELFEELVERGHHPDVVTYNTLIDS  260

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKG----  1551
             LC +G    ARRL  ++      PN +TY+ ++    +  R +E  ++++EM RK     
Sbjct  261   LCKAGDLEEARRLHGDMSSRSCVPNVVTYSVLINGLCKVGRIDEARELIQEMTRKSCDVL  320

Query  1550  ---YIFDSF--------------------------------AYCTVISFLIKAGRMKDAY  1476
                  ++SF                                 + T+I  L K G++ +A 
Sbjct  321   PNIITYNSFLDGLCKQSMTAEACELMRSLRDGSLRVSPDTVTFSTLIDGLCKCGQIDEAC  380

Query  1475  DCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGL  1296
                 +MI  G   +++ YN L+N  CK  K++ A+ ++     KG   D  T+++++D  
Sbjct  381   SVFDDMIAGGYVPNVITYNALVNGLCKADKMERAHAMIESMVDKGVTPDVITYSVLVDAF  440

Query  1295  CKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK-----D  1131
             CKA  + EAL  L+     G   N+V FN  IDGLCK      A  +F  M  K     D
Sbjct  441   CKASRVDEALELLHGMASRGCTPNVVTFNSIIDGLCKSDRSGEAFQMFDDMALKHGLVPD  500

Query  1130  CFTYSSLVHGLCKAGRFRVASELL  1059
               TY +L+ GL + GR   A  LL
Sbjct  501   KITYCTLIDGLFRTGRAGQAEALL  524


 Score =   107 bits (266),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 128/258 (50%), Gaps = 8/258 (3%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             LCK  Q ++A  V  D I  G   +VVTYN L+   C    ++  ++++  M + G+ PD
Sbjct  864   LCKCGQTDEACNVFDDMIAGGYVPNVVTYNVLMNGLCKTDKMERAHAMIESMVDKGVTPD  923

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             VITY+ L+ +  +   +   L+LL  M   G  P+  ++N+++  L +  +  EA++ F 
Sbjct  924   VITYSVLVDAFCKASHVDEALELLHGMASRGCTPNVVTFNSIIDGLCKSDQSGEAFQMFD  983

Query  1883  DI-FWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNS  1707
             D+     + P  +T+  L+ GL   G+  +A +L   +      P    +N  I+GL   
Sbjct  984   DMTLKHGLAPDKITYCTLIDGLFRTGWAGQAEVLLDAMPD----PDTYAFNCCINGLSKL  1039

Query  1706  GRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAY  1527
             G  +   R L+ ++++   P+ +T+  ++    ++  FE+   + EEM  K    D   +
Sbjct  1040  GDVS---RALHRMLELELVPDKVTFNILIAGACKAGNFEQASALFEEMVAKNLQPDVMTF  1096

Query  1526  CTVISFLIKAGRMKDAYD  1473
               +I  L KAG+++  +D
Sbjct  1097  GALIDGLCKAGQVEATWD  1114



>ref|XP_010530464.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=618

 Score =   225 bits (574),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 127/447 (28%), Positives = 231/447 (52%), Gaps = 4/447 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             L+I + C C+++Q+    +V+   +++G   +V+T+NTLI   C    + A  S++ RM 
Sbjct  107   LSILINCFCRSRQVGLGFSVLGKIMKIGYEPNVITFNTLINGLCIEGKLSAALSLIERMV  166

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             + G  PDV+T N+++      G +   + L+++M + G +P+  +Y  +++ + + G   
Sbjct  167   KDGYTPDVVTCNTVVNGLCLQGRIHEAVTLVDQMPKKGHIPNVITYGAIVNGICKSGDSA  226

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A      +    +    V +N ++  LC +G  + AL LF+++   G  P +VTYN LI
Sbjct  227   LALNLLIKMEERHVEVNVVVYNTIIDCLCKDGRVDDALNLFKKMDDRGVEPDVVTYNTLI  286

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLC  GRW+   RLLN+++     P+ +T+T ++    +  +F E  ++ E+M ++G +
Sbjct  287   NGLCCYGRWSDVARLLNDMIKRNITPDVVTFTGLIDNFVKEGKFLEARELYEQMVQRGLV  346

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D+  Y ++I  L    R+ +A     +M   G   D+V +N LIN YCK G++D    L
Sbjct  347   PDTITYNSLIDGLCMQNRLDEAKKMFDSMATKGCPPDVVTFNALINGYCKAGRVDQGMKL  406

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E  R+    D  T+  +I G  + GN+  A +     +  G D NLV F+  +DGLCK
Sbjct  407   FSEMSRRRVVADACTYNSLIQGFFRVGNLDTARKLFLEMQCQGQDPNLVTFSVLLDGLCK  466

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G+++ A  ++  M++     D   ++ ++HGLC   +   A  L        ++     
Sbjct  467   NGKLEEAFCLYNKMEKSGMNLDIIAHNIIIHGLCVDDKVEDALRLFNGLFDREVEPNVKT  526

Query  1016  RQAVIDGLQHSGFIQEARKLHSELKLS  936
               A+I GL   G + EA KL  ++K++
Sbjct  527   YTAMISGLCRKGLLDEAEKLFGDMKVA  553


 Score =   186 bits (473),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 114/425 (27%), Positives = 206/425 (48%), Gaps = 4/425 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  V  LC   ++ +A T++    + G   +V+TY  ++   C         ++L +M E
Sbjct  178   NTVVNGLCLQGRIHEAVTLVDQMPKKGHIPNVITYGAIVNGICKSGDSALALNLLIKMEE  237

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               ++ +V+ YN++I    + G +   L+L ++M + G+ PD  +YNTL++ L   G+  +
Sbjct  238   RHVEVNVVVYNTIIDCLCKDGRVDDALNLFKKMDDRGVEPDVVTYNTLINGLCCYGRWSD  297

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
               R   D+   +I P  VTF  L+      G   +A  L+ ++   G +P  +TYN LI 
Sbjct  298   VARLLNDMIKRNITPDVVTFTGLIDNFVKEGKFLEARELYEQMVQRGLVPDTITYNSLID  357

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC   R   A+++ + +   G  P+ +T+  ++    ++ R ++G+++  EM R+  + 
Sbjct  358   GLCMQNRLDEAKKMFDSMATKGCPPDVVTFNALINGYCKAGRVDQGMKLFSEMSRRRVVA  417

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D+  Y ++I    + G +  A      M   G + +LV ++ L++  CK GKL+ A+ L 
Sbjct  418   DACTYNSLIQGFFRVGNLDTARKLFLEMQCQGQDPNLVTFSVLLDGLCKNGKLEEAFCLY  477

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              + E+ G + D   H III GLC    +++ALR  N       + N+  +   I GLC+ 
Sbjct  478   NKMEKSGMNLDIIAHNIIIHGLCVDDKVEDALRLFNGLFDREVEPNVKTYTAMISGLCRK  537

Query  1181  GEVDYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G +D A  +F  M    C     TY++L+ G  + G      EL+      G     S  
Sbjct  538   GLLDEAEKLFGDMKVAGCLPNDRTYNALIQGHLRKGYTSKGIELVREMRSCGFSADASTT  597

Query  1013  QAVID  999
             + ++D
Sbjct  598   EIIVD  602


 Score =   174 bits (442),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 115/415 (28%), Positives = 200/415 (48%), Gaps = 4/415 (1%)
 Frame = -1

Query  2168  VVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLE  1989
             ++ +N L++A           S+  +M   GI     + + LI    R   +     +L 
Sbjct  69    IIEFNKLLSAIAKMKRYGIVISLCKKMELHGISHSNYSLSILINCFCRSRQVGLGFSVLG  128

Query  1988  EMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNG  1809
             +++++G  P+  ++NTL++ L   GK   A    + +      P  VT N +++GLC+ G
Sbjct  129   KIMKIGYEPNVITFNTLINGLCIEGKLSAALSLIERMVKDGYTPDVVTCNTVVNGLCLQG  188

Query  1808  YTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYT  1629
                +A+ L  ++   G IP ++TY  +++G+C SG  A A  LL ++ +     N + Y 
Sbjct  189   RIHEAVTLVDQMPKKGHIPNVITYGAIVNGICKSGDSALALNLLIKMEERHVEVNVVVYN  248

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
             TI+ C  +  R ++ L + ++M  +G   D   Y T+I+ L   GR  D    + +MI  
Sbjct  249   TIIDCLCKDGRVDDALNLFKKMDDRGVEPDVVTYNTLINGLCCYGRWSDVARLLNDMIKR  308

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
              I  D+V +  LI+ + KEGK   A  L  +  ++G   D  T+  +IDGLC    + EA
Sbjct  309   NITPDVVTFTGLIDNFVKEGKFLEARELYEQMVQRGLVPDTITYNSLIDGLCMQNRLDEA  368

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHG  1101
              +  +     G   ++V FN  I+G CK G VD  + +F  M  +    D  TY+SL+ G
Sbjct  369   KKMFDSMATKGCPPDVVTFNALINGYCKAGRVDQGMKLFSEMSRRRVVADACTYNSLIQG  428

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
               + G    A +L L     G          ++DGL  +G ++EA  L+++++ S
Sbjct  429   FFRVGNLDTARKLFLEMQCQGQDPNLVTFSVLLDGLCKNGKLEEAFCLYNKMEKS  483


 Score =   167 bits (422),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/358 (28%), Positives = 173/358 (48%), Gaps = 0/358 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  + CLCK  +++ A  +       GV  DVVTYNTLI   CC+        +L+ M +
Sbjct  248   NTIIDCLCKDGRVDDALNLFKKMDDRGVEPDVVTYNTLINGLCCYGRWSDVARLLNDMIK  307

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I PDV+T+  LI +  + G      +L E+M++ G++PDT +YN+L+  L    + DE
Sbjct  308   RNITPDVVTFTGLIDNFVKEGKFLEARELYEQMVQRGLVPDTITYNSLIDGLCMQNRLDE  367

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A + F  +     PP  VTFN L++G C  G  ++ + LF E+     +    TYN LI 
Sbjct  368   AKKMFDSMATKGCPPDVVTFNALINGYCKAGRVDQGMKLFSEMSRRRVVADACTYNSLIQ  427

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G    G    AR+L  E+   G +PN +T++ ++    ++ + EE   +  +M + G   
Sbjct  428   GFFRVGNLDTARKLFLEMQCQGQDPNLVTFSVLLDGLCKNGKLEEAFCLYNKMEKSGMNL  487

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D  A+  +I  L    +++DA      +    +E ++  Y  +I+  C++G LD A  L 
Sbjct  488   DIIAHNIIIHGLCVDDKVEDALRLFNGLFDREVEPNVKTYTAMISGLCRKGLLDEAEKLF  547

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLC  1188
              + +  G   +  T+  +I G  + G   + +  +   +  GF ++       +D +C
Sbjct  548   GDMKVAGCLPNDRTYNALIQGHLRKGYTSKGIELVREMRSCGFSADASTTEIIVDMIC  605


 Score =   125 bits (313),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 150/294 (51%), Gaps = 4/294 (1%)
 Frame = -1

Query  1814  NGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAIT  1635
             N   + A+ +F ++  S  +P ++ +N L+  +    R+     L  ++   G + +  +
Sbjct  47    NSNVKDAVDVFDQMVRSRPLPSIIEFNKLLSAIAKMKRYGIVISLCKKMELHGISHSNYS  106

Query  1634  YTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMI  1455
              + ++ C  RSR+   G  +L ++ + GY  +   + T+I+ L   G++  A   +  M+
Sbjct  107   LSILINCFCRSRQVGLGFSVLGKIMKIGYEPNVITFNTLINGLCIEGKLSAALSLIERMV  166

Query  1454  MNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMK  1275
              +G   D+V  NT++N  C +G++  A  LV +  +KG   +  T+  I++G+CK+G+  
Sbjct  167   KDGYTPDVVTCNTVVNGLCLQGRIHEAVTLVDQMPKKGHIPNVITYGAIVNGICKSGDSA  226

Query  1274  EALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMD----EKDCFTYSSLV  1107
              AL  L   +    + N+V +N  ID LCK G VD AL++FK MD    E D  TY++L+
Sbjct  227   LALNLLIKMEERHVEVNVVVYNTIIDCLCKDGRVDDALNLFKKMDDRGVEPDVVTYNTLI  286

Query  1106  HGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             +GLC  GR+   + LL   I   +         +ID     G   EAR+L+ ++
Sbjct  287   NGLCCYGRWSDVARLLNDMIKRNITPDVVTFTGLIDNFVKEGKFLEARELYEQM  340


 Score =   120 bits (302),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 173/410 (42%), Gaps = 45/410 (11%)
 Frame = -1

Query  2039  ASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIP  1860
              SA  H  LS CL L            + SY   +   F      +A   F  +      
Sbjct  13    TSAFVHSHLSSCLCLRLR------FSSSVSYRERLRSGFGNSNVKDAVDVFDQMVRSRPL  66

Query  1859  PCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRL  1680
             P  + FN LLS +         + L ++++  G      + +ILI+  C S +      +
Sbjct  67    PSIIEFNKLLSAIAKMKRYGIVISLCKKMELHGISHSNYSLSILINCFCRSRQVGLGFSV  126

Query  1679  LNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIK  1500
             L +++ IGY PN IT+ T++       +    L ++E M + GY  D     TV++ L  
Sbjct  127   LGKIMKIGYEPNVITFNTLINGLCIEGKLSAALSLIERMVKDGYTPDVVTCNTVVNGLCL  186

Query  1499  AGRMKDAYDCVGNM--------------IMNGI---------------------ELDLVA  1425
              GR+ +A   V  M              I+NGI                     E+++V 
Sbjct  187   QGRIHEAVTLVDQMPKKGHIPNVITYGAIVNGICKSGDSALALNLLIKMEERHVEVNVVV  246

Query  1424  YNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTK  1245
             YNT+I+  CK+G++D+A  L  + + +G + D  T+  +I+GLC  G   +  R LN   
Sbjct  247   YNTIIDCLCKDGRVDDALNLFKKMDDRGVEPDVVTYNTLINGLCCYGRWSDVARLLNDMI  306

Query  1244  LMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFR  1077
                   ++V F   ID   K G+   A  +++ M ++    D  TY+SL+ GLC   R  
Sbjct  307   KRNITPDVVTFTGLIDNFVKEGKFLEARELYEQMVQRGLVPDTITYNSLIDGLCMQNRLD  366

Query  1076  VASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              A ++  S    G         A+I+G   +G + +  KL SE+   +++
Sbjct  367   EAKKMFDSMATKGCPPDVVTFNALINGYCKAGRVDQGMKLFSEMSRRRVV  416


 Score = 72.4 bits (176),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 92/220 (42%), Gaps = 35/220 (16%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              N  +   CKA ++++   +  +  R  V AD  TYN+LI  +     +D    +   M 
Sbjct  387   FNALINGYCKAGRVDQGMKLFSEMSRRRVVADACTYNSLIQGFFRVGNLDTARKLFLEMQ  446

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
               G  P+++T++ L+    ++G L     L  +M + G+  D  ++N ++H L    K +
Sbjct  447   CQGQDPNLVTFSVLLDGLCKNGKLEEAFCLYNKMEKSGMNLDIIAHNIIIHGLCVDDKVE  506

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNG----------------------------  1809
             +A R F  +F  ++ P   T+  ++SGLC  G                            
Sbjct  507   DALRLFNGLFDREVEPNVKTYTAMISGLCRKGLLDEAEKLFGDMKVAGCLPNDRTYNALI  566

Query  1808  -------YTEKALMLFRELKHSGFIPQLVTYNILIHGLCN  1710
                    YT K + L RE++  GF     T  I++  +C+
Sbjct  567   QGHLRKGYTSKGIELVREMRSCGFSADASTTEIIVDMICD  606



>ref|XP_006847029.1| hypothetical protein AMTR_s00017p00176770 [Amborella trichopoda]
 gb|ERN08610.1| hypothetical protein AMTR_s00017p00176770 [Amborella trichopoda]
Length=658

 Score =   226 bits (576),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 141/449 (31%), Positives = 234/449 (52%), Gaps = 6/449 (1%)
 Frame = -1

Query  2288  KSRLSTKL--LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGID  2115
             +SR+   L  LNI +   C+  Q+++A  V+           VVTYNTLI   C    + 
Sbjct  105   QSRIVPDLVTLNIMMNFYCETHQIDRAFQVLDQIQAFNYAPTVVTYNTLIKGLCKSKMVS  164

Query  2114  AGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLM  1935
             A   IL +M   G  P+  TY+ +I           CL L+ EML+ G+ P   +YNT++
Sbjct  165   AALRILQKMGMEGPFPNDRTYSIVIDGLCNSSRSELCLGLIGEMLQKGLNPTVVTYNTIL  224

Query  1934  HCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFI  1755
               L + GK   A + ++++    I    +T+  L+ GLC  G  ++A  LF E+      
Sbjct  225   AGLCKDGKIRAAKKLYKEMKNQGIRSNLLTYTALIDGLCKEGSLDEAKKLFYEMSEKNIS  284

Query  1754  PQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQI  1575
             P +VTY+ L+HGLC  G+W  A  +L+E++D G +PN ITYT ++    +  R  + L++
Sbjct  285   PSVVTYSALVHGLCAKGQWRDATMILHEMLDRGLSPNVITYTGVLGGLCKEGRLPQALRL  344

Query  1574  LEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCK  1395
             L+ M +KG   ++  Y T+I  L K GR+ DA      M   G   +LVAY+ LI+ +CK
Sbjct  345   LDSMFQKGIEPNAVTYTTLIDGLCKGGRLDDAMRTFRLMEERGHGSNLVAYSVLIDGFCK  404

Query  1394  EGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVA  1215
              GK++ A  L  E   KG       +  ++DG  K G ++ A R  +  K    + N+ +
Sbjct  405   IGKIEEAMELFRELVAKGSRPHVIIYNTLMDGYIKMGQLEVAQRLFDEMKEQNEEPNVTS  464

Query  1214  FNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCI  1047
             +   ++G CK G ++  + +F+ M ++    +  TY++L++GLCKAG+F+ A  +L    
Sbjct  465   YTVLMNGFCKAGALEKVMDLFEEMTKQGKKPNVITYNTLINGLCKAGKFQDAKGMLSEMC  524

Query  1046  IGGMKILKSDRQAVIDGLQHSGFIQEARK  960
               G++       ++I+GL+    + EAR+
Sbjct  525   ERGIEADVVTYSSIINGLRKKQQLNEARE  553


 Score =   199 bits (507),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 122/421 (29%), Positives = 204/421 (48%), Gaps = 12/421 (3%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +A LCK  ++  A+ +  +    G+ ++++TY  LI   C    +D    + + M+E
Sbjct  221   NTILAGLCKDGKIRAAKKLYKEMKNQGIRSNLLTYTALIDGLCKEGSLDEAKKLFYEMSE  280

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I P V+TY++L+      G       +L EML+ G+ P+  +Y  ++  L + G+  +
Sbjct  281   KNISPSVVTYSALVHGLCAKGQWRDATMILHEMLDRGLSPNVITYTGVLGGLCKEGRLPQ  340

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A R    +F   I P  VT+  L+ GLC  G  + A+  FR ++  G    LV Y++LI 
Sbjct  341   ALRLLDSMFQKGIEPNAVTYTTLIDGLCKGGRLDDAMRTFRLMEERGHGSNLVAYSVLID  400

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G C  G+   A  L  ELV  G  P+ I Y T+M    +  + E   ++ +EM+ +    
Sbjct  401   GFCKIGKIEEAMELFRELVAKGSRPHVIIYNTLMDGYIKMGQLEVAQRLFDEMKEQNEEP  460

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             +  +Y  +++   KAG ++   D    M   G + +++ YNTLIN  CK GK  +A  ++
Sbjct  461   NVTSYTVLMNGFCKAGALEKVMDLFEEMTKQGKKPNVITYNTLINGLCKAGKFQDAKGML  520

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E   +G + D  T++ II+GL K   + EA          G   N+V +N  +  LC  
Sbjct  521   SEMCERGIEADVVTYSSIINGLRKKQQLNEARESFAYVVEKGIHPNIVTYNSNLQELCVK  580

Query  1181  GEVDYALSVFKSMDEKD----CFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             GE++ AL +   ++  D     +T S  +  + K+G F  ASEL+         +L S R
Sbjct  581   GEIEEALKLLHEINVSDIAPSAYTISLFLECVHKSGYFEKASELI--------SVLASKR  632

Query  1013  Q  1011
             Q
Sbjct  633   Q  633


 Score =   186 bits (471),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 117/415 (28%), Positives = 200/415 (48%), Gaps = 5/415 (1%)
 Frame = -1

Query  2171  DVVTYNTLITAYCCFVGIDAGYSILHRM-NEVGIKPDVITYNSLIASATRHGMLSRCLDL  1995
             D+ +   LI + C    +D    +   + +EV  KP + T N ++A+  R       L  
Sbjct  40    DLTSKEDLIKSLCKSDMVDEALELFKEVASEVTPKPSISTCNYVLATLVRVNKFQATLST  99

Query  1994  LEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCM  1815
              + + +  I+PD  + N +M+      + D A++    I   +  P  VT+N L+ GLC 
Sbjct  100   YDLINQSRIVPDLVTLNIMMNFYCETHQIDRAFQVLDQIQAFNYAPTVVTYNTLIKGLCK  159

Query  1814  NGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAIT  1635
             +     AL + +++   G  P   TY+I+I GLCNS R      L+ E++  G NP  +T
Sbjct  160   SKMVSAALRILQKMGMEGPFPNDRTYSIVIDGLCNSSRSELCLGLIGEMLQKGLNPTVVT  219

Query  1634  YTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMI  1455
             Y TI+    +  +     ++ +EM+ +G   +   Y  +I  L K G + +A      M 
Sbjct  220   YNTILAGLCKDGKIRAAKKLYKEMKNQGIRSNLLTYTALIDGLCKEGSLDEAKKLFYEMS  279

Query  1454  MNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMK  1275
                I   +V Y+ L++  C +G+  +A M++ E   +G   +  T+T ++ GLCK G + 
Sbjct  280   EKNISPSVVTYSALVHGLCAKGQWRDATMILHEMLDRGLSPNVITYTGVLGGLCKEGRLP  339

Query  1274  EALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLV  1107
             +ALR L+     G + N V +   IDGLCK G +D A+  F+ M+E+    +   YS L+
Sbjct  340   QALRLLDSMFQKGIEPNAVTYTTLIDGLCKGGRLDDAMRTFRLMEERGHGSNLVAYSVLI  399

Query  1106  HGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELK  942
              G CK G+   A EL    +  G +        ++DG    G ++ A++L  E+K
Sbjct  400   DGFCKIGKIEEAMELFRELVAKGSRPHVIIYNTLMDGYIKMGQLEVAQRLFDEMK  454


 Score =   177 bits (448),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 119/476 (25%), Positives = 213/476 (45%), Gaps = 40/476 (8%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIID-GIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVG  2076
             +  LCK+  +++A  +  +    V     + T N ++          A  S    +N+  
Sbjct  48    IKSLCKSDMVDEALELFKEVASEVTPKPSISTCNYVLATLVRVNKFQATLSTYDLINQSR  107

Query  2075  IKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAY  1896
             I PD++T N ++        + R   +L+++      P   +YNTL+  L +      A 
Sbjct  108   IVPDLVTLNIMMNFYCETHQIDRAFQVLDQIQAFNYAPTVVTYNTLIKGLCKSKMVSAAL  167

Query  1895  RFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGL  1716
             R  Q +      P   T++I++ GLC +  +E  L L  E+   G  P +VTYN ++ GL
Sbjct  168   RILQKMGMEGPFPNDRTYSIVIDGLCNSSRSELCLGLIGEMLQKGLNPTVVTYNTILAGL  227

Query  1715  CNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDS  1536
             C  G+   A++L  E+ + G   N +TYT ++    +    +E  ++  EM  K      
Sbjct  228   CKDGKIRAAKKLYKEMKNQGIRSNLLTYTALIDGLCKEGSLDEAKKLFYEMSEKNISPSV  287

Query  1535  FAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVE  1356
               Y  ++  L   G+ +DA   +  M+  G+  +++ Y  ++   CKEG+L  A  L+  
Sbjct  288   VTYSALVHGLCAKGQWRDATMILHEMLDRGLSPNVITYTGVLGGLCKEGRLPQALRLLDS  347

Query  1355  AERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGE  1176
               +KG + +  T+T +IDGLCK G + +A+R     +  G  SNLVA++  IDG CK+G+
Sbjct  348   MFQKGIEPNAVTYTTLIDGLCKGGRLDDAMRTFRLMEERGHGSNLVAYSVLIDGFCKIGK  407

Query  1175  VDYALSVFKSM---------------------------------------DEKDCFTYSS  1113
             ++ A+ +F+ +                                       +E +  +Y+ 
Sbjct  408   IEEAMELFRELVAKGSRPHVIIYNTLMDGYIKMGQLEVAQRLFDEMKEQNEEPNVTSYTV  467

Query  1112  LVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             L++G CKAG      +L       G K        +I+GL  +G  Q+A+ + SE+
Sbjct  468   LMNGFCKAGALEKVMDLFEEMTKQGKKPNVITYNTLINGLCKAGKFQDAKGMLSEM  523


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 96/207 (46%), Gaps = 0/207 (0%)
 Frame = -1

Query  2285  SRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGY  2106
             SR    + N  +    K  QLE A+ +  +        +V +Y  L+  +C    ++   
Sbjct  423   SRPHVIIYNTLMDGYIKMGQLEVAQRLFDEMKEQNEEPNVTSYTVLMNGFCKAGALEKVM  482

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
              +   M + G KP+VITYN+LI    + G       +L EM E GI  D  +Y+++++ L
Sbjct  483   DLFEEMTKQGKKPNVITYNTLINGLCKAGKFQDAKGMLSEMCERGIEADVVTYSSIINGL  542

Query  1925  FRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
              +  + +EA   F  +    I P  VT+N  L  LC+ G  E+AL L  E+  S   P  
Sbjct  543   RKKQQLNEARESFAYVVEKGIHPNIVTYNSNLQELCVKGEIEEALKLLHEINVSDIAPSA  602

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELV  1665
              T ++ +  +  SG +  A  L++ L 
Sbjct  603   YTISLFLECVHKSGYFEKASELISVLA  629



>emb|CCD31439.1| RNA processing factor 3 [Arabidopsis thaliana]
 emb|CED92694.1| PPR protein [Arabidopsis thaliana]
Length=629

 Score =   225 bits (573),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 132/444 (30%), Positives = 229/444 (52%), Gaps = 4/444 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI + C C+  QL  A  V+   +++G   D+VT ++L+  YC    I    +++ +M E
Sbjct  119   NILINCFCRRSQLPLALAVLGKMMKLGYEPDIVTLSSLLNGYCHSKRISDAVALVDQMVE  178

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G KPD +T+N+LI     H   S  + L+++M++ G  PD  +Y  +++ L + G  D 
Sbjct  179   MGYKPDTVTFNTLIHGLFLHNKASEAVALVDQMVQRGCQPDLVTYGAVVNGLCKRGDIDL  238

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A    + +  G I    V +N ++ GLC   + + A  LF +++  G  P + TYN LI 
Sbjct  239   ALSLLKKMEKGKIEADVVIYNTIIDGLCKYKHIDDAFALFNKMETKGIRPDVFTYNSLIS  298

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LCN GRW+ A RLL+ +++   NPN +T++ ++    +  +  E  ++ +EM ++    
Sbjct  299   CLCNYGRWSDASRLLSNMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDP  358

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D F Y ++I+      R+ +A      MI      ++V YNTLI  +CK  +++    L 
Sbjct  359   DIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELF  418

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E  ++G   +  T+  +I GL +AG+   A +        G   +++ ++  +DGLCK 
Sbjct  419   REMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKY  478

Query  1181  GEVDYALSVF----KSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G+++ AL VF    KS  E D +TY+ ++ G+CKAG+     +L  S  + G+K      
Sbjct  479   GKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVIIY  538

Query  1013  QAVIDGLQHSGFIQEARKLHSELK  942
               +I G    G  +EA  L  E+K
Sbjct  539   TTMISGFCRKGLKEEADALFREMK  562


 Score =   197 bits (500),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 127/474 (27%), Positives = 227/474 (48%), Gaps = 26/474 (5%)
 Frame = -1

Query  2414  CYLRRSQSSPRLPLAASAL----------------QLATRTCPMLRLGD*--HLE*MFRI  2289
             C+ RRSQ    LPLA + L                 L    C   R+ D    ++ M  +
Sbjct  124   CFCRRSQ----LPLALAVLGKMMKLGYEPDIVTLSSLLNGYCHSKRISDAVALVDQMVEM  179

Query  2288  KSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAG  2109
               +  T   N  +  L    +  +A  ++   ++ G   D+VTY  ++   C    ID  
Sbjct  180   GYKPDTVTFNTLIHGLFLHNKASEAVALVDQMVQRGCQPDLVTYGAVVNGLCKRGDIDLA  239

Query  2108  YSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHC  1929
              S+L +M +  I+ DV+ YN++I    ++  +     L  +M   GI PD ++YN+L+ C
Sbjct  240   LSLLKKMEKGKIEADVVIYNTIIDGLCKYKHIDDAFALFNKMETKGIRPDVFTYNSLISC  299

Query  1928  LFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQ  1749
             L   G+  +A R   ++    I P  VTF+ L+      G   +A  L+ E+      P 
Sbjct  300   LCNYGRWSDASRLLSNMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPD  359

Query  1748  LVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILE  1569
             + TY+ LI+G C   R   A+ +   ++     PN +TY T++K   +++R EEG+++  
Sbjct  360   IFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELFR  419

Query  1568  EMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEG  1389
             EM ++G + ++  Y T+I  L +AG    A      M+ +G+  D++ Y+ L++  CK G
Sbjct  420   EMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKYG  479

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
             KL+ A ++    ++   + D YT+ I+I+G+CKAG +++         L G   N++ + 
Sbjct  480   KLEKALVVFEYLQKSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVIIYT  539

Query  1208  CCIDGLCKVGEVDYALSVFKSMDE----KDCFTYSSLVHGLCKAGRFRVASELL  1059
               I G C+ G  + A ++F+ M E     D   Y++L+    + G    ++EL+
Sbjct  540   TMISGFCRKGLKEEADALFREMKEDGTLPDSGCYNTLIRARLRDGDKAASAELI  593


 Score =   160 bits (405),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 94/343 (27%), Positives = 174/343 (51%), Gaps = 0/343 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCK K ++ A  +       G+  DV TYN+LI+  C +        +L  M E
Sbjct  259   NTIIDGLCKYKHIDDAFALFNKMETKGIRPDVFTYNSLISCLCNYGRWSDASRLLSNMIE  318

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I P+V+T+++LI +  + G L     L +EM++  I PD ++Y++L++      + DE
Sbjct  319   RKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDE  378

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F+ +   D  P  VT+N L+ G C     E+ + LFRE+   G +   VTYN LI 
Sbjct  379   AKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLIQ  438

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GL  +G    A+++  ++V  G  P+ ITY+ ++    +  + E+ L + E +++     
Sbjct  439   GLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEP  498

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D + Y  +I  + KAG+++D +D   ++ + G++ +++ Y T+I+ +C++G  + A  L 
Sbjct  499   DIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALF  558

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF  1233
              E +  G   D   +  +I    + G+   +   +   +  GF
Sbjct  559   REMKEDGTLPDSGCYNTLIRARLRDGDKAASAELIKEMRSCGF  601


 Score =   150 bits (380),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/295 (31%), Positives = 151/295 (51%), Gaps = 1/295 (0%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             +    K  +L +AE +  + I+  +  D+ TY++LI  +C    +D    +   M     
Sbjct  332   IDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDC  391

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
              P+V+TYN+LI    +   +   ++L  EM + G++ +T +YNTL+  LF+ G  D A +
Sbjct  392   FPNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQK  451

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
              F+ +    +PP  +T++ILL GLC  G  EKAL++F  L+ S   P + TYNI+I G+C
Sbjct  452   IFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMC  511

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
              +G+      L   L   G  PN I YTT++    R    EE   +  EM+  G + DS 
Sbjct  512   KAGKVEDGWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTLPDSG  571

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
              Y T+I   ++ G    + + +  M   G   D    + +IN+   +G+L+ +Y+
Sbjct  572   CYNTLIRARLRDGDKAASAELIKEMRSCGFVGDASTISMVINM-LHDGRLEKSYL  625


 Score =   120 bits (302),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 84/295 (28%), Positives = 145/295 (49%), Gaps = 4/295 (1%)
 Frame = -1

Query  1817  MNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAI  1638
             +N   + A+ LF E+  S  +P +V +N L+  +    ++     L   + ++  + +  
Sbjct  57    LNLKLDDAIGLFGEMVQSRPLPSIVEFNKLLSAIAKMKKFDLVISLGERMQNLRISYDLY  116

Query  1637  TYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNM  1458
             +Y  ++ C  R  +    L +L +M + GY  D     ++++    + R+ DA   V  M
Sbjct  117   SYNILINCFCRRSQLPLALAVLGKMMKLGYEPDIVTLSSLLNGYCHSKRISDAVALVDQM  176

Query  1457  IMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNM  1278
             +  G + D V +NTLI+      K   A  LV +  ++G   D  T+  +++GLCK G++
Sbjct  177   VEMGYKPDTVTFNTLIHGLFLHNKASEAVALVDQMVQRGCQPDLVTYGAVVNGLCKRGDI  236

Query  1277  KEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSL  1110
               AL  L   +    ++++V +N  IDGLCK   +D A ++F  M+ K    D FTY+SL
Sbjct  237   DLALSLLKKMEKGKIEADVVIYNTIIDGLCKYKHIDDAFALFNKMETKGIRPDVFTYNSL  296

Query  1109  VHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             +  LC  GR+  AS LL + I   +        A+ID     G + EA KL+ E+
Sbjct  297   ISCLCNYGRWSDASRLLSNMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEM  351


 Score =   119 bits (299),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 137/288 (48%), Gaps = 4/288 (1%)
 Frame = -1

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             K D+A   F ++      P  V FN LLS +      +  + L   +++      L +YN
Sbjct  60    KLDDAIGLFGEMVQSRPLPSIVEFNKLLSAIAKMKKFDLVISLGERMQNLRISYDLYSYN  119

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             ILI+  C   +   A  +L +++ +GY P+ +T ++++     S+R  + + ++++M   
Sbjct  120   ILINCFCRRSQLPLALAVLGKMMKLGYEPDIVTLSSLLNGYCHSKRISDAVALVDQMVEM  179

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
             GY  D+  + T+I  L    +  +A   V  M+  G + DLV Y  ++N  CK G +D A
Sbjct  180   GYKPDTVTFNTLIHGLFLHNKASEAVALVDQMVQRGCQPDLVTYGAVVNGLCKRGDIDLA  239

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               L+ + E+   + D   +  IIDGLCK  ++ +A    N  +  G   ++  +N  I  
Sbjct  240   LSLLKKMEKGKIEADVVIYNTIIDGLCKYKHIDDAFALFNKMETKGIRPDVFTYNSLISC  299

Query  1193  LCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASEL  1062
             LC  G    A  +  +M E+    +  T+S+L+    K G+   A +L
Sbjct  300   LCNYGRWSDASRLLSNMIERKINPNVVTFSALIDAFVKEGKLVEAEKL  347


 Score =   112 bits (280),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 113/230 (49%), Gaps = 0/230 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +   CKAK++E+   +  +  + G+  + VTYNTLI         D    I  +M  
Sbjct  399   NTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVS  458

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G+ PD+ITY+ L+    ++G L + L + E + +  + PD ++YN ++  + + GK ++
Sbjct  459   DGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMCKAGKVED  518

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
              +  F  +    + P  + +  ++SG C  G  E+A  LFRE+K  G +P    YN LI 
Sbjct  519   GWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTLPDSGCYNTLIR  578

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQIL  1572
                  G  A +  L+ E+   G+  +A T + ++      R  +  L++L
Sbjct  579   ARLRDGDKAASAELIKEMRSCGFVGDASTISMVINMLHDGRLEKSYLEML  628



>ref|XP_006828472.1| hypothetical protein AMTR_s00060p00144370 [Amborella trichopoda]
 gb|ERM95888.1| hypothetical protein AMTR_s00060p00144370 [Amborella trichopoda]
Length=548

 Score =   223 bits (568),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 139/443 (31%), Positives = 226/443 (51%), Gaps = 5/443 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  ++  CK      A+ ++     +    D+V+YN+LI  YC F  ++   S+ + +  
Sbjct  57    NAIISLFCKFGSFSGAQHLLSIMPNIQCEPDIVSYNSLINGYCQFRKLNEATSVFNTIQR  116

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
                KPDVITYN LI    ++G L   L  L  M ++   PD  +Y+T +  L +L K DE
Sbjct  117   GAYKPDVITYNILINGYCKYGKLKEVLVFLASMWKI-YTPDVVTYSTFIDALCKLNKLDE  175

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F+D+    I P  V+F  L+ G C +G  +KA  L+  +  S   P +VTYN+L++
Sbjct  176   ADYAFRDMSIVGISPNFVSFTSLIDGYCKSGSIDKAFKLYDNMLKSSISPSVVTYNVLLN  235

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC  G    + +L  ++++ G  PNA+ YT+++   F+    +E +  +++M  +G   
Sbjct  236   GLCKQGLMERSEQLFMQMLERGVIPNAVIYTSLIDGHFKRGNVDEAMGYVKKMLHQGIKL  295

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D  AY  +I  L K G++ +A   +  M   G+  D + + TLI+ + KEG +  A+  V
Sbjct  296   DVQAYGAIIWGLCKKGQLCEAEGLMVEMEKRGLWPDKLIFTTLIDAHFKEGNMIKAFGFV  355

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E  ++GFD D    + ++DGLCK G + EA  HL         +N V +   IDGLCK 
Sbjct  356   NETLKRGFDFDTVMISSLMDGLCKHGRLDEAKEHLKRLNQANAPANEVTYTVLIDGLCKE  415

Query  1181  GEVDYALSVFKSMDE----KDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G +  A  V K M E     D F Y+S +  LCK G    A +L  + +  G+       
Sbjct  416   GSLSEAELVLKEMLEAGLIPDKFVYTSWIAELCKQGNMVEALKLKKAMLEKGITPDLLTF  475

Query  1013  QAVIDGLQHSGFIQEARKLHSEL  945
              +++ GL + GF+ EA  + +++
Sbjct  476   TSLVWGLANKGFMIEAELVFNDM  498


 Score =   161 bits (407),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 122/418 (29%), Positives = 191/418 (46%), Gaps = 42/418 (10%)
 Frame = -1

Query  2078  GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLM--HCLFRLGKPD  1905
             G  P + + N++I+   + G  S    LL  M  +   PD  SYN+L+  +C FR  K +
Sbjct  48    GYHPHLSSCNAIISLFCKFGSFSGAQHLLSIMPNIQCEPDIVSYNSLINGYCQFR--KLN  105

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALML--------------------  1785
             EA   F  I  G   P  +T+NIL++G C  G  ++ L+                     
Sbjct  106   EATSVFNTIQRGAYKPDVITYNILINGYCKYGKLKEVLVFLASMWKIYTPDVVTYSTFID  165

Query  1784  --------------FRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNP  1647
                           FR++   G  P  V++  LI G C SG    A +L + ++    +P
Sbjct  166   ALCKLNKLDEADYAFRDMSIVGISPNFVSFTSLIDGYCKSGSIDKAFKLYDNMLKSSISP  225

Query  1646  NAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCV  1467
             + +TY  ++    +    E   Q+  +M  +G I ++  Y ++I    K G + +A   V
Sbjct  226   SVVTYNVLLNGLCKQGLMERSEQLFMQMLERGVIPNAVIYTSLIDGHFKRGNVDEAMGYV  285

Query  1466  GNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKA  1287
               M+  GI+LD+ AY  +I   CK+G+L  A  L+VE E++G   DK   T +ID   K 
Sbjct  286   KKMLHQGIKLDVQAYGAIIWGLCKKGQLCEAEGLMVEMEKRGLWPDKLIFTTLIDAHFKE  345

Query  1286  GNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDC----FTY  1119
             GNM +A   +N T   GFD + V  +  +DGLCK G +D A    K +++ +      TY
Sbjct  346   GNMIKAFGFVNETLKRGFDFDTVMISSLMDGLCKHGRLDEAKEHLKRLNQANAPANEVTY  405

Query  1118  SSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             + L+ GLCK G    A  +L   +  G+   K    + I  L   G + EA KL   +
Sbjct  406   TVLIDGLCKEGSLSEAELVLKEMLEAGLIPDKFVYTSWIAELCKQGNMVEALKLKKAM  463


 Score =   156 bits (395),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 110/401 (27%), Positives = 174/401 (43%), Gaps = 39/401 (10%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             +  LCK  +L++A+    D   VG+  + V++ +LI  YC    ID  + +   M +  I
Sbjct  164   IDALCKLNKLDEADYAFRDMSIVGISPNFVSFTSLIDGYCKSGSIDKAFKLYDNMLKSSI  223

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
              P V+TYN L+    + G++ R   L  +MLE G++P+   Y +L+   F+ G  DEA  
Sbjct  224   SPSVVTYNVLLNGLCKQGLMERSEQLFMQMLERGVIPNAVIYTSLIDGHFKRGNVDEAM-  282

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
                                        GY +K L       H G    +  Y  +I GLC
Sbjct  283   ---------------------------GYVKKML-------HQGIKLDVQAYGAIIWGLC  308

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
               G+   A  L+ E+   G  P+ + +TT++   F+     +    + E  ++G+ FD+ 
Sbjct  309   KKGQLCEAEGLMVEMEKRGLWPDKLIFTTLIDAHFKEGNMIKAFGFVNETLKRGFDFDTV  368

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
                +++  L K GR+ +A + +  +       + V Y  LI+  CKEG L  A +++ E 
Sbjct  369   MISSLMDGLCKHGRLDEAKEHLKRLNQANAPANEVTYTVLIDGLCKEGSLSEAELVLKEM  428

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEV  1173
                G   DK+ +T  I  LCK GNM EAL+        G   +L+ F   + GL   G +
Sbjct  429   LEAGLIPDKFVYTSWIAELCKQGNMVEALKLKKAMLEKGITPDLLTFTSLVWGLANKGFM  488

Query  1172  DYALSVFKSM----DEKDCFTYSSLVHGLCKAGRFRVASEL  1062
               A  VF  M     E D   Y  L+ G  K      A  L
Sbjct  489   IEAELVFNDMLCRGIEPDFAVYDVLIRGYLKQNNMSEAIRL  529


 Score =   128 bits (321),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/320 (27%), Positives = 148/320 (46%), Gaps = 2/320 (1%)
 Frame = -1

Query  2291  IKSRLSTKLL--NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGI  2118
             +KS +S  ++  N+ +  LCK   +E++E + +  +  GV  + V Y +LI  +     +
Sbjct  219   LKSSISPSVVTYNVLLNGLCKQGLMERSEQLFMQMLERGVIPNAVIYTSLIDGHFKRGNV  278

Query  2117  DAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTL  1938
             D     + +M   GIK DV  Y ++I    + G L     L+ EM + G+ PD   + TL
Sbjct  279   DEAMGYVKKMLHQGIKLDVQAYGAIIWGLCKKGQLCEAEGLMVEMEKRGLWPDKLIFTTL  338

Query  1937  MHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGF  1758
             +   F+ G   +A+ F  +          V  + L+ GLC +G  ++A    + L  +  
Sbjct  339   IDAHFKEGNMIKAFGFVNETLKRGFDFDTVMISSLMDGLCKHGRLDEAKEHLKRLNQANA  398

Query  1757  IPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQ  1578
                 VTY +LI GLC  G  + A  +L E+++ G  P+   YT+ +    +     E L+
Sbjct  399   PANEVTYTVLIDGLCKEGSLSEAELVLKEMLEAGLIPDKFVYTSWIAELCKQGNMVEALK  458

Query  1577  ILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYC  1398
             + + M  KG   D   + +++  L   G M +A     +M+  GIE D   Y+ LI  Y 
Sbjct  459   LKKAMLEKGITPDLLTFTSLVWGLANKGFMIEAELVFNDMLCRGIEPDFAVYDVLIRGYL  518

Query  1397  KEGKLDNAYMLVVEAERKGF  1338
             K+  +  A  L  + + +G 
Sbjct  519   KQNNMSEAIRLQDDMKERGL  538


 Score =   112 bits (279),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 92/338 (27%), Positives = 147/338 (43%), Gaps = 12/338 (4%)
 Frame = -1

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             L+H L R      A + F D+      P   + N ++S  C  G    A  L   + +  
Sbjct  24    LIHQLMRSNCEQLALKIFSDLVGNGYHPHLSSCNAIISLFCKFGSFSGAQHLLSIMPNIQ  83

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P +V+YN LI+G C   +   A  + N +    Y P+ ITY  ++    +  + +E L
Sbjct  84    CEPDIVSYNSLINGYCQFRKLNEATSVFNTIQRGAYKPDVITYNILINGYCKYGKLKEVL  143

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
               L  M  K Y  D   Y T I  L K  ++ +A     +M + GI  + V++ +LI+ Y
Sbjct  144   VFLASM-WKIYTPDVVTYSTFIDALCKLNKLDEADYAFRDMSIVGISPNFVSFTSLIDGY  202

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CK G +D A+ L     +        T+ ++++GLCK G M+ + +        G   N 
Sbjct  203   CKSGSIDKAFKLYDNMLKSSISPSVVTYNVLLNGLCKQGLMERSEQLFMQMLERGVIPNA  262

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLS  1053
             V +   IDG  K G VD A+   K M  +    D   Y +++ GLCK G+   A  L++ 
Sbjct  263   VIYTSLIDGHFKRGNVDEAMGYVKKMLHQGIKLDVQAYGAIIWGLCKKGQLCEAEGLMVE  322

Query  1052  CIIGGMKILKSDRQAVIDG-------LQHSGFIQEARK  960
                 G+   K     +ID        ++  GF+ E  K
Sbjct  323   MEKRGLWPDKLIFTTLIDAHFKEGNMIKAFGFVNETLK  360


 Score =   106 bits (265),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 84/326 (26%), Positives = 154/326 (47%), Gaps = 8/326 (2%)
 Frame = -1

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             +EA +FF     G   P     + L+  L  +   + AL +F +L  +G+ P L + N +
Sbjct  3     EEALQFFAQARRGKRFP---EVSRLIHQLMRSNCEQLALKIFSDLVGNGYHPHLSSCNAI  59

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             I   C  G ++ A+ LL+ + +I   P+ ++Y +++    + R+  E   +   ++R  Y
Sbjct  60    ISLFCKFGSFSGAQHLLSIMPNIQCEPDIVSYNSLINGYCQFRKLNEATSVFNTIQRGAY  119

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
               D   Y  +I+   K G++K+    + +M       D+V Y+T I+  CK  KLD A  
Sbjct  120   KPDVITYNILINGYCKYGKLKEVLVFLASM-WKIYTPDVVTYSTFIDALCKLNKLDEADY  178

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLC  1188
                +    G   +  + T +IDG CK+G++ +A +  +         ++V +N  ++GLC
Sbjct  179   AFRDMSIVGISPNFVSFTSLIDGYCKSGSIDKAFKLYDNMLKSSISPSVVTYNVLLNGLC  238

Query  1187  KVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             K G ++ +  +F  M E+    +   Y+SL+ G  K G    A   +   +  G+K+   
Sbjct  239   KQGLMERSEQLFMQMLERGVIPNAVIYTSLIDGHFKRGNVDEAMGYVKKMLHQGIKLDVQ  298

Query  1019  DRQAVIDGLQHSGFIQEARKLHSELK  942
                A+I GL   G + EA  L  E++
Sbjct  299   AYGAIIWGLCKKGQLCEAEGLMVEME  324


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 94/199 (47%), Gaps = 0/199 (0%)
 Frame = -1

Query  2237  KAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVI  2058
             K   + KA   + + ++ G   D V  ++L+   C    +D     L R+N+     + +
Sbjct  344   KEGNMIKAFGFVNETLKRGFDFDTVMISSLMDGLCKHGRLDEAKEHLKRLNQANAPANEV  403

Query  2057  TYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDI  1878
             TY  LI    + G LS    +L+EMLE G++PD + Y + +  L + G   EA +  + +
Sbjct  404   TYTVLIDGLCKEGSLSEAELVLKEMLEAGLIPDKFVYTSWIAELCKQGNMVEALKLKKAM  463

Query  1877  FWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRW  1698
                 I P  +TF  L+ GL   G+  +A ++F ++   G  P    Y++LI G       
Sbjct  464   LEKGITPDLLTFTSLVWGLANKGFMIEAELVFNDMLCRGIEPDFAVYDVLIRGYLKQNNM  523

Query  1697  APARRLLNELVDIGYNPNA  1641
             + A RL +++ + G  P A
Sbjct  524   SEAIRLQDDMKERGLLPIA  542


 Score = 83.6 bits (205),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 112/246 (46%), Gaps = 0/246 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             +L  +     +  LCK  QL +AE ++++  + G+  D + + TLI A+     +   + 
Sbjct  294   KLDVQAYGAIIWGLCKKGQLCEAEGLMVEMEKRGLWPDKLIFTTLIDAHFKEGNMIKAFG  353

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
              ++   + G   D +  +SL+    +HG L    + L+ + +     +  +Y  L+  L 
Sbjct  354   FVNETLKRGFDFDTVMISSLMDGLCKHGRLDEAKEHLKRLNQANAPANEVTYTVLIDGLC  413

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             + G   EA    +++    + P    +   ++ LC  G   +AL L + +   G  P L+
Sbjct  414   KEGSLSEAELVLKEMLEAGLIPDKFVYTSWIAELCKQGNMVEALKLKKAMLEKGITPDLL  473

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             T+  L+ GL N G    A  + N+++  G  P+   Y  +++   +     E +++ ++M
Sbjct  474   TFTSLVWGLANKGFMIEAELVFNDMLCRGIEPDFAVYDVLIRGYLKQNNMSEAIRLQDDM  533

Query  1562  RRKGYI  1545
             + +G +
Sbjct  534   KERGLL  539


 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 76/164 (46%), Gaps = 0/164 (0%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             LCK  +L++A+  +    +   PA+ VTY  LI   C    +     +L  M E G+ PD
Sbjct  377   LCKHGRLDEAKEHLKRLNQANAPANEVTYTVLIDGLCKEGSLSEAELVLKEMLEAGLIPD  436

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
                Y S IA   + G +   L L + MLE GI PD  ++ +L+  L   G   EA   F 
Sbjct  437   KFVYTSWIAELCKQGNMVEALKLKKAMLEKGITPDLLTFTSLVWGLANKGFMIEAELVFN  496

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIP  1752
             D+    I P    +++L+ G        +A+ L  ++K  G +P
Sbjct  497   DMLCRGIEPDFAVYDVLIRGYLKQNNMSEAIRLQDDMKERGLLP  540


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 100/224 (45%), Gaps = 6/224 (3%)
 Frame = -1

Query  1592  EEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTL  1413
             EE LQ   + RR G  F   +   +I  L+++   + A     +++ NG    L + N +
Sbjct  3     EEALQFFAQARR-GKRFPEVS--RLIHQLMRSNCEQLALKIFSDLVGNGYHPHLSSCNAI  59

Query  1412  INLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF  1233
             I+L+CK G    A  L+        + D  ++  +I+G C+   + EA    N  +   +
Sbjct  60    ISLFCKFGSFSGAQHLLSIMPNIQCEPDIVSYNSLINGYCQFRKLNEATSVFNTIQRGAY  119

Query  1232  DSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE---KDCFTYSSLVHGLCKAGRFRVASEL  1062
               +++ +N  I+G CK G++   L    SM +    D  TYS+ +  LCK  +   A   
Sbjct  120   KPDVITYNILINGYCKYGKLKEVLVFLASMWKIYTPDVVTYSTFIDALCKLNKLDEADYA  179

Query  1061  LLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
                  I G+        ++IDG   SG I +A KL+  +  S I
Sbjct  180   FRDMSIVGISPNFVSFTSLIDGYCKSGSIDKAFKLYDNMLKSSI  223


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/145 (25%), Positives = 62/145 (43%), Gaps = 0/145 (0%)
 Frame = -1

Query  2312  HLE*MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYC  2133
             HL+ + +  +  +     + +  LCK   L +AE V+ + +  G+  D   Y + I   C
Sbjct  389   HLKRLNQANAPANEVTYTVLIDGLCKEGSLSEAELVLKEMLEAGLIPDKFVYTSWIAELC  448

Query  2132  CFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTW  1953
                 +     +   M E GI PD++T+ SL+      G +     +  +ML  GI PD  
Sbjct  449   KQGNMVEALKLKKAMLEKGITPDLLTFTSLVWGLANKGFMIEAELVFNDMLCRGIEPDFA  508

Query  1952  SYNTLMHCLFRLGKPDEAYRFFQDI  1878
              Y+ L+    +     EA R   D+
Sbjct  509   VYDVLIRGYLKQNNMSEAIRLQDDM  533



>ref|XP_002962761.1| hypothetical protein SELMODRAFT_165305 [Selaginella moellendorffii]
 gb|EFJ36224.1| hypothetical protein SELMODRAFT_165305 [Selaginella moellendorffii]
Length=707

 Score =   226 bits (576),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 141/443 (32%), Positives = 228/443 (51%), Gaps = 7/443 (2%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI +  LCKA + +KA  ++ + +  GV  D VT+N+++   C     +  +S+L  M E
Sbjct  14    NILIDGLCKASKTDKASEMLHEMVDRGVTPDTVTFNSIMDGLCKAGKFERAHSLLAVMAE  73

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
                +P   TYN+LI+   +   + R   L++E +  G +PD  +Y+ L   L + G+ DE
Sbjct  74    RNCRPSCCTYNTLISGLCKQQNVDRAKTLVDEFVSSGFVPDVVTYSILADGLCKRGRIDE  133

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A+   +++      P  VT+N L+ GLC    TEKA  L   L  SGF+P +VTY I++ 
Sbjct  134   AFELVKEMSGNGCTPNLVTYNTLIDGLCKASKTEKAYELLETLVSSGFVPDVVTYTIIVD  193

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC  GR   A +++  ++  G  P+ ITYT +M+   R+ R +E   I +EM  K    
Sbjct  194   GLCKEGRLDKALKMVEGMLKRGCTPSVITYTALMEGLCRTGRVDEAHHIFKEMVSKDCTA  253

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D+ AY ++++   K+ R K+A   V + I     +D+  YN L++ YCKEG+LD    + 
Sbjct  254   DALAYVSLVNGYCKSSRTKEAQKVV-DGIRGTPYIDV--YNALMDGYCKEGRLDEIPNVF  310

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              +   +G   +  T+ I++DGLCK G + EA   L      G   ++V++N  IDGL K 
Sbjct  311   EDMACRGCVPNIKTYNIVMDGLCKHGKVDEAFPFLESMHSAGCVPDVVSYNIIIDGLFKA  370

Query  1181  GEVDYALSVFKSMDE----KDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
              +   A  V   M +     D  TY++L+   CK  RF  A  +L + I  G+       
Sbjct  371   SKPKEARQVLDQMIQAGIPPDAVTYNTLMAQFCKEERFDDAVGILKNMIKAGVDPDNVTY  430

Query  1013  QAVIDGLQHSGFIQEARKLHSEL  945
               +I GL  +  + +A +L  E+
Sbjct  431   NTLISGLSQTNRLGDAYELMHEM  453


 Score =   206 bits (523),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 137/464 (30%), Positives = 224/464 (48%), Gaps = 35/464 (8%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             LCK  ++++A  ++ +    G   ++VTYNTLI   C     +  Y +L  +   G  PD
Sbjct  125   LCKRGRIDEAFELVKEMSGNGCTPNLVTYNTLIDGLCKASKTEKAYELLETLVSSGFVPD  184

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             V+TY  ++    + G L + L ++E ML+ G  P   +Y  LM  L R G+ DEA+  F+
Sbjct  185   VVTYTIIVDGLCKEGRLDKALKMVEGMLKRGCTPSVITYTALMEGLCRTGRVDEAHHIFK  244

Query  1883  DIFWGDIP--------------------------------PCPVTFNILLSGLCMNGYTE  1800
             ++   D                                  P    +N L+ G C  G  +
Sbjct  245   EMVSKDCTADALAYVSLVNGYCKSSRTKEAQKVVDGIRGTPYIDVYNALMDGYCKEGRLD  304

Query  1799  KALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIM  1620
             +   +F ++   G +P + TYNI++ GLC  G+   A   L  +   G  P+ ++Y  I+
Sbjct  305   EIPNVFEDMACRGCVPNIKTYNIVMDGLCKHGKVDEAFPFLESMHSAGCVPDVVSYNIII  364

Query  1619  KCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE  1440
                F++ + +E  Q+L++M + G   D+  Y T+++   K  R  DA   + NMI  G++
Sbjct  365   DGLFKASKPKEARQVLDQMIQAGIPPDAVTYNTLMAQFCKEERFDDAVGILKNMIKAGVD  424

Query  1439  LDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDK-YTHTIIIDGLCKAGNMKEALR  1263
              D V YNTLI+   +  +L +AY L+ E  R G       T+  IID LCK G +K+AL 
Sbjct  425   PDNVTYNTLISGLSQTNRLGDAYELMHEMLRNGCVVSACTTYNTIIDRLCKEGCLKQALL  484

Query  1262  HLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE-KDCFTYSSLVHGLCKAG  1086
              ++     G ++N V +N  ID LCK G +D A S+   MD  +D  +Y++++ GLCKA 
Sbjct  485   LMDHMTGHGVEANTVTYNIFIDRLCKEGRLDEASSLLSEMDTLRDEVSYTTVIIGLCKAE  544

Query  1085  RFRVASELLLSCI-IGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
             +   AS+L    + + G+ I       +ID    +  + EA  L
Sbjct  545   QLDRASKLAREMVAVKGLCITSHTFNLLIDAFTKTKRLDEALTL  588


 Score =   195 bits (496),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 194/386 (50%), Gaps = 7/386 (2%)
 Frame = -1

Query  2090  MNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGK  1911
             MNE  + PDV TYN LI    +     +  ++L EM++ G+ PDT ++N++M  L + GK
Sbjct  1     MNERKVAPDVFTYNILIDGLCKASKTDKASEMLHEMVDRGVTPDTVTFNSIMDGLCKAGK  60

Query  1910  PDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNI  1731
              + A+     +   +  P   T+N L+SGLC     ++A  L  E   SGF+P +VTY+I
Sbjct  61    FERAHSLLAVMAERNCRPSCCTYNTLISGLCKQQNVDRAKTLVDEFVSSGFVPDVVTYSI  120

Query  1730  LIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKG  1551
             L  GLC  GR   A  L+ E+   G  PN +TY T++    ++ + E+  ++LE +   G
Sbjct  121   LADGLCKRGRIDEAFELVKEMSGNGCTPNLVTYNTLIDGLCKASKTEKAYELLETLVSSG  180

Query  1550  YIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAY  1371
             ++ D   Y  ++  L K GR+  A   V  M+  G    ++ Y  L+   C+ G++D A+
Sbjct  181   FVPDVVTYTIIVDGLCKEGRLDKALKMVEGMLKRGCTPSVITYTALMEGLCRTGRVDEAH  240

Query  1370  MLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGL  1191
              +  E   K    D   +  +++G CK+   KEA + ++  +   +   +  +N  +DG 
Sbjct  241   HIFKEMVSKDCTADALAYVSLVNGYCKSSRTKEAQKVVDGIRGTPY---IDVYNALMDGY  297

Query  1190  CKVGEVDYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             CK G +D   +VF+ M  + C     TY+ ++ GLCK G+   A   L S    G     
Sbjct  298   CKEGRLDEIPNVFEDMACRGCVPNIKTYNIVMDGLCKHGKVDEAFPFLESMHSAGCVPDV  357

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSEL  945
                  +IDGL  +   +EAR++  ++
Sbjct  358   VSYNIIIDGLFKASKPKEARQVLDQM  383


 Score =   182 bits (461),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 139/512 (27%), Positives = 227/512 (44%), Gaps = 70/512 (14%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCKA + EKA  ++   +  G   DVVTY  ++   C    +D    ++  M +
Sbjct  154   NTLIDGLCKASKTEKAYELLETLVSSGFVPDVVTYTIIVDGLCKEGRLDKALKMVEGMLK  213

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSY---------------  1947
              G  P VITY +L+    R G +     + +EM+      D  +Y               
Sbjct  214   RGCTPSVITYTALMEGLCRTGRVDEAHHIFKEMVSKDCTADALAYVSLVNGYCKSSRTKE  273

Query  1946  -----------------NTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLC  1818
                              N LM    + G+ DE    F+D+      P   T+NI++ GLC
Sbjct  274   AQKVVDGIRGTPYIDVYNALMDGYCKEGRLDEIPNVFEDMACRGCVPNIKTYNIVMDGLC  333

Query  1817  MNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAI  1638
              +G  ++A      +  +G +P +V+YNI+I GL  + +   AR++L++++  G  P+A+
Sbjct  334   KHGKVDEAFPFLESMHSAGCVPDVVSYNIIIDGLFKASKPKEARQVLDQMIQAGIPPDAV  393

Query  1637  TYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNM  1458
             TY T+M    +  RF++ + IL+ M + G   D+  Y T+IS L +  R+ DAY+ +  M
Sbjct  394   TYNTLMAQFCKEERFDDAVGILKNMIKAGVDPDNVTYNTLISGLSQTNRLGDAYELMHEM  453

Query  1457  IMNGIELDL-VAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGN  1281
             + NG  +     YNT+I+  CKEG L  A +L+      G + +  T+ I ID LCK G 
Sbjct  454   LRNGCVVSACTTYNTIIDRLCKEGCLKQALLLMDHMTGHGVEANTVTYNIFIDRLCKEGR  513

Query  1280  MKEALRHLN-----------CTKLMG------------FDSNLVA----------FNCCI  1200
             + EA   L+            T ++G                +VA          FN  I
Sbjct  514   LDEASSLLSEMDTLRDEVSYTTVIIGLCKAEQLDRASKLAREMVAVKGLCITSHTFNLLI  573

Query  1199  DGLCKVGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             D   K   +D AL++ + M ++ C     TY+ ++  LCK  +   A EL     + G+ 
Sbjct  574   DAFTKTKRLDEALTLLELMVQRGCSPSVITYNMVITCLCKLDKVDKAWELFDEMAVRGIV  633

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
                     +I GL   G  +EA ++  E+  S
Sbjct  634   ASSVSYTVLIYGLCGQGRGKEALQVLEEMASS  665


 Score =   152 bits (383),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 120/435 (28%), Positives = 190/435 (44%), Gaps = 47/435 (11%)
 Frame = -1

Query  2240  CKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDV  2061
             CK+ + ++A+ V+ DGIR G P  +  YN L+  YC    +D   ++   M   G  P++
Sbjct  266   CKSSRTKEAQKVV-DGIR-GTPY-IDVYNALMDGYCKEGRLDEIPNVFEDMACRGCVPNI  322

Query  2060  ITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQD  1881
              TYN ++    +HG +      LE M   G +PD  SYN ++  LF+  KP EA +    
Sbjct  323   KTYNIVMDGLCKHGKVDEAFPFLESMHSAGCVPDVVSYNIIIDGLFKASKPKEARQVLDQ  382

Query  1880  IFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGR  1701
             +    IPP  VT+N L++  C     + A+ + + +  +G  P  VTYN LI GL  + R
Sbjct  383   MIQAGIPPDAVTYNTLMAQFCKEERFDDAVGILKNMIKAGVDPDNVTYNTLISGLSQTNR  442

Query  1700  WAPARRLLNELVDIG--------YN----------------------------PNAITYT  1629
                A  L++E++  G        YN                             N +TY 
Sbjct  443   LGDAYELMHEMLRNGCVVSACTTYNTIIDRLCKEGCLKQALLLMDHMTGHGVEANTVTYN  502

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMI-M  1452
               +    +  R +E   +L EM     + D  +Y TVI  L KA ++  A      M+ +
Sbjct  503   IFIDRLCKEGRLDEASSLLSEM---DTLRDEVSYTTVIIGLCKAEQLDRASKLAREMVAV  559

Query  1451  NGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKE  1272
              G+ +    +N LI+ + K  +LD A  L+    ++G      T+ ++I  LCK   + +
Sbjct  560   KGLCITSHTFNLLIDAFTKTKRLDEALTLLELMVQRGCSPSVITYNMVITCLCKLDKVDK  619

Query  1271  ALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDC----FTYSSLVH  1104
             A    +   + G  ++ V++   I GLC  G    AL V + M   DC         L  
Sbjct  620   AWELFDEMAVRGIVASSVSYTVLIYGLCGQGRGKEALQVLEEMASSDCEIDDLKCRKLYL  679

Query  1103  GLCKAGRFRVASELL  1059
              L   GR   A+ELL
Sbjct  680   ALRGQGRGEEAAELL  694


 Score =   149 bits (376),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 101/362 (28%), Positives = 171/362 (47%), Gaps = 14/362 (4%)
 Frame = -1

Query  2270  KLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHR  2091
             K  NI +  LCK  ++++A   +      G   DVV+YN +I              +L +
Sbjct  323   KTYNIVMDGLCKHGKVDEAFPFLESMHSAGCVPDVVSYNIIIDGLFKASKPKEARQVLDQ  382

Query  2090  MNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGK  1911
             M + GI PD +TYN+L+A   +       + +L+ M++ G+ PD  +YNTL+  L +  +
Sbjct  383   MIQAGIPPDAVTYNTLMAQFCKEERFDDAVGILKNMIKAGVDPDNVTYNTLISGLSQTNR  442

Query  1910  PDEAYRFFQDIFW-GDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
               +AY    ++   G +     T+N ++  LC  G  ++AL+L   +   G     VTYN
Sbjct  443   LGDAYELMHEMLRNGCVVSACTTYNTIIDRLCKEGCLKQALLLMDHMTGHGVEANTVTYN  502

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRR-  1557
             I I  LC  GR   A  LL+E+  +    + ++YTT++    ++ + +   ++  EM   
Sbjct  503   IFIDRLCKEGRLDEASSLLSEMDTL---RDEVSYTTVIIGLCKAEQLDRASKLAREMVAV  559

Query  1556  KGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDN  1377
             KG    S  +  +I    K  R+ +A   +  M+  G    ++ YN +I   CK  K+D 
Sbjct  560   KGLCITSHTFNLLIDAFTKTKRLDEALTLLELMVQRGCSPSVITYNMVITCLCKLDKVDK  619

Query  1376  AYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCID  1197
             A+ L  E   +G      ++T++I GLC  G  KEAL+ L           + + +C ID
Sbjct  620   AWELFDEMAVRGIVASSVSYTVLIYGLCGQGRGKEALQVLE---------EMASSDCEID  670

Query  1196  GL  1191
              L
Sbjct  671   DL  672


 Score = 95.9 bits (237),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 84/347 (24%), Positives = 138/347 (40%), Gaps = 71/347 (20%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI +  L KA + ++A  V+   I+ G+P D VTYNTL+  +C     D    IL  M +
Sbjct  361   NIIIDGLFKASKPKEARQVLDQMIQAGIPPDAVTYNTLMAQFCKEERFDDAVGILKNMIK  420

Query  2081  VGIKPDVITYNSLIASAT------------------------------------RHGMLS  2010
              G+ PD +TYN+LI+  +                                    + G L 
Sbjct  421   AGVDPDNVTYNTLISGLSQTNRLGDAYELMHEMLRNGCVVSACTTYNTIIDRLCKEGCLK  480

Query  2009  RCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ--DIFWGDIPPCPV----  1848
             + L L++ M   G+  +T +YN  +  L + G+ DEA       D    ++    V    
Sbjct  481   QALLLMDHMTGHGVEANTVTYNIFIDRLCKEGRLDEASSLLSEMDTLRDEVSYTTVIIGL  540

Query  1847  ---------------------------TFNILLSGLCMNGYTEKALMLFRELKHSGFIPQ  1749
                                        TFN+L+         ++AL L   +   G  P 
Sbjct  541   CKAEQLDRASKLAREMVAVKGLCITSHTFNLLIDAFTKTKRLDEALTLLELMVQRGCSPS  600

Query  1748  LVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILE  1569
             ++TYN++I  LC   +   A  L +E+   G   ++++YT ++       R +E LQ+LE
Sbjct  601   VITYNMVITCLCKLDKVDKAWELFDEMAVRGIVASSVSYTVLIYGLCGQGRGKEALQVLE  660

Query  1568  EMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMI--MNGIELD  1434
             EM       D      +   L   GR ++A + +  M   M+ + LD
Sbjct  661   EMASSDCEIDDLKCRKLYLALRGQGRGEEAAELLRRMTTKMDSLSLD  707



>gb|KDP42578.1| hypothetical protein JCGZ_24352 [Jatropha curcas]
Length=662

 Score =   225 bits (574),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/403 (33%), Positives = 211/403 (52%), Gaps = 4/403 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             LN  +  LC   + ++A  +  + +  G   DV TYN ++ A C     +  + IL RM 
Sbjct  48    LNTLINGLCSEDRFDEAVELFDEMVAKGYQPDVYTYNVIVNALCKIRKTNVAFGILKRMV  107

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             E G +PDV++YN++I S  +  +++  L+L  +M   GI P   +YN+L++ L    +  
Sbjct  108   EEGCEPDVVSYNAIIDSLCKDRLVTEALELFLKMKSEGISPSIVTYNSLINGLCTSSRLK  167

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             EA+     +   +I P  +TF IL+ GLC  G   KA  + R +   G    LVTYN LI
Sbjct  168   EAFLLLNKMLKANIMPDLITFTILVDGLCKEGRAAKAHGIVRGMIQRGIKTDLVTYNSLI  227

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLCNSGRW  +   LNE+ +    P+ IT   ++    +  R  +   I++ M ++G  
Sbjct  228   YGLCNSGRWKESFMQLNEMSEANITPDLITLNILVDGLCKEGRVAKACGIVKLMIQRGMK  287

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D   Y ++I  L  +GR  ++   +  M+   I  +++ +N L++  CKEG++  A+ +
Sbjct  288   PDVVTYPSLIYGLCNSGRWDESSMQLNEMLEANIAPNIITFNILVDGLCKEGRVAKAHGI  347

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
             V    ++G   D  T+  +I GLC +G  +EA   LN    +    NL+ FN  +DGLCK
Sbjct  348   VKWMIQRGMKPDVVTYPSLIYGLCNSGRWEEASMQLNEMLEVNITPNLITFNILVDGLCK  407

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVAS  1068
              G V  A  + K M ++    D  TYSSL++GLC  GR+  AS
Sbjct  408   EGRVAKAHGIVKWMIQRGIKPDVVTYSSLIYGLCNLGRWEEAS  450


 Score =   218 bits (554),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 136/466 (29%), Positives = 234/466 (50%), Gaps = 26/466 (6%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCK + + +A  + +     G+   +VTYN+LI   C    +   + +L++M +
Sbjct  119   NAIIDSLCKDRLVTEALELFLKMKSEGISPSIVTYNSLINGLCTSSRLKEAFLLLNKMLK  178

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I PD+IT+  L+    + G  ++   ++  M++ GI  D  +YN+L++ L   G+  E
Sbjct  179   ANIMPDLITFTILVDGLCKEGRAAKAHGIVRGMIQRGIKTDLVTYNSLIYGLCNSGRWKE  238

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             ++    ++   +I P  +T NIL+ GLC  G   KA  + + +   G  P +VTY  LI+
Sbjct  239   SFMQLNEMSEANITPDLITLNILVDGLCKEGRVAKACGIVKLMIQRGMKPDVVTYPSLIY  298

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLCNSGRW  +   LNE+++    PN IT+  ++    +  R  +   I++ M ++G   
Sbjct  299   GLCNSGRWDESSMQLNEMLEANIAPNIITFNILVDGLCKEGRVAKAHGIVKWMIQRGMKP  358

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y ++I  L  +GR ++A   +  M+   I  +L+ +N L++  CKEG++  A+ +V
Sbjct  359   DVVTYPSLIYGLCNSGRWEEASMQLNEMLEVNITPNLITFNILVDGLCKEGRVAKAHGIV  418

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
                 ++G   D  T++ +I GLC  G  +EA   LN    +    NL+ FN  +DGLCK 
Sbjct  419   KWMIQRGIKPDVVTYSSLIYGLCNLGRWEEASMQLNEMLEVNITPNLITFNILVDGLCKE  478

Query  1181  GEV----------------------DYALSVFKSMDEK----DCFTYSSLVHGLCKAGRF  1080
             G V                      D ALS+++ M +     D   Y+ L+ G+ KAG+ 
Sbjct  479   GRVAKAHDVVTYNILIDGFCKHQSLDVALSLYQEMQKNSLTPDIIVYNILIDGMFKAGKI  538

Query  1079  RVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELK  942
             + A EL+    I G++        +I+GL   G + EA KL  +++
Sbjct  539   KDAKELVSRLSIEGLRPDVYTYSTMINGLCKEGLLDEAFKLFRKME  584


 Score =   209 bits (533),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 134/471 (28%), Positives = 235/471 (50%), Gaps = 26/471 (6%)
 Frame = -1

Query  2258  ITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEV  2079
             I V  LCK  +  KA  ++   I+ G+  D+VTYN+LI   C        +  L+ M+E 
Sbjct  190   ILVDGLCKEGRAAKAHGIVRGMIQRGIKTDLVTYNSLIYGLCNSGRWKESFMQLNEMSEA  249

Query  2078  GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEA  1899
              I PD+IT N L+    + G +++   +++ M++ G+ PD  +Y +L++ L   G+ DE+
Sbjct  250   NITPDLITLNILVDGLCKEGRVAKACGIVKLMIQRGMKPDVVTYPSLIYGLCNSGRWDES  309

Query  1898  YRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
                  ++   +I P  +TFNIL+ GLC  G   KA  + + +   G  P +VTY  LI+G
Sbjct  310   SMQLNEMLEANIAPNIITFNILVDGLCKEGRVAKAHGIVKWMIQRGMKPDVVTYPSLIYG  369

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFD  1539
             LCNSGRW  A   LNE++++   PN IT+  ++    +  R  +   I++ M ++G   D
Sbjct  370   LCNSGRWEEASMQLNEMLEVNITPNLITFNILVDGLCKEGRVAKAHGIVKWMIQRGIKPD  429

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGK---------  1386
                Y ++I  L   GR ++A   +  M+   I  +L+ +N L++  CKEG+         
Sbjct  430   VVTYSSLIYGLCNLGRWEEASMQLNEMLEVNITPNLITFNILVDGLCKEGRVAKAHDVVT  489

Query  1385  -------------LDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTK  1245
                          LD A  L  E ++     D   + I+IDG+ KAG +K+A   ++   
Sbjct  490   YNILIDGFCKHQSLDVALSLYQEMQKNSLTPDIIVYNILIDGMFKAGKIKDAKELVSRLS  549

Query  1244  LMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFR  1077
             + G   ++  ++  I+GLCK G +D A  +F+ M+   CF    +Y+ ++ G  +     
Sbjct  550   IEGLRPDVYTYSTMINGLCKEGLLDEAFKLFRKMEGDGCFPDSCSYNVIIQGYLRHNDSS  609

Query  1076  VASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
             +A++L+   +  G     +  + VI+ + +       +KL +  K S+ +N
Sbjct  610   MATQLIDEMVGKGFSADATTTELVINLVMNKPDDPLVQKLLNYSKRSQDVN  660


 Score =   200 bits (508),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/376 (31%), Positives = 196/376 (52%), Gaps = 4/376 (1%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC  2004
             G+  D+   N L   +C    +D G+S+L ++ ++G +P +IT N+LI            
Sbjct  5     GISLDIYCINILTNCFCHLDRVDFGFSLLGKILKLGFQPTIITLNTLINGLCSEDRFDEA  64

Query  2003  LDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSG  1824
             ++L +EM+  G  PD ++YN +++ L ++ K + A+   + +      P  V++N ++  
Sbjct  65    VELFDEMVAKGYQPDVYTYNVIVNALCKIRKTNVAFGILKRMVEEGCEPDVVSYNAIIDS  124

Query  1823  LCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPN  1644
             LC +    +AL LF ++K  G  P +VTYN LI+GLC S R   A  LLN+++     P+
Sbjct  125   LCKDRLVTEALELFLKMKSEGISPSIVTYNSLINGLCTSSRLKEAFLLLNKMLKANIMPD  184

Query  1643  AITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVG  1464
              IT+T ++    +  R  +   I+  M ++G   D   Y ++I  L  +GR K+++  + 
Sbjct  185   LITFTILVDGLCKEGRAAKAHGIVRGMIQRGIKTDLVTYNSLIYGLCNSGRWKESFMQLN  244

Query  1463  NMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAG  1284
              M    I  DL+  N L++  CKEG++  A  +V    ++G   D  T+  +I GLC +G
Sbjct  245   EMSEANITPDLITLNILVDGLCKEGRVAKACGIVKLMIQRGMKPDVVTYPSLIYGLCNSG  304

Query  1283  NMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYS  1116
                E+   LN         N++ FN  +DGLCK G V  A  + K M ++    D  TY 
Sbjct  305   RWDESSMQLNEMLEANIAPNIITFNILVDGLCKEGRVAKAHGIVKWMIQRGMKPDVVTYP  364

Query  1115  SLVHGLCKAGRFRVAS  1068
             SL++GLC +GR+  AS
Sbjct  365   SLIYGLCNSGRWEEAS  380


 Score =   132 bits (331),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/309 (27%), Positives = 149/309 (48%), Gaps = 22/309 (7%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              NI V  LCK  ++ KA  ++   I+ G+  DVVTY +LI   C     +     L+ M 
Sbjct  328   FNILVDGLCKEGRVAKAHGIVKWMIQRGMKPDVVTYPSLIYGLCNSGRWEEASMQLNEML  387

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             EV I P++IT+N L+    + G +++   +++ M++ GI PD  +Y++L++ L  LG+ +
Sbjct  388   EVNITPNLITFNILVDGLCKEGRVAKAHGIVKWMIQRGIKPDVVTYSSLIYGLCNLGRWE  447

Query  1904  EAYRFFQDIFWGDIPPCPVTFNIL----------------------LSGLCMNGYTEKAL  1791
             EA     ++   +I P  +TFNIL                      + G C +   + AL
Sbjct  448   EASMQLNEMLEVNITPNLITFNILVDGLCKEGRVAKAHDVVTYNILIDGFCKHQSLDVAL  507

Query  1790  MLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCC  1611
              L++E++ +   P ++ YNILI G+  +G+   A+ L++ L   G  P+  TY+T++   
Sbjct  508   SLYQEMQKNSLTPDIIVYNILIDGMFKAGKIKDAKELVSRLSIEGLRPDVYTYSTMINGL  567

Query  1610  FRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDL  1431
              +    +E  ++  +M   G   DS +Y  +I   ++      A   +  M+  G   D 
Sbjct  568   CKEGLLDEAFKLFRKMEGDGCFPDSCSYNVIIQGYLRHNDSSMATQLIDEMVGKGFSADA  627

Query  1430  VAYNTLINL  1404
                  +INL
Sbjct  628   TTTELVINL  636


 Score = 67.4 bits (163),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 85/178 (48%), Gaps = 4/178 (2%)
 Frame = -1

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
             GI LD+   N L N +C   ++D  + L+ +  + GF     T   +I+GLC      EA
Sbjct  5     GISLDIYCINILTNCFCHLDRVDFGFSLLGKILKLGFQPTIITLNTLINGLCSEDRFDEA  64

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDC----FTYSSLVHG  1101
             +   +     G+  ++  +N  ++ LCK+ + + A  + K M E+ C     +Y++++  
Sbjct  65    VELFDEMVAKGYQPDVYTYNVIVNALCKIRKTNVAFGILKRMVEEGCEPDVVSYNAIIDS  124

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             LCK      A EL L     G+        ++I+GL  S  ++EA  L +++  + I+
Sbjct  125   LCKDRLVTEALELFLKMKSEGISPSIVTYNSLINGLCTSSRLKEAFLLLNKMLKANIM  182



>ref|XP_006854103.1| hypothetical protein AMTR_s00048p00141020 [Amborella trichopoda]
 gb|ERN15570.1| hypothetical protein AMTR_s00048p00141020 [Amborella trichopoda]
Length=609

 Score =   224 bits (570),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/449 (29%), Positives = 234/449 (52%), Gaps = 4/449 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             + R K  ++   LNI +  LCK +++E A++   +   +G   DVVT+NTLI  YC    
Sbjct  108   VIRNKIPVNMYTLNIMMNSLCKERKIEPAKSFYTEMENMGFAPDVVTHNTLIDLYCREGL  167

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             ++  + IL+ M   G++P ++TYNS+I    R G  S+ +++++EM  VG++P+T +YN 
Sbjct  168   LEEAFGILNSMPVKGLRPGIVTYNSVINGLCRRGDYSKSIEIMDEMHRVGLVPNTSTYNI  227

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             ++    ++G   EA R ++ +    + P  VTF +L+   C  G  + AL    ++K++G
Sbjct  228   MISGSAKMGNSVEATRNYEKMKSKGLLPDIVTFTLLIGLSCREGNPDIALGYLGDMKNTG  287

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P  V Y ++I+  C +GR   A RL +E+ + G  P+ +TY TI+    +  R  +  
Sbjct  288   LAPDNVVYTMVINAFCRAGRTTEALRLRDEMAERGSLPDVVTYNTILNGLCKEGRLSDAD  347

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
              + +EM  +G + D   + T+I    + G ++ A D    M    ++ D+V YNTLI+ +
Sbjct  348   DLFKEMAERGLVPDYVTFTTLIDGYCRDGSIEKAQDLFDEMRDRNLKPDIVTYNTLIDGF  407

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CKEG ++ A  L  +   +G   +  T++ +IDG C  GNM +A+   +     G   N+
Sbjct  408   CKEGDMEKARDLWGDMINRGILPNLVTYSTMIDGFCSKGNMMQAVGLWDEMVEKGIAPNV  467

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLS  1053
             + +N  I G C+ G       +   M  +    +  TY++L+HG CK  +   A +L++ 
Sbjct  468   ITYNSVIKGYCRSGNSSKGEELLAEMTGEGLVANKITYNTLIHGFCKEEKIPQAFDLVVK  527

Query  1052  CIIGGMKILKSDRQAVIDGLQHSGFIQEA  966
                 G++       A+++G      ++EA
Sbjct  528   MENHGIRPDVVTYNALLNGFCRQERMKEA  556


 Score =   182 bits (462),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 104/326 (32%), Positives = 172/326 (53%), Gaps = 0/326 (0%)
 Frame = -1

Query  2240  CKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDV  2061
             C+    + A   + D    G+  D V Y  +I A+C          +   M E G  PDV
Sbjct  268   CREGNPDIALGYLGDMKNTGLAPDNVVYTMVINAFCRAGRTTEALRLRDEMAERGSLPDV  327

Query  2060  ITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQD  1881
             +TYN+++    + G LS   DL +EM E G++PD  ++ TL+    R G  ++A   F +
Sbjct  328   VTYNTILNGLCKEGRLSDADDLFKEMAERGLVPDYVTFTTLIDGYCRDGSIEKAQDLFDE  387

Query  1880  IFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGR  1701
             +   ++ P  VT+N L+ G C  G  EKA  L+ ++ + G +P LVTY+ +I G C+ G 
Sbjct  388   MRDRNLKPDIVTYNTLIDGFCKEGDMEKARDLWGDMINRGILPNLVTYSTMIDGFCSKGN  447

Query  1700  WAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCT  1521
                A  L +E+V+ G  PN ITY +++K   RS    +G ++L EM  +G + +   Y T
Sbjct  448   MMQAVGLWDEMVEKGIAPNVITYNSVIKGYCRSGNSSKGEELLAEMTGEGLVANKITYNT  507

Query  1520  VISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKG  1341
             +I    K  ++  A+D V  M  +GI  D+V YN L+N +C++ ++  A ++  +   KG
Sbjct  508   LIHGFCKEEKIPQAFDLVVKMENHGIRPDVVTYNALLNGFCRQERMKEANVVFQKMVEKG  567

Query  1340  FDCDKYTHTIIIDGLCKAGNMKEALR  1263
                D+ T+T +++G     N++EA R
Sbjct  568   VMPDRLTYTSLMNGYVAVNNVREAFR  593


 Score =   175 bits (444),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 110/404 (27%), Positives = 183/404 (45%), Gaps = 4/404 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LC+     K+  ++ +  RVG+  +  TYN +I+                +M  
Sbjct  191   NSVINGLCRRGDYSKSIEIMDEMHRVGLVPNTSTYNIMISGSAKMGNSVEATRNYEKMKS  250

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G+ PD++T+  LI  + R G     L  L +M   G+ PD   Y  +++   R G+  E
Sbjct  251   KGLLPDIVTFTLLIGLSCREGNPDIALGYLGDMKNTGLAPDNVVYTMVINAFCRAGRTTE  310

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A R   ++      P  VT+N +L+GLC  G    A  LF+E+   G +P  VT+  LI 
Sbjct  311   ALRLRDEMAERGSLPDVVTYNTILNGLCKEGRLSDADDLFKEMAERGLVPDYVTFTTLID  370

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G C  G    A+ L +E+ D    P+ +TY T++    +    E+   +  +M  +G + 
Sbjct  371   GYCRDGSIEKAQDLFDEMRDRNLKPDIVTYNTLIDGFCKEGDMEKARDLWGDMINRGILP  430

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             +   Y T+I      G M  A      M+  GI  +++ YN++I  YC+ G       L+
Sbjct  431   NLVTYSTMIDGFCSKGNMMQAVGLWDEMVEKGIAPNVITYNSVIKGYCRSGNSSKGEELL  490

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E   +G   +K T+  +I G CK   + +A   +   +  G   ++V +N  ++G C+ 
Sbjct  491   AEMTGEGLVANKITYNTLIHGFCKEEKIPQAFDLVVKMENHGIRPDVVTYNALLNGFCRQ  550

Query  1181  GEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASEL  1062
               +  A  VF+ M EK    D  TY+SL++G       R A  L
Sbjct  551   ERMKEANVVFQKMVEKGVMPDRLTYTSLMNGYVAVNNVREAFRL  594


 Score =   169 bits (428),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 120/449 (27%), Positives = 206/449 (46%), Gaps = 5/449 (1%)
 Frame = -1

Query  2276  STKLL-NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             S KL+ ++ +    +AK+L +A  V     + G+   +   N L+        +D  + I
Sbjct  45    SNKLVFDLLIKTYVQAKRLREATEVFKLLEKNGLLPSIHACNCLLGGLVKVAWVDLTWQI  104

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
              H +    I  ++ T N ++ S  +   +        EM  +G  PD  ++NTL+    R
Sbjct  105   YHEVIRNKIPVNMYTLNIMMNSLCKERKIEPAKSFYTEMENMGFAPDVVTHNTLIDLYCR  164

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
              G  +EA+     +    + P  VT+N +++GLC  G   K++ +  E+   G +P   T
Sbjct  165   EGLLEEAFGILNSMPVKGLRPGIVTYNSVINGLCRRGDYSKSIEIMDEMHRVGLVPNTST  224

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YNI+I G    G    A R   ++   G  P+ +T+T ++    R    +  L  L +M+
Sbjct  225   YNIMISGSAKMGNSVEATRNYEKMKSKGLLPDIVTFTLLIGLSCREGNPDIALGYLGDMK  284

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
               G   D+  Y  VI+   +AGR  +A      M   G   D+V YNT++N  CKEG+L 
Sbjct  285   NTGLAPDNVVYTMVINAFCRAGRTTEALRLRDEMAERGSLPDVVTYNTILNGLCKEGRLS  344

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
             +A  L  E   +G   D  T T +IDG C+ G++++A    +  +      ++V +N  I
Sbjct  345   DADDLFKEMAERGLVPDYVTFTTLIDGYCRDGSIEKAQDLFDEMRDRNLKPDIVTYNTLI  404

Query  1199  DGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             DG CK G+++ A  ++  M  +    +  TYS+++ G C  G    A  L    +  G+ 
Sbjct  405   DGFCKEGDMEKARDLWGDMINRGILPNLVTYSTMIDGFCSKGNMMQAVGLWDEMVEKGIA  464

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
                    +VI G   SG   +  +L +E+
Sbjct  465   PNVITYNSVIKGYCRSGNSSKGEELLAEM  493


 Score =   142 bits (359),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/313 (28%), Positives = 149/313 (48%), Gaps = 1/313 (0%)
 Frame = -1

Query  2258  ITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEV  2079
             + +   C+A +  +A  +  +    G   DVVTYNT++   C    +     +   M E 
Sbjct  297   MVINAFCRAGRTTEALRLRDEMAERGSLPDVVTYNTILNGLCKEGRLSDADDLFKEMAER  356

Query  2078  GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEA  1899
             G+ PD +T+ +LI    R G + +  DL +EM +  + PD  +YNTL+    + G  ++A
Sbjct  357   GLVPDYVTFTTLIDGYCRDGSIEKAQDLFDEMRDRNLKPDIVTYNTLIDGFCKEGDMEKA  416

Query  1898  YRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
                + D+    I P  VT++ ++ G C  G   +A+ L+ E+   G  P ++TYN +I G
Sbjct  417   RDLWGDMINRGILPNLVTYSTMIDGFCSKGNMMQAVGLWDEMVEKGIAPNVITYNSVIKG  476

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFD  1539
              C SG  +    LL E+   G   N ITY T++    +  +  +   ++ +M   G   D
Sbjct  477   YCRSGNSSKGEELLAEMTGEGLVANKITYNTLIHGFCKEEKIPQAFDLVVKMENHGIRPD  536

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVV  1359
                Y  +++   +  RMK+A      M+  G+  D + Y +L+N Y     +  A+ L  
Sbjct  537   VVTYNALLNGFCRQERMKEANVVFQKMVEKGVMPDRLTYTSLMNGYVAVNNVREAFRLHD  596

Query  1358  EAERKGF-DCDKY  1323
             +  +KGF   DKY
Sbjct  597   QMLQKGFIPDDKY  609


 Score =   107 bits (268),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 107/206 (52%), Gaps = 0/206 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +   CK   +EKA  +  D I  G+  ++VTY+T+I  +C    +     +   M E
Sbjct  401   NTLIDGFCKEGDMEKARDLWGDMINRGILPNLVTYSTMIDGFCSKGNMMQAVGLWDEMVE  460

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              GI P+VITYNS+I    R G  S+  +LL EM   G++ +  +YNTL+H   +  K  +
Sbjct  461   KGIAPNVITYNSVIKGYCRSGNSSKGEELLAEMTGEGLVANKITYNTLIHGFCKEEKIPQ  520

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A+     +    I P  VT+N LL+G C     ++A ++F+++   G +P  +TY  L++
Sbjct  521   AFDLVVKMENHGIRPDVVTYNALLNGFCRQERMKEANVVFQKMVEKGVMPDRLTYTSLMN  580

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPN  1644
             G         A RL ++++  G+ P+
Sbjct  581   GYVAVNNVREAFRLHDQMLQKGFIPD  606


 Score = 67.0 bits (162),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 110/248 (44%), Gaps = 21/248 (8%)
 Frame = -1

Query  1607  RSRRFEEGLQ-ILEEMRRKGY--------IFDSFAYCT--------VISFLIKAGRMKDA  1479
             +SRR  +    IL  +R+KG         +  ++ YC         +I   ++A R+++A
Sbjct  7     KSRRLSDAQAFILRMVRKKGVSRLEIVQALLGTYDYCDSNKLVFDLLIKTYVQAKRLREA  66

Query  1478  YDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDG  1299
              +    +  NG+   + A N L+    K   +D  + +  E  R     + YT  I+++ 
Sbjct  67    TEVFKLLEKNGLLPSIHACNCLLGGLVKVAWVDLTWQIYHEVIRNKIPVNMYTLNIMMNS  126

Query  1298  LCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKD----  1131
             LCK   ++ A       + MGF  ++V  N  ID  C+ G ++ A  +  SM  K     
Sbjct  127   LCKERKIEPAKSFYTEMENMGFAPDVVTHNTLIDLYCREGLLEEAFGILNSMPVKGLRPG  186

Query  1130  CFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHS  951
               TY+S+++GLC+ G +  + E++      G+    S    +I G    G   EA + + 
Sbjct  187   IVTYNSVINGLCRRGDYSKSIEIMDEMHRVGLVPNTSTYNIMISGSAKMGNSVEATRNYE  246

Query  950   ELKLSKIL  927
             ++K   +L
Sbjct  247   KMKSKGLL  254



>ref|XP_002962532.1| hypothetical protein SELMODRAFT_404389 [Selaginella moellendorffii]
 gb|EFJ35995.1| hypothetical protein SELMODRAFT_404389 [Selaginella moellendorffii]
Length=1031

 Score =   229 bits (583),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 142/443 (32%), Positives = 229/443 (52%), Gaps = 7/443 (2%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI +  LCKA + +KA  ++ + +  GV  D VT+N+++   C     +  +S+L  M E
Sbjct  265   NILIDGLCKASKTDKASEMLHEMVDRGVTPDTVTFNSIMDGLCKAGKFERAHSLLAVMAE  324

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
                +P   TYN+LI+   +   + R  DL++E +  G +PD  +Y+ L   L + G+ DE
Sbjct  325   RNCRPSCCTYNTLISGLCKQQNVDRAKDLVDEFVSSGFVPDVVTYSILADGLCKRGRIDE  384

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A+   +++      P  VT+N L+ GLC    TEKA  L   L  SGF+P +VTY I++ 
Sbjct  385   AFELVKEMSGKGCTPNLVTYNTLIDGLCKASKTEKAYELLESLVSSGFVPDVVTYTIIVD  444

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC  GR   A +++  ++  G  P+ ITYT +M+   R+ R +E   I +EM  K    
Sbjct  445   GLCKEGRLDKALKMVEGMLKRGCTPSVITYTALMEGLCRTGRVDEAHHIFKEMVSKDCTA  504

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D+ AY ++++   K+ R K+A   V + I     +D+  YN L++ YCKEG+LD    + 
Sbjct  505   DALAYVSLVNGYCKSSRTKEAQKVV-DGIRGTPYIDV--YNALMDGYCKEGRLDEIPNVF  561

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              +   +G   +  T+ I++DGLCK G + EA   L      G   ++V++N  IDGL K 
Sbjct  562   EDMACRGCVPNIKTYNIVMDGLCKHGKVDEAFPFLESMHSAGCVPDVVSYNIIIDGLFKA  621

Query  1181  GEVDYALSVFKSMDE----KDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
              +   A  V   M +     D  TY++L+   CK  RF  A  +L + I  G+       
Sbjct  622   SKPKEARQVLDQMIQAGIPPDAVTYNTLMAQFCKEERFDDAVGILKNMIKAGVDPDNVTY  681

Query  1013  QAVIDGLQHSGFIQEARKLHSEL  945
               +I GL  +  + +A +L  E+
Sbjct  682   NTLISGLSQTNRLGDAYELMHEM  704


 Score =   207 bits (528),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 129/444 (29%), Positives = 216/444 (49%), Gaps = 13/444 (3%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPA-DVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              I     CK  +L+ A  +  +     +P+ D + YN +I  +C     D     L  MN
Sbjct  199   TILTRAFCKTGRLKDALEIFRN-----IPSPDAIAYNAIIHGHCRKNDCDGALEFLKEMN  253

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             E  + PDV TYN LI    +     +  ++L EM++ G+ PDT ++N++M  L + GK +
Sbjct  254   ERKVAPDVFTYNILIDGLCKASKTDKASEMLHEMVDRGVTPDTVTFNSIMDGLCKAGKFE  313

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A+     +   +  P   T+N L+SGLC     ++A  L  E   SGF+P +VTY+IL 
Sbjct  314   RAHSLLAVMAERNCRPSCCTYNTLISGLCKQQNVDRAKDLVDEFVSSGFVPDVVTYSILA  373

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
              GLC  GR   A  L+ E+   G  PN +TY T++    ++ + E+  ++LE +   G++
Sbjct  374   DGLCKRGRIDEAFELVKEMSGKGCTPNLVTYNTLIDGLCKASKTEKAYELLESLVSSGFV  433

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D   Y  ++  L K GR+  A   V  M+  G    ++ Y  L+   C+ G++D A+ +
Sbjct  434   PDVVTYTIIVDGLCKEGRLDKALKMVEGMLKRGCTPSVITYTALMEGLCRTGRVDEAHHI  493

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E   K    D   +  +++G CK+   KEA + ++  +   +   +  +N  +DG CK
Sbjct  494   FKEMVSKDCTADALAYVSLVNGYCKSSRTKEAQKVVDGIRGTPY---IDVYNALMDGYCK  550

Query  1184  VGEVDYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G +D   +VF+ M  + C     TY+ ++ GLCK G+   A   L S    G       
Sbjct  551   EGRLDEIPNVFEDMACRGCVPNIKTYNIVMDGLCKHGKVDEAFPFLESMHSAGCVPDVVS  610

Query  1016  RQAVIDGLQHSGFIQEARKLHSEL  945
                +IDGL  +   +EAR++  ++
Sbjct  611   YNIIIDGLFKASKPKEARQVLDQM  634


 Score =   206 bits (523),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 137/464 (30%), Positives = 224/464 (48%), Gaps = 35/464 (8%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             LCK  ++++A  ++ +    G   ++VTYNTLI   C     +  Y +L  +   G  PD
Sbjct  376   LCKRGRIDEAFELVKEMSGKGCTPNLVTYNTLIDGLCKASKTEKAYELLESLVSSGFVPD  435

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             V+TY  ++    + G L + L ++E ML+ G  P   +Y  LM  L R G+ DEA+  F+
Sbjct  436   VVTYTIIVDGLCKEGRLDKALKMVEGMLKRGCTPSVITYTALMEGLCRTGRVDEAHHIFK  495

Query  1883  DIFWGDIP--------------------------------PCPVTFNILLSGLCMNGYTE  1800
             ++   D                                  P    +N L+ G C  G  +
Sbjct  496   EMVSKDCTADALAYVSLVNGYCKSSRTKEAQKVVDGIRGTPYIDVYNALMDGYCKEGRLD  555

Query  1799  KALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIM  1620
             +   +F ++   G +P + TYNI++ GLC  G+   A   L  +   G  P+ ++Y  I+
Sbjct  556   EIPNVFEDMACRGCVPNIKTYNIVMDGLCKHGKVDEAFPFLESMHSAGCVPDVVSYNIII  615

Query  1619  KCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE  1440
                F++ + +E  Q+L++M + G   D+  Y T+++   K  R  DA   + NMI  G++
Sbjct  616   DGLFKASKPKEARQVLDQMIQAGIPPDAVTYNTLMAQFCKEERFDDAVGILKNMIKAGVD  675

Query  1439  LDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDK-YTHTIIIDGLCKAGNMKEALR  1263
              D V YNTLI+   +  +L +AY L+ E  R G       T+  IID LCK G +K+AL 
Sbjct  676   PDNVTYNTLISGLSQTNRLGDAYELMHEMLRNGCVVSACTTYNTIIDRLCKEGCLKQALL  735

Query  1262  HLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE-KDCFTYSSLVHGLCKAG  1086
              ++     G ++N V +N  ID LCK G +D A S+   MD  +D  +Y++++ GLCKA 
Sbjct  736   LMDHMTGHGVEANTVTYNIFIDRLCKEGRLDEASSLLSEMDTLRDEVSYTTVIIGLCKAE  795

Query  1085  RFRVASELLLSCI-IGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
             +   AS+L    + + G+ I       +ID    +  + EA  L
Sbjct  796   QLDRASKLAREMVAVKGLCITSHTFNLLIDAFTKTKRLDEALTL  839


 Score =   205 bits (522),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 138/489 (28%), Positives = 227/489 (46%), Gaps = 13/489 (3%)
 Frame = -1

Query  2498  PEKSRRLLSHINLLNSPAGQPSPADMFVCYLRRSQSSPRLPLAASALQLATRTCPMLRLG  2319
             P +   L +   L  S + Q    D+       S    RL      LQ A  +  + RL 
Sbjct  45    PHRQLHLSTARKLARSESLQQDVLDLLGLLQSGSNIRERLEQWRGTLQPAVVSRVLQRLK  104

Query  2318  D*HLE*MFRIKS-----RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYN  2154
             D     +F + +     + ST   N  +  L +    ++   +    +  G   D  TY+
Sbjct  105   DPQTAIVFFVWAGDRGFKHSTFTRNCFLQTLLENGSSDRIPAMFERMLDAGYAPDSYTYH  164

Query  2153  TLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEV  1974
              +I + C    ID  +++L +    G KP+V  Y  L  +  + G L   L++   +   
Sbjct  165   LVIKSLCQMNQIDKAFTMLDKAKVRGFKPEVSVYTILTRAFCKTGRLKDALEIFRNIPS-  223

Query  1973  GILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKA  1794
                PD  +YN ++H   R    D A  F +++    + P   T+NIL+ GLC    T+KA
Sbjct  224   ---PDAIAYNAIIHGHCRKNDCDGALEFLKEMNERKVAPDVFTYNILIDGLCKASKTDKA  280

Query  1793  LMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKC  1614
               +  E+   G  P  VT+N ++ GLC +G++  A  LL  + +    P+  TY T++  
Sbjct  281   SEMLHEMVDRGVTPDTVTFNSIMDGLCKAGKFERAHSLLAVMAERNCRPSCCTYNTLISG  340

Query  1613  CFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELD  1434
               + +  +    +++E    G++ D   Y  +   L K GR+ +A++ V  M   G   +
Sbjct  341   LCKQQNVDRAKDLVDEFVSSGFVPDVVTYSILADGLCKRGRIDEAFELVKEMSGKGCTPN  400

Query  1433  LVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLN  1254
             LV YNTLI+  CK  K + AY L+      GF  D  T+TII+DGLCK G + +AL+ + 
Sbjct  401   LVTYNTLIDGLCKASKTEKAYELLESLVSSGFVPDVVTYTIIVDGLCKEGRLDKALKMVE  460

Query  1253  CTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAG  1086
                  G   +++ +   ++GLC+ G VD A  +FK M  KDC      Y SLV+G CK+ 
Sbjct  461   GMLKRGCTPSVITYTALMEGLCRTGRVDEAHHIFKEMVSKDCTADALAYVSLVNGYCKSS  520

Query  1085  RFRVASELL  1059
             R + A +++
Sbjct  521   RTKEAQKVV  529


 Score =   181 bits (458),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 139/512 (27%), Positives = 226/512 (44%), Gaps = 70/512 (14%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCKA + EKA  ++   +  G   DVVTY  ++   C    +D    ++  M +
Sbjct  405   NTLIDGLCKASKTEKAYELLESLVSSGFVPDVVTYTIIVDGLCKEGRLDKALKMVEGMLK  464

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSY---------------  1947
              G  P VITY +L+    R G +     + +EM+      D  +Y               
Sbjct  465   RGCTPSVITYTALMEGLCRTGRVDEAHHIFKEMVSKDCTADALAYVSLVNGYCKSSRTKE  524

Query  1946  -----------------NTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLC  1818
                              N LM    + G+ DE    F+D+      P   T+NI++ GLC
Sbjct  525   AQKVVDGIRGTPYIDVYNALMDGYCKEGRLDEIPNVFEDMACRGCVPNIKTYNIVMDGLC  584

Query  1817  MNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAI  1638
              +G  ++A      +  +G +P +V+YNI+I GL  + +   AR++L++++  G  P+A+
Sbjct  585   KHGKVDEAFPFLESMHSAGCVPDVVSYNIIIDGLFKASKPKEARQVLDQMIQAGIPPDAV  644

Query  1637  TYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNM  1458
             TY T+M    +  RF++ + IL+ M + G   D+  Y T+IS L +  R+ DAY+ +  M
Sbjct  645   TYNTLMAQFCKEERFDDAVGILKNMIKAGVDPDNVTYNTLISGLSQTNRLGDAYELMHEM  704

Query  1457  IMNGIELDL-VAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGN  1281
             + NG  +     YNT+I+  CKEG L  A +L+      G + +  T+ I ID LCK G 
Sbjct  705   LRNGCVVSACTTYNTIIDRLCKEGCLKQALLLMDHMTGHGVEANTVTYNIFIDRLCKEGR  764

Query  1280  MKEALRHLN-----------CTKLMG------------FDSNLVA----------FNCCI  1200
             + EA   L+            T ++G                +VA          FN  I
Sbjct  765   LDEASSLLSEMDTLRDEVSYTTVIIGLCKAEQLDRASKLAREMVAVKGLCITSHTFNLLI  824

Query  1199  DGLCKVGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             D   K   +D AL++   M ++ C     TY+ ++  LCK  +   A EL     + G+ 
Sbjct  825   DAFTKTKRLDEALTLLGLMVQRGCSPSVITYNMVITCLCKLDKVDKAWELFDEMAVRGIV  884

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
                     +I GL   G  +EA ++  E+  S
Sbjct  885   ASSVSYTVLIYGLCGQGRGKEALQVLEEMASS  916


 Score =   151 bits (382),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 102/362 (28%), Positives = 172/362 (48%), Gaps = 14/362 (4%)
 Frame = -1

Query  2270  KLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHR  2091
             K  NI +  LCK  ++++A   +      G   DVV+YN +I              +L +
Sbjct  574   KTYNIVMDGLCKHGKVDEAFPFLESMHSAGCVPDVVSYNIIIDGLFKASKPKEARQVLDQ  633

Query  2090  MNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGK  1911
             M + GI PD +TYN+L+A   +       + +L+ M++ G+ PD  +YNTL+  L +  +
Sbjct  634   MIQAGIPPDAVTYNTLMAQFCKEERFDDAVGILKNMIKAGVDPDNVTYNTLISGLSQTNR  693

Query  1910  PDEAYRFFQDIFW-GDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
               +AY    ++   G +     T+N ++  LC  G  ++AL+L   +   G     VTYN
Sbjct  694   LGDAYELMHEMLRNGCVVSACTTYNTIIDRLCKEGCLKQALLLMDHMTGHGVEANTVTYN  753

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRR-  1557
             I I  LC  GR   A  LL+E+  +    + ++YTT++    ++ + +   ++  EM   
Sbjct  754   IFIDRLCKEGRLDEASSLLSEMDTLR---DEVSYTTVIIGLCKAEQLDRASKLAREMVAV  810

Query  1556  KGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDN  1377
             KG    S  +  +I    K  R+ +A   +G M+  G    ++ YN +I   CK  K+D 
Sbjct  811   KGLCITSHTFNLLIDAFTKTKRLDEALTLLGLMVQRGCSPSVITYNMVITCLCKLDKVDK  870

Query  1376  AYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCID  1197
             A+ L  E   +G      ++T++I GLC  G  KEAL+ L           + + +C ID
Sbjct  871   AWELFDEMAVRGIVASSVSYTVLIYGLCGQGRGKEALQVLE---------EMASSDCEID  921

Query  1196  GL  1191
              L
Sbjct  922   DL  923


 Score =   151 bits (381),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 101/346 (29%), Positives = 162/346 (47%), Gaps = 14/346 (4%)
 Frame = -1

Query  1973  GILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKA  1794
             G    T++ N  +  L   G  D     F+ +      P   T+++++  LC     +KA
Sbjct  120   GFKHSTFTRNCFLQTLLENGSSDRIPAMFERMLDAGYAPDSYTYHLVIKSLCQMNQIDKA  179

Query  1793  LMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKC  1614
               +  + K  GF P++  Y IL    C +GR   A  +   +     +P+AI Y  I+  
Sbjct  180   FTMLDKAKVRGFKPEVSVYTILTRAFCKTGRLKDALEIFRNIP----SPDAIAYNAIIHG  235

Query  1613  CFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELD  1434
               R    +  L+ L+EM  +    D F Y  +I  L KA +   A + +  M+  G+  D
Sbjct  236   HCRKNDCDGALEFLKEMNERKVAPDVFTYNILIDGLCKASKTDKASEMLHEMVDRGVTPD  295

Query  1433  LVAYNTLINLYCKEGKLDNAY-MLVVEAERKGFDCDKY--THTIIIDGLCKAGNMKEALR  1263
              V +N++++  CK GK + A+ +L V AER   +C     T+  +I GLCK  N+  A  
Sbjct  296   TVTFNSIMDGLCKAGKFERAHSLLAVMAER---NCRPSCCTYNTLISGLCKQQNVDRAKD  352

Query  1262  HLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDC----FTYSSLVHGLC  1095
              ++     GF  ++V ++   DGLCK G +D A  + K M  K C     TY++L+ GLC
Sbjct  353   LVDEFVSSGFVPDVVTYSILADGLCKRGRIDEAFELVKEMSGKGCTPNLVTYNTLIDGLC  412

Query  1094  KAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
             KA +   A ELL S +  G          ++DGL   G + +A K+
Sbjct  413   KASKTEKAYELLESLVSSGFVPDVVTYTIIVDGLCKEGRLDKALKM  458


 Score =   149 bits (377),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 112/408 (27%), Positives = 181/408 (44%), Gaps = 43/408 (11%)
 Frame = -1

Query  2240  CKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDV  2061
             CK+ + ++A+ V+ DGIR G P  +  YN L+  YC    +D   ++   M   G  P++
Sbjct  517   CKSSRTKEAQKVV-DGIR-GTPY-IDVYNALMDGYCKEGRLDEIPNVFEDMACRGCVPNI  573

Query  2060  ITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQD  1881
              TYN ++    +HG +      LE M   G +PD  SYN ++  LF+  KP EA +    
Sbjct  574   KTYNIVMDGLCKHGKVDEAFPFLESMHSAGCVPDVVSYNIIIDGLFKASKPKEARQVLDQ  633

Query  1880  IFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGR  1701
             +    IPP  VT+N L++  C     + A+ + + +  +G  P  VTYN LI GL  + R
Sbjct  634   MIQAGIPPDAVTYNTLMAQFCKEERFDDAVGILKNMIKAGVDPDNVTYNTLISGLSQTNR  693

Query  1700  WAPARRLLNELVDIG--------YN----------------------------PNAITYT  1629
                A  L++E++  G        YN                             N +TY 
Sbjct  694   LGDAYELMHEMLRNGCVVSACTTYNTIIDRLCKEGCLKQALLLMDHMTGHGVEANTVTYN  753

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMI-M  1452
               +    +  R +E   +L EM     + D  +Y TVI  L KA ++  A      M+ +
Sbjct  754   IFIDRLCKEGRLDEASSLLSEM---DTLRDEVSYTTVIIGLCKAEQLDRASKLAREMVAV  810

Query  1451  NGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKE  1272
              G+ +    +N LI+ + K  +LD A  L+    ++G      T+ ++I  LCK   + +
Sbjct  811   KGLCITSHTFNLLIDAFTKTKRLDEALTLLGLMVQRGCSPSVITYNMVITCLCKLDKVDK  870

Query  1271  ALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDC  1128
             A    +   + G  ++ V++   I GLC  G    AL V + M   DC
Sbjct  871   AWELFDEMAVRGIVASSVSYTVLIYGLCGQGRGKEALQVLEEMASSDC  918


 Score =   121 bits (304),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 80/290 (28%), Positives = 136/290 (47%), Gaps = 8/290 (3%)
 Frame = -1

Query  1802  EKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTI  1623
             + A++ F      GF     T N  +  L  +G       +   ++D GY P++ TY  +
Sbjct  107   QTAIVFFVWAGDRGFKHSTFTRNCFLQTLLENGSSDRIPAMFERMLDAGYAPDSYTYHLV  166

Query  1622  MKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGI  1443
             +K   +  + ++   +L++ + +G+  +   Y  +     K GR+KDA +   N+     
Sbjct  167   IKSLCQMNQIDKAFTMLDKAKVRGFKPEVSVYTILTRAFCKTGRLKDALEIFRNI----P  222

Query  1442  ELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALR  1263
               D +AYN +I+ +C++   D A   + E   +    D +T+ I+IDGLCKA    +A  
Sbjct  223   SPDAIAYNAIIHGHCRKNDCDGALEFLKEMNERKVAPDVFTYNILIDGLCKASKTDKASE  282

Query  1262  HLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCF----TYSSLVHGLC  1095
              L+     G   + V FN  +DGLCK G+ + A S+   M E++C     TY++L+ GLC
Sbjct  283   MLHEMVDRGVTPDTVTFNSIMDGLCKAGKFERAHSLLAVMAERNCRPSCCTYNTLISGLC  342

Query  1094  KAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             K      A +L+   +  G          + DGL   G I EA +L  E+
Sbjct  343   KQQNVDRAKDLVDEFVSSGFVPDVVTYSILADGLCKRGRIDEAFELVKEM  392



>ref|XP_008444287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic [Cucumis melo]
 gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucumis melo subsp. 
melo]
Length=566

 Score =   223 bits (567),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/443 (30%), Positives = 228/443 (51%), Gaps = 4/443 (1%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             LCKA ++ KA  V+   I  G+  D  +Y  L+++ C    +     ++ +M E G   +
Sbjct  107   LCKACKMRKAIKVMEMMIGSGIIPDASSYTFLVSSLCRKGNVGYAMQLVDKMEEYGYPTN  166

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
              +TYNSL+     HG L++ L LL+ +++ G++P+ ++Y+ L+   ++    DEA +   
Sbjct  167   TVTYNSLVRGLCMHGNLTQSLQLLDRLIQKGLVPNAYTYSFLLEAAYKERGADEASKLLD  226

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
             +I      P  V++N+LL+GLC  G TE A+ LFREL   GF P +V+YNIL+  LCN G
Sbjct  227   EIIAKGGEPNLVSYNVLLTGLCKEGRTEDAIRLFRELPSKGFSPNVVSYNILLRSLCNEG  286

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYC  1524
             RW  A  LL E+     +P+ +TY  ++       R E  L++LEEM R  +   + +Y 
Sbjct  287   RWEEANVLLAEMNGDERSPSTVTYNILIGSLALHGRTEHALEVLEEMIRARFKPTASSYN  346

Query  1523  TVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERK  1344
              +I+ L K G++     C+  M+      +   YN +  L C+EG +  A+ ++     K
Sbjct  347   PIIAHLCKDGKLDLVVKCLDQMMYRHCNPNEGTYNAIATL-CEEGMVQEAFSIIQSLGNK  405

Query  1343  GFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYA  1164
                  +  + I+I  LC+ GN   A + L      GF  +   ++  I GLC  G ++ A
Sbjct  406   QHSSTQEFYKIVITSLCRKGNTYPAFQLLYEMTKYGFTPDSFTYSSLIRGLCMEGMLNEA  465

Query  1163  LSVFKSMDEK---DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGL  993
             + +F  M+E    D   Y+SL+ G CK+ R  +A ++    +  G    ++    +++G+
Sbjct  466   IEIFSVMEENNKPDTENYNSLILGCCKSRRTDLALDVFEIMVGKGYLPNETTYTILVEGI  525

Query  992   QHSGFIQEARKLHSELKLSKILN  924
              H   +  A K+  EL+L  +++
Sbjct  526   IHEKEMDLATKVLRELQLRDVIS  548


 Score =   135 bits (340),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 101/385 (26%), Positives = 170/385 (44%), Gaps = 4/385 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  V  LC    L ++  ++   I+ G+  +  TY+ L+ A     G D    +L  +  
Sbjct  171   NSLVRGLCMHGNLTQSLQLLDRLIQKGLVPNAYTYSFLLEAAYKERGADEASKLLDEIIA  230

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G +P++++YN L+    + G     + L  E+   G  P+  SYN L+  L   G+ +E
Sbjct  231   KGGEPNLVSYNVLLTGLCKEGRTEDAIRLFRELPSKGFSPNVVSYNILLRSLCNEGRWEE  290

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A     ++   +  P  VT+NIL+  L ++G TE AL +  E+  + F P   +YN +I 
Sbjct  291   ANVLLAEMNGDERSPSTVTYNILIGSLALHGRTEHALEVLEEMIRARFKPTASSYNPIIA  350

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LC  G+     + L++++    NPN  TY  I   C      +E   I++ +  K +  
Sbjct  351   HLCKDGKLDLVVKCLDQMMYRHCNPNEGTYNAIATLC-EEGMVQEAFSIIQSLGNKQHSS  409

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAY-ML  1365
                 Y  VI+ L + G    A+  +  M   G   D   Y++LI   C EG L+ A  + 
Sbjct  410   TQEFYKIVITSLCRKGNTYPAFQLLYEMTKYGFTPDSFTYSSLIRGLCMEGMLNEAIEIF  469

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
              V  E    D + Y   I+  G CK+     AL         G+  N   +   ++G+  
Sbjct  470   SVMEENNKPDTENYNSLIL--GCCKSRRTDLALDVFEIMVGKGYLPNETTYTILVEGIIH  527

Query  1184  VGEVDYALSVFKSMDEKDCFTYSSL  1110
               E+D A  V + +  +D  + S+L
Sbjct  528   EKEMDLATKVLRELQLRDVISQSTL  552


 Score =   128 bits (321),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 93/368 (25%), Positives = 169/368 (46%), Gaps = 11/368 (3%)
 Frame = -1

Query  2126  VGIDAGYSILHRMNEVGIKPDVITYN------SLIASATRHGMLSRCLDLLEEMLEVGIL  1965
             + ++ G+S +    ++ I P    +         +   ++   L+     LE M+E G  
Sbjct  35    LSLNKGFSKVLASTQITISPKDTIFTLPNWKTGKVEQKSKELRLTDAFFHLEFMVEKGQK  94

Query  1964  PDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALML  1785
             PD +    L++ L +  K  +A +  + +    I P   ++  L+S LC  G    A+ L
Sbjct  95    PDVFQATQLLYDLCKACKMRKAIKVMEMMIGSGIIPDASSYTFLVSSLCRKGNVGYAMQL  154

Query  1784  FRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFR  1605
               +++  G+    VTYN L+ GLC  G    + +LL+ L+  G  PNA TY+ +++  ++
Sbjct  155   VDKMEEYGYPTNTVTYNSLVRGLCMHGNLTQSLQLLDRLIQKGLVPNAYTYSFLLEAAYK  214

Query  1604  SRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVA  1425
              R  +E  ++L+E+  KG   +  +Y  +++ L K GR +DA      +   G   ++V+
Sbjct  215   ERGADEASKLLDEIIAKGGEPNLVSYNVLLTGLCKEGRTEDAIRLFRELPSKGFSPNVVS  274

Query  1424  YNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTK  1245
             YN L+   C EG+ + A +L+ E           T+ I+I  L   G  + AL  L    
Sbjct  275   YNILLRSLCNEGRWEEANVLLAEMNGDERSPSTVTYNILIGSLALHGRTEHALEVLEEMI  334

Query  1244  LMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFR  1077
                F     ++N  I  LCK G++D  +     M  + C     TY+++   LC+ G  +
Sbjct  335   RARFKPTASSYNPIIAHLCKDGKLDLVVKCLDQMMYRHCNPNEGTYNAIA-TLCEEGMVQ  393

Query  1076  VASELLLS  1053
              A  ++ S
Sbjct  394   EAFSIIQS  401


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 88/190 (46%), Gaps = 4/190 (2%)
 Frame = -1

Query  1502  KAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKY  1323
             K  R+ DA+  +  M+  G + D+     L+   CK  K+  A  ++      G   D  
Sbjct  74    KELRLTDAFFHLEFMVEKGQKPDVFQATQLLYDLCKACKMRKAIKVMEMMIGSGIIPDAS  133

Query  1322  THTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSM  1143
             ++T ++  LC+ GN+  A++ ++  +  G+ +N V +N  + GLC  G +  +L +   +
Sbjct  134   SYTFLVSSLCRKGNVGYAMQLVDKMEEYGYPTNTVTYNSLVRGLCMHGNLTQSLQLLDRL  193

Query  1142  DEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFI  975
              +K    + +TYS L+    K      AS+LL   I  G +        ++ GL   G  
Sbjct  194   IQKGLVPNAYTYSFLLEAAYKERGADEASKLLDEIIAKGGEPNLVSYNVLLTGLCKEGRT  253

Query  974   QEARKLHSEL  945
             ++A +L  EL
Sbjct  254   EDAIRLFREL  263



>ref|XP_006391783.1| hypothetical protein EUTSA_v10023354mg [Eutrema salsugineum]
 gb|ESQ29069.1| hypothetical protein EUTSA_v10023354mg [Eutrema salsugineum]
Length=618

 Score =   224 bits (570),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 140/484 (29%), Positives = 252/484 (52%), Gaps = 37/484 (8%)
 Frame = -1

Query  2291  IKSRLSTKLLNIT--VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGI  2118
             +KSR    +++ +  ++ + K K+ +   ++  +  ++G+  D+ TYN LI  +C    +
Sbjct  71    VKSRPFPSIVDFSKLLSAIAKMKKFDVVISMGEEMHKLGIRHDLYTYNILINCFCRSSQL  130

Query  2117  DAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTL  1938
              + ++IL +M ++G +P ++T ++L+        +S  + LL++M+E+G  PDT ++NTL
Sbjct  131   SSAFAILGKMTKLGHEPSIVTLSTLLNGYCHGNRISDAVSLLDQMVELGYKPDTVTFNTL  190

Query  1937  MHCLFRLGKPDEAY-----------------RFFQD--------IFWGDIPPCPVTFNIL  1833
             +H LF   K  EA                  R + D        I  G I P  V +N +
Sbjct  191   IHGLFLNNKASEAVALVDLLTYGAVINGVCKRSYMDLALDLLKKIEKGKIQPNVVIYNTI  250

Query  1832  LSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGY  1653
             + GLC       AL LF E+++ G  P + TYN LI+ LCN GRW+ A RLL+++++   
Sbjct  251   IDGLCKYRDVNDALNLFNEMENKGVRPDVFTYNSLINCLCNYGRWSDASRLLSDMIERKI  310

Query  1652  NPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYD  1473
             NPN +T++ ++    +  +  E  ++ +EM  +    D+  Y ++I+ L    R+ +A +
Sbjct  311   NPNVVTFSALIDAFVKEGKLLEAEELYKEMINRSINPDNITYNSLINGLCLNDRLDEAKE  370

Query  1472  CVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLC  1293
                +M+  GI  ++V Y TLIN +CK  ++++   L  E  ++G   D  T+T +I G  
Sbjct  371   MFTSMVSKGILPNVVTYTTLINGFCKSKRVEDGMELFREMSQRGIVGDTITYTTLIQGYF  430

Query  1292  KAG---NMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMD----EK  1134
             +AG   N +E  +H+  +   G    +  +N  ++GLC  G+++ AL +F+ M     E 
Sbjct  431   QAGDCDNAQEIFKHMVSS---GVPRGIRTYNTLLNGLCNNGKLEKALVIFQDMQKSEMEL  487

Query  1133  DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLH  954
             D  TYS ++ G+CKAG+     +L  S  + G+K        +I GL   G  ++A  L 
Sbjct  488   DIVTYSIIIEGMCKAGKVEDGWDLFSSLSLKGVKPNVVTYTTMISGLCRKGLKKDAYALF  547

Query  953   SELK  942
             S++K
Sbjct  548   SKMK  551


 Score =   209 bits (531),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/361 (30%), Positives = 195/361 (54%), Gaps = 0/361 (0%)
 Frame = -1

Query  2171  DVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLL  1992
             D++TY  +I   C    +D    +L ++ +  I+P+V+ YN++I    ++  ++  L+L 
Sbjct  208   DLLTYGAVINGVCKRSYMDLALDLLKKIEKGKIQPNVVIYNTIIDGLCKYRDVNDALNLF  267

Query  1991  EEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMN  1812
              EM   G+ PD ++YN+L++CL   G+  +A R   D+    I P  VTF+ L+      
Sbjct  268   NEMENKGVRPDVFTYNSLINCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKE  327

Query  1811  GYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITY  1632
             G   +A  L++E+ +    P  +TYN LI+GLC + R   A+ +   +V  G  PN +TY
Sbjct  328   GKLLEAEELYKEMINRSINPDNITYNSLINGLCLNDRLDEAKEMFTSMVSKGILPNVVTY  387

Query  1631  TTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIM  1452
             TT++    +S+R E+G+++  EM ++G + D+  Y T+I    +AG   +A +   +M+ 
Sbjct  388   TTLINGFCKSKRVEDGMELFREMSQRGIVGDTITYTTLIQGYFQAGDCDNAQEIFKHMVS  447

Query  1451  NGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKE  1272
             +G+   +  YNTL+N  C  GKL+ A ++  + ++   + D  T++III+G+CKAG +++
Sbjct  448   SGVPRGIRTYNTLLNGLCNNGKLEKALVIFQDMQKSEMELDIVTYSIIIEGMCKAGKVED  507

Query  1271  ALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSSLVHGLCK  1092
                  +   L G   N+V +   I GLC+ G    A ++F  M E      S   + L +
Sbjct  508   GWDLFSSLSLKGVKPNVVTYTTMISGLCRKGLKKDAYALFSKMKEDGPIPNSGPYNTLIR  567

Query  1091  A  1089
             A
Sbjct  568   A  568


 Score =   153 bits (386),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/309 (28%), Positives = 154/309 (50%), Gaps = 0/309 (0%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
             + N  +  LCK + +  A  +  +    GV  DV TYN+LI   C +        +L  M
Sbjct  246   IYNTIIDGLCKYRDVNDALNLFNEMENKGVRPDVFTYNSLINCLCNYGRWSDASRLLSDM  305

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
              E  I P+V+T+++LI +  + G L    +L +EM+   I PD  +YN+L++ L    + 
Sbjct  306   IERKINPNVVTFSALIDAFVKEGKLLEAEELYKEMINRSINPDNITYNSLINGLCLNDRL  365

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             DEA   F  +    I P  VT+  L++G C +   E  + LFRE+   G +   +TY  L
Sbjct  366   DEAKEMFTSMVSKGILPNVVTYTTLINGFCKSKRVEDGMELFREMSQRGIVGDTITYTTL  425

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             I G   +G    A+ +   +V  G      TY T++     + + E+ L I ++M++   
Sbjct  426   IQGYFQAGDCDNAQEIFKHMVSSGVPRGIRTYNTLLNGLCNNGKLEKALVIFQDMQKSEM  485

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
               D   Y  +I  + KAG+++D +D   ++ + G++ ++V Y T+I+  C++G   +AY 
Sbjct  486   ELDIVTYSIIIEGMCKAGKVEDGWDLFSSLSLKGVKPNVVTYTTMISGLCRKGLKKDAYA  545

Query  1367  LVVEAERKG  1341
             L  + +  G
Sbjct  546   LFSKMKEDG  554


 Score =   121 bits (303),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 134/262 (51%), Gaps = 1/262 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LC   +L++A+ +    +  G+  +VVTY TLI  +C    ++ G  +   M++
Sbjct  353   NSLINGLCLNDRLDEAKEMFTSMVSKGILPNVVTYTTLINGFCKSKRVEDGMELFREMSQ  412

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              GI  D ITY +LI    + G      ++ + M+  G+     +YNTL++ L   GK ++
Sbjct  413   RGIVGDTITYTTLIQGYFQAGDCDNAQEIFKHMVSSGVPRGIRTYNTLLNGLCNNGKLEK  472

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   FQD+   ++    VT++I++ G+C  G  E    LF  L   G  P +VTY  +I 
Sbjct  473   ALVIFQDMQKSEMELDIVTYSIIIEGMCKAGKVEDGWDLFSSLSLKGVKPNVVTYTTMIS  532

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC  G    A  L +++ + G  PN+  Y T+++   R       +++++EMR   +  
Sbjct  533   GLCRKGLKKDAYALFSKMKEDGPIPNSGPYNTLIRAYLRDGDEVTSVKLIKEMRSCKFCG  592

Query  1541  DSFAYCTVISFLIKAGRMKDAY  1476
             D+ +  ++++ ++  GR+  ++
Sbjct  593   DA-STISLVTNMLHDGRLDKSF  613


 Score =   116 bits (291),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 92/358 (26%), Positives = 160/358 (45%), Gaps = 29/358 (8%)
 Frame = -1

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             K D+A   F ++      P  V F+ LLS +      +  + +  E+   G    L TYN
Sbjct  59    KLDDAIGLFGEMVKSRPFPSIVDFSKLLSAIAKMKKFDVVISMGEEMHKLGIRHDLYTYN  118

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             ILI+  C S + + A  +L ++  +G+ P+ +T +T++       R  + + +L++M   
Sbjct  119   ILINCFCRSSQLSSAFAILGKMTKLGHEPSIVTLSTLLNGYCHGNRISDAVSLLDQMVEL  178

Query  1553  GY-------------------------IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
             GY                         + D   Y  VI+ + K   M  A D +  +   
Sbjct  179   GYKPDTVTFNTLIHGLFLNNKASEAVALVDLLTYGAVINGVCKRSYMDLALDLLKKIEKG  238

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
              I+ ++V YNT+I+  CK   +++A  L  E E KG   D +T+  +I+ LC  G   +A
Sbjct  239   KIQPNVVIYNTIIDGLCKYRDVNDALNLFNEMENKGVRPDVFTYNSLINCLCNYGRWSDA  298

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHG  1101
              R L+       + N+V F+  ID   K G++  A  ++K M  +    D  TY+SL++G
Sbjct  299   SRLLSDMIERKINPNVVTFSALIDAFVKEGKLLEAEELYKEMINRSINPDNITYNSLING  358

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             LC   R   A E+  S +  G+         +I+G   S  +++  +L  E+    I+
Sbjct  359   LCLNDRLDEAKEMFTSMVSKGILPNVVTYTTLINGFCKSKRVEDGMELFREMSQRGIV  416


 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 103/224 (46%), Gaps = 0/224 (0%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
              CK+K++E    +  +  + G+  D +TY TLI  Y      D    I   M   G+   
Sbjct  394   FCKSKRVEDGMELFREMSQRGIVGDTITYTTLIQGYFQAGDCDNAQEIFKHMVSSGVPRG  453

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             + TYN+L+     +G L + L + ++M +  +  D  +Y+ ++  + + GK ++ +  F 
Sbjct  454   IRTYNTLLNGLCNNGKLEKALVIFQDMQKSEMELDIVTYSIIIEGMCKAGKVEDGWDLFS  513

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
              +    + P  VT+  ++SGLC  G  + A  LF ++K  G IP    YN LI      G
Sbjct  514   SLSLKGVKPNVVTYTTMISGLCRKGLKKDAYALFSKMKEDGPIPNSGPYNTLIRAYLRDG  573

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQIL  1572
                 + +L+ E+    +  +A T + +       R  +  L++L
Sbjct  574   DEVTSVKLIKEMRSCKFCGDASTISLVTNMLHDGRLDKSFLEML  617



>ref|XP_006826435.1| hypothetical protein AMTR_s00004p00168920 [Amborella trichopoda]
 gb|ERM93672.1| hypothetical protein AMTR_s00004p00168920 [Amborella trichopoda]
Length=735

 Score =   226 bits (575),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 145/505 (29%), Positives = 245/505 (49%), Gaps = 59/505 (12%)
 Frame = -1

Query  2294  RIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYC------  2133
             ++  R S   LNI +  LCK +Q+ +A  +     +  +  DVVTYNTLI   C      
Sbjct  151   KLGYRFSVIQLNIVMRGLCKERQVARAIELFQVMEKQKLLPDVVTYNTLINGLCKSMLFE  210

Query  2132  -------------CFVGI----------------DAGYSILHRMNEVGIKPDVITYNSLI  2040
                          C+  I                +   ++L  M+  G+ PDV+TY++++
Sbjct  211   EALTLCKEMRKRECYPNIVTYTTLIDGLSKDGRTEQAMNLLGEMHRKGLNPDVVTYSAIV  270

Query  2039  ASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIP  1860
                   G+  + ++L  EM E  I P+  +Y++L+H L + G+  +A   F  +    + 
Sbjct  271   NGLCNKGLFDKAIELFHEMSEKRISPNVVTYSSLIHGLCKNGQWQDATEMFNGMLESGLQ  330

Query  1859  PCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRL  1680
             P  +T+  L+ GLC +G   +A+ L   +   G  P  VTYN+LI+GLC  G+   A   
Sbjct  331   PDAITYTGLVDGLCKDGRVPQAMQLLNTMMEKGEEPDTVTYNVLINGLCKEGQMGDAMNY  390

Query  1679  LNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF--------------  1542
             + ++++ G  P+ +T+ T+M    R  + EE +++L+ M   G+I               
Sbjct  391   MGKMIERGNMPDVVTFNTLMVGFCRIGKVEESVKLLQHMLDGGFISYAPGSVVFIDKKHR  450

Query  1541  ------DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
                   D   Y T++  L K  R+ +A      M   G+  +LV YN LI+ +CK  +L+
Sbjct  451   NCCVEPDIMTYNTLVHGLCKECRVDEAVQLCQKMAERGVACNLVTYNMLIDGFCKVHQLN  510

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              A ML+ +   KGF+   +T++I+IDGLCK G ++ A + L   +  G   N   +N  +
Sbjct  511   EALMLLQQMGDKGFELTSFTYSILIDGLCKNGKIETAKKLLYDMQSHGLVPNQRDYNTLL  570

Query  1199  DGLCKVGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
             D LCKVG++++A+S+F  M+E  C     T++ L+ G+C+AG    A E+L   I  G  
Sbjct  571   DALCKVGDLEHAMSLFLVMNEGGCEPDVITFNILIDGMCRAGNLNDAKEMLNEMIQRGFI  630

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKL  957
                     +I+GL   G + +A+ L
Sbjct  631   PDIVTYSIIINGLSKVGDMDDAKGL  655


 Score =   215 bits (547),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 137/461 (30%), Positives = 229/461 (50%), Gaps = 24/461 (5%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
             +L+  + C C  +    A  V+    ++G    V+  N ++   C    +     +   M
Sbjct  125   ILHTLLNCFCHTRMTHSAFGVLGLIQKLGYRFSVIQLNIVMRGLCKERQVARAIELFQVM  184

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
              +  + PDV+TYN+LI    +  +    L L +EM +    P+  +Y TL+  L + G+ 
Sbjct  185   EKQKLLPDVVTYNTLINGLCKSMLFEEALTLCKEMRKRECYPNIVTYTTLIDGLSKDGRT  244

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             ++A     ++    + P  VT++ +++GLC  G  +KA+ LF E+      P +VTY+ L
Sbjct  245   EQAMNLLGEMHRKGLNPDVVTYSAIVNGLCNKGLFDKAIELFHEMSEKRISPNVVTYSSL  304

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             IHGLC +G+W  A  + N +++ G  P+AITYT ++    +  R  + +Q+L  M  KG 
Sbjct  305   IHGLCKNGQWQDATEMFNGMLESGLQPDAITYTGLVDGLCKDGRVPQAMQLLNTMMEKGE  364

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
               D+  Y  +I+ L K G+M DA + +G MI  G   D+V +NTL+  +C+ GK++ +  
Sbjct  365   EPDTVTYNVLINGLCKEGQMGDAMNYMGKMIERGNMPDVVTFNTLMVGFCRIGKVEESVK  424

Query  1367  L----------------VVEAERKGFDC----DKYTHTIIIDGLCKAGNMKEALRHLNCT  1248
             L                VV  ++K  +C    D  T+  ++ GLCK   + EA++     
Sbjct  425   LLQHMLDGGFISYAPGSVVFIDKKHRNCCVEPDIMTYNTLVHGLCKECRVDEAVQLCQKM  484

Query  1247  KLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRF  1080
                G   NLV +N  IDG CKV +++ AL + + M +K      FTYS L+ GLCK G+ 
Sbjct  485   AERGVACNLVTYNMLIDGFCKVHQLNEALMLLQQMGDKGFELTSFTYSILIDGLCKNGKI  544

Query  1079  RVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
               A +LL      G+   + D   ++D L   G ++ A  L
Sbjct  545   ETAKKLLYDMQSHGLVPNQRDYNTLLDALCKVGDLEHAMSL  585


 Score =   193 bits (491),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 132/450 (29%), Positives = 214/450 (48%), Gaps = 24/450 (5%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             V  LC     +KA  +  +     +  +VVTY++LI   C          + + M E G+
Sbjct  270   VNGLCNKGLFDKAIELFHEMSEKRISPNVVTYSSLIHGLCKNGQWQDATEMFNGMLESGL  329

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             +PD ITY  L+    + G + + + LL  M+E G  PDT +YN L++ L + G+  +A  
Sbjct  330   QPDAITYTGLVDGLCKDGRVPQAMQLLNTMMEKGEEPDTVTYNVLINGLCKEGQMGDAMN  389

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFI--------------  1755
             +   +      P  VTFN L+ G C  G  E+++ L + +   GFI              
Sbjct  390   YMGKMIERGNMPDVVTFNTLMVGFCRIGKVEESVKLLQHMLDGGFISYAPGSVVFIDKKH  449

Query  1754  ------PQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRF  1593
                   P ++TYN L+HGLC   R   A +L  ++ + G   N +TY  ++    +  + 
Sbjct  450   RNCCVEPDIMTYNTLVHGLCKECRVDEAVQLCQKMAERGVACNLVTYNMLIDGFCKVHQL  509

Query  1592  EEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTL  1413
              E L +L++M  KG+   SF Y  +I  L K G+++ A   + +M  +G+  +   YNTL
Sbjct  510   NEALMLLQQMGDKGFELTSFTYSILIDGLCKNGKIETAKKLLYDMQSHGLVPNQRDYNTL  569

Query  1412  INLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF  1233
             ++  CK G L++A  L +     G + D  T  I+IDG+C+AGN+ +A   LN     GF
Sbjct  570   LDALCKVGDLEHAMSLFLVMNEGGCEPDVITFNILIDGMCRAGNLNDAKEMLNEMIQRGF  629

Query  1232  DSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASE  1065
               ++V ++  I+GL KVG++D A  + + M  K    D   Y SL+ G    G       
Sbjct  630   IPDIVTYSIIINGLSKVGDMDDAKGLLEKMIAKGLSPDACIYDSLLKGFWAKGDVEEFMR  689

Query  1064  LLLSCIIGGMKILKSDRQAVIDGLQHSGFI  975
             LL      G+++       ++D L   G I
Sbjct  690   LLHGMAAQGVRLDDKLESTILDCLSGDGRI  719


 Score =   166 bits (419),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 179/367 (49%), Gaps = 4/367 (1%)
 Frame = -1

Query  2126  VGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSY  1947
             V +    +IL+ M +   KP   T  SL+ S +R G   + L + + +    ILPD    
Sbjct  67    VKLKEAVTILNSMLQSNSKPSSFTCFSLLDSLSRAGEHDKALSVYKSIATAEILPDINIL  126

Query  1946  NTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKH  1767
             +TL++C         A+     I         +  NI++ GLC      +A+ LF+ ++ 
Sbjct  127   HTLLNCFCHTRMTHSAFGVLGLIQKLGYRFSVIQLNIVMRGLCKERQVARAIELFQVMEK  186

Query  1766  SGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEE  1587
                +P +VTYN LI+GLC S  +  A  L  E+      PN +TYTT++    +  R E+
Sbjct  187   QKLLPDVVTYNTLINGLCKSMLFEEALTLCKEMRKRECYPNIVTYTTLIDGLSKDGRTEQ  246

Query  1586  GLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
              + +L EM RKG   D   Y  +++ L   G    A +    M    I  ++V Y++LI+
Sbjct  247   AMNLLGEMHRKGLNPDVVTYSAIVNGLCNKGLFDKAIELFHEMSEKRISPNVVTYSSLIH  306

Query  1406  LYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDS  1227
               CK G+  +A  +       G   D  T+T ++DGLCK G + +A++ LN     G + 
Sbjct  307   GLCKNGQWQDATEMFNGMLESGLQPDAITYTGLVDGLCKDGRVPQAMQLLNTMMEKGEEP  366

Query  1226  NLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELL  1059
             + V +N  I+GLCK G++  A++    M E+    D  T+++L+ G C+ G+   + +LL
Sbjct  367   DTVTYNVLINGLCKEGQMGDAMNYMGKMIERGNMPDVVTFNTLMVGFCRIGKVEESVKLL  426

Query  1058  LSCIIGG  1038
                + GG
Sbjct  427   QHMLDGG  433


 Score =   149 bits (377),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 158/326 (48%), Gaps = 4/326 (1%)
 Frame = -1

Query  2045  LIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGD  1866
             +++    H  L   + +L  ML+    P +++  +L+  L R G+ D+A   ++ I   +
Sbjct  59    IVSLCKSHVKLKEAVTILNSMLQSNSKPSSFTCFSLLDSLSRAGEHDKALSVYKSIATAE  118

Query  1865  IPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPAR  1686
             I P     + LL+  C    T  A  +   ++  G+   ++  NI++ GLC   + A A 
Sbjct  119   ILPDINILHTLLNCFCHTRMTHSAFGVLGLIQKLGYRFSVIQLNIVMRGLCKERQVARAI  178

Query  1685  RLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFL  1506
              L   +      P+ +TY T++    +S  FEE L + +EMR++    +   Y T+I  L
Sbjct  179   ELFQVMEKQKLLPDVVTYNTLINGLCKSMLFEEALTLCKEMRKRECYPNIVTYTTLIDGL  238

Query  1505  IKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDK  1326
              K GR + A + +G M   G+  D+V Y+ ++N  C +G  D A  L  E   K    + 
Sbjct  239   SKDGRTEQAMNLLGEMHRKGLNPDVVTYSAIVNGLCNKGLFDKAIELFHEMSEKRISPNV  298

Query  1325  YTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKS  1146
              T++ +I GLCK G  ++A    N     G   + + +   +DGLCK G V  A+ +  +
Sbjct  299   VTYSSLIHGLCKNGQWQDATEMFNGMLESGLQPDAITYTGLVDGLCKDGRVPQAMQLLNT  358

Query  1145  M----DEKDCFTYSSLVHGLCKAGRF  1080
             M    +E D  TY+ L++GLCK G+ 
Sbjct  359   MMEKGEEPDTVTYNVLINGLCKEGQM  384


 Score =   134 bits (336),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 90/355 (25%), Positives = 159/355 (45%), Gaps = 20/355 (6%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N+ +  LCK  Q+  A   +   I  G   DVVT+NTL+  +C    ++    +L  M +
Sbjct  372   NVLINGLCKEGQMGDAMNYMGKMIERGNMPDVVTFNTLMVGFCRIGKVEESVKLLQHMLD  431

Query  2081  VG--------------------IKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILP  1962
              G                    ++PD++TYN+L+    +   +   + L ++M E G+  
Sbjct  432   GGFISYAPGSVVFIDKKHRNCCVEPDIMTYNTLVHGLCKECRVDEAVQLCQKMAERGVAC  491

Query  1961  DTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLF  1782
             +  +YN L+    ++ + +EA    Q +          T++IL+ GLC NG  E A  L 
Sbjct  492   NLVTYNMLIDGFCKVHQLNEALMLLQQMGDKGFELTSFTYSILIDGLCKNGKIETAKKLL  551

Query  1781  RELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRS  1602
              +++  G +P    YN L+  LC  G    A  L   + + G  P+ IT+  ++    R+
Sbjct  552   YDMQSHGLVPNQRDYNTLLDALCKVGDLEHAMSLFLVMNEGGCEPDVITFNILIDGMCRA  611

Query  1601  RRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAY  1422
                 +  ++L EM ++G+I D   Y  +I+ L K G M DA   +  MI  G+  D   Y
Sbjct  612   GNLNDAKEMLNEMIQRGFIPDIVTYSIIINGLSKVGDMDDAKGLLEKMIAKGLSPDACIY  671

Query  1421  NTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHL  1257
             ++L+  +  +G ++    L+     +G   D    + I+D L   G +   +  L
Sbjct  672   DSLLKGFWAKGDVEEFMRLLHGMAAQGVRLDDKLESTILDCLSGDGRISTFMESL  726


 Score = 84.7 bits (208),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 89/174 (51%), Gaps = 0/174 (0%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
              L++   +I +  LCK  ++E A+ ++ D    G+  +   YNTL+ A C    ++   S
Sbjct  525   ELTSFTYSILIDGLCKNGKIETAKKLLYDMQSHGLVPNQRDYNTLLDALCKVGDLEHAMS  584

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +   MNE G +PDVIT+N LI    R G L+   ++L EM++ G +PD  +Y+ +++ L 
Sbjct  585   LFLVMNEGGCEPDVITFNILIDGMCRAGNLNDAKEMLNEMIQRGFIPDIVTYSIIINGLS  644

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             ++G  D+A    + +    + P    ++ LL G    G  E+ + L   +   G
Sbjct  645   KVGDMDDAKGLLEKMIAKGLSPDACIYDSLLKGFWAKGDVEEFMRLLHGMAAQG  698



>ref|XP_010530346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=636

 Score =   224 bits (570),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 136/445 (31%), Positives = 230/445 (52%), Gaps = 4/445 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             L+I +   C++ Q+    +V+   I+ G    V+T+NTLI  +C    +    S + +M 
Sbjct  124   LSILINAFCRSGQVVLGLSVLGKIIKKGYKPHVITFNTLINGFCIQGKLSVVLSWVDQMV  183

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             + G KPDV+TYN+L+    R G +S  + L+++ML++G  PD  +Y T+++ + + G   
Sbjct  184   QEGYKPDVVTYNTLVNGLCREGRVSEAVSLVDKMLKMGYQPDVVTYGTVVNGICKSGDCA  243

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A      +   +I      +++++ GLC  G+ + AL LF ++   G  P +VTY+ LI
Sbjct  244   LALNLLMKMEERNIEVDVKIYSMIIDGLCKGGHIDDALSLFEKMDSKGIAPNVVTYSCLI  303

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLC   RW  A RLLN++      PN +T+  ++    +  +F E  ++ EEM R+G +
Sbjct  304   NGLCVFDRWNDAVRLLNDMAKRKIFPNVVTFNILIDAFVKEGKFLEAKELYEEMIRRGLV  363

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
               +  Y ++I  L    R+ +A      MI  G   + V +N LIN YCK  K+D   ML
Sbjct  364   PTTLTYNSLIDGLCMQNRLDEAKQLFDFMINRGCYPNAVTFNCLINGYCKCNKVDEGVML  423

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E  R+G   D  T++ +I G  +AGN+K A +  +  +  G D +LV +   +DGLCK
Sbjct  424   FHEMPRRGLVGDTCTYSTLIQGFFRAGNVKVAQKLFSEMQSQGVDLDLVTYAIMLDGLCK  483

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G++D AL ++  ++      D F ++ ++HGLCK      A  L       G+++    
Sbjct  484   NGKLDEALGLYCQLETSGIDLDIFVHNVMMHGLCKGDMVDEALGLFNKLSDKGVELDVIT  543

Query  1016  RQAVIDGLQHSGFIQEARKLHSELK  942
                +I G   +  + EA KL   +K
Sbjct  544   YNTMITGFCGTSLLGEADKLFKNMK  568


 Score =   209 bits (533),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 125/405 (31%), Positives = 205/405 (51%), Gaps = 4/405 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  V  LC+  ++ +A +++   +++G   DVVTY T++   C         ++L +M E
Sbjct  195   NTLVNGLCREGRVSEAVSLVDKMLKMGYQPDVVTYGTVVNGICKSGDCALALNLLMKMEE  254

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I+ DV  Y+ +I    + G +   L L E+M   GI P+  +Y+ L++ L    + ++
Sbjct  255   RNIEVDVKIYSMIIDGLCKGGHIDDALSLFEKMDSKGIAPNVVTYSCLINGLCVFDRWND  314

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A R   D+    I P  VTFNIL+      G   +A  L+ E+   G +P  +TYN LI 
Sbjct  315   AVRLLNDMAKRKIFPNVVTFNILIDAFVKEGKFLEAKELYEEMIRRGLVPTTLTYNSLID  374

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC   R   A++L + +++ G  PNA+T+  ++    +  + +EG+ +  EM R+G + 
Sbjct  375   GLCMQNRLDEAKQLFDFMINRGCYPNAVTFNCLINGYCKCNKVDEGVMLFHEMPRRGLVG  434

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D+  Y T+I    +AG +K A      M   G++LDLV Y  +++  CK GKLD A  L 
Sbjct  435   DTCTYSTLIQGFFRAGNVKVAQKLFSEMQSQGVDLDLVTYAIMLDGLCKNGKLDEALGLY  494

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              + E  G D D + H +++ GLCK   + EAL   N     G + +++ +N  I G C  
Sbjct  495   CQLETSGIDLDIFVHNVMMHGLCKGDMVDEALGLFNKLSDKGVELDVITYNTMITGFCGT  554

Query  1181  GEVDYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASELL  1059
               +  A  +FK+M +  C     TY+ L+ G  K G      EL+
Sbjct  555   SLLGEADKLFKNMKKIGCMPDDCTYNVLIRGHLKGGHVATVIELI  599


 Score =   166 bits (421),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 119/417 (29%), Positives = 199/417 (48%), Gaps = 4/417 (1%)
 Frame = -1

Query  2168  VVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLE  1989
             +V +N L+T+       D   S+  RM  + +  D  T + LI +  R G +   L +L 
Sbjct  86    IVDFNKLLTSIAKMKRYDVVISLCKRMELLRVSHDDCTLSILINAFCRSGQVVLGLSVLG  145

Query  1988  EMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNG  1809
             ++++ G  P   ++NTL++     GK      +   +      P  VT+N L++GLC  G
Sbjct  146   KIIKKGYKPHVITFNTLINGFCIQGKLSVVLSWVDQMVQEGYKPDVVTYNTLVNGLCREG  205

Query  1808  YTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYT  1629
                +A+ L  ++   G+ P +VTY  +++G+C SG  A A  LL ++ +     +   Y+
Sbjct  206   RVSEAVSLVDKMLKMGYQPDVVTYGTVVNGICKSGDCALALNLLMKMEERNIEVDVKIYS  265

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
              I+    +    ++ L + E+M  KG   +   Y  +I+ L    R  DA   + +M   
Sbjct  266   MIIDGLCKGGHIDDALSLFEKMDSKGIAPNVVTYSCLINGLCVFDRWNDAVRLLNDMAKR  325

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
              I  ++V +N LI+ + KEGK   A  L  E  R+G      T+  +IDGLC    + EA
Sbjct  326   KIFPNVVTFNILIDAFVKEGKFLEAKELYEEMIRRGLVPTTLTYNSLIDGLCMQNRLDEA  385

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHG  1101
              +  +     G   N V FNC I+G CK  +VD  + +F  M  +    D  TYS+L+ G
Sbjct  386   KQLFDFMINRGCYPNAVTFNCLINGYCKCNKVDEGVMLFHEMPRRGLVGDTCTYSTLIQG  445

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
               +AG  +VA +L       G+ +       ++DGL  +G + EA  L+ +L+ S I
Sbjct  446   FFRAGNVKVAQKLFSEMQSQGVDLDLVTYAIMLDGLCKNGKLDEALGLYCQLETSGI  502


 Score =   154 bits (390),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 96/363 (26%), Positives = 176/363 (48%), Gaps = 0/363 (0%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             +  K+ ++ +  LCK   ++ A ++       G+  +VVTY+ LI   C F   +    +
Sbjct  259   VDVKIYSMIIDGLCKGGHIDDALSLFEKMDSKGIAPNVVTYSCLINGLCVFDRWNDAVRL  318

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             L+ M +  I P+V+T+N LI +  + G      +L EEM+  G++P T +YN+L+  L  
Sbjct  319   LNDMAKRKIFPNVVTFNILIDAFVKEGKFLEAKELYEEMIRRGLVPTTLTYNSLIDGLCM  378

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
               + DEA + F  +      P  VTFN L++G C     ++ +MLF E+   G +    T
Sbjct  379   QNRLDEAKQLFDFMINRGCYPNAVTFNCLINGYCKCNKVDEGVMLFHEMPRRGLVGDTCT  438

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             Y+ LI G   +G    A++L +E+   G + + +TY  ++    ++ + +E L +  ++ 
Sbjct  439   YSTLIQGFFRAGNVKVAQKLFSEMQSQGVDLDLVTYAIMLDGLCKNGKLDEALGLYCQLE  498

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
               G   D F +  ++  L K   + +A      +   G+ELD++ YNT+I  +C    L 
Sbjct  499   TSGIDLDIFVHNVMMHGLCKGDMVDEALGLFNKLSDKGVELDVITYNTMITGFCGTSLLG  558

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
              A  L    ++ G   D  T+ ++I G  K G++   +  +   +  GF S++      +
Sbjct  559   EADKLFKNMKKIGCMPDDCTYNVLIRGHLKGGHVATVIELIREMRSCGFSSDVSTMEMVV  618

Query  1199  DGL  1191
             D L
Sbjct  619   DML  621


 Score =   118 bits (296),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 83/291 (29%), Positives = 147/291 (51%), Gaps = 8/291 (3%)
 Frame = -1

Query  1799  KALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIM  1620
             +A+ LF ++  S  +P +V +N L+  +    R+     L   +  +  + +  T + ++
Sbjct  69    EAVALFDQMVRSHPLPSIVDFNKLLTSIAKMKRYDVVISLCKRMELLRVSHDDCTLSILI  128

Query  1619  KCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIE  1440
                 RS +   GL +L ++ +KGY      + T+I+     G++      V  M+  G +
Sbjct  129   NAFCRSGQVVLGLSVLGKIIKKGYKPHVITFNTLINGFCIQGKLSVVLSWVDQMVQEGYK  188

Query  1439  LDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRH  1260
              D+V YNTL+N  C+EG++  A  LV +  + G+  D  T+  +++G+CK+G+   AL  
Sbjct  189   PDVVTYNTLVNGLCREGRVSEAVSLVDKMLKMGYQPDVVTYGTVVNGICKSGDCALALNL  248

Query  1259  LNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCK  1092
             L   +    + ++  ++  IDGLCK G +D ALS+F+ MD K    +  TYS L++GLC 
Sbjct  249   LMKMEERNIEVDVKIYSMIIDGLCKGGHIDDALSLFEKMDSKGIAPNVVTYSCLINGLCV  308

Query  1091  AGRFRVASELLLSCIIGGMKILKS--DRQAVIDGLQHSGFIQEARKLHSEL  945
               R+  A  LL    +   KI  +      +ID     G   EA++L+ E+
Sbjct  309   FDRWNDAVRLLND--MAKRKIFPNVVTFNILIDAFVKEGKFLEAKELYEEM  357


 Score =   108 bits (271),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/267 (27%), Positives = 122/267 (46%), Gaps = 1/267 (0%)
 Frame = -1

Query  2276  STKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSIL  2097
             +T   N  +  LC   +L++A+ +    I  G   + VT+N LI  YC    +D G  + 
Sbjct  365   TTLTYNSLIDGLCMQNRLDEAKQLFDFMINRGCYPNAVTFNCLINGYCKCNKVDEGVMLF  424

Query  2096  HRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRL  1917
             H M   G+  D  TY++LI    R G +     L  EM   G+  D  +Y  ++  L + 
Sbjct  425   HEMPRRGLVGDTCTYSTLIQGFFRAGNVKVAQKLFSEMQSQGVDLDLVTYAIMLDGLCKN  484

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTY  1737
             GK DEA   +  +    I       N+++ GLC     ++AL LF +L   G    ++TY
Sbjct  485   GKLDEALGLYCQLETSGIDLDIFVHNVMMHGLCKGDMVDEALGLFNKLSDKGVELDVITY  544

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRR  1557
             N +I G C +     A +L   +  IG  P+  TY  +++   +       ++++ EMR 
Sbjct  545   NTMITGFCGTSLLGEADKLFKNMKKIGCMPDDCTYNVLIRGHLKGGHVATVIELIREMRS  604

Query  1556  KGYIFDSFAYCTVISFLIKAGRMKDAY  1476
              G+  D      V+  L+  GR++ ++
Sbjct  605   CGFSSDVSTMEMVVDMLLD-GRLEKSF  630


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/235 (25%), Positives = 104/235 (44%), Gaps = 4/235 (2%)
 Frame = -1

Query  2258  ITVACL----CKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHR  2091
             +T  CL    CK  ++++   +  +  R G+  D  TY+TLI  +     +     +   
Sbjct  402   VTFNCLINGYCKCNKVDEGVMLFHEMPRRGLVGDTCTYSTLIQGFFRAGNVKVAQKLFSE  461

Query  2090  MNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGK  1911
             M   G+  D++TY  ++    ++G L   L L  ++   GI  D + +N +MH L +   
Sbjct  462   MQSQGVDLDLVTYAIMLDGLCKNGKLDEALGLYCQLETSGIDLDIFVHNVMMHGLCKGDM  521

Query  1910  PDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNI  1731
              DEA   F  +    +    +T+N +++G C      +A  LF+ +K  G +P   TYN+
Sbjct  522   VDEALGLFNKLSDKGVELDVITYNTMITGFCGTSLLGEADKLFKNMKKIGCMPDDCTYNV  581

Query  1730  LIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             LI G    G  A    L+ E+   G++ +  T   ++      R  +  L +L  
Sbjct  582   LIRGHLKGGHVATVIELIREMRSCGFSSDVSTMEMVVDMLLDGRLEKSFLDLLSR  636



>ref|XP_004501057.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Cicer arietinum]
Length=591

 Score =   223 bits (567),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 140/474 (30%), Positives = 242/474 (51%), Gaps = 16/474 (3%)
 Frame = -1

Query  2333  MLRLGD*HLE*MFRIKSRLSTK-LLNITVAC------LCKAKQLEKAETVIIDGIRVGVP  2175
             ++R+G   LE  FR   R+S +  +   +AC       CK  + +KA  V+      G  
Sbjct  100   LVRIG--KLEQGFRFLERMSYQGDMPDVIACTNLIRQFCKTGKTKKATRVLQILEDSGAV  157

Query  2174  ADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDL  1995
              DV+TYN LI+ YC    ++    +L RM+   + PDV+TYN+++ S    G L + +++
Sbjct  158   PDVITYNVLISGYCKSGEVEEALQVLERMS---VSPDVVTYNTILRSLCDSGKLKQAMEV  214

Query  1994  LEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCM  1815
             L+  LE    PD  +Y  L+  + +     EA + F  +      P   TFN+L++G C 
Sbjct  215   LDRQLERVCYPDVITYTILIEAICKESGVGEAMKLFDAMRIKGCKPDVFTFNVLINGFCK  274

Query  1814  NGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAIT  1635
              G  +KA+    ++   G  P ++T+NI++  LC +GRW  A  LL++++  G +P+ +T
Sbjct  275   EGRLDKAIKFLNDMSSYGCEPNVITHNIILRSLCGTGRWRDAESLLSDMLRKGCSPSVVT  334

Query  1634  YTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMI  1455
             +  ++    R       + ILE+M+  G   +S +Y  ++    +  +M  A + +  M+
Sbjct  335   FNILINFLCRKGLLGRAIDILEKMKNHGCTPNSLSYNPLLHGFCQEKKMDRAIEYLEVMV  394

Query  1454  MNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMK  1275
               G   D+V YNTL+   CK+GK+D A  L+ +   KG      T+  +I GL K G  +
Sbjct  395   SRGCYPDIVTYNTLLTALCKDGKVDVALELLNQLSSKGCSPVAITYNTVIGGLSKVGATE  454

Query  1274  EALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE----KDCFTYSSLV  1107
              A++ L+     G   ++V ++  I G  + G+VD A+ +F  ++      +  TY+S++
Sbjct  455   RAMKLLDEMCRKGLKPDVVTYSSLIAGFIREGKVDVAIKIFHELERLGIRANAVTYNSIM  514

Query  1106  HGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
              GLCKA R   A +LL   I  G K  ++    +I+G+ + G  +EA  L +EL
Sbjct  515   SGLCKARRTSHAIDLLARMIAKGCKPTEATYTILIEGIAYEGLAEEALGLLNEL  568


 Score =   171 bits (433),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 112/384 (29%), Positives = 182/384 (47%), Gaps = 2/384 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGI-RVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             N  +  LC + +L++A  V+   + RV  P DV+TY  LI A C   G+     +   M 
Sbjct  196   NTILRSLCDSGKLKQAMEVLDRQLERVCYP-DVITYTILIEAICKESGVGEAMKLFDAMR  254

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
               G KPDV T+N LI    + G L + +  L +M   G  P+  ++N ++  L   G+  
Sbjct  255   IKGCKPDVFTFNVLINGFCKEGRLDKAIKFLNDMSSYGCEPNVITHNIILRSLCGTGRWR  314

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             +A     D+      P  VTFNIL++ LC  G   +A+ +  ++K+ G  P  ++YN L+
Sbjct  315   DAESLLSDMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMKNHGCTPNSLSYNPLL  374

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             HG C   +   A   L  +V  G  P+ +TY T++    +  + +  L++L ++  KG  
Sbjct  375   HGFCQEKKMDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKDGKVDVALELLNQLSSKGCS  434

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
               +  Y TVI  L K G  + A   +  M   G++ D+V Y++LI  + +EGK+D A  +
Sbjct  435   PVAITYNTVIGGLSKVGATERAMKLLDEMCRKGLKPDVVTYSSLIAGFIREGKVDVAIKI  494

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E ER G   +  T+  I+ GLCKA     A+  L      G       +   I+G+  
Sbjct  495   FHELERLGIRANAVTYNSIMSGLCKARRTSHAIDLLARMIAKGCKPTEATYTILIEGIAY  554

Query  1184  VGEVDYALSVFKSMDEKDCFTYSS  1113
              G  + AL +   +  +     SS
Sbjct  555   EGLAEEALGLLNELSSRGFVKKSS  578


 Score =   162 bits (411),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 109/376 (29%), Positives = 182/376 (48%), Gaps = 7/376 (2%)
 Frame = -1

Query  2060  ITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQD  1881
             I  NS +    R G L +    LE M   G +PD  +   L+    + GK  +A R  Q 
Sbjct  91    IDNNSYLVKLVRIGKLEQGFRFLERMSYQGDMPDVIACTNLIRQFCKTGKTKKATRVLQI  150

Query  1880  IFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGR  1701
             +      P  +T+N+L+SG C +G  E+AL +   +  S   P +VTYN ++  LC+SG+
Sbjct  151   LEDSGAVPDVITYNVLISGYCKSGEVEEALQVLERMSVS---PDVVTYNTILRSLCDSGK  207

Query  1700  WAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCT  1521
                A  +L+  ++    P+ ITYT +++   +     E +++ + MR KG   D F +  
Sbjct  208   LKQAMEVLDRQLERVCYPDVITYTILIEAICKESGVGEAMKLFDAMRIKGCKPDVFTFNV  267

Query  1520  VISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKG  1341
             +I+   K GR+  A   + +M   G E +++ +N ++   C  G+  +A  L+ +  RKG
Sbjct  268   LINGFCKEGRLDKAIKFLNDMSSYGCEPNVITHNIILRSLCGTGRWRDAESLLSDMLRKG  327

Query  1340  FDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYAL  1161
                   T  I+I+ LC+ G +  A+  L   K  G   N +++N  + G C+  ++D A+
Sbjct  328   CSPSVVTFNILINFLCRKGLLGRAIDILEKMKNHGCTPNSLSYNPLLHGFCQEKKMDRAI  387

Query  1160  SVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGL  993
                + M  + C+    TY++L+  LCK G+  VA ELL      G   +      VI GL
Sbjct  388   EYLEVMVSRGCYPDIVTYNTLLTALCKDGKVDVALELLNQLSSKGCSPVAITYNTVIGGL  447

Query  992   QHSGFIQEARKLHSEL  945
                G  + A KL  E+
Sbjct  448   SKVGATERAMKLLDEM  463


 Score =   114 bits (285),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/257 (28%), Positives = 124/257 (48%), Gaps = 0/257 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M R     S    NI +  LC+   L +A  ++      G   + ++YN L+  +C    
Sbjct  323   MLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMKNHGCTPNSLSYNPLLHGFCQEKK  382

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +D     L  M   G  PD++TYN+L+ +  + G +   L+LL ++   G  P   +YNT
Sbjct  383   MDRAIEYLEVMVSRGCYPDIVTYNTLLTALCKDGKVDVALELLNQLSSKGCSPVAITYNT  442

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             ++  L ++G  + A +   ++    + P  VT++ L++G    G  + A+ +F EL+  G
Sbjct  443   VIGGLSKVGATERAMKLLDEMCRKGLKPDVVTYSSLIAGFIREGKVDVAIKIFHELERLG  502

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
                  VTYN ++ GLC + R + A  LL  ++  G  P   TYT +++        EE L
Sbjct  503   IRANAVTYNSIMSGLCKARRTSHAIDLLARMIAKGCKPTEATYTILIEGIAYEGLAEEAL  562

Query  1580  QILEEMRRKGYIFDSFA  1530
              +L E+  +G++  S A
Sbjct  563   GLLNELSSRGFVKKSSA  579


 Score = 63.2 bits (152),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 64/128 (50%), Gaps = 1/128 (1%)
 Frame = -1

Query  1439  LDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRH  1260
             L+ +  N+ +    + GKL+  +  +     +G   D    T +I   CK G  K+A R 
Sbjct  88    LEEIDNNSYLVKLVRIGKLEQGFRFLERMSYQGDMPDVIACTNLIRQFCKTGKTKKATRV  147

Query  1259  LNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMD-EKDCFTYSSLVHGLCKAGR  1083
             L   +  G   +++ +N  I G CK GEV+ AL V + M    D  TY++++  LC +G+
Sbjct  148   LQILEDSGAVPDVITYNVLISGYCKSGEVEEALQVLERMSVSPDVVTYNTILRSLCDSGK  207

Query  1082  FRVASELL  1059
              + A E+L
Sbjct  208   LKQAMEVL  215



>emb|CED92696.1| PPR protein [Arabidopsis thaliana]
Length=629

 Score =   223 bits (569),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 131/444 (30%), Positives = 229/444 (52%), Gaps = 4/444 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI + C C+  QL  A  V+   +++G   D+VT ++L+  YC    I    +++ +M E
Sbjct  119   NILINCFCRRSQLPLALAVLGKMMKLGYEPDIVTLSSLLNGYCHSKRISDAVALVDQMVE  178

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G KP+ +T+N+LI     H   S  + L++ M+  G  PD ++Y T+++   + G  D 
Sbjct  179   MGYKPNTVTFNTLIHGLFLHNKASEAVALIDRMVAKGCQPDLFTYGTVVNGFCKRGDIDL  238

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A    + +  G I    V +N ++ GLC   + + A  LF +++  G  P + TYN LI+
Sbjct  239   ALSLLKKMEKGKIEADVVIYNTIIDGLCKYKHIDDAFDLFNKMETKGIRPDVFTYNSLIN  298

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LCN GRW+ A RLL+ +++   NPN +T++ ++    +  +  E  ++ +EM ++    
Sbjct  299   CLCNYGRWSDASRLLSNMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDP  358

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D F Y ++I+      R+ +A      MI      ++V YNTLI  +CK  +++    L 
Sbjct  359   DIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELF  418

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E  ++G   +  T+  +I GL +AG+   A +        G   +++ ++  +DGLCK 
Sbjct  419   REMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKY  478

Query  1181  GEVDYALSVF----KSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G+++ AL VF    KS  E D +TY+ ++ G+CKAG+     +L  S  + G+K      
Sbjct  479   GKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVIIY  538

Query  1013  QAVIDGLQHSGFIQEARKLHSELK  942
               +I G    G  +EA  L  E+K
Sbjct  539   TTMISGFCRKGLKEEADALFREMK  562


 Score =   202 bits (513),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 129/474 (27%), Positives = 230/474 (49%), Gaps = 26/474 (5%)
 Frame = -1

Query  2414  CYLRRSQSSPRLPLAASAL----------------QLATRTCPMLRLGD*--HLE*MFRI  2289
             C+ RRSQ    LPLA + L                 L    C   R+ D    ++ M  +
Sbjct  124   CFCRRSQ----LPLALAVLGKMMKLGYEPDIVTLSSLLNGYCHSKRISDAVALVDQMVEM  179

Query  2288  KSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAG  2109
               + +T   N  +  L    +  +A  +I   +  G   D+ TY T++  +C    ID  
Sbjct  180   GYKPNTVTFNTLIHGLFLHNKASEAVALIDRMVAKGCQPDLFTYGTVVNGFCKRGDIDLA  239

Query  2108  YSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHC  1929
              S+L +M +  I+ DV+ YN++I    ++  +    DL  +M   GI PD ++YN+L++C
Sbjct  240   LSLLKKMEKGKIEADVVIYNTIIDGLCKYKHIDDAFDLFNKMETKGIRPDVFTYNSLINC  299

Query  1928  LFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQ  1749
             L   G+  +A R   ++    I P  VTF+ L+      G   +A  L+ E+      P 
Sbjct  300   LCNYGRWSDASRLLSNMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPD  359

Query  1748  LVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILE  1569
             + TY+ LI+G C   R   A+ +   ++     PN +TY T++K   +++R EEG+++  
Sbjct  360   IFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELFR  419

Query  1568  EMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEG  1389
             EM ++G + ++  Y T+I  L +AG    A      M+ +G+  D++ Y+ L++  CK G
Sbjct  420   EMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKYG  479

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
             KL+ A ++    ++   + D YT+ I+I+G+CKAG +++         L G   N++ + 
Sbjct  480   KLEKALVVFEYLQKSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVIIYT  539

Query  1208  CCIDGLCKVGEVDYALSVFKSMDE----KDCFTYSSLVHGLCKAGRFRVASELL  1059
               I G C+ G  + A ++F+ M E     D   Y++L+    + G    ++EL+
Sbjct  540   TMISGFCRKGLKEEADALFREMKEDGTLPDSGCYNTLIRARLRDGDKAASAELI  593


 Score =   159 bits (403),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/343 (27%), Positives = 173/343 (50%), Gaps = 0/343 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCK K ++ A  +       G+  DV TYN+LI   C +        +L  M E
Sbjct  259   NTIIDGLCKYKHIDDAFDLFNKMETKGIRPDVFTYNSLINCLCNYGRWSDASRLLSNMIE  318

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I P+V+T+++LI +  + G L     L +EM++  I PD ++Y++L++      + DE
Sbjct  319   RKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDE  378

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F+ +   D  P  VT+N L+ G C     E+ + LFRE+   G +   VTYN LI 
Sbjct  379   AKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLIQ  438

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GL  +G    A+++  ++V  G  P+ ITY+ ++    +  + E+ L + E +++     
Sbjct  439   GLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEP  498

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D + Y  +I  + KAG+++D +D   ++ + G++ +++ Y T+I+ +C++G  + A  L 
Sbjct  499   DIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALF  558

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF  1233
              E +  G   D   +  +I    + G+   +   +   +  GF
Sbjct  559   REMKEDGTLPDSGCYNTLIRARLRDGDKAASAELIKEMRSCGF  601


 Score =   150 bits (380),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/295 (31%), Positives = 151/295 (51%), Gaps = 1/295 (0%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             +    K  +L +AE +  + I+  +  D+ TY++LI  +C    +D    +   M     
Sbjct  332   IDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDC  391

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
              P+V+TYN+LI    +   +   ++L  EM + G++ +T +YNTL+  LF+ G  D A +
Sbjct  392   FPNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQK  451

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
              F+ +    +PP  +T++ILL GLC  G  EKAL++F  L+ S   P + TYNI+I G+C
Sbjct  452   IFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMC  511

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
              +G+      L   L   G  PN I YTT++    R    EE   +  EM+  G + DS 
Sbjct  512   KAGKVEDGWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTLPDSG  571

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
              Y T+I   ++ G    + + +  M   G   D    + +IN+   +G+L+ +Y+
Sbjct  572   CYNTLIRARLRDGDKAASAELIKEMRSCGFVGDASTISMVINM-LHDGRLEKSYL  625


 Score =   120 bits (300),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 156/331 (47%), Gaps = 5/331 (2%)
 Frame = -1

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             K D+A   F ++      P  V FN LLS +      +  + L   +++      L +YN
Sbjct  60    KLDDAVDLFGEMVQSRPLPSIVEFNKLLSAIAKMNKFDLVISLGERMQNLRISYDLYSYN  119

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             ILI+  C   +   A  +L +++ +GY P+ +T ++++     S+R  + + ++++M   
Sbjct  120   ILINCFCRRSQLPLALAVLGKMMKLGYEPDIVTLSSLLNGYCHSKRISDAVALVDQMVEM  179

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
             GY  ++  + T+I  L    +  +A   +  M+  G + DL  Y T++N +CK G +D A
Sbjct  180   GYKPNTVTFNTLIHGLFLHNKASEAVALIDRMVAKGCQPDLFTYGTVVNGFCKRGDIDLA  239

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               L+ + E+   + D   +  IIDGLCK  ++ +A    N  +  G   ++  +N  I+ 
Sbjct  240   LSLLKKMEKGKIEADVVIYNTIIDGLCKYKHIDDAFDLFNKMETKGIRPDVFTYNSLINC  299

Query  1193  LCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
             LC  G    A  +  +M E+    +  T+S+L+    K G+   A +L    I   +   
Sbjct  300   LCNYGRWSDASRLLSNMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPD  359

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELKLSK  933
                  ++I+G      + EA+ +  EL +SK
Sbjct  360   IFTYSSLINGFCMHDRLDEAKHMF-ELMISK  389


 Score =   112 bits (281),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 113/230 (49%), Gaps = 0/230 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +   CKAK++E+   +  +  + G+  + VTYNTLI         D    I  +M  
Sbjct  399   NTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVS  458

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G+ PD+ITY+ L+    ++G L + L + E + +  + PD ++YN ++  + + GK ++
Sbjct  459   DGVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMCKAGKVED  518

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
              +  F  +    + P  + +  ++SG C  G  E+A  LFRE+K  G +P    YN LI 
Sbjct  519   GWDLFCSLSLKGVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTLPDSGCYNTLIR  578

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQIL  1572
                  G  A +  L+ E+   G+  +A T + ++      R  +  L++L
Sbjct  579   ARLRDGDKAASAELIKEMRSCGFVGDASTISMVINMLHDGRLEKSYLEML  628



>ref|XP_008375656.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Malus domestica]
Length=755

 Score =   225 bits (574),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 142/485 (29%), Positives = 242/485 (50%), Gaps = 39/485 (8%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             +L+   LNI V  LCKA+++E  +  + D    GV +D+VTYNTLI AYC    ++  + 
Sbjct  260   QLNVYTLNIMVNALCKARKIESVKFFLSDMEEKGVFSDIVTYNTLINAYCREGLLEEAFQ  319

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             + + M+  G+KP++ TYN+++    + G  +R  +LL+EML+ G+ PDT +YNT++    
Sbjct  320   LKNSMSSKGLKPELFTYNAIMNGLCKVGNYARAKELLDEMLQGGLNPDTTTYNTMLFESC  379

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             R G   EA   F ++    + P  V+F+ L+     N   ++AL+ FR++K +G +P  V
Sbjct  380   RKGDILEAEEIFHEMSLRGVVPDIVSFSSLIGVFSRNKNIDRALLYFRDMKRAGLVPDNV  439

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
              Y ILI G C  G    A +L +E+++ G   + +T+ TI+    R +   +  ++  EM
Sbjct  440   IYTILIDGYCRKGMMLEALKLRDEMLEQGCTIDVVTFNTILNGLCREKMLSDADELFNEM  499

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
               +G I D + + T+I    K G M  + +    M    I+ D+V YNTL + +CK G++
Sbjct  500   LERGVIPDFYTFTTLIHGYCKHGNMTKSLNLFDAMTNGNIKPDIVTYNTLFDGFCKLGEM  559

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D A  L  +   +    +  ++ I+I+G C  GN+ EA R  +     G    LV  N  
Sbjct  560   DKAKELWGDMVSRRILPNHISYGILINGFCSLGNVHEAFRLWDQMIEEGIKPTLVTCNTV  619

Query  1202  IDGLCKVGE-----------------------------------VDYALSVFKSMDEK--  1134
             I G C+ G+                                   ++ A S  + M+++  
Sbjct  620   IKGYCRSGDTTKADEFLGKMISKGVVPDSITYNTLINGYVKEENLNKAFSSVQEMEKQGI  679

Query  1133  --DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARK  960
               D FTY+ +++G C+ GR   A  +L   I  G+K  +S   ++I+G      ++EA +
Sbjct  680   LSDQFTYNIILNGFCRQGRMHEAELVLRKMIERGVKPDRSTYTSLINGHVTQDNLKEAFR  739

Query  959   LHSEL  945
              H E+
Sbjct  740   FHDEM  744


 Score =   167 bits (422),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 116/432 (27%), Positives = 199/432 (46%), Gaps = 15/432 (3%)
 Frame = -1

Query  2309  LE*MFRIKSRLSTKLL-------NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNT  2151
             LE  F++K+ +S+K L       N  +  LCK     +A+ ++ + ++ G+  D  TYNT
Sbjct  314   LEEAFQLKNSMSSKGLKPELFTYNAIMNGLCKVGNYARAKELLDEMLQGGLNPDTTTYNT  373

Query  2150  LITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVG  1971
             ++   C    I     I H M+  G+ PD+++++SLI   +R+  + R L    +M   G
Sbjct  374   MLFESCRKGDILEAEEIFHEMSLRGVVPDIVSFSSLIGVFSRNKNIDRALLYFRDMKRAG  433

Query  1970  ILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKAL  1791
             ++PD   Y  L+    R G   EA +   ++         VTFN +L+GLC       A 
Sbjct  434   LVPDNVIYTILIDGYCRKGMMLEALKLRDEMLEQGCTIDVVTFNTILNGLCREKMLSDAD  493

Query  1790  MLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCC  1611
              LF E+   G IP   T+  LIHG C  G    +  L + + +    P+ +TY T+    
Sbjct  494   ELFNEMLERGVIPDFYTFTTLIHGYCKHGNMTKSLNLFDAMTNGNIKPDIVTYNTLFDGF  553

Query  1610  FRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDL  1431
              +    ++  ++  +M  +  + +  +Y  +I+     G + +A+     MI  GI+  L
Sbjct  554   CKLGEMDKAKELWGDMVSRRILPNHISYGILINGFCSLGNVHEAFRLWDQMIEEGIKPTL  613

Query  1430  VAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNC  1251
             V  NT+I  YC+ G    A   + +   KG   D  T+  +I+G  K  N+ +A   +  
Sbjct  614   VTCNTVIKGYCRSGDTTKADEFLGKMISKGVVPDSITYNTLINGYVKEENLNKAFSSVQE  673

Query  1250  TKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGR  1083
              +  G  S+   +N  ++G C+ G +  A  V + M E+    D  TY+SL++G      
Sbjct  674   MEKQGILSDQFTYNIILNGFCRQGRMHEAELVLRKMIERGVKPDRSTYTSLINGHVTQDN  733

Query  1082  ----FRVASELL  1059
                 FR   E+L
Sbjct  734   LKEAFRFHDEML  745


 Score =   161 bits (408),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 112/438 (26%), Positives = 197/438 (45%), Gaps = 4/438 (1%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
             + ++ V    +AK+L +         R G    +   N+L+         D  + +   +
Sbjct  195   IFDLFVRTYVQAKKLREGFEAFQVFRRKGFCVSINACNSLLGGLVKVGWFDLAWVVYGEV  254

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
                GI+ +V T N ++ +  +   +      L +M E G+  D  +YNTL++   R G  
Sbjct  255   VSSGIQLNVYTLNIMVNALCKARKIESVKFFLSDMEEKGVFSDIVTYNTLINAYCREGLL  314

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             +EA++    +    + P   T+N +++GLC  G   +A  L  E+   G  P   TYN +
Sbjct  315   EEAFQLKNSMSSKGLKPELFTYNAIMNGLCKVGNYARAKELLDEMLQGGLNPDTTTYNTM  374

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             +   C  G    A  + +E+   G  P+ +++++++    R++  +  L    +M+R G 
Sbjct  375   LFESCRKGDILEAEEIFHEMSLRGVVPDIVSFSSLIGVFSRNKNIDRALLYFRDMKRAGL  434

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
             + D+  Y  +I    + G M +A      M+  G  +D+V +NT++N  C+E  L +A  
Sbjct  435   VPDNVIYTILIDGYCRKGMMLEALKLRDEMLEQGCTIDVVTFNTILNGLCREKMLSDADE  494

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLC  1188
             L  E   +G   D YT T +I G CK GNM ++L   +         ++V +N   DG C
Sbjct  495   LFNEMLERGVIPDFYTFTTLIHGYCKHGNMTKSLNLFDAMTNGNIKPDIVTYNTLFDGFC  554

Query  1187  KVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             K+GE+D A  ++  M  +    +  +Y  L++G C  G    A  L    I  G+K    
Sbjct  555   KLGEMDKAKELWGDMVSRRILPNHISYGILINGFCSLGNVHEAFRLWDQMIEEGIKPTLV  614

Query  1019  DRQAVIDGLQHSGFIQEA  966
                 VI G   SG   +A
Sbjct  615   TCNTVIKGYCRSGDTTKA  632


 Score =   156 bits (394),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/310 (28%), Positives = 154/310 (50%), Gaps = 0/310 (0%)
 Frame = -1

Query  2258  ITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEV  2079
             I +   C+   + +A  +  + +  G   DVVT+NT++   C    +     + + M E 
Sbjct  443   ILIDGYCRKGMMLEALKLRDEMLEQGCTIDVVTFNTILNGLCREKMLSDADELFNEMLER  502

Query  2078  GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEA  1899
             G+ PD  T+ +LI    +HG +++ L+L + M    I PD  +YNTL     +LG+ D+A
Sbjct  503   GVIPDFYTFTTLIHGYCKHGNMTKSLNLFDAMTNGNIKPDIVTYNTLFDGFCKLGEMDKA  562

Query  1898  YRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
                + D+    I P  +++ IL++G C  G   +A  L+ ++   G  P LVT N +I G
Sbjct  563   KELWGDMVSRRILPNHISYGILINGFCSLGNVHEAFRLWDQMIEEGIKPTLVTCNTVIKG  622

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFD  1539
              C SG    A   L +++  G  P++ITY T++    +     +    ++EM ++G + D
Sbjct  623   YCRSGDTTKADEFLGKMISKGVVPDSITYNTLINGYVKEENLNKAFSSVQEMEKQGILSD  682

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVV  1359
              F Y  +++   + GRM +A   +  MI  G++ D   Y +LIN +  +  L  A+    
Sbjct  683   QFTYNIILNGFCRQGRMHEAELVLRKMIERGVKPDRSTYTSLINGHVTQDNLKEAFRFHD  742

Query  1358  EAERKGFDCD  1329
             E  ++GF  D
Sbjct  743   EMLQRGFVPD  752



>emb|CED92697.1| PPR protein [Arabidopsis thaliana]
Length=630

 Score =   223 bits (568),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 133/444 (30%), Positives = 226/444 (51%), Gaps = 4/444 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             +I + C C+  QL  A  V+   +++G   D+VT N+L+  +C    I    S++ +M E
Sbjct  120   SILINCFCRRSQLSLALAVLAKMMKLGYEPDIVTLNSLLNGFCHGNRISDAVSLVGQMVE  179

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G +PD  T+N+LI    RH   S  + L++ M+  G  PD  +Y T+++ L + G  D 
Sbjct  180   MGYQPDSFTFNTLIHGLFRHNRASEAVALVDRMVVKGCQPDLVTYGTVVNGLCKRGDIDL  239

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A    + +  G I P  V +N ++  LC       AL LF E+ + G  P +VTYN LI 
Sbjct  240   ALSLLKKMEQGKIEPGVVIYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIR  299

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LCN GRW+ A RLL+++++   NPN +T++ ++    +  +  E  ++ +EM ++    
Sbjct  300   CLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDSFVKEGKLVEAEKLYDEMIKRSIDP  359

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D F Y ++I+      R+ +A      MI      ++V YNTLI  +CK  +++    L 
Sbjct  360   DIFTYSSLINGYCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELF  419

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E  ++G   +  T+T +I G  +A +   A         +G   N++ +N  +DGLCK 
Sbjct  420   REMSQRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSVGVHPNILTYNILLDGLCKN  479

Query  1181  GEVDYALSVF----KSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G++  A+ VF    +S  E D +TY+ ++ G+CKAG+     EL  +  + G+       
Sbjct  480   GKLAKAMVVFEYLQRSTMEPDIYTYNIMIEGMCKAGKVEDGWELFCNLSLKGVSPNVIAY  539

Query  1013  QAVIDGLQHSGFIQEARKLHSELK  942
               +I G    G  +EA  L  ++K
Sbjct  540   NTMISGFCRKGSKEEADSLLKKMK  563


 Score =   202 bits (515),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 116/406 (29%), Positives = 206/406 (51%), Gaps = 4/406 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              N  +  L +  +  +A  ++   +  G   D+VTY T++   C    ID   S+L +M 
Sbjct  189   FNTLIHGLFRHNRASEAVALVDRMVVKGCQPDLVTYGTVVNGLCKRGDIDLALSLLKKME  248

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             +  I+P V+ YN++I +   +  ++  L+L  EM   GI P+  +YN+L+ CL   G+  
Sbjct  249   QGKIEPGVVIYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWS  308

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             +A R   D+    I P  VTF+ L+      G   +A  L+ E+      P + TY+ LI
Sbjct  309   DASRLLSDMIERKINPNVVTFSALIDSFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLI  368

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +G C   R   A+ +   ++     PN +TY T++K   +++R EEG+++  EM ++G +
Sbjct  369   NGYCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLV  428

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              ++  Y T+I    +A    +A      M+  G+  +++ YN L++  CK GKL  A ++
Sbjct  429   GNTVTYTTLIHGFFQARDCDNAQMVFKQMVSVGVHPNILTYNILLDGLCKNGKLAKAMVV  488

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
                 +R   + D YT+ I+I+G+CKAG +++         L G   N++A+N  I G C+
Sbjct  489   FEYLQRSTMEPDIYTYNIMIEGMCKAGKVEDGWELFCNLSLKGVSPNVIAYNTMISGFCR  548

Query  1184  VGEVDYALSVFKSMDE----KDCFTYSSLVHGLCKAGRFRVASELL  1059
              G  + A S+ K M E     +  TY++L+    + G    ++EL+
Sbjct  549   KGSKEEADSLLKKMKEDGPLPNSGTYNTLIRARLRDGNREASAELI  594


 Score =   164 bits (416),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 93/345 (27%), Positives = 176/345 (51%), Gaps = 0/345 (0%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
             + N  +  LC  K +  A  +  +    G+  +VVTYN+LI   C +        +L  M
Sbjct  258   IYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWSDASRLLSDM  317

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
              E  I P+V+T+++LI S  + G L     L +EM++  I PD ++Y++L++      + 
Sbjct  318   IERKINPNVVTFSALIDSFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGYCMHDRL  377

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             DEA   F+ +   D  P  VT+N L+ G C     E+ + LFRE+   G +   VTY  L
Sbjct  378   DEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYTTL  437

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             IHG   +     A+ +  ++V +G +PN +TY  ++    ++ +  + + + E ++R   
Sbjct  438   IHGFFQARDCDNAQMVFKQMVSVGVHPNILTYNILLDGLCKNGKLAKAMVVFEYLQRSTM  497

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
               D + Y  +I  + KAG+++D ++   N+ + G+  +++AYNT+I+ +C++G  + A  
Sbjct  498   EPDIYTYNIMIEGMCKAGKVEDGWELFCNLSLKGVSPNVIAYNTMISGFCRKGSKEEADS  557

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF  1233
             L+ + +  G   +  T+  +I    + GN + +   +   +  GF
Sbjct  558   LLKKMKEDGPLPNSGTYNTLIRARLRDGNREASAELIKEMRSCGF  602


 Score =   157 bits (396),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/370 (27%), Positives = 176/370 (48%), Gaps = 0/370 (0%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             V  LCK   ++ A +++    +  +   VV YNT+I A C +  ++   ++   M+  GI
Sbjct  228   VNGLCKRGDIDLALSLLKKMEQGKIEPGVVIYNTIIDALCNYKNVNDALNLFTEMDNKGI  287

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             +P+V+TYNSLI     +G  S    LL +M+E  I P+  +++ L+    + GK  EA +
Sbjct  288   RPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDSFVKEGKLVEAEK  347

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
              + ++    I P   T++ L++G CM+   ++A  +F  +      P +VTYN LI G C
Sbjct  348   LYDEMIKRSIDPDIFTYSSLINGYCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFC  407

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
              + R      L  E+   G   N +TYTT++   F++R  +    + ++M   G   +  
Sbjct  408   KAKRVEEGMELFREMSQRGLVGNTVTYTTLIHGFFQARDCDNAQMVFKQMVSVGVHPNIL  467

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              Y  ++  L K G++  A      +  + +E D+  YN +I   CK GK+++ + L    
Sbjct  468   TYNILLDGLCKNGKLAKAMVVFEYLQRSTMEPDIYTYNIMIEGMCKAGKVEDGWELFCNL  527

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEV  1173
               KG   +   +  +I G C+ G+ +EA   L   K  G   N   +N  I    + G  
Sbjct  528   SLKGVSPNVIAYNTMISGFCRKGSKEEADSLLKKMKEDGPLPNSGTYNTLIRARLRDGNR  587

Query  1172  DYALSVFKSM  1143
             + +  + K M
Sbjct  588   EASAELIKEM  597


 Score =   142 bits (359),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/295 (29%), Positives = 148/295 (50%), Gaps = 1/295 (0%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             +    K  +L +AE +  + I+  +  D+ TY++LI  YC    +D    +   M     
Sbjct  333   IDSFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGYCMHDRLDEAKHMFELMISKDC  392

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
              P+V+TYN+LI    +   +   ++L  EM + G++ +T +Y TL+H  F+    D A  
Sbjct  393   FPNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYTTLIHGFFQARDCDNAQM  452

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
              F+ +    + P  +T+NILL GLC NG   KA+++F  L+ S   P + TYNI+I G+C
Sbjct  453   VFKQMVSVGVHPNILTYNILLDGLCKNGKLAKAMVVFEYLQRSTMEPDIYTYNIMIEGMC  512

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
              +G+      L   L   G +PN I Y T++    R    EE   +L++M+  G + +S 
Sbjct  513   KAGKVEDGWELFCNLSLKGVSPNVIAYNTMISGFCRKGSKEEADSLLKKMKEDGPLPNSG  572

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
              Y T+I   ++ G  + + + +  M   G   D      + N+   +G+LD +++
Sbjct  573   TYNTLIRARLRDGNREASAELIKEMRSCGFAGDASTIGLVTNM-LHDGRLDKSFL  626


 Score =   123 bits (308),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/288 (28%), Positives = 136/288 (47%), Gaps = 4/288 (1%)
 Frame = -1

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             K D+A   F D+      P  V F+ LLS +      +  + L  ++++ G    L TY+
Sbjct  61    KLDDAVNLFGDMVKSRPFPSIVEFSKLLSAIAKMNKFDLVISLGEQMQNLGISHNLYTYS  120

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             ILI+  C   + + A  +L +++ +GY P+ +T  +++       R  + + ++ +M   
Sbjct  121   ILINCFCRRSQLSLALAVLAKMMKLGYEPDIVTLNSLLNGFCHGNRISDAVSLVGQMVEM  180

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
             GY  DSF + T+I  L +  R  +A   V  M++ G + DLV Y T++N  CK G +D A
Sbjct  181   GYQPDSFTFNTLIHGLFRHNRASEAVALVDRMVVKGCQPDLVTYGTVVNGLCKRGDIDLA  240

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               L+ + E+   +     +  IID LC   N+ +AL         G   N+V +N  I  
Sbjct  241   LSLLKKMEQGKIEPGVVIYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRC  300

Query  1193  LCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASEL  1062
             LC  G    A  +   M E+    +  T+S+L+    K G+   A +L
Sbjct  301   LCNYGRWSDASRLLSDMIERKINPNVVTFSALIDSFVKEGKLVEAEKL  348



>ref|XP_007029263.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY09765.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 3 [Theobroma cacao]
Length=535

 Score =   221 bits (562),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 132/458 (29%), Positives = 231/458 (50%), Gaps = 4/458 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M  +  R S    +  V  + + K    A ++I     +G+  DV T N  +  +C    
Sbjct  1     MVGMHPRPSVMKFDQLVGAIVRMKHYPTALSLIRQMELLGIHPDVCTLNISLNCFCRLHR  60

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +D G+S+  +M ++GI+P ++T+ +LI      G +++ + L  +M++    P+   YNT
Sbjct  61    LDFGFSVFGKMLKLGIQPSIVTFFTLINGLCIGGEVAQAVRLFNDMVQEEYKPNVIHYNT  120

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             +++CL ++   + A RF + +      P   T++I++ GLC + +  +AL LF E+K  G
Sbjct  121   IVNCLCKISDTNGAIRFLKVMKKRGCEPNTTTYSIIIDGLCKDKHAAEALKLFSEMKGKG  180

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P +VTYN LIH +CNS +W    RLLNE+V     P+ +TY  ++    +  R  E  
Sbjct  181   IPPTVVTYNSLIHAMCNSCQWKVVTRLLNEMVANNCKPDVVTYNILVDALCKGGRVLEAQ  240

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
              I+E M + G+  D F Y ++++     G M +A   +  ++ +G  +D   YNT+IN Y
Sbjct  241   DIIERMIQLGFEPDMFTYNSLMNGYCGRGEMDEARKLLNFLVSSGYGVDAFTYNTVINGY  300

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CK  +++ A  L  E  + G   D  T+  +I G+   G +  A          G   + 
Sbjct  301   CKARRMNEAVELFHEMTQNGSIPDTVTYNTLISGMSLIGRLSAAQELFKEMGAHGTVPDK  360

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELLLS  1053
             + +   +DGLCK G+++ AL +F  M     E D   Y+ L++GLC+ G+ +VA +L  +
Sbjct  361   ITYFTLLDGLCKHGQINDALGLFHVMQNSGLEPDIVHYNILINGLCQVGQLKVARKLFYA  420

Query  1052  CIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKL  939
               + G+         +I GL   G   EA KL  ++++
Sbjct  421   LTVRGLHTNVYTYNIMIKGLCKEGLPNEAYKLLRKMEV  458


 Score =   167 bits (424),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 115/412 (28%), Positives = 182/412 (44%), Gaps = 35/412 (8%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             LC   ++ +A  +  D ++     +V+ YNT++   C     +     L  M + G +P+
Sbjct  90    LCIGGEVAQAVRLFNDMVQEEYKPNVIHYNTIVNCLCKISDTNGAIRFLKVMKKRGCEPN  149

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
               TY+ +I    +    +  L L  EM   GI P   +YN+L+H +    +     R   
Sbjct  150   TTTYSIIIDGLCKDKHAAEALKLFSEMKGKGIPPTVVTYNSLIHAMCNSCQWKVVTRLLN  209

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
             ++   +  P  VT+NIL+  LC  G   +A  +   +   GF P + TYN L++G C  G
Sbjct  210   EMVANNCKPDVVTYNILVDALCKGGRVLEAQDIIERMIQLGFEPDMFTYNSLMNGYCGRG  269

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYC  1524
                 AR+LLN LV  GY  +A TY T++    ++RR  E +++  EM + G I D+  Y 
Sbjct  270   EMDEARKLLNFLVSSGYGVDAFTYNTVINGYCKARRMNEAVELFHEMTQNGSIPDTVTYN  329

Query  1523  TVISF-----------------------------------LIKAGRMKDAYDCVGNMIMN  1449
             T+IS                                    L K G++ DA      M  +
Sbjct  330   TLISGMSLIGRLSAAQELFKEMGAHGTVPDKITYFTLLDGLCKHGQINDALGLFHVMQNS  389

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
             G+E D+V YN LIN  C+ G+L  A  L      +G   + YT+ I+I GLCK G   EA
Sbjct  390   GLEPDIVHYNILINGLCQVGQLKVARKLFYALTVRGLHTNVYTYNIMIKGLCKEGLPNEA  449

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSS  1113
              + L   ++ G   N  ++N  I G  +  ++     +   M +K    Y S
Sbjct  450   YKLLRKMEVDGCMPNSCSYNTMIQGCLQNNDISRVAQILHEMVKKGFSAYIS  501


 Score =   140 bits (352),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/286 (30%), Positives = 145/286 (51%), Gaps = 0/286 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI V  LCK  ++ +A+ +I   I++G   D+ TYN+L+  YC    +D    +L+ +  
Sbjct  224   NILVDALCKGGRVLEAQDIIERMIQLGFEPDMFTYNSLMNGYCGRGEMDEARKLLNFLVS  283

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G   D  TYN++I    +   ++  ++L  EM + G +PDT +YNTL+  +  +G+   
Sbjct  284   SGYGVDAFTYNTVINGYCKARRMNEAVELFHEMTQNGSIPDTVTYNTLISGMSLIGRLSA  343

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F+++      P  +T+  LL GLC +G    AL LF  +++SG  P +V YNILI+
Sbjct  344   AQELFKEMGAHGTVPDKITYFTLLDGLCKHGQINDALGLFHVMQNSGLEPDIVHYNILIN  403

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC  G+   AR+L   L   G + N  TY  ++K   +     E  ++L +M   G + 
Sbjct  404   GLCQVGQLKVARKLFYALTVRGLHTNVYTYNIMIKGLCKEGLPNEAYKLLRKMEVDGCMP  463

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINL  1404
             +S +Y T+I   ++   +      +  M+  G    +     L++L
Sbjct  464   NSCSYNTMIQGCLQNNDISRVAQILHEMVKKGFSAYISTAAMLVDL  509


 Score =   124 bits (312),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 151/320 (47%), Gaps = 0/320 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  +C + Q +    ++ + +      DVVTYN L+ A C    +     I+ RM +
Sbjct  189   NSLIHAMCNSCQWKVVTRLLNEMVANNCKPDVVTYNILVDALCKGGRVLEAQDIIERMIQ  248

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G +PD+ TYNSL+      G +     LL  ++  G   D ++YNT+++   +  + +E
Sbjct  249   LGFEPDMFTYNSLMNGYCGRGEMDEARKLLNFLVSSGYGVDAFTYNTVINGYCKARRMNE  308

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F ++      P  VT+N L+SG+ + G    A  LF+E+   G +P  +TY  L+ 
Sbjct  309   AVELFHEMTQNGSIPDTVTYNTLISGMSLIGRLSAAQELFKEMGAHGTVPDKITYFTLLD  368

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC  G+   A  L + + + G  P+ + Y  ++    +  + +   ++   +  +G   
Sbjct  369   GLCKHGQINDALGLFHVMQNSGLEPDIVHYNILINGLCQVGQLKVARKLFYALTVRGLHT  428

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             + + Y  +I  L K G   +AY  +  M ++G   +  +YNT+I    +   +     ++
Sbjct  429   NVYTYNIMIKGLCKEGLPNEAYKLLRKMEVDGCMPNSCSYNTMIQGCLQNNDISRVAQIL  488

Query  1361  VEAERKGFDCDKYTHTIIID  1302
              E  +KGF     T  +++D
Sbjct  489   HEMVKKGFSAYISTAAMLVD  508



>ref|XP_002971208.1| hypothetical protein SELMODRAFT_94745 [Selaginella moellendorffii]
 gb|EFJ27806.1| hypothetical protein SELMODRAFT_94745 [Selaginella moellendorffii]
Length=599

 Score =   222 bits (566),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 136/442 (31%), Positives = 223/442 (50%), Gaps = 14/442 (3%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N+ +   CK   LE+A  +I   I  G   DVVTYNT++   C    ++    + + M  
Sbjct  84    NVMIDASCKRGMLEEACDLIKKMIEDGHVPDVVTYNTVMDGLCKSSRVEEALLLFNEMER  143

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G  P+  ++N++I    +   + +   +  EM    I PD+WSY  L+  L + GK +E
Sbjct  144   LGCTPNRRSHNTIILGLCQQSKIDQACQVFHEMEAKDIPPDSWSYGILIDGLAKAGKLNE  203

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             AY+ FQ +    I P  VT+N+++ G+C+    ++AL LF+ ++  G  P   T+NILI 
Sbjct  204   AYKLFQRMLDSGITPSAVTYNVVIHGMCLAYTLDEALELFKSMRSKGCRPSRFTFNILID  263

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
               C  G+   A RLL  + D G+ P+ +TY+T++       R ++   +LE+M ++    
Sbjct  264   AHCKRGKLDEAFRLLKRMTDDGHVPDVVTYSTLISGLCSIARVDDARHLLEDMVKRQCKP  323

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
                   T+I  L KAGR+K+A + +  M+ +G   D+V YNTL++ +C+ G+ + A  L+
Sbjct  324   TVVTQNTLIHGLCKAGRIKEAREVLDAMVSSGQSPDVVTYNTLVHGHCRAGQTERARELL  383

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              +   +G   +  T+T ++ GLCKA  + EA       K  G   NL  +   I G C  
Sbjct  384   SDMVARGLAPNVVTYTALVSGLCKANRLPEACGVFAQMKSSGCAPNLFTYTALILGFCSA  443

Query  1181  GEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G+VD  L +F  M       D   Y +L   LCK+GR   A E+L      G + L+S+ 
Sbjct  444   GQVDGGLKLFGEMVCAGISPDHVVYGTLAAELCKSGRSARALEILRE----GRESLRSEA  499

Query  1013  QA------VIDGLQHSGFIQEA  966
                      +DGL  +G ++ A
Sbjct  500   WGDEVYRFAVDGLLEAGKMEMA  521


 Score =   216 bits (549),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 197/386 (51%), Gaps = 4/386 (1%)
 Frame = -1

Query  2090  MNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGK  1911
             MNE  + PD  +Y  LI    + G L+   +L +++L  G+ P T +Y +L+H L     
Sbjct  1     MNERNVSPDSWSYGILIDGLAKAGKLNDARNLFQKLLHSGVTPSTVAYTSLIHGLCMANS  60

Query  1910  PDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNI  1731
              D+A   F D+     PP PVT+N+++   C  G  E+A  L +++   G +P +VTYN 
Sbjct  61    FDDARELFADMNRRGCPPSPVTYNVMIDASCKRGMLEEACDLIKKMIEDGHVPDVVTYNT  120

Query  1730  LIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKG  1551
             ++ GLC S R   A  L NE+  +G  PN  ++ TI+    +  + ++  Q+  EM  K 
Sbjct  121   VMDGLCKSSRVEEALLLFNEMERLGCTPNRRSHNTIILGLCQQSKIDQACQVFHEMEAKD  180

Query  1550  YIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAY  1371
                DS++Y  +I  L KAG++ +AY     M+ +GI    V YN +I+  C    LD A 
Sbjct  181   IPPDSWSYGILIDGLAKAGKLNEAYKLFQRMLDSGITPSAVTYNVVIHGMCLAYTLDEAL  240

Query  1370  MLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGL  1191
              L      KG    ++T  I+ID  CK G + EA R L      G   ++V ++  I GL
Sbjct  241   ELFKSMRSKGCRPSRFTFNILIDAHCKRGKLDEAFRLLKRMTDDGHVPDVVTYSTLISGL  300

Query  1190  CKVGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             C +  VD A  + + M ++ C     T ++L+HGLCKAGR + A E+L + +  G     
Sbjct  301   CSIARVDDARHLLEDMVKRQCKPTVVTQNTLIHGLCKAGRIKEAREVLDAMVSSGQSPDV  360

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSEL  945
                  ++ G   +G  + AR+L S++
Sbjct  361   VTYNTLVHGHCRAGQTERARELLSDM  386


 Score =   199 bits (506),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 118/400 (30%), Positives = 197/400 (49%), Gaps = 4/400 (1%)
 Frame = -1

Query  2258  ITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEV  2079
             I +  L KA +L  A  +    +  GV    V Y +LI   C     D    +   MN  
Sbjct  15    ILIDGLAKAGKLNDARNLFQKLLHSGVTPSTVAYTSLIHGLCMANSFDDARELFADMNRR  74

Query  2078  GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEA  1899
             G  P  +TYN +I ++ + GML    DL+++M+E G +PD  +YNT+M  L +  + +EA
Sbjct  75    GCPPSPVTYNVMIDASCKRGMLEEACDLIKKMIEDGHVPDVVTYNTVMDGLCKSSRVEEA  134

Query  1898  YRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
                F ++      P   + N ++ GLC     ++A  +F E++     P   +Y ILI G
Sbjct  135   LLLFNEMERLGCTPNRRSHNTIILGLCQQSKIDQACQVFHEMEAKDIPPDSWSYGILIDG  194

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFD  1539
             L  +G+   A +L   ++D G  P+A+TY  ++     +   +E L++ + MR KG    
Sbjct  195   LAKAGKLNEAYKLFQRMLDSGITPSAVTYNVVIHGMCLAYTLDEALELFKSMRSKGCRPS  254

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVV  1359
              F +  +I    K G++ +A+  +  M  +G   D+V Y+TLI+  C   ++D+A  L+ 
Sbjct  255   RFTFNILIDAHCKRGKLDEAFRLLKRMTDDGHVPDVVTYSTLISGLCSIARVDDARHLLE  314

Query  1358  EAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVG  1179
             +  ++       T   +I GLCKAG +KEA   L+     G   ++V +N  + G C+ G
Sbjct  315   DMVKRQCKPTVVTQNTLIHGLCKAGRIKEAREVLDAMVSSGQSPDVVTYNTLVHGHCRAG  374

Query  1178  EVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVA  1071
             + + A  +   M  +    +  TY++LV GLCKA R   A
Sbjct  375   QTERARELLSDMVARGLAPNVVTYTALVSGLCKANRLPEA  414


 Score =   185 bits (469),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 203/445 (46%), Gaps = 6/445 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCK+ ++E+A  +  +  R+G   +  ++NT+I   C    ID    + H M  
Sbjct  119   NTVMDGLCKSSRVEEALLLFNEMERLGCTPNRRSHNTIILGLCQQSKIDQACQVFHEMEA  178

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I PD  +Y  LI    + G L+    L + ML+ GI P   +YN ++H +      DE
Sbjct  179   KDIPPDSWSYGILIDGLAKAGKLNEAYKLFQRMLDSGITPSAVTYNVVIHGMCLAYTLDE  238

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F+ +      P   TFNIL+   C  G  ++A  L + +   G +P +VTY+ LI 
Sbjct  239   ALELFKSMRSKGCRPSRFTFNILIDAHCKRGKLDEAFRLLKRMTDDGHVPDVVTYSTLIS  298

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC+  R   AR LL ++V     P  +T  T++    ++ R +E  ++L+ M   G   
Sbjct  299   GLCSIARVDDARHLLEDMVKRQCKPTVVTQNTLIHGLCKAGRIKEAREVLDAMVSSGQSP  358

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y T++    +AG+ + A + + +M+  G+  ++V Y  L++  CK  +L  A  + 
Sbjct  359   DVVTYNTLVHGHCRAGQTERARELLSDMVARGLAPNVVTYTALVSGLCKANRLPEACGVF  418

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              + +  G   + +T+T +I G C AG +   L+        G   + V +      LCK 
Sbjct  419   AQMKSSGCAPNLFTYTALILGFCSAGQVDGGLKLFGEMVCAGISPDHVVYGTLAAELCKS  478

Query  1181  GEVDYALSVFKSMDEK------DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             G    AL + +   E           Y   V GL +AG+  +A   +   + GG      
Sbjct  479   GRSARALEILREGRESLRSEAWGDEVYRFAVDGLLEAGKMEMALGFVRDMVRGGQLPAPE  538

Query  1019  DRQAVIDGLQHSGFIQEARKLHSEL  945
                +++ GL  SG   EAR +  E+
Sbjct  539   RCASLVAGLCKSGQGGEARAVLEEI  563


 Score =   143 bits (360),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 150/311 (48%), Gaps = 2/311 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             R S    NI +   CK  +L++A  ++      G   DVVTY+TLI+  C    +D    
Sbjct  252   RPSRFTFNILIDAHCKRGKLDEAFRLLKRMTDDGHVPDVVTYSTLISGLCSIARVDDARH  311

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +L  M +   KP V+T N+LI    + G +    ++L+ M+  G  PD  +YNTL+H   
Sbjct  312   LLEDMVKRQCKPTVVTQNTLIHGLCKAGRIKEAREVLDAMVSSGQSPDVVTYNTLVHGHC  371

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             R G+ + A     D+    + P  VT+  L+SGLC      +A  +F ++K SG  P L 
Sbjct  372   RAGQTERARELLSDMVARGLAPNVVTYTALVSGLCKANRLPEACGVFAQMKSSGCAPNLF  431

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TY  LI G C++G+     +L  E+V  G +P+ + Y T+     +S R    L+IL E 
Sbjct  432   TYTALILGFCSAGQVDGGLKLFGEMVCAGISPDHVVYGTLAAELCKSGRSARALEILREG  491

Query  1562  RR--KGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEG  1389
             R   +   +    Y   +  L++AG+M+ A   V +M+  G         +L+   CK G
Sbjct  492   RESLRSEAWGDEVYRFAVDGLLEAGKMEMALGFVRDMVRGGQLPAPERCASLVAGLCKSG  551

Query  1388  KLDNAYMLVVE  1356
             +   A  ++ E
Sbjct  552   QGGEARAVLEE  562


 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 125/295 (42%), Gaps = 39/295 (13%)
 Frame = -1

Query  2408  LRRSQSSPRLPLAASALQLATRTCPMLRLGD*H--LE*MFRIKSRLSTKLLNITVACLCK  2235
             L+R      +P   +   L +  C + R+ D    LE M + + + +    N  +  LCK
Sbjct  278   LKRMTDDGHVPDVVTYSTLISGLCSIARVDDARHLLEDMVKRQCKPTVVTQNTLIHGLCK  337

Query  2234  AKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVIT  2055
             A ++++A  V+   +  G   DVVTYNTL+  +C     +    +L  M   G+ P+V+T
Sbjct  338   AGRIKEAREVLDAMVSSGQSPDVVTYNTLVHGHCRAGQTERARELLSDMVARGLAPNVVT  397

Query  2054  YNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIF  1875
             Y +L++   +   L     +  +M   G  P+ ++Y  L+      G+ D   + F ++ 
Sbjct  398   YTALVSGLCKANRLPEACGVFAQMKSSGCAPNLFTYTALILGFCSAGQVDGGLKLFGEMV  457

Query  1874  WGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHS-----------------------  1764
                I P  V +  L + LC +G + +AL + RE + S                       
Sbjct  458   CAGISPDHVVYGTLAAELCKSGRSARALEILREGRESLRSEAWGDEVYRFAVDGLLEAGK  517

Query  1763  -----GFIPQLVTYN---------ILIHGLCNSGRWAPARRLLNELVDIGYNPNA  1641
                  GF+  +V             L+ GLC SG+   AR +L E++D+ Y   A
Sbjct  518   MEMALGFVRDMVRGGQLPAPERCASLVAGLCKSGQGGEARAVLEEIMDLAYGGKA  572



>ref|XP_010105594.1| hypothetical protein L484_003967 [Morus notabilis]
 gb|EXC05161.1| hypothetical protein L484_003967 [Morus notabilis]
Length=634

 Score =   223 bits (568),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 132/411 (32%), Positives = 213/411 (52%), Gaps = 4/411 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             MFR+K + S    NI +  LCK  +L+KA+  I     +GV  +VVTYNTLI  YC    
Sbjct  218   MFRLKIKSSVYTFNIMINVLCKEGKLKKAKEFIGSMEILGVKPNVVTYNTLIHGYCLRGR  277

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             I+    +   M   GI+ D  TY SLI    +   L    +L ++M+E+G++P   +YNT
Sbjct  278   IEGARMVFDAMRGKGIRLDSYTYGSLINGLCKERKLEEASELFDKMIEIGLVPSAVTYNT  337

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             ++      G  D+A+ +  ++    I     T+N+L+  L + G T +A  L +E+   G
Sbjct  338   MIDGYCNKGDLDKAFSYRDEMIKNGIKQTVSTYNLLIHALFLEGRTSEADGLVKEMGEKG  397

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
              +P  +TYNILI+G C  G+   A  L +E++  G     +TYT+++    R +R EE  
Sbjct  398   IVPDGITYNILINGCCRCGKAEKAFALHDEMLSKGIEATRVTYTSLVYVLSRQKRMEEAD  457

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             ++ ++M  KG + D   +  +I      G M  A+  +  M    +  D V YNTL+   
Sbjct  458   ELFQKMMSKGVLPDLVLFNALIDGHCGNGNMVRAFSLLKEMDKMNVPRDEVTYNTLMQGL  517

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             C++GK++ A  L+ E +R+G   D  ++  +I G  K G++K+A R  +    +GF+  L
Sbjct  518   CRQGKVEEARELLDEMKRRGIKPDHISYNTLISGYSKRGDVKDAFRVRDEMLSIGFNPTL  577

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRF  1080
             + +N  I G+CK  E D A  + K M  K    +  TY SL+  + K G+F
Sbjct  578   LTYNALIQGVCKTREGDLAEELLKEMVTKGFTPNDKTYDSLIESIGKDGKF  628


 Score =   189 bits (480),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 119/431 (28%), Positives = 208/431 (48%), Gaps = 4/431 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  ++   K+  LE A  +  +  R+ + + V T+N +I   C    +      +  M  
Sbjct  196   NDMLSLFSKSNMLEMAWLLYAEMFRLKIKSSVYTFNIMINVLCKEGKLKKAKEFIGSMEI  255

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G+KP+V+TYN+LI      G +     + + M   GI  D+++Y +L++ L +  K +E
Sbjct  256   LGVKPNVVTYNTLIHGYCLRGRIEGARMVFDAMRGKGIRLDSYTYGSLINGLCKERKLEE  315

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F  +    + P  VT+N ++ G C  G  +KA     E+  +G    + TYN+LIH
Sbjct  316   ASELFDKMIEIGLVPSAVTYNTMIDGYCNKGDLDKAFSYRDEMIKNGIKQTVSTYNLLIH  375

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              L   GR + A  L+ E+ + G  P+ ITY  ++  C R  + E+   + +EM  KG   
Sbjct  376   ALFLEGRTSEADGLVKEMGEKGIVPDGITYNILINGCCRCGKAEKAFALHDEMLSKGIEA  435

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
                 Y +++  L +  RM++A +    M+  G+  DLV +N LI+ +C  G +  A+ L+
Sbjct  436   TRVTYTSLVYVLSRQKRMEEADELFQKMMSKGVLPDLVLFNALIDGHCGNGNMVRAFSLL  495

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E ++     D+ T+  ++ GLC+ G ++EA   L+  K  G   + +++N  I G  K 
Sbjct  496   KEMDKMNVPRDEVTYNTLMQGLCRQGKVEEARELLDEMKRRGIKPDHISYNTLISGYSKR  555

Query  1181  GEVDYALSVFKSM----DEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G+V  A  V   M          TY++L+ G+CK     +A ELL   +  G        
Sbjct  556   GDVKDAFRVRDEMLSIGFNPTLLTYNALIQGVCKTREGDLAEELLKEMVTKGFTPNDKTY  615

Query  1013  QAVIDGLQHSG  981
              ++I+ +   G
Sbjct  616   DSLIESIGKDG  626


 Score =   172 bits (437),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 124/433 (29%), Positives = 203/433 (47%), Gaps = 11/433 (3%)
 Frame = -1

Query  2231  KQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITY  2052
             ++LE+A        R+ + + VV ++ LI A C        +     M E G+ P + T 
Sbjct  143   EELERARE------RLSIESAVV-FDFLIRACCELNKAKEAFECFWIMKEKGVVPKIETC  195

Query  2051  NSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFW  1872
             N +++  ++  ML     L  EM  + I    +++N +++ L + GK  +A  F   +  
Sbjct  196   NDMLSLFSKSNMLEMAWLLYAEMFRLKIKSSVYTFNIMINVLCKEGKLKKAKEFIGSMEI  255

Query  1871  GDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAP  1692
               + P  VT+N L+ G C+ G  E A M+F  ++  G      TY  LI+GLC   +   
Sbjct  256   LGVKPNVVTYNTLIHGYCLRGRIEGARMVFDAMRGKGIRLDSYTYGSLINGLCKERKLEE  315

Query  1691  ARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVIS  1512
             A  L +++++IG  P+A+TY T++         ++     +EM + G       Y  +I 
Sbjct  316   ASELFDKMIEIGLVPSAVTYNTMIDGYCNKGDLDKAFSYRDEMIKNGIKQTVSTYNLLIH  375

Query  1511  FLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDC  1332
              L   GR  +A   V  M   GI  D + YN LIN  C+ GK + A+ L  E   KG + 
Sbjct  376   ALFLEGRTSEADGLVKEMGEKGIVPDGITYNILINGCCRCGKAEKAFALHDEMLSKGIEA  435

Query  1331  DKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVF  1152
              + T+T ++  L +   M+EA          G   +LV FN  IDG C  G +  A S+ 
Sbjct  436   TRVTYTSLVYVLSRQKRMEEADELFQKMMSKGVLPDLVLFNALIDGHCGNGNMVRAFSLL  495

Query  1151  KSMDE----KDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHS  984
             K MD+    +D  TY++L+ GLC+ G+   A ELL      G+K        +I G    
Sbjct  496   KEMDKMNVPRDEVTYNTLMQGLCRQGKVEEARELLDEMKRRGIKPDHISYNTLISGYSKR  555

Query  983   GFIQEARKLHSEL  945
             G +++A ++  E+
Sbjct  556   GDVKDAFRVRDEM  568


 Score = 96.3 bits (238),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 106/220 (48%), Gaps = 9/220 (4%)
 Frame = -1

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKA----GRMKDAYDCVGNMIMNGIELDLVAYNTL  1413
             +I EE+ R      S     V  FLI+A     + K+A++C   M   G+   +   N +
Sbjct  140   EIFEELERARERL-SIESAVVFDFLIRACCELNKAKEAFECFWIMKEKGVVPKIETCNDM  198

Query  1412  INLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF  1233
             ++L+ K   L+ A++L  E  R       YT  I+I+ LCK G +K+A   +   +++G 
Sbjct  199   LSLFSKSNMLEMAWLLYAEMFRLKIKSSVYTFNIMINVLCKEGKLKKAKEFIGSMEILGV  258

Query  1232  DSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASE  1065
               N+V +N  I G C  G ++ A  VF +M  K    D +TY SL++GLCK  +   ASE
Sbjct  259   KPNVVTYNTLIHGYCLRGRIEGARMVFDAMRGKGIRLDSYTYGSLINGLCKERKLEEASE  318

Query  1064  LLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             L    I  G+         +IDG  + G + +A     E+
Sbjct  319   LFDKMIEIGLVPSAVTYNTMIDGYCNKGDLDKAFSYRDEM  358


 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 85/347 (24%), Positives = 146/347 (42%), Gaps = 43/347 (12%)
 Frame = -1

Query  1859  PCPVTFNILLSGLCMNGYTEKALMLFRELKHSG---FIPQLVTYNILIHGLCNSGRWAPA  1689
             P P T   LL    +NG       +F EL+ +     I   V ++ LI   C   +   A
Sbjct  118   PSPKTALHLLK-RAVNGGIASTREIFEELERARERLSIESAVVFDFLIRACCELNKAKEA  176

Query  1688  RRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISF  1509
                   + + G  P   T   ++    +S   E    +  EM R       + +  +I+ 
Sbjct  177   FECFWIMKEKGVVPKIETCNDMLSLFSKSNMLEMAWLLYAEMFRLKIKSSVYTFNIMINV  236

Query  1508  LIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCD  1329
             L K G++K A + +G+M + G++ ++V YNTLI+ YC  G+++ A M+      KG   D
Sbjct  237   LCKEGKLKKAKEFIGSMEILGVKPNVVTYNTLIHGYCLRGRIEGARMVFDAMRGKGIRLD  296

Query  1328  KYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALS---  1158
              YT+  +I+GLCK   ++EA    +    +G   + V +N  IDG C  G++D A S   
Sbjct  297   SYTYGSLINGLCKERKLEEASELFDKMIEIGLVPSAVTYNTMIDGYCNKGDLDKAFSYRD  356

Query  1157  --------------------------------VFKSMDEK----DCFTYSSLVHGLCKAG  1086
                                             + K M EK    D  TY+ L++G C+ G
Sbjct  357   EMIKNGIKQTVSTYNLLIHALFLEGRTSEADGLVKEMGEKGIVPDGITYNILINGCCRCG  416

Query  1085  RFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             +   A  L    +  G++  +    +++  L     ++EA +L  ++
Sbjct  417   KAEKAFALHDEMLSKGIEATRVTYTSLVYVLSRQKRMEEADELFQKM  463



>ref|XP_010473513.1| PREDICTED: pentatricopeptide repeat-containing protein At1g64100-like 
[Camelina sativa]
Length=678

 Score =   223 bits (569),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 125/442 (28%), Positives = 220/442 (50%), Gaps = 4/442 (1%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             LCK      A  +  + +  G+  +VVTYN +I   C +        +L  M +  + P+
Sbjct  196   LCKDGHHSHARHLFTEMLEKGIFPNVVTYNCMIDGCCRYGKWSDAEQLLRDMIKRSVDPN  255

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             V+T+N+LI +  + G +S   +L  EML + I PDT++YN+L++   +  + D+A R F 
Sbjct  256   VVTFNALINAFVKEGKVSEAEELYSEMLRMDIFPDTFTYNSLINGFCKHSRLDDAKRMFN  315

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
              +      P  +T N L+ G C     +  + L  E+   G +P  V+YN LIHG C  G
Sbjct  316   LMVSNGCSPNIITVNTLIDGCCRAKRLDAGMKLLHEMSKRGLVPDTVSYNTLIHGFCQVG  375

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYC  1524
                 A+ L  E++  G +PN +T  +++       + ++ L++ E M++     D+  Y 
Sbjct  376   DLNAAQDLFQEMISHGVSPNIVTCGSLLDGFCNDMKIDKALKLFEVMQKSKMDLDTAIYN  435

Query  1523  TVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERK  1344
              +I  + K+ ++ +A+D   ++ +NG++ D+  YN +I+ + KEG    A  L  E  RK
Sbjct  436   IIIHGMCKSSKVDEAWDLFNSLPLNGVKPDVQTYNIMISSFVKEGNFLRAEELYAEMFRK  495

Query  1343  GFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYA  1164
             G   D + +T ++DGLCK   + EA +  +     G   +LV F+  I+G CK  +VD  
Sbjct  496   GVVLDTFIYTSMVDGLCKQNRLDEARQMFDSMASKGCSPDLVTFSTLINGYCKAKKVDDG  555

Query  1163  LSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDG  996
             L ++  M  +    D  TY++L+HG C+ G    A ++    +  G+         +I G
Sbjct  556   LELYCEMYRRGIVADTITYNTLIHGFCQVGDLNGALDIFQEMVSSGVCPDTITYSTLIHG  615

Query  995   LQHSGFIQEARKLHSELKLSKI  930
                 G++  AR +  E+  S +
Sbjct  616   FCQVGYLNGARDIFQEMVSSGV  637


 Score =   211 bits (538),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 126/437 (29%), Positives = 212/437 (49%), Gaps = 4/437 (1%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             LC   ++ +A  ++   +  G   D VTY T+++  C     ++  ++L  M +  IKP 
Sbjct  126   LCMEGRVLEATALLDRMVEEGHQPDEVTYRTIVSGMCKMGDTESALNLLRNMEQTHIKPG  185

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             V+ Y ++I    + G  S    L  EMLE GI P+  +YN ++    R GK  +A +  +
Sbjct  186   VVIYTAIIDRLCKDGHHSHARHLFTEMLEKGIFPNVVTYNCMIDGCCRYGKWSDAEQLLR  245

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
             D+    + P  VTFN L++     G   +A  L+ E+      P   TYN LI+G C   
Sbjct  246   DMIKRSVDPNVVTFNALINAFVKEGKVSEAEELYSEMLRMDIFPDTFTYNSLINGFCKHS  305

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYC  1524
             R   A+R+ N +V  G +PN IT  T++  C R++R + G+++L EM ++G + D+ +Y 
Sbjct  306   RLDDAKRMFNLMVSNGCSPNIITVNTLIDGCCRAKRLDAGMKLLHEMSKRGLVPDTVSYN  365

Query  1523  TVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERK  1344
             T+I    + G +  A D    MI +G+  ++V   +L++ +C + K+D A  L    ++ 
Sbjct  366   TLIHGFCQVGDLNAAQDLFQEMISHGVSPNIVTCGSLLDGFCNDMKIDKALKLFEVMQKS  425

Query  1343  GFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYA  1164
               D D   + III G+CK+  + EA    N   L G   ++  +N  I    K G    A
Sbjct  426   KMDLDTAIYNIIIHGMCKSSKVDEAWDLFNSLPLNGVKPDVQTYNIMISSFVKEGNFLRA  485

Query  1163  LSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDG  996
               ++  M  K    D F Y+S+V GLCK  R   A ++  S    G          +I+G
Sbjct  486   EELYAEMFRKGVVLDTFIYTSMVDGLCKQNRLDEARQMFDSMASKGCSPDLVTFSTLING  545

Query  995   LQHSGFIQEARKLHSEL  945
                +  + +  +L+ E+
Sbjct  546   YCKAKKVDDGLELYCEM  562


 Score =   206 bits (524),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 124/406 (31%), Positives = 197/406 (49%), Gaps = 4/406 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              N  +    K  ++ +AE +  + +R+ +  D  TYN+LI  +C    +D    + + M 
Sbjct  259   FNALINAFVKEGKVSEAEELYSEMLRMDIFPDTFTYNSLINGFCKHSRLDDAKRMFNLMV  318

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
               G  P++IT N+LI    R   L   + LL EM + G++PDT SYNTL+H   ++G  +
Sbjct  319   SNGCSPNIITVNTLIDGCCRAKRLDAGMKLLHEMSKRGLVPDTVSYNTLIHGFCQVGDLN  378

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A   FQ++    + P  VT   LL G C +   +KAL LF  ++ S        YNI+I
Sbjct  379   AAQDLFQEMISHGVSPNIVTCGSLLDGFCNDMKIDKALKLFEVMQKSKMDLDTAIYNIII  438

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             HG+C S +   A  L N L   G  P+  TY  ++    +   F    ++  EM RKG +
Sbjct  439   HGMCKSSKVDEAWDLFNSLPLNGVKPDVQTYNIMISSFVKEGNFLRAEELYAEMFRKGVV  498

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D+F Y +++  L K  R+ +A     +M   G   DLV ++TLIN YCK  K+D+   L
Sbjct  499   LDTFIYTSMVDGLCKQNRLDEARQMFDSMASKGCSPDLVTFSTLINGYCKAKKVDDGLEL  558

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E  R+G   D  T+  +I G C+ G++  AL         G   + + ++  I G C+
Sbjct  559   YCEMYRRGIVADTITYNTLIHGFCQVGDLNGALDIFQEMVSSGVCPDTITYSTLIHGFCQ  618

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELL  1059
             VG ++ A  +F+ M       D  T+  ++ GL      + A  +L
Sbjct  619   VGYLNGARDIFQEMVSSGVCPDTITFHGMLTGLFSKEELKKAKAML  664


 Score =   202 bits (514),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 117/445 (26%), Positives = 214/445 (48%), Gaps = 5/445 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              +I + C C   +L  A +      ++G   +VVT+NTL+   C    +    ++   M 
Sbjct  48    FSILMKCFCDCHKLPFALSTFGKITKLGFQPNVVTFNTLLHGLCLQDRLSEALALFDHMV  107

Query  2084  EVGIK-PDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
             E G+  P+V+T+++L+      G +     LL+ M+E G  PD  +Y T++  + ++G  
Sbjct  108   ETGLTTPNVVTFSTLMNGLCMEGRVLEATALLDRMVEEGHQPDEVTYRTIVSGMCKMGDT  167

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             + A    +++    I P  V +  ++  LC +G+   A  LF E+   G  P +VTYN +
Sbjct  168   ESALNLLRNMEQTHIKPGVVIYTAIIDRLCKDGHHSHARHLFTEMLEKGIFPNVVTYNCM  227

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             I G C  G+W+ A +LL +++    +PN +T+  ++    +  +  E  ++  EM R   
Sbjct  228   IDGCCRYGKWSDAEQLLRDMIKRSVDPNVVTFNALINAFVKEGKVSEAEELYSEMLRMDI  287

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
               D+F Y ++I+   K  R+ DA      M+ NG   +++  NTLI+  C+  +LD    
Sbjct  288   FPDTFTYNSLINGFCKHSRLDDAKRMFNLMVSNGCSPNIITVNTLIDGCCRAKRLDAGMK  347

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLC  1188
             L+ E  ++G   D  ++  +I G C+ G++  A          G   N+V     +DG C
Sbjct  348   LLHEMSKRGLVPDTVSYNTLIHGFCQVGDLNAAQDLFQEMISHGVSPNIVTCGSLLDGFC  407

Query  1187  KVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
                ++D AL +F+ M +     D   Y+ ++HG+CK+ +   A +L  S  + G+K    
Sbjct  408   NDMKIDKALKLFEVMQKSKMDLDTAIYNIIIHGMCKSSKVDEAWDLFNSLPLNGVKPDVQ  467

Query  1019  DRQAVIDGLQHSGFIQEARKLHSEL  945
                 +I      G    A +L++E+
Sbjct  468   TYNIMISSFVKEGNFLRAEELYAEM  492


 Score =   159 bits (402),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/401 (26%), Positives = 180/401 (45%), Gaps = 5/401 (1%)
 Frame = -1

Query  2117  DAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTL  1938
             D   S+  +M+   I  ++ +++ L+        L   L    ++ ++G  P+  ++NTL
Sbjct  27    DVAISLYQKMSLRRIPCNIYSFSILMKCFCDCHKLPFALSTFGKITKLGFQPNVVTFNTL  86

Query  1937  MHCLFRLGKPDEAYRFFQDIF-WGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             +H L    +  EA   F  +   G   P  VTF+ L++GLCM G   +A  L   +   G
Sbjct  87    LHGLCLQDRLSEALALFDHMVETGLTTPNVVTFSTLMNGLCMEGRVLEATALLDRMVEEG  146

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P  VTY  ++ G+C  G    A  LL  +      P  + YT I+    +        
Sbjct  147   HQPDEVTYRTIVSGMCKMGDTESALNLLRNMEQTHIKPGVVIYTAIIDRLCKDGHHSHAR  206

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
              +  EM  KG   +   Y  +I    + G+  DA   + +MI   ++ ++V +N LIN +
Sbjct  207   HLFTEMLEKGIFPNVVTYNCMIDGCCRYGKWSDAEQLLRDMIKRSVDPNVVTFNALINAF  266

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
              KEGK+  A  L  E  R     D +T+  +I+G CK   + +A R  N     G   N+
Sbjct  267   VKEGKVSEAEELYSEMLRMDIFPDTFTYNSLINGFCKHSRLDDAKRMFNLMVSNGCSPNI  326

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLS  1053
             +  N  IDG C+   +D  + +   M ++    D  +Y++L+HG C+ G    A +L   
Sbjct  327   ITVNTLIDGCCRAKRLDAGMKLLHEMSKRGLVPDTVSYNTLIHGFCQVGDLNAAQDLFQE  386

Query  1052  CIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
              I  G+        +++DG  +   I +A KL   ++ SK+
Sbjct  387   MISHGVSPNIVTCGSLLDGFCNDMKIDKALKLFEVMQKSKM  427


 Score =   148 bits (374),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 102/352 (29%), Positives = 161/352 (46%), Gaps = 5/352 (1%)
 Frame = -1

Query  1985  MLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGY  1806
             M+     P    +  LM  + R+ +PD A   +Q +    IP    +F+IL+   C    
Sbjct  1     MVRSRPFPSEIDFCKLMGVILRMNRPDVAISLYQKMSLRRIPCNIYSFSILMKCFCDCHK  60

Query  1805  TEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGY-NPNAITYT  1629
                AL  F ++   GF P +VT+N L+HGLC   R + A  L + +V+ G   PN +T++
Sbjct  61    LPFALSTFGKITKLGFQPNVVTFNTLLHGLCLQDRLSEALALFDHMVETGLTTPNVVTFS  120

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
             T+M       R  E   +L+ M  +G+  D   Y T++S + K G  + A + + NM   
Sbjct  121   TLMNGLCMEGRVLEATALLDRMVEEGHQPDEVTYRTIVSGMCKMGDTESALNLLRNMEQT  180

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
              I+  +V Y  +I+  CK+G   +A  L  E   KG   +  T+  +IDG C+ G   +A
Sbjct  181   HIKPGVVIYTAIIDRLCKDGHHSHARHLFTEMLEKGIFPNVVTYNCMIDGCCRYGKWSDA  240

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE----KDCFTYSSLVHG  1101
              + L        D N+V FN  I+   K G+V  A  ++  M       D FTY+SL++G
Sbjct  241   EQLLRDMIKRSVDPNVVTFNALINAFVKEGKVSEAEELYSEMLRMDIFPDTFTYNSLING  300

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
              CK  R   A  +    +  G          +IDG   +  +    KL  E+
Sbjct  301   FCKHSRLDDAKRMFNLMVSNGCSPNIITVNTLIDGCCRAKRLDAGMKLLHEM  352


 Score = 99.0 bits (245),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 94/179 (53%), Gaps = 0/179 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             MFR    L T +    V  LCK  +L++A  +       G   D+VT++TLI  YC    
Sbjct  492   MFRKGVVLDTFIYTSMVDGLCKQNRLDEARQMFDSMASKGCSPDLVTFSTLINGYCKAKK  551

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +D G  +   M   GI  D ITYN+LI    + G L+  LD+ +EM+  G+ PDT +Y+T
Sbjct  552   VDDGLELYCEMYRRGIVADTITYNTLIHGFCQVGDLNGALDIFQEMVSSGVCPDTITYST  611

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHS  1764
             L+H   ++G  + A   FQ++    + P  +TF+ +L+GL      +KA  +  +L+ S
Sbjct  612   LIHGFCQVGYLNGARDIFQEMVSSGVCPDTITFHGMLTGLFSKEELKKAKAMLEDLQKS  670


 Score = 99.0 bits (245),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/198 (28%), Positives = 98/198 (49%), Gaps = 0/198 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI ++   K     +AE +  +  R GV  D   Y +++   C    +D    +   M  
Sbjct  470   NIMISSFVKEGNFLRAEELYAEMFRKGVVLDTFIYTSMVDGLCKQNRLDEARQMFDSMAS  529

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G  PD++T+++LI    +   +   L+L  EM   GI+ DT +YNTL+H   ++G  + 
Sbjct  530   KGCSPDLVTFSTLINGYCKAKKVDDGLELYCEMYRRGIVADTITYNTLIHGFCQVGDLNG  589

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   FQ++    + P  +T++ L+ G C  GY   A  +F+E+  SG  P  +T++ ++ 
Sbjct  590   ALDIFQEMVSSGVCPDTITYSTLIHGFCQVGYLNGARDIFQEMVSSGVCPDTITFHGMLT  649

Query  1721  GLCNSGRWAPARRLLNEL  1668
             GL +      A+ +L +L
Sbjct  650   GLFSKEELKKAKAMLEDL  667



>ref|XP_008803207.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
[Phoenix dactylifera]
 ref|XP_008803208.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
[Phoenix dactylifera]
Length=552

 Score =   221 bits (562),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 157/516 (30%), Positives = 254/516 (49%), Gaps = 19/516 (4%)
 Frame = -1

Query  2480  LLSHINLLNSPAGQPSPADMFVCYLRRSQSSPRLPLAASALQLATRTCPMLRLGD*HLE*  2301
             L SH++  + PA         V  LRRS  SP     A+++ L        R  +  +  
Sbjct  43    LRSHLDSGDVPAA--------VSVLRRSFHSPLSRPPATSVNLVFAHLSKSRQFESVISL  94

Query  2300  MFRIK-SRLSTKL--LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCC  2130
                ++ S LS  L  LNI + C C+ +QL+ A  V  +        D+V++NT+I  +C 
Sbjct  95    YHSLRESGLSADLVSLNILIHCYCQTRQLDLALKVFDEIRERSYRPDIVSFNTVIKGFCN  154

Query  2129  FVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC-LDLLEEMLEVGILPDTW  1953
                +   + +L  M E G  P+  TY  LI   +R    S   L L++EML++G+ P   
Sbjct  155   ENRVSDAFKVLREMRENGPSPNGYTYAMLIGLVSRGCSNSELGLGLIQEMLQLGLEPSMV  214

Query  1952  SYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFREL  1773
             + N ++  L +  K   A   +  +    I    V++   +  LC      +A MLF E+
Sbjct  215   NCNCVLTALSKQFKIHAAKALYGRMSKSGIAGDVVSYTSFIDVLCRKRMIIEAKMLFSEM  274

Query  1772  KHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRF  1593
                G  P +VTYN +IHGLC +G+   A R+L+++V  G  PN +TYTT++   +R  + 
Sbjct  275   PEKGVAPNVVTYNTMIHGLCVNGQVDNAMRMLDQMVICGLRPNIVTYTTVISGLYRDGKL  334

Query  1592  EEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTL  1413
             EE L +L+ MR++G   D   Y T++  L K GR++ A      +  +G   D+ +YN+L
Sbjct  335   EETLNLLDVMRQQGLEPDKQMYGTLLDGLCKGGRVEIALQLFRAIEASGFN-DIASYNSL  393

Query  1412  INLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF  1233
             I+ +CK GK++ A  L  E   KGF  D   +T ++DG CK G ++ A   +   +  G 
Sbjct  394   ISGFCKLGKMEEASKLFEEIMEKGFKPDVVMYTTLMDGFCKIGKVEAAQGLIGAMERRGL  453

Query  1232  DSNLVAFNCCIDGLCKVGEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASE  1065
               +L+ ++  ++G C   + D A  +   M+    E +   Y+ LV+GLCKAG F  A  
Sbjct  454   KPDLITYSTMVEGFCDTEQFDAAEELLCDMERHGFEPNSVIYNMLVYGLCKAGNFDRAEH  513

Query  1064  LLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
              L      G ++    RQ + DG   +G +++A KL
Sbjct  514   YLEEMSHKGQQVNAKTRQILSDG--RAGRLRDAEKL  547



>ref|XP_008232168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Prunus mume]
Length=700

 Score =   223 bits (569),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 142/485 (29%), Positives = 241/485 (50%), Gaps = 39/485 (8%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             +L+   LNI V  LCK ++++  ++ + D    G+ +D+VTYNTLI AYC    ++  + 
Sbjct  205   QLNVYTLNIMVNALCKDRKIDSVKSFLSDMEEKGIFSDIVTYNTLINAYCREGLLEEAFQ  264

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             + + M+  G++P+V TYN++I    + G  +R  ++L EML  G+ PDT +YNTL+    
Sbjct  265   LKNSMSCKGLRPEVFTYNAIINGLCKVGNYARAKEILCEMLNNGLSPDTTTYNTLLVESC  324

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             R     EA   F ++    + P  V+F+ L+     NG+ + AL+ FR++K +G++P  V
Sbjct  325   RKDDISEAEGIFNEMSCRGVIPDLVSFSSLIGVFSRNGHIDHALVYFRDMKKAGWVPDNV  384

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
              Y ILIHG C +G    A +L +E+++ G   + +T+ TI+    R +   +  ++  EM
Sbjct  385   IYTILIHGYCRNGMMLEALKLRDEMLEQGCVMDVVTFNTILNGLCREKMLSDADELFNEM  444

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
               +G   D + + T+I    K G M  + +    M    I+ D+V YNTLI+ +CK G++
Sbjct  445   VERGVFPDFYTFTTLIHGYSKHGNMTKSLNLFEAMTKRNIKPDIVTYNTLIDGFCKVGEM  504

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D A  L  +   +    +  ++ I+I+G C  G++ EA R  +     G    LV  N  
Sbjct  505   DKAKELWADMVSRRILPNHISYGILINGFCSTGHVHEAFRLWDQMIEEGIKPTLVTCNTV  564

Query  1202  IDGLCKVG-----------------------------------EVDYALSVFKSMDEK--  1134
             I G C+ G                                    +D A SV K M+ +  
Sbjct  565   IKGYCRSGNTTKADEFLGKMVSKGIVPDSITYNTLINGYVKEENLDKAFSVVKEMENQGI  624

Query  1133  --DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARK  960
               D FTY+ +++G C+ GR   A  +L   I  G+K  +    ++I+G      ++EA +
Sbjct  625   LPDLFTYNIILNGFCRQGRMHEAELVLRKMIERGVKPDRDTYTSLINGHVTQDNLREAFR  684

Query  959   LHSEL  945
              H E+
Sbjct  685   FHDEM  689


 Score =   165 bits (417),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 113/424 (27%), Positives = 192/424 (45%), Gaps = 11/424 (3%)
 Frame = -1

Query  2309  LE*MFRIKSRLSTKLL-------NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNT  2151
             LE  F++K+ +S K L       N  +  LCK     +A+ ++ + +  G+  D  TYNT
Sbjct  259   LEEAFQLKNSMSCKGLRPEVFTYNAIINGLCKVGNYARAKEILCEMLNNGLSPDTTTYNT  318

Query  2150  LITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVG  1971
             L+   C    I     I + M+  G+ PD+++++SLI   +R+G +   L    +M + G
Sbjct  319   LLVESCRKDDISEAEGIFNEMSCRGVIPDLVSFSSLIGVFSRNGHIDHALVYFRDMKKAG  378

Query  1970  ILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKAL  1791
              +PD   Y  L+H   R G   EA +   ++         VTFN +L+GLC       A 
Sbjct  379   WVPDNVIYTILIHGYCRNGMMLEALKLRDEMLEQGCVMDVVTFNTILNGLCREKMLSDAD  438

Query  1790  MLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCC  1611
              LF E+   G  P   T+  LIHG    G    +  L   +      P+ +TY T++   
Sbjct  439   ELFNEMVERGVFPDFYTFTTLIHGYSKHGNMTKSLNLFEAMTKRNIKPDIVTYNTLIDGF  498

Query  1610  FRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDL  1431
              +    ++  ++  +M  +  + +  +Y  +I+     G + +A+     MI  GI+  L
Sbjct  499   CKVGEMDKAKELWADMVSRRILPNHISYGILINGFCSTGHVHEAFRLWDQMIEEGIKPTL  558

Query  1430  VAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNC  1251
             V  NT+I  YC+ G    A   + +   KG   D  T+  +I+G  K  N+ +A   +  
Sbjct  559   VTCNTVIKGYCRSGNTTKADEFLGKMVSKGIVPDSITYNTLINGYVKEENLDKAFSVVKE  618

Query  1250  TKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGR  1083
              +  G   +L  +N  ++G C+ G +  A  V + M E+    D  TY+SL++G      
Sbjct  619   MENQGILPDLFTYNIILNGFCRQGRMHEAELVLRKMIERGVKPDRDTYTSLINGHVTQDN  678

Query  1082  FRVA  1071
              R A
Sbjct  679   LREA  682


 Score =   161 bits (408),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/310 (29%), Positives = 159/310 (51%), Gaps = 0/310 (0%)
 Frame = -1

Query  2258  ITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEV  2079
             I +   C+   + +A  +  + +  G   DVVT+NT++   C    +     + + M E 
Sbjct  388   ILIHGYCRNGMMLEALKLRDEMLEQGCVMDVVTFNTILNGLCREKMLSDADELFNEMVER  447

Query  2078  GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEA  1899
             G+ PD  T+ +LI   ++HG +++ L+L E M +  I PD  +YNTL+    ++G+ D+A
Sbjct  448   GVFPDFYTFTTLIHGYSKHGNMTKSLNLFEAMTKRNIKPDIVTYNTLIDGFCKVGEMDKA  507

Query  1898  YRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
                + D+    I P  +++ IL++G C  G+  +A  L+ ++   G  P LVT N +I G
Sbjct  508   KELWADMVSRRILPNHISYGILINGFCSTGHVHEAFRLWDQMIEEGIKPTLVTCNTVIKG  567

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFD  1539
              C SG    A   L ++V  G  P++ITY T++    +    ++   +++EM  +G + D
Sbjct  568   YCRSGNTTKADEFLGKMVSKGIVPDSITYNTLINGYVKEENLDKAFSVVKEMENQGILPD  627

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVV  1359
              F Y  +++   + GRM +A   +  MI  G++ D   Y +LIN +  +  L  A+    
Sbjct  628   LFTYNIILNGFCRQGRMHEAELVLRKMIERGVKPDRDTYTSLINGHVTQDNLREAFRFHD  687

Query  1358  EAERKGFDCD  1329
             E  ++GF  D
Sbjct  688   EMLQRGFVPD  697


 Score =   160 bits (405),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 113/441 (26%), Positives = 201/441 (46%), Gaps = 4/441 (1%)
 Frame = -1

Query  2276  STKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSIL  2097
             S+ + ++ V    +A++L +   V       G    +   N+L+        +D  + + 
Sbjct  137   SSLVFDLLVRTYVQARKLREGFEVFQLFRSKGFCVSINACNSLLGGLVKVGWVDLAWQVY  196

Query  2096  HRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRL  1917
               +   GI+ +V T N ++ +  +   +      L +M E GI  D  +YNTL++   R 
Sbjct  197   GEVVSSGIQLNVYTLNIMVNALCKDRKIDSVKSFLSDMEEKGIFSDIVTYNTLINAYCRE  256

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTY  1737
             G  +EA++    +    + P   T+N +++GLC  G   +A  +  E+ ++G  P   TY
Sbjct  257   GLLEEAFQLKNSMSCKGLRPEVFTYNAIINGLCKVGNYARAKEILCEMLNNGLSPDTTTY  316

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRR  1557
             N L+   C     + A  + NE+   G  P+ +++++++    R+   +  L    +M++
Sbjct  317   NTLLVESCRKDDISEAEGIFNEMSCRGVIPDLVSFSSLIGVFSRNGHIDHALVYFRDMKK  376

Query  1556  KGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDN  1377
              G++ D+  Y  +I    + G M +A      M+  G  +D+V +NT++N  C+E  L +
Sbjct  377   AGWVPDNVIYTILIHGYCRNGMMLEALKLRDEMLEQGCVMDVVTFNTILNGLCREKMLSD  436

Query  1376  AYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCID  1197
             A  L  E   +G   D YT T +I G  K GNM ++L             ++V +N  ID
Sbjct  437   ADELFNEMVERGVFPDFYTFTTLIHGYSKHGNMTKSLNLFEAMTKRNIKPDIVTYNTLID  496

Query  1196  GLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             G CKVGE+D A  ++  M  +    +  +Y  L++G C  G    A  L    I  G+K 
Sbjct  497   GFCKVGEMDKAKELWADMVSRRILPNHISYGILINGFCSTGHVHEAFRLWDQMIEEGIKP  556

Query  1028  LKSDRQAVIDGLQHSGFIQEA  966
                    VI G   SG   +A
Sbjct  557   TLVTCNTVIKGYCRSGNTTKA  577


 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 106/206 (51%), Gaps = 0/206 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +   CK  +++KA+ +  D +   +  + ++Y  LI  +C    +   + +  +M E
Sbjct  492   NTLIDGFCKVGEMDKAKELWADMVSRRILPNHISYGILINGFCSTGHVHEAFRLWDQMIE  551

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              GIKP ++T N++I    R G  ++  + L +M+  GI+PD+ +YNTL++   +    D+
Sbjct  552   EGIKPTLVTCNTVIKGYCRSGNTTKADEFLGKMVSKGIVPDSITYNTLINGYVKEENLDK  611

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A+   +++    I P   T+NI+L+G C  G   +A ++ R++   G  P   TY  LI+
Sbjct  612   AFSVVKEMENQGILPDLFTYNIILNGFCRQGRMHEAELVLRKMIERGVKPDRDTYTSLIN  671

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPN  1644
             G         A R  +E++  G+ P+
Sbjct  672   GHVTQDNLREAFRFHDEMLQRGFVPD  697



>ref|XP_010048714.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Eucalyptus grandis]
 ref|XP_010048715.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Eucalyptus grandis]
 ref|XP_010048716.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Eucalyptus grandis]
 ref|XP_010048717.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Eucalyptus grandis]
 ref|XP_010048718.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Eucalyptus grandis]
 ref|XP_010048720.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Eucalyptus grandis]
 ref|XP_010048721.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Eucalyptus grandis]
 ref|XP_010048722.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Eucalyptus grandis]
 gb|KCW81077.1| hypothetical protein EUGRSUZ_C02447 [Eucalyptus grandis]
Length=736

 Score =   224 bits (570),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/437 (31%), Positives = 231/437 (53%), Gaps = 4/437 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             LNI V  LCK +++++ ++ ++D    GV  D+VTYNTLI A+C    +   + +++ M 
Sbjct  247   LNIMVNALCKDRKMDEVKSFLLDLEEKGVFPDIVTYNTLINAHCREGLVKEAFGLVNSML  306

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             E G+KP + TYN LI    R+G  +R  ++L EM E G+ PD  S+NTL+  + R G   
Sbjct  307   EKGMKPSLYTYNGLINGLCRNGEYTRAREMLNEMSEKGVSPDNASFNTLLVEIGRKGNAV  366

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             EA + F+++    + P  V+++ ++  L  +   ++ALM FR +K +G +P  V Y ILI
Sbjct  367   EAEKIFEEMSLRGVVPDLVSYSSIIGVLLRSHNLDQALMYFRRMKSAGLVPDSVIYTILI  426

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
                C +G  + A RL +E+++ G   + +TY TI+    + +   E  ++L EM  +G  
Sbjct  427   DWYCKNGLVSEALRLRDEMMEQGCFVDVVTYNTILNGLCKDKMLVEADRLLHEMGERGVF  486

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D   + T+I+   K G M  A      M    ++ D+V YNTLI+ +C+ G+++ AY +
Sbjct  487   PDFCTFTTLINGHCKDGNMNKAMSLFQTMSQKNLKPDIVTYNTLIDGFCRVGEMEKAYQI  546

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               +    G   +  +++I+I+G C  G + EALR  +     G   +L++ N  + G C+
Sbjct  547   WDDMINSGIRPNHISYSILINGFCSTGAVAEALRLWDEMVKGGIRPSLISCNTILKGFCR  606

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G+V  A   F  M  K    D  TY++L++G  +      A+EL+      G+   +  
Sbjct  607   SGDVSKADEFFSKMVAKGILPDSITYNTLINGFVRIEDMDKAAELVYKMENVGLLADEFT  666

Query  1016  RQAVIDGLQHSGFIQEA  966
                ++ G    G +QEA
Sbjct  667   YNVILSGFCRQGKMQEA  683


 Score =   178 bits (452),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 121/439 (28%), Positives = 211/439 (48%), Gaps = 7/439 (2%)
 Frame = -1

Query  2243  LCKAKQLEKAETV--IIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIK  2070
             + +   + +AE V  +I+  R G  +    ++ LI  Y     +  G      ++  GI+
Sbjct  148   MVRKSGVSRAEVVDSLIEASRDG-GSSCAVFSLLIRTYVQARKLREGAEAFRLLSSKGIR  206

Query  2069  PDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRF  1890
               +   N L+    + G +    ++  E++  G+  D ++ N +++ L +  K DE   F
Sbjct  207   VLIGACNGLLGGLVKAGWVDLAWEVYGEVVRSGVQVDVYTLNIMVNALCKDRKMDEVKSF  266

Query  1889  FQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCN  1710
               D+    + P  VT+N L++  C  G  ++A  L   +   G  P L TYN LI+GLC 
Sbjct  267   LLDLEEKGVFPDIVTYNTLINAHCREGLVKEAFGLVNSMLEKGMKPSLYTYNGLINGLCR  326

Query  1709  SGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFA  1530
             +G +  AR +LNE+ + G +P+  ++ T++    R     E  +I EEM  +G + D  +
Sbjct  327   NGEYTRAREMLNEMSEKGVSPDNASFNTLLVEIGRKGNAVEAEKIFEEMSLRGVVPDLVS  386

Query  1529  YCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAE  1350
             Y ++I  L+++  +  A      M   G+  D V Y  LI+ YCK G +  A  L  E  
Sbjct  387   YSSIIGVLLRSHNLDQALMYFRRMKSAGLVPDSVIYTILIDWYCKNGLVSEALRLRDEMM  446

Query  1349  RKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVD  1170
              +G   D  T+  I++GLCK   + EA R L+     G   +   F   I+G CK G ++
Sbjct  447   EQGCFVDVVTYNTILNGLCKDKMLVEADRLLHEMGERGVFPDFCTFTTLINGHCKDGNMN  506

Query  1169  YALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVI  1002
              A+S+F++M +K    D  TY++L+ G C+ G    A ++    I  G++        +I
Sbjct  507   KAMSLFQTMSQKNLKPDIVTYNTLIDGFCRVGEMEKAYQIWDDMINSGIRPNHISYSILI  566

Query  1001  DGLQHSGFIQEARKLHSEL  945
             +G   +G + EA +L  E+
Sbjct  567   NGFCSTGAVAEALRLWDEM  585


 Score =   172 bits (437),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/402 (27%), Positives = 188/402 (47%), Gaps = 4/402 (1%)
 Frame = -1

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +D  + +   +   G++ DV T N ++ +  +   +      L ++ E G+ PD  +YNT
Sbjct  225   VDLAWEVYGEVVRSGVQVDVYTLNIMVNALCKDRKMDEVKSFLLDLEEKGVFPDIVTYNT  284

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             L++   R G   EA+     +    + P   T+N L++GLC NG   +A  +  E+   G
Sbjct  285   LINAHCREGLVKEAFGLVNSMLEKGMKPSLYTYNGLINGLCRNGEYTRAREMLNEMSEKG  344

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P   ++N L+  +   G    A ++  E+   G  P+ ++Y++I+    RS   ++ L
Sbjct  345   VSPDNASFNTLLVEIGRKGNAVEAEKIFEEMSLRGVVPDLVSYSSIIGVLLRSHNLDQAL  404

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
                  M+  G + DS  Y  +I +  K G + +A      M+  G  +D+V YNT++N  
Sbjct  405   MYFRRMKSAGLVPDSVIYTILIDWYCKNGLVSEALRLRDEMMEQGCFVDVVTYNTILNGL  464

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CK+  L  A  L+ E   +G   D  T T +I+G CK GNM +A+             ++
Sbjct  465   CKDKMLVEADRLLHEMGERGVFPDFCTFTTLINGHCKDGNMNKAMSLFQTMSQKNLKPDI  524

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELLLS  1053
             V +N  IDG C+VGE++ A  ++  M       +  +YS L++G C  G    A  L   
Sbjct  525   VTYNTLIDGFCRVGEMEKAYQIWDDMINSGIRPNHISYSILINGFCSTGAVAEALRLWDE  584

Query  1052  CIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              + GG++        ++ G   SG + +A +  S++    IL
Sbjct  585   MVKGGIRPSLISCNTILKGFCRSGDVSKADEFFSKMVAKGIL  626


 Score =   164 bits (414),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/363 (29%), Positives = 178/363 (49%), Gaps = 2/363 (1%)
 Frame = -1

Query  2219  KAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLI  2040
             +AE +  +    GV  D+V+Y+++I        +D       RM   G+ PD + Y  LI
Sbjct  367   EAEKIFEEMSLRGVVPDLVSYSSIIGVLLRSHNLDQALMYFRRMKSAGLVPDSVIYTILI  426

Query  2039  ASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIP  1860
                 ++G++S  L L +EM+E G   D  +YNT+++ L +     EA R   ++    + 
Sbjct  427   DWYCKNGLVSEALRLRDEMMEQGCFVDVVTYNTILNGLCKDKMLVEADRLLHEMGERGVF  486

Query  1859  PCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRL  1680
             P   TF  L++G C +G   KA+ LF+ +      P +VTYN LI G C  G    A ++
Sbjct  487   PDFCTFTTLINGHCKDGNMNKAMSLFQTMSQKNLKPDIVTYNTLIDGFCRVGEMEKAYQI  546

Query  1679  LNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYC-TVISFLI  1503
              +++++ G  PN I+Y+ ++     +    E L++ +EM  KG I  S   C T++    
Sbjct  547   WDDMINSGIRPNHISYSILINGFCSTGAVAEALRLWDEM-VKGGIRPSLISCNTILKGFC  605

Query  1502  KAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKY  1323
             ++G +  A +    M+  GI  D + YNTLIN + +   +D A  LV + E  G   D++
Sbjct  606   RSGDVSKADEFFSKMVAKGILPDSITYNTLINGFVRIEDMDKAAELVYKMENVGLLADEF  665

Query  1322  THTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSM  1143
             T+ +I+ G C+ G M+EA   L      G + +   ++  I+G     ++  A      M
Sbjct  666   TYNVILSGFCRQGKMQEAELVLRRMISRGVNPDRATYSALINGYVSKDDLKEAFRFHDEM  725

Query  1142  DEK  1134
              +K
Sbjct  726   LQK  728


 Score =   160 bits (404),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/310 (29%), Positives = 160/310 (52%), Gaps = 0/310 (0%)
 Frame = -1

Query  2258  ITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEV  2079
             I +   CK   + +A  +  + +  G   DVVTYNT++   C    +     +LH M E 
Sbjct  424   ILIDWYCKNGLVSEALRLRDEMMEQGCFVDVVTYNTILNGLCKDKMLVEADRLLHEMGER  483

Query  2078  GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEA  1899
             G+ PD  T+ +LI    + G +++ + L + M +  + PD  +YNTL+    R+G+ ++A
Sbjct  484   GVFPDFCTFTTLINGHCKDGNMNKAMSLFQTMSQKNLKPDIVTYNTLIDGFCRVGEMEKA  543

Query  1898  YRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
             Y+ + D+    I P  ++++IL++G C  G   +AL L+ E+   G  P L++ N ++ G
Sbjct  544   YQIWDDMINSGIRPNHISYSILINGFCSTGAVAEALRLWDEMVKGGIRPSLISCNTILKG  603

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFD  1539
              C SG  + A    +++V  G  P++ITY T++    R    ++  +++ +M   G + D
Sbjct  604   FCRSGDVSKADEFFSKMVAKGILPDSITYNTLINGFVRIEDMDKAAELVYKMENVGLLAD  663

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVV  1359
              F Y  ++S   + G+M++A   +  MI  G+  D   Y+ LIN Y  +  L  A+    
Sbjct  664   EFTYNVILSGFCRQGKMQEAELVLRRMISRGVNPDRATYSALINGYVSKDDLKEAFRFHD  723

Query  1358  EAERKGFDCD  1329
             E  +KGF  D
Sbjct  724   EMLQKGFVPD  733


 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 69/279 (25%), Positives = 123/279 (44%), Gaps = 23/279 (8%)
 Frame = -1

Query  1694  PARRLLNELVD--IGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF-------  1542
             PA +L++ ++    G+  +  + + ++    R RR  +   +L  M RK  +        
Sbjct  103   PALKLVDLVLSGCPGFKHSPESLSAMVHVLVRGRRASDAQGLLLRMVRKSGVSRAEVVDS  162

Query  1541  ------DSFAYCTVISFLIK----AGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKE  1392
                   D  + C V S LI+    A ++++  +    +   GI + + A N L+    K 
Sbjct  163   LIEASRDGGSSCAVFSLLIRTYVQARKLREGAEAFRLLSSKGIRVLIGACNGLLGGLVKA  222

Query  1391  GKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAF  1212
             G +D A+ +  E  R G   D YT  I+++ LCK   M E    L   +  G   ++V +
Sbjct  223   GWVDLAWEVYGEVVRSGVQVDVYTLNIMVNALCKDRKMDEVKSFLLDLEEKGVFPDIVTY  282

Query  1211  NCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCII  1044
             N  I+  C+ G V  A  +  SM EK      +TY+ L++GLC+ G +  A E+L     
Sbjct  283   NTLINAHCREGLVKEAFGLVNSMLEKGMKPSLYTYNGLINGLCRNGEYTRAREMLNEMSE  342

Query  1043  GGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              G+    +    ++  +   G   EA K+  E+ L  ++
Sbjct  343   KGVSPDNASFNTLLVEIGRKGNAVEAEKIFEEMSLRGVV  381


 Score = 71.2 bits (173),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 80/170 (47%), Gaps = 0/170 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             +I +   C    + +A  +  + ++ G+   +++ NT++  +C    +        +M  
Sbjct  563   SILINGFCSTGAVAEALRLWDEMVKGGIRPSLISCNTILKGFCRSGDVSKADEFFSKMVA  622

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              GI PD ITYN+LI    R   + +  +L+ +M  VG+L D ++YN ++    R GK  E
Sbjct  623   KGILPDSITYNTLINGFVRIEDMDKAAELVYKMENVGLLADEFTYNVILSGFCRQGKMQE  682

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIP  1752
             A    + +    + P   T++ L++G       ++A     E+   GF+P
Sbjct  683   AELVLRRMISRGVNPDRATYSALINGYVSKDDLKEAFRFHDEMLQKGFVP  732



>ref|XP_002968006.1| hypothetical protein SELMODRAFT_88008 [Selaginella moellendorffii]
 gb|EFJ31353.1| hypothetical protein SELMODRAFT_88008 [Selaginella moellendorffii]
Length=737

 Score =   224 bits (570),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 142/444 (32%), Positives = 214/444 (48%), Gaps = 4/444 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
              I V  LCK+ ++  A  ++ D I  G   +VVTYNTLI  +C    +D    + ++M E
Sbjct  240   TILVDALCKSARISDASLILEDMIEAGCAPNVVTYNTLINGFCKLGNMDEAVVLFNQMLE  299

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
                 PDV TYN LI    +         LL+EM++ G  P+  +YNTLM  L + GK  +
Sbjct  300   NSCSPDVFTYNILIDGYCKQERPQDGAKLLQEMVKYGCEPNFITYNTLMDSLVKSGKYID  359

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A+   Q +   D  P   TFN+++   C  G  + A  LF+ +   G +P + TYNI+I 
Sbjct  360   AFNLAQMMLRRDCKPSHFTFNLMIDMFCKVGQLDLAYELFQLMTDRGCLPDIYTYNIMIS  419

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G C + R   AR+LL  + + G  P+ +TY +I+    ++ + +E  ++ E +R  GY  
Sbjct  420   GACRANRIDDARQLLERMTEAGCPPDVVTYNSIVSGLCKASQVDEAYEVYEVLRNGGYFL  479

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D     T+I  L K+ R+ DA   +  M  NG   D+VAY  LI+ +CK  +LD +    
Sbjct  480   DVVTCSTLIDGLCKSRRLDDAEKLLREMERNGSAPDVVAYTILIHGFCKADQLDKSLAFF  539

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E   KG      T++I+ID LCK+  +++    L      G   + + +   IDGLCK 
Sbjct  540   SEMLDKGCVPTVITYSIVIDKLCKSARVRDGCMLLKTMLERGVTPDAIVYTSVIDGLCKS  599

Query  1181  GEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
                D A  ++K M +  C     TY+ LV  LCK  R   A  LL      G        
Sbjct  600   DSYDEAYELYKLMKQTGCAPTVVTYNVLVDKLCKVSRLDEAIHLLEVMESDGCLPDTVTY  659

Query  1013  QAVIDGLQHSGFIQEARKLHSELK  942
              +V DG   S    +A +L   +K
Sbjct  660   NSVFDGFWKSAEHDKAFRLFQAMK  683


 Score =   186 bits (473),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 123/438 (28%), Positives = 212/438 (48%), Gaps = 5/438 (1%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
              CKA+  ++A  ++ +  + G+      YNT+I   C    +D+   + +R  +    P 
Sbjct  177   FCKARDFQQAYRLLDEMEKRGIVPHNAVYNTIIKGLCDNGRVDSAL-VHYRDMQRNCAPS  235

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             VITY  L+ +  +   +S    +LE+M+E G  P+  +YNTL++   +LG  DEA   F 
Sbjct  236   VITYTILVDALCKSARISDASLILEDMIEAGCAPNVVTYNTLINGFCKLGNMDEAVVLFN  295

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
              +      P   T+NIL+ G C     +    L +E+   G  P  +TYN L+  L  SG
Sbjct  296   QMLENSCSPDVFTYNILIDGYCKQERPQDGAKLLQEMVKYGCEPNFITYNTLMDSLVKSG  355

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYC  1524
             ++  A  L   ++     P+  T+  ++    +  + +   ++ + M  +G + D + Y 
Sbjct  356   KYIDAFNLAQMMLRRDCKPSHFTFNLMIDMFCKVGQLDLAYELFQLMTDRGCLPDIYTYN  415

Query  1523  TVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERK  1344
              +IS   +A R+ DA   +  M   G   D+V YN++++  CK  ++D AY +       
Sbjct  416   IMISGACRANRIDDARQLLERMTEAGCPPDVVTYNSIVSGLCKASQVDEAYEVYEVLRNG  475

Query  1343  GFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYA  1164
             G+  D  T + +IDGLCK+  + +A + L   +  G   ++VA+   I G CK  ++D +
Sbjct  476   GYFLDVVTCSTLIDGLCKSRRLDDAEKLLREMERNGSAPDVVAYTILIHGFCKADQLDKS  535

Query  1163  LSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDG  996
             L+ F  M +K C     TYS ++  LCK+ R R    LL + +  G+        +VIDG
Sbjct  536   LAFFSEMLDKGCVPTVITYSIVIDKLCKSARVRDGCMLLKTMLERGVTPDAIVYTSVIDG  595

Query  995   LQHSGFIQEARKLHSELK  942
             L  S    EA +L+  +K
Sbjct  596   LCKSDSYDEAYELYKLMK  613


 Score =   153 bits (387),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 105/385 (27%), Positives = 178/385 (46%), Gaps = 5/385 (1%)
 Frame = -1

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             + G K    T N L+++  R        DL +        PD+ +Y+TL++   +     
Sbjct  125   QPGYKHSKFTCNCLLSAFVRKKKAQEAYDLFKNHRCGLCSPDSITYSTLINGFCKARDFQ  184

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             +AYR   ++    I P    +N ++ GLC NG  + AL+ +R+++ +   P ++TY IL+
Sbjct  185   QAYRLLDEMEKRGIVPHNAVYNTIIKGLCDNGRVDSALVHYRDMQRN-CAPSVITYTILV  243

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
               LC S R + A  +L ++++ G  PN +TY T++    +    +E + +  +M      
Sbjct  244   DALCKSARISDASLILEDMIEAGCAPNVVTYNTLINGFCKLGNMDEAVVLFNQMLENSCS  303

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D F Y  +I    K  R +D    +  M+  G E + + YNTL++   K GK  +A+ L
Sbjct  304   PDVFTYNILIDGYCKQERPQDGAKLLQEMVKYGCEPNFITYNTLMDSLVKSGKYIDAFNL  363

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
                  R+      +T  ++ID  CK G +  A          G   ++  +N  I G C+
Sbjct  364   AQMMLRRDCKPSHFTFNLMIDMFCKVGQLDLAYELFQLMTDRGCLPDIYTYNIMISGACR  423

Query  1184  VGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
                +D A  + + M E  C     TY+S+V GLCKA +   A E+      GG  +    
Sbjct  424   ANRIDDARQLLERMTEAGCPPDVVTYNSIVSGLCKASQVDEAYEVYEVLRNGGYFLDVVT  483

Query  1016  RQAVIDGLQHSGFIQEARKLHSELK  942
                +IDGL  S  + +A KL  E++
Sbjct  484   CSTLIDGLCKSRRLDDAEKLLREME  508


 Score =   134 bits (336),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 136/311 (44%), Gaps = 0/311 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI ++  C+A +++ A  ++      G P DVVTYN++++  C    +D  Y +   +  
Sbjct  415   NIMISGACRANRIDDARQLLERMTEAGCPPDVVTYNSIVSGLCKASQVDEAYEVYEVLRN  474

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G   DV+T ++LI    +   L     LL EM   G  PD  +Y  L+H   +  + D+
Sbjct  475   GGYFLDVVTCSTLIDGLCKSRRLDDAEKLLREMERNGSAPDVVAYTILIHGFCKADQLDK  534

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             +  FF ++      P  +T++I++  LC +       ML + +   G  P  + Y  +I 
Sbjct  535   SLAFFSEMLDKGCVPTVITYSIVIDKLCKSARVRDGCMLLKTMLERGVTPDAIVYTSVID  594

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC S  +  A  L   +   G  P  +TY  ++    +  R +E + +LE M   G + 
Sbjct  595   GLCKSDSYDEAYELYKLMKQTGCAPTVVTYNVLVDKLCKVSRLDEAIHLLEVMESDGCLP  654

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D+  Y +V     K+     A+     M   G       Y+ L+     E K+D A  + 
Sbjct  655   DTVTYNSVFDGFWKSAEHDKAFRLFQAMKSRGCSPTPFMYSLLLTKLVAEEKMDQAMEIW  714

Query  1361  VEAERKGFDCD  1329
              EA   G D D
Sbjct  715   EEALEAGADVD  725


 Score =   122 bits (305),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 98/372 (26%), Positives = 161/372 (43%), Gaps = 47/372 (13%)
 Frame = -1

Query  1928  LFRLGKPDEAYRFFQDIFWGDIPP----CPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             L +L   D+A +FF    W    P       T N LLS        ++A  LF+  +   
Sbjct  106   LQQLDDLDKAVKFFD---WCTGQPGYKHSKFTCNCLLSAFVRKKKAQEAYDLFKNHRCGL  162

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P  +TY+ LI+G C +  +  A RLL+E+   G  P+   Y TI+K    + R +  L
Sbjct  163   CSPDSITYSTLINGFCKARDFQQAYRLLDEMEKRGIVPHNAVYNTIIKGLCDNGRVDSAL  222

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
                 +M+R         Y  ++  L K+ R+ DA   + +MI  G   ++V YNTLIN +
Sbjct  223   VHYRDMQRNCAP-SVITYTILVDALCKSARISDASLILEDMIEAGCAPNVVTYNTLINGF  281

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CK G +D A +L  +        D +T+ I+IDG CK    ++  + L      G + N 
Sbjct  282   CKLGNMDEAVVLFNQMLENSCSPDVFTYNILIDGYCKQERPQDGAKLLQEMVKYGCEPNF  341

Query  1220  VAFNCCIDGL-----------------------------------CKVGEVDYALSVFKS  1146
             + +N  +D L                                   CKVG++D A  +F+ 
Sbjct  342   ITYNTLMDSLVKSGKYIDAFNLAQMMLRRDCKPSHFTFNLMIDMFCKVGQLDLAYELFQL  401

Query  1145  MDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGF  978
             M ++ C    +TY+ ++ G C+A R   A +LL      G         +++ GL  +  
Sbjct  402   MTDRGCLPDIYTYNIMISGACRANRIDDARQLLERMTEAGCPPDVVTYNSIVSGLCKASQ  461

Query  977   IQEARKLHSELK  942
             + EA +++  L+
Sbjct  462   VDEAYEVYEVLR  473


 Score =   115 bits (289),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/283 (26%), Positives = 132/283 (47%), Gaps = 0/283 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  V+ LCKA Q+++A  V       G   DVVT +TLI   C    +D    +L  M  
Sbjct  450   NSIVSGLCKASQVDEAYEVYEVLRNGGYFLDVVTCSTLIDGLCKSRRLDDAEKLLREMER  509

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G  PDV+ Y  LI    +   L + L    EML+ G +P   +Y+ ++  L +  +  +
Sbjct  510   NGSAPDVVAYTILIHGFCKADQLDKSLAFFSEMLDKGCVPTVITYSIVIDKLCKSARVRD  569

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
                  + +    + P  + +  ++ GLC +   ++A  L++ +K +G  P +VTYN+L+ 
Sbjct  570   GCMLLKTMLERGVTPDAIVYTSVIDGLCKSDSYDEAYELYKLMKQTGCAPTVVTYNVLVD  629

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LC   R   A  LL  +   G  P+ +TY ++    ++S   ++  ++ + M+ +G   
Sbjct  630   KLCKVSRLDEAIHLLEVMESDGCLPDTVTYNSVFDGFWKSAEHDKAFRLFQAMKSRGCSP  689

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTL  1413
               F Y  +++ L+   +M  A +     +  G ++D     TL
Sbjct  690   TPFMYSLLLTKLVAEEKMDQAMEIWEEALEAGADVDPEISRTL  732



>ref|XP_010540379.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
isoform X1 [Tarenaya hassleriana]
Length=617

 Score =   221 bits (564),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 137/452 (30%), Positives = 230/452 (51%), Gaps = 18/452 (4%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             LNI + C C++ Q+    +V    +++G   DVVT+NTLI  +C    I A   ++ RM 
Sbjct  81    LNIMINCFCRSCQVVLGFSVFGKIMKLGYDPDVVTFNTLINGFCIGGQISAALDLMERMV  140

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             +VG KPDV+T+ +++      G +     L++ M E G  P+T +YN +++ + +LG   
Sbjct  141   DVGHKPDVVTFTTVVKGLFLEGRVYEAGILVDRMAERGCQPNTVTYNVVVNGICKLGDSA  200

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A    + +    I    VT+  ++  LC  G  + AL +F ++   G  P ++TYN LI
Sbjct  201   LALNLIKKMEERTIEVDVVTYTTIIDCLCKVGNIDDALDIFSKMDDRGIAPDVITYNTLI  260

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             + LC+ GRW  A +LL  +      P+ +T+T ++    +  RF E   +  EM ++G  
Sbjct  261   NCLCSYGRWNDASQLLKGMTSRKITPDVVTFTGLIDNFIKEERFAEAKDLYMEMIQRGLN  320

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D+F Y ++I       R+ +A +    MI  G   ++V  N L+N YCK G++D A  L
Sbjct  321   PDTFTYTSLIDGFCMQNRLDEAKEMFDYMISKGCFPNVVTCNVLVNGYCKSGRIDEAMEL  380

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMK-------EALRHLNCTKLMGFDSNLVAFNC  1206
               E  R+    D  T+T +I G C+AG +        E  RH  C        +LV ++ 
Sbjct  381   FSEMSRRRVIPDTNTYTSLIQGFCRAGKLDVAETLFVEMQRHGPCL-------DLVTYSV  433

Query  1205  CIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGG  1038
              +DGLCK G+++ AL ++  M++     +   ++S++HGLCKA +   A  L +     G
Sbjct  434   FLDGLCKNGKLEEALELYYEMEKSGMDLNIVPHNSIIHGLCKAEKVDEAVGLFVKLFDKG  493

Query  1037  MKILKSDRQAVIDGLQHSGFIQEARKLHSELK  942
             ++        +I GL   G + EA+KL  ++K
Sbjct  494   VEPNVRTYNIMIFGLCSKGLLDEAQKLFRDMK  525


 Score =   166 bits (419),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/429 (27%), Positives = 193/429 (45%), Gaps = 39/429 (9%)
 Frame = -1

Query  2105  SILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCL  1926
             ++ H+M +    P  I +N L+++  +       + L + M  +G+  D ++ N +++C 
Sbjct  29    ALFHQMLQSRPLPSTIDFNKLLSAIVKMKRFDIAIFLCKRMELLGVSRDLYTLNIMINCF  88

Query  1925  FRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQL  1746
              R  +    +  F  I      P  VTFN L++G C+ G    AL L   +   G  P +
Sbjct  89    CRSCQVVLGFSVFGKIMKLGYDPDVVTFNTLINGFCIGGQISAALDLMERMVDVGHKPDV  148

Query  1745  VTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEE  1566
             VT+  ++ GL   GR   A  L++ + + G  PN +TY  ++    +       L ++++
Sbjct  149   VTFTTVVKGLFLEGRVYEAGILVDRMAERGCQPNTVTYNVVVNGICKLGDSALALNLIKK  208

Query  1565  MRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGK  1386
             M  +    D   Y T+I  L K G + DA D    M   GI  D++ YNTLIN  C  G+
Sbjct  209   MEERTIEVDVVTYTTIIDCLCKVGNIDDALDIFSKMDDRGIAPDVITYNTLINCLCSYGR  268

Query  1385  LDNAYMLV----------------------VEAER-------------KGFDCDKYTHTI  1311
              ++A  L+                      ++ ER             +G + D +T+T 
Sbjct  269   WNDASQLLKGMTSRKITPDVVTFTGLIDNFIKEERFAEAKDLYMEMIQRGLNPDTFTYTS  328

Query  1310  IIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK-  1134
             +IDG C    + EA    +     G   N+V  N  ++G CK G +D A+ +F  M  + 
Sbjct  329   LIDGFCMQNRLDEAKEMFDYMISKGCFPNVVTCNVLVNGYCKSGRIDEAMELFSEMSRRR  388

Query  1133  ---DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEAR  963
                D  TY+SL+ G C+AG+  VA  L +     G  +        +DGL  +G ++EA 
Sbjct  389   VIPDTNTYTSLIQGFCRAGKLDVAETLFVEMQRHGPCLDLVTYSVFLDGLCKNGKLEEAL  448

Query  962   KLHSELKLS  936
             +L+ E++ S
Sbjct  449   ELYYEMEKS  457


 Score =   166 bits (419),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 110/390 (28%), Positives = 186/390 (48%), Gaps = 0/390 (0%)
 Frame = -1

Query  2276  STKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSIL  2097
             +T   N+ V  +CK      A  +I       +  DVVTY T+I   C    ID    I 
Sbjct  182   NTVTYNVVVNGICKLGDSALALNLIKKMEERTIEVDVVTYTTIIDCLCKVGNIDDALDIF  241

Query  2096  HRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRL  1917
              +M++ GI PDVITYN+LI     +G  +    LL+ M    I PD  ++  L+    + 
Sbjct  242   SKMDDRGIAPDVITYNTLINCLCSYGRWNDASQLLKGMTSRKITPDVVTFTGLIDNFIKE  301

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTY  1737
              +  EA   + ++    + P   T+  L+ G CM    ++A  +F  +   G  P +VT 
Sbjct  302   ERFAEAKDLYMEMIQRGLNPDTFTYTSLIDGFCMQNRLDEAKEMFDYMISKGCFPNVVTC  361

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRR  1557
             N+L++G C SGR   A  L +E+      P+  TYT++++   R+ + +    +  EM+R
Sbjct  362   NVLVNGYCKSGRIDEAMELFSEMSRRRVIPDTNTYTSLIQGFCRAGKLDVAETLFVEMQR  421

Query  1556  KGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDN  1377
              G   D   Y   +  L K G++++A +    M  +G++L++V +N++I+  CK  K+D 
Sbjct  422   HGPCLDLVTYSVFLDGLCKNGKLEEALELYYEMEKSGMDLNIVPHNSIIHGLCKAEKVDE  481

Query  1376  AYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCID  1197
             A  L V+   KG + +  T+ I+I GLC  G + EA +     K  G   +   FN  I 
Sbjct  482   AVGLFVKLFDKGVEPNVRTYNIMIFGLCSKGLLDEAQKLFRDMKEAGCLPSDCTFNTLIR  541

Query  1196  GLCKVGEVDYALSVFKSMDEKDCFTYSSLV  1107
             G  + G     + + + M  +     +S++
Sbjct  542   GHLRNGSSSEVVELVREMKSRGFLPDASIM  571


 Score =   151 bits (381),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 98/352 (28%), Positives = 164/352 (47%), Gaps = 0/352 (0%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             + CLCK   ++ A  +       G+  DV+TYNTLI   C +   +    +L  M    I
Sbjct  225   IDCLCKVGNIDDALDIFSKMDDRGIAPDVITYNTLINCLCSYGRWNDASQLLKGMTSRKI  284

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
              PDV+T+  LI +  +    +   DL  EM++ G+ PDT++Y +L+       + DEA  
Sbjct  285   TPDVVTFTGLIDNFIKEERFAEAKDLYMEMIQRGLNPDTFTYTSLIDGFCMQNRLDEAKE  344

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
              F  +      P  VT N+L++G C +G  ++A+ LF E+     IP   TY  LI G C
Sbjct  345   MFDYMISKGCFPNVVTCNVLVNGYCKSGRIDEAMELFSEMSRRRVIPDTNTYTSLIQGFC  404

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
              +G+   A  L  E+   G   + +TY+  +    ++ + EE L++  EM + G   +  
Sbjct  405   RAGKLDVAETLFVEMQRHGPCLDLVTYSVFLDGLCKNGKLEEALELYYEMEKSGMDLNIV  464

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              + ++I  L KA ++ +A      +   G+E ++  YN +I   C +G LD A  L  + 
Sbjct  465   PHNSIIHGLCKAEKVDEAVGLFVKLFDKGVEPNVRTYNIMIFGLCSKGLLDEAQKLFRDM  524

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCID  1197
             +  G      T   +I G  + G+  E +  +   K  GF  +    +  ID
Sbjct  525   KEAGCLPSDCTFNTLIRGHLRNGSSSEVVELVREMKSRGFLPDASIMSLIID  576


 Score =   121 bits (304),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 142/292 (49%), Gaps = 5/292 (2%)
 Frame = -1

Query  2237  KAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVI  2058
             K ++  +A+ + ++ I+ G+  D  TY +LI  +C    +D    +   M   G  P+V+
Sbjct  300   KEERFAEAKDLYMEMIQRGLNPDTFTYTSLIDGFCMQNRLDEAKEMFDYMISKGCFPNVV  359

Query  2057  TYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDI  1878
             T N L+    + G +   ++L  EM    ++PDT +Y +L+    R GK D A   F ++
Sbjct  360   TCNVLVNGYCKSGRIDEAMELFSEMSRRRVIPDTNTYTSLIQGFCRAGKLDVAETLFVEM  419

Query  1877  FWGDIPPCP--VTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
                   PC   VT+++ L GLC NG  E+AL L+ E++ SG    +V +N +IHGLC + 
Sbjct  420   QRHG--PCLDLVTYSVFLDGLCKNGKLEEALELYYEMEKSGMDLNIVPHNSIIHGLCKAE  477

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYC  1524
             +   A  L  +L D G  PN  TY  ++         +E  ++  +M+  G +     + 
Sbjct  478   KVDEAVGLFVKLFDKGVEPNVRTYNIMIFGLCSKGLLDEAQKLFRDMKEAGCLPSDCTFN  537

Query  1523  TVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
             T+I   ++ G   +  + V  M   G   D    + +I++   +G+LD  ++
Sbjct  538   TLIRGHLRNGSSSEVVELVREMKSRGFLPDASIMSLIIDM-VYDGRLDKEFL  588


 Score =   106 bits (265),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/228 (29%), Positives = 115/228 (50%), Gaps = 0/228 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N+ V   CK+ ++++A  +  +  R  V  D  TY +LI  +C    +D   ++   M  
Sbjct  362   NVLVNGYCKSGRIDEAMELFSEMSRRRVIPDTNTYTSLIQGFCRAGKLDVAETLFVEMQR  421

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G   D++TY+  +    ++G L   L+L  EM + G+  +   +N+++H L +  K DE
Sbjct  422   HGPCLDLVTYSVFLDGLCKNGKLEEALELYYEMEKSGMDLNIVPHNSIIHGLCKAEKVDE  481

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F  +F   + P   T+NI++ GLC  G  ++A  LFR++K +G +P   T+N LI 
Sbjct  482   AVGLFVKLFDKGVEPNVRTYNIMIFGLCSKGLLDEAQKLFRDMKEAGCLPSDCTFNTLIR  541

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQ  1578
             G   +G  +    L+ E+   G+ P+A   + I+   +  R  +E L 
Sbjct  542   GHLRNGSSSEVVELVREMKSRGFLPDASIMSLIIDMVYDGRLDKEFLD  589



>gb|KDO54847.1| hypothetical protein CISIN_1g004758mg [Citrus sinensis]
Length=487

 Score =   218 bits (556),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 136/475 (29%), Positives = 236/475 (50%), Gaps = 39/475 (8%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             V  LCK  +++ A+  + +  + GV  D VTYNTLI AYC    ++  + +++ M+  G+
Sbjct  2     VNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGL  61

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             KP V TYNSLI    + G   R  ++L+EML++G+ PDT +YNTL+    R     EA  
Sbjct  62    KPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEE  121

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
              F ++    + P  V+F+ L+     NG  ++ALM FRE+K +G +P  V Y I+I+G C
Sbjct  122   IFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYC  181

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
              +G    A ++ +E+++ G   + +TY TI+    R++   E   +  EM  +G   D +
Sbjct  182   RNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFY  241

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              + T+I    K G M  A +    M    I+ D+V YNTLI+ +CK G+++ A  L  + 
Sbjct  242   TFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADM  301

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALR-------------HLNCTKLM---------  1239
               +    +  ++ I+I+G C  G++ EA R              ++C  ++         
Sbjct  302   ISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDA  361

Query  1238  -------------GFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSL  1110
                          G D + +++N  I+G  +   +D A ++   M+ +    D  TY+ +
Sbjct  362   SKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVI  421

Query  1109  VHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             + G C+ GR   +  +L   I  G+   +S    +I+G      ++EA + H E+
Sbjct  422   LTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEM  476


 Score =   163 bits (413),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 169/348 (49%), Gaps = 2/348 (1%)
 Frame = -1

Query  2309  LE*MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCC  2130
             L+ M ++     T   N  +   C+ + + +AE +  +  R GV  D+V+++TLI  +  
Sbjct  88    LDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSR  147

Query  2129  FVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWS  1950
                +D        M   G+ PD + Y  +I    R+G +   L + +EMLE G + D  +
Sbjct  148   NGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVT  207

Query  1949  YNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELK  1770
             YNT+++ L R     EA   F ++    + P   TF  L+ G C +G   KAL LF  + 
Sbjct  208   YNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMT  267

Query  1769  HSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFE  1590
                  P +VTYN LI G C  G    A +L  +++    +PN I+Y  ++          
Sbjct  268   QKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVT  327

Query  1589  EGLQILEEMRRKGYIFDSFAYC-TVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTL  1413
             E  ++  EM  KG I  +   C T+I    ++G    A + +  M+  G++ D ++YNTL
Sbjct  328   EAFRLWYEMVGKG-IKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTL  386

Query  1412  INLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
             IN + +E  +D A+ LV + E +G   D  T+ +I+ G C+ G M ++
Sbjct  387   INGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDS  434


 Score =   163 bits (412),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 107/407 (26%), Positives = 189/407 (46%), Gaps = 4/407 (1%)
 Frame = -1

Query  2150  LITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVG  1971
             ++ A C    ID+    L  M + G+ PD +TYN+LI +  R G L     L+  M   G
Sbjct  1     MVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKG  60

Query  1970  ILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKAL  1791
             + P  ++YN+L++ L + G+ D A     ++    + P   T+N LL   C      +A 
Sbjct  61    LKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAE  120

Query  1790  MLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCC  1611
              +F E+   G  P +V+++ LI     +G+   A     E+   G  P+ + YT I+   
Sbjct  121   EIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGY  180

Query  1610  FRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDL  1431
              R+    E L++ +EM  KG + D   Y T+++ L +A  + +A D    M+  G+  D 
Sbjct  181   CRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDF  240

Query  1430  VAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNC  1251
               + TLI+ +CK+G ++ A  L     +K    D  T+  +IDG CK G M++A +    
Sbjct  241   YTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWAD  300

Query  1250  TKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGR  1083
                     N +++   I+G C +G V  A  ++  M  K       + ++++ G C++G 
Sbjct  301   MISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGD  360

Query  1082  FRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELK  942
                A E L   +  G+         +I+G      + +A  L S+++
Sbjct  361   ASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKME  407


 Score =   154 bits (388),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 148/285 (52%), Gaps = 0/285 (0%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC  2004
             G   DVVTYNT++   C    +     + + M E G+ PD  T+ +LI    + G +++ 
Sbjct  200   GCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKA  259

Query  2003  LDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSG  1824
             L+L + M +  I PD  +YNTL+    ++G+ ++A + + D+    I P  +++ IL++G
Sbjct  260   LNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILING  319

Query  1823  LCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPN  1644
              C  G+  +A  L+ E+   G  P LV+ N +I G C SG  + A   L+++V  G +P+
Sbjct  320   YCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPD  379

Query  1643  AITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVG  1464
             +I+Y T++    R    ++   ++ +M  +G + D   Y  +++   + GRM D+   + 
Sbjct  380   SISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILW  439

Query  1463  NMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCD  1329
              MI  G+  D   Y TLIN +  +  L  A+    E  ++GF  D
Sbjct  440   RMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPD  484


 Score =   123 bits (309),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/276 (28%), Positives = 131/276 (47%), Gaps = 0/276 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LC+AK L +A+ +  + +  GV  D  T+ TLI  +C    ++   ++   M +
Sbjct  209   NTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQ  268

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               IKPD++TYN+LI    + G + +   L  +M+   I P+  SY  L++    +G   E
Sbjct  269   KSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTE  328

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A+R + ++    I P  V+ N ++ G C +G   KA     ++   G  P  ++YN LI+
Sbjct  329   AFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLIN  388

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G         A  L++++ + G  P+ ITY  I+    R  R  +   IL  M  KG   
Sbjct  389   GFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNP  448

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELD  1434
             D   Y T+I+  +    +K+A+     M+  G   D
Sbjct  449   DRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPD  484



>gb|KHN25331.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=437

 Score =   216 bits (551),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/405 (31%), Positives = 208/405 (51%), Gaps = 4/405 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             MFR+  R S    NI +  LCK  +L+KA+  I     +GV  +VVTYNT+I  +C    
Sbjct  21    MFRMNIRSSLYTFNIMINVLCKEGKLKKAKEFIGHMETLGVKPNVVTYNTIIHGHCLRGK  80

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
                   I   M + G++PD  TYNS I+   + G +     L+ +MLE G++P+  +YN 
Sbjct  81    FQRARVIFQTMKDKGLEPDCYTYNSFISGLCKEGRVEEASGLICKMLEGGLVPNAVTYNA  140

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             L+      G  D+AY +  ++    I    VT+N+ +  L M G    A  + +E++  G
Sbjct  141   LIDGYCNKGDLDKAYAYRDEMISKGIMASLVTYNLFIHALFMEGRMGDADNMIKEMREKG  200

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
              +P  VT+NILI+G C  G    A  LL+E+V  G  P  +TYT+++    +  R +E  
Sbjct  201   MMPDAVTHNILINGYCRCGDAKRAFGLLDEMVGKGIQPTLVTYTSLIYVLGKRNRMKEAD  260

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
              +  +++++G + D   +  +I      G +  A+  +  M    +  D + YNTL+  Y
Sbjct  261   ALFSKIQQEGLLPDIIVFNALIDGHCANGNIDRAFQLLKEMDNMKVLPDEITYNTLMQGY  320

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             C++GK++ A  L+ E +R+G   D  ++  +I G  K G+MK+A R  +     GFD  +
Sbjct  321   CRDGKVEEARQLLDEMKRRGIKPDHISYNTLISGYSKRGDMKDAFRVRDEMMTTGFDPTI  380

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGL  1098
             + +N  I GLCK  E ++A  + K M  K    D  TY S++  +
Sbjct  381   LTYNALIQGLCKNQEGEHAEELLKEMVSKGITPDDSTYLSIIEAM  425


 Score =   187 bits (474),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 114/425 (27%), Positives = 205/425 (48%), Gaps = 4/425 (1%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             ++   K  + + A  +  +  R+ + + + T+N +I   C    +      +  M  +G+
Sbjct  2     LSLFLKLNRTQMAWVLYAEMFRMNIRSSLYTFNIMINVLCKEGKLKKAKEFIGHMETLGV  61

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             KP+V+TYN++I      G   R   + + M + G+ PD ++YN+ +  L + G+ +EA  
Sbjct  62    KPNVVTYNTIIHGHCLRGKFQRARVIFQTMKDKGLEPDCYTYNSFISGLCKEGRVEEASG  121

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
                 +  G + P  VT+N L+ G C  G  +KA     E+   G +  LVTYN+ IH L 
Sbjct  122   LICKMLEGGLVPNAVTYNALIDGYCNKGDLDKAYAYRDEMISKGIMASLVTYNLFIHALF  181

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
               GR   A  ++ E+ + G  P+A+T+  ++    R    +    +L+EM  KG      
Sbjct  182   MEGRMGDADNMIKEMREKGMMPDAVTHNILINGYCRCGDAKRAFGLLDEMVGKGIQPTLV  241

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              Y ++I  L K  RMK+A      +   G+  D++ +N LI+ +C  G +D A+ L+ E 
Sbjct  242   TYTSLIYVLGKRNRMKEADALFSKIQQEGLLPDIIVFNALIDGHCANGNIDRAFQLLKEM  301

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEV  1173
             +      D+ T+  ++ G C+ G ++EA + L+  K  G   + +++N  I G  K G++
Sbjct  302   DNMKVLPDEITYNTLMQGYCRDGKVEEARQLLDEMKRRGIKPDHISYNTLISGYSKRGDM  361

Query  1172  DYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAV  1005
               A  V   M     +    TY++L+ GLCK      A ELL   +  G+    S   ++
Sbjct  362   KDAFRVRDEMMTTGFDPTILTYNALIQGLCKNQEGEHAEELLKEMVSKGITPDDSTYLSI  421

Query  1004  IDGLQ  990
             I+ ++
Sbjct  422   IEAME  426


 Score =   161 bits (408),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 106/355 (30%), Positives = 169/355 (48%), Gaps = 4/355 (1%)
 Frame = -1

Query  1997  LLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLC  1818
             L  EM  + I    +++N +++ L + GK  +A  F   +    + P  VT+N ++ G C
Sbjct  17    LYAEMFRMNIRSSLYTFNIMINVLCKEGKLKKAKEFIGHMETLGVKPNVVTYNTIIHGHC  76

Query  1817  MNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAI  1638
             + G  ++A ++F+ +K  G  P   TYN  I GLC  GR   A  L+ ++++ G  PNA+
Sbjct  77    LRGKFQRARVIFQTMKDKGLEPDCYTYNSFISGLCKEGRVEEASGLICKMLEGGLVPNAV  136

Query  1637  TYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNM  1458
             TY  ++         ++     +EM  KG +     Y   I  L   GRM DA + +  M
Sbjct  137   TYNALIDGYCNKGDLDKAYAYRDEMISKGIMASLVTYNLFIHALFMEGRMGDADNMIKEM  196

Query  1457  IMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNM  1278
                G+  D V +N LIN YC+ G    A+ L+ E   KG      T+T +I  L K   M
Sbjct  197   REKGMMPDAVTHNILINGYCRCGDAKRAFGLLDEMVGKGIQPTLVTYTSLIYVLGKRNRM  256

Query  1277  KEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE----KDCFTYSSL  1110
             KEA    +  +  G   +++ FN  IDG C  G +D A  + K MD      D  TY++L
Sbjct  257   KEADALFSKIQQEGLLPDIIVFNALIDGHCANGNIDRAFQLLKEMDNMKVLPDEITYNTL  316

Query  1109  VHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             + G C+ G+   A +LL      G+K        +I G    G +++A ++  E+
Sbjct  317   MQGYCRDGKVEEARQLLDEMKRRGIKPDHISYNTLISGYSKRGDMKDAFRVRDEM  371



>gb|KDO54845.1| hypothetical protein CISIN_1g004758mg [Citrus sinensis]
 gb|KDO54846.1| hypothetical protein CISIN_1g004758mg [Citrus sinensis]
Length=732

 Score =   223 bits (568),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 140/484 (29%), Positives = 241/484 (50%), Gaps = 39/484 (8%)
 Frame = -1

Query  2279  LSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSI  2100
             L+   LNI V  LCK  +++ A+  + +  + GV  D VTYNTLI AYC    ++  + +
Sbjct  238   LNVYTLNIMVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFLEEAFQL  297

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             ++ M+  G+KP V TYNSLI    + G   R  ++L+EML++G+ PDT +YNTL+    R
Sbjct  298   MNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTLLVESCR  357

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
                  EA   F ++    + P  V+F+ L+     NG  ++ALM FRE+K +G +P  V 
Sbjct  358   KENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGLVPDNVL  417

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             Y I+I+G C +G    A ++ +E+++ G   + +TY TI+    R++   E   +  EM 
Sbjct  418   YTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADDLFNEML  477

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              +G   D + + T+I    K G M  A +    M    I+ D+V YNTLI+ +CK G+++
Sbjct  478   ERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEME  537

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALR-------------HLNCTKLM  1239
              A  L  +   +    +  ++ I+I+G C  G++ EA R              ++C  ++
Sbjct  538   KANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTII  597

Query  1238  ----------------------GFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK---  1134
                                   G D + +++N  I+G  +   +D A ++   M+ +   
Sbjct  598   KGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLINGFVREENMDKAFALVSKMENQGLV  657

Query  1133  -DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
              D  TY+ ++ G C+ GR   +  +L   I  G+   +S    +I+G      ++EA + 
Sbjct  658   PDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRF  717

Query  956   HSEL  945
             H E+
Sbjct  718   HDEM  721


 Score =   174 bits (442),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 117/444 (26%), Positives = 206/444 (46%), Gaps = 4/444 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  L K   ++ A  V  + +R G+  +V T N ++ A C    ID+    L  M +
Sbjct  209   NSLLGGLVKIGWVDLAREVYAEVVRSGIELNVYTLNIMVNALCKDHKIDSAKMFLCEMEQ  268

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G+ PD +TYN+LI +  R G L     L+  M   G+ P  ++YN+L++ L + G+ D 
Sbjct  269   KGVYPDTVTYNTLINAYCREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDR  328

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A     ++    + P   T+N LL   C      +A  +F E+   G  P +V+++ LI 
Sbjct  329   AKEVLDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIG  388

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
                 +G+   A     E+   G  P+ + YT I+    R+    E L++ +EM  KG + 
Sbjct  389   IFSRNGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVM  448

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y T+++ L +A  + +A D    M+  G+  D   + TLI+ +CK+G ++ A  L 
Sbjct  449   DVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLF  508

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
                 +K    D  T+  +IDG CK G M++A +            N +++   I+G C +
Sbjct  509   DIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSM  568

Query  1181  GEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G V  A  ++  M  K       + ++++ G C++G    A E L   +  G+       
Sbjct  569   GHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISY  628

Query  1013  QAVIDGLQHSGFIQEARKLHSELK  942
               +I+G      + +A  L S+++
Sbjct  629   NTLINGFVREENMDKAFALVSKME  652


 Score =   164 bits (416),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 113/445 (25%), Positives = 203/445 (46%), Gaps = 4/445 (1%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
             + ++ +    +A++L +   V       G+   +   N+L+        +D    +   +
Sbjct  172   IFDLVIRTYVQARKLREGSEVFRLLRNKGICFSINACNSLLGGLVKIGWVDLAREVYAEV  231

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
                GI+ +V T N ++ +  +   +      L EM + G+ PDT +YNTL++   R G  
Sbjct  232   VRSGIELNVYTLNIMVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAYCREGFL  291

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             +EA++    +    + P   T+N L++GLC  G  ++A  +  E+   G  P   TYN L
Sbjct  292   EEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDTATYNTL  351

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             +   C     + A  +  E+   G  P+ ++++T++    R+ + +  L    EM+  G 
Sbjct  352   LVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSRNGQLDRALMYFREMKSAGL  411

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
             + D+  Y  +I+   + G + +A      M+  G  +D+V YNT++N  C+   L  A  
Sbjct  412   VPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVTYNTILNGLCRAKMLTEADD  471

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLC  1188
             L  E   +G   D YT T +I G CK GNM +AL   +         ++V +N  IDG C
Sbjct  472   LFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQKSIKPDIVTYNTLIDGFC  531

Query  1187  KVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             KVGE++ A  ++  M  +    +  +Y  L++G C  G    A  L    +  G+K    
Sbjct  532   KVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTEAFRLWYEMVGKGIKPTLV  591

Query  1019  DRQAVIDGLQHSGFIQEARKLHSEL  945
                 +I G   SG   +A +  S++
Sbjct  592   SCNTIIKGYCRSGDASKADEFLSKM  616


 Score =   162 bits (411),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 169/348 (49%), Gaps = 2/348 (1%)
 Frame = -1

Query  2309  LE*MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCC  2130
             L+ M ++     T   N  +   C+ + + +AE +  +  R GV  D+V+++TLI  +  
Sbjct  333   LDEMLQMGLSPDTATYNTLLVESCRKENMSEAEEIFCEMSRRGVAPDIVSFSTLIGIFSR  392

Query  2129  FVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWS  1950
                +D        M   G+ PD + Y  +I    R+G +   L + +EMLE G + D  +
Sbjct  393   NGQLDRALMYFREMKSAGLVPDNVLYTIIINGYCRNGFVLEALKMRDEMLEKGCVMDVVT  452

Query  1949  YNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELK  1770
             YNT+++ L R     EA   F ++    + P   TF  L+ G C +G   KAL LF  + 
Sbjct  453   YNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMT  512

Query  1769  HSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFE  1590
                  P +VTYN LI G C  G    A +L  +++    +PN I+Y  ++          
Sbjct  513   QKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVT  572

Query  1589  EGLQILEEMRRKGYIFDSFAYC-TVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTL  1413
             E  ++  EM  KG I  +   C T+I    ++G    A + +  M+  G++ D ++YNTL
Sbjct  573   EAFRLWYEMVGKG-IKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTL  631

Query  1412  INLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
             IN + +E  +D A+ LV + E +G   D  T+ +I+ G C+ G M ++
Sbjct  632   INGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDS  679


 Score =   153 bits (387),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 148/285 (52%), Gaps = 0/285 (0%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC  2004
             G   DVVTYNT++   C    +     + + M E G+ PD  T+ +LI    + G +++ 
Sbjct  445   GCVMDVVTYNTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKA  504

Query  2003  LDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSG  1824
             L+L + M +  I PD  +YNTL+    ++G+ ++A + + D+    I P  +++ IL++G
Sbjct  505   LNLFDIMTQKSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILING  564

Query  1823  LCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPN  1644
              C  G+  +A  L+ E+   G  P LV+ N +I G C SG  + A   L+++V  G +P+
Sbjct  565   YCSMGHVTEAFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPD  624

Query  1643  AITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVG  1464
             +I+Y T++    R    ++   ++ +M  +G + D   Y  +++   + GRM D+   + 
Sbjct  625   SISYNTLINGFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILW  684

Query  1463  NMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCD  1329
              MI  G+  D   Y TLIN +  +  L  A+    E  ++GF  D
Sbjct  685   RMIEKGLNPDRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPD  729


 Score =   122 bits (307),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/276 (28%), Positives = 131/276 (47%), Gaps = 0/276 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LC+AK L +A+ +  + +  GV  D  T+ TLI  +C    ++   ++   M +
Sbjct  454   NTILNGLCRAKMLTEADDLFNEMLERGVFPDFYTFTTLIHGHCKDGNMNKALNLFDIMTQ  513

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               IKPD++TYN+LI    + G + +   L  +M+   I P+  SY  L++    +G   E
Sbjct  514   KSIKPDIVTYNTLIDGFCKVGEMEKANKLWADMISRKISPNYISYGILINGYCSMGHVTE  573

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A+R + ++    I P  V+ N ++ G C +G   KA     ++   G  P  ++YN LI+
Sbjct  574   AFRLWYEMVGKGIKPTLVSCNTIIKGYCRSGDASKADEFLSKMVSEGVDPDSISYNTLIN  633

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G         A  L++++ + G  P+ ITY  I+    R  R  +   IL  M  KG   
Sbjct  634   GFVREENMDKAFALVSKMENQGLVPDVITYNVILTGFCRQGRMHDSELILWRMIEKGLNP  693

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELD  1434
             D   Y T+I+  +    +K+A+     M+  G   D
Sbjct  694   DRSTYTTLINGHVSQNNLKEAFRFHDEMLQRGFVPD  729


 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/263 (27%), Positives = 128/263 (49%), Gaps = 26/263 (10%)
 Frame = -1

Query  1784  FRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLN-----------ELVDI---GYNP  1647
             F  +KHS      ++ + +IH L    R + A+ L+            E+VD     Y+P
Sbjct  111   FPNVKHSS-----MSLSAMIHFLVRGRRISDAQALILRMVRKSGVSRLEIVDSFVSTYSP  165

Query  1646  ---NAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAY  1476
                N++ +  +++   ++R+  EG ++   +R KG  F   A  +++  L+K G +  A 
Sbjct  166   CGSNSLIFDLVIRTYVQARKLREGSEVFRLLRNKGICFSINACNSLLGGLVKIGWVDLAR  225

Query  1475  DCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGL  1296
             +    ++ +GIEL++   N ++N  CK+ K+D+A M + E E+KG   D  T+  +I+  
Sbjct  226   EVYAEVVRSGIELNVYTLNIMVNALCKDHKIDSAKMFLCEMEQKGVYPDTVTYNTLINAY  285

Query  1295  CKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE----KDC  1128
             C+ G ++EA + +N     G    +  +N  I+GLCK G  D A  V   M +     D 
Sbjct  286   CREGFLEEAFQLMNSMSGKGLKPGVFTYNSLINGLCKKGRCDRAKEVLDEMLQMGLSPDT  345

Query  1127  FTYSSLVHGLCKAGRFRVASELL  1059
              TY++L+   C+      A E+ 
Sbjct  346   ATYNTLLVESCRKENMSEAEEIF  368



>ref|XP_009345567.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Pyrus x bretschneideri]
 ref|XP_009345568.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like 
[Pyrus x bretschneideri]
Length=755

 Score =   223 bits (569),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 141/485 (29%), Positives = 241/485 (50%), Gaps = 39/485 (8%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             +L+   LNI V  LCKA+++E  +  + D    GV +D+VTYNTLI AYC    ++  + 
Sbjct  260   QLNVYTLNIMVNALCKARKIESVKFFLSDMEEKGVFSDIVTYNTLINAYCREGLLEEAFQ  319

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             + + M+  G+KP++ TYN+++    + G  +R  ++L EML+ G+ PDT +YNT++    
Sbjct  320   LKNSMSSKGLKPELFTYNAIMNGLCKVGNYARAKEMLYEMLQGGLNPDTTTYNTMLFESC  379

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             R G   EA   F ++    + P  V+F+ L+     N   ++AL+ FR++K +G +P  V
Sbjct  380   RKGDFLEAEEIFHEMSQRGVVPDMVSFSSLIGVFSRNKNIDRALLYFRDMKRAGLVPDNV  439

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
              Y ILI G C  G    A +L +E+++ G   + +T+ TI+    R +   +  ++  EM
Sbjct  440   IYTILIDGYCRKGMMLEALKLRDEMLEQGCTIDVVTFNTILNGLCREKMLSDADELFNEM  499

Query  1562  RRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
               +G I D + + T+I    K G M  + +    M    I+ D+V YNTL + +CK G++
Sbjct  500   LERGVIPDFYTFTTLIHGYCKHGNMTKSLNLFDAMTNGNIKPDIVTYNTLFDGFCKLGEM  559

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D A  L  +   +    +  ++ I+I+G C  GN+ EA R  +     G    LV  N  
Sbjct  560   DKAKELWDDMVSRRILPNHISYGILINGFCSMGNVHEAFRLWDQMIEEGIKPTLVTCNTV  619

Query  1202  IDGLCKVGE-----------------------------------VDYALSVFKSMDEK--  1134
             I G C+ G+                                   ++ A S  + M+++  
Sbjct  620   IKGYCRSGDTTKADEFLGKMISKGVVPDSITYNTLINGYVKEENLNKAFSSVQEMEKQGI  679

Query  1133  --DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARK  960
               D FTY+ +++G C+ GR   A  +L   I  G+K  +S   ++I+G      ++EA +
Sbjct  680   LSDQFTYNIILNGFCRQGRMHEAELVLRKMIERGVKPDRSTYTSLINGHVTQDNLKEAFR  739

Query  959   LHSEL  945
              H E+
Sbjct  740   FHDEM  744


 Score =   169 bits (428),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 115/432 (27%), Positives = 200/432 (46%), Gaps = 15/432 (3%)
 Frame = -1

Query  2309  LE*MFRIKSRLSTKLL-------NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNT  2151
             LE  F++K+ +S+K L       N  +  LCK     +A+ ++ + ++ G+  D  TYNT
Sbjct  314   LEEAFQLKNSMSSKGLKPELFTYNAIMNGLCKVGNYARAKEMLYEMLQGGLNPDTTTYNT  373

Query  2150  LITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVG  1971
             ++   C          I H M++ G+ PD+++++SLI   +R+  + R L    +M   G
Sbjct  374   MLFESCRKGDFLEAEEIFHEMSQRGVVPDMVSFSSLIGVFSRNKNIDRALLYFRDMKRAG  433

Query  1970  ILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKAL  1791
             ++PD   Y  L+    R G   EA +   ++         VTFN +L+GLC       A 
Sbjct  434   LVPDNVIYTILIDGYCRKGMMLEALKLRDEMLEQGCTIDVVTFNTILNGLCREKMLSDAD  493

Query  1790  MLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCC  1611
              LF E+   G IP   T+  LIHG C  G    +  L + + +    P+ +TY T+    
Sbjct  494   ELFNEMLERGVIPDFYTFTTLIHGYCKHGNMTKSLNLFDAMTNGNIKPDIVTYNTLFDGF  553

Query  1610  FRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDL  1431
              +    ++  ++ ++M  +  + +  +Y  +I+     G + +A+     MI  GI+  L
Sbjct  554   CKLGEMDKAKELWDDMVSRRILPNHISYGILINGFCSMGNVHEAFRLWDQMIEEGIKPTL  613

Query  1430  VAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNC  1251
             V  NT+I  YC+ G    A   + +   KG   D  T+  +I+G  K  N+ +A   +  
Sbjct  614   VTCNTVIKGYCRSGDTTKADEFLGKMISKGVVPDSITYNTLINGYVKEENLNKAFSSVQE  673

Query  1250  TKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGR  1083
              +  G  S+   +N  ++G C+ G +  A  V + M E+    D  TY+SL++G      
Sbjct  674   MEKQGILSDQFTYNIILNGFCRQGRMHEAELVLRKMIERGVKPDRSTYTSLINGHVTQDN  733

Query  1082  ----FRVASELL  1059
                 FR   E+L
Sbjct  734   LKEAFRFHDEML  745


 Score =   167 bits (422),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 113/441 (26%), Positives = 201/441 (46%), Gaps = 4/441 (1%)
 Frame = -1

Query  2276  STKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSIL  2097
             S+ + ++ V    +AK+L +         R G    +   N+L+        ID  + + 
Sbjct  192   SSLVFDLFVRTYVQAKKLREGFEAFQVFRRKGFCVSINACNSLLGGLVKVGWIDLAWVVY  251

Query  2096  HRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRL  1917
               +   GI+ +V T N ++ +  +   +      L +M E G+  D  +YNTL++   R 
Sbjct  252   GEVVSSGIQLNVYTLNIMVNALCKARKIESVKFFLSDMEEKGVFSDIVTYNTLINAYCRE  311

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTY  1737
             G  +EA++    +    + P   T+N +++GLC  G   +A  +  E+   G  P   TY
Sbjct  312   GLLEEAFQLKNSMSSKGLKPELFTYNAIMNGLCKVGNYARAKEMLYEMLQGGLNPDTTTY  371

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRR  1557
             N ++   C  G +  A  + +E+   G  P+ +++++++    R++  +  L    +M+R
Sbjct  372   NTMLFESCRKGDFLEAEEIFHEMSQRGVVPDMVSFSSLIGVFSRNKNIDRALLYFRDMKR  431

Query  1556  KGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDN  1377
              G + D+  Y  +I    + G M +A      M+  G  +D+V +NT++N  C+E  L +
Sbjct  432   AGLVPDNVIYTILIDGYCRKGMMLEALKLRDEMLEQGCTIDVVTFNTILNGLCREKMLSD  491

Query  1376  AYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCID  1197
             A  L  E   +G   D YT T +I G CK GNM ++L   +         ++V +N   D
Sbjct  492   ADELFNEMLERGVIPDFYTFTTLIHGYCKHGNMTKSLNLFDAMTNGNIKPDIVTYNTLFD  551

Query  1196  GLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
             G CK+GE+D A  ++  M  +    +  +Y  L++G C  G    A  L    I  G+K 
Sbjct  552   GFCKLGEMDKAKELWDDMVSRRILPNHISYGILINGFCSMGNVHEAFRLWDQMIEEGIKP  611

Query  1028  LKSDRQAVIDGLQHSGFIQEA  966
                    VI G   SG   +A
Sbjct  612   TLVTCNTVIKGYCRSGDTTKA  632


 Score =   157 bits (396),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/310 (28%), Positives = 154/310 (50%), Gaps = 0/310 (0%)
 Frame = -1

Query  2258  ITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEV  2079
             I +   C+   + +A  +  + +  G   DVVT+NT++   C    +     + + M E 
Sbjct  443   ILIDGYCRKGMMLEALKLRDEMLEQGCTIDVVTFNTILNGLCREKMLSDADELFNEMLER  502

Query  2078  GIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEA  1899
             G+ PD  T+ +LI    +HG +++ L+L + M    I PD  +YNTL     +LG+ D+A
Sbjct  503   GVIPDFYTFTTLIHGYCKHGNMTKSLNLFDAMTNGNIKPDIVTYNTLFDGFCKLGEMDKA  562

Query  1898  YRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHG  1719
                + D+    I P  +++ IL++G C  G   +A  L+ ++   G  P LVT N +I G
Sbjct  563   KELWDDMVSRRILPNHISYGILINGFCSMGNVHEAFRLWDQMIEEGIKPTLVTCNTVIKG  622

Query  1718  LCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFD  1539
              C SG    A   L +++  G  P++ITY T++    +     +    ++EM ++G + D
Sbjct  623   YCRSGDTTKADEFLGKMISKGVVPDSITYNTLINGYVKEENLNKAFSSVQEMEKQGILSD  682

Query  1538  SFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVV  1359
              F Y  +++   + GRM +A   +  MI  G++ D   Y +LIN +  +  L  A+    
Sbjct  683   QFTYNIILNGFCRQGRMHEAELVLRKMIERGVKPDRSTYTSLINGHVTQDNLKEAFRFHD  742

Query  1358  EAERKGFDCD  1329
             E  ++GF  D
Sbjct  743   EMLQRGFLPD  752



>ref|XP_006391822.1| hypothetical protein EUTSA_v10023344mg [Eutrema salsugineum]
 gb|ESQ29108.1| hypothetical protein EUTSA_v10023344mg [Eutrema salsugineum]
Length=633

 Score =   221 bits (563),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 133/457 (29%), Positives = 228/457 (50%), Gaps = 6/457 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M RI   L T   NI + C C++ QL  A  ++   +++G   D+VT+N+L+  +C    
Sbjct  112   MLRIPHNLYT--YNILINCFCRSSQLSSAFAILGKMMKLGYEPDLVTFNSLLNGFCHGNR  169

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             I    S+L +M E+G KPD +T+ +LI     +  +S  + L++ M   G  PD  +Y  
Sbjct  170   ISDAVSLLDQMVELGYKPDTVTFTTLIHGLFLNNKVSEAVALVDRMAAKGCQPDLLTYGA  229

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             +++ + + G  D A    + +    I P  V +N ++ GLC      +AL LF E+++ G
Sbjct  230   VINGICKRGSMDLALNLLKKLEAEKIKPNVVIYNTVIDGLCKYRDVNEALDLFNEMENKG  289

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P ++TYN LI  LCN GRW+   RLL++++    NP+ +T+  ++    +  +  E  
Sbjct  290   IKPNVITYNSLISCLCNYGRWSDTSRLLSDMIKRKLNPDVVTFNALIDALVKEGKLLEAE  349

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             ++ +EM  +    ++  Y ++I+      R+ +A      M+      D+V  NTLIN  
Sbjct  350   ELYKEMIERSVTPNTITYNSLINGFCMHDRLDEAERMFELMVSKDSLPDIVTCNTLINGL  409

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CK  ++++   L  E  ++G   D  T+T ++ G  +AG+   A          G   ++
Sbjct  410   CKSKRVEDGRELFREMSQRGLVADTITYTTLMQGFFQAGDCDNAQEVFKQMVSDGVPRDI  469

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELLLS  1053
             V +N  +DGLC   +++ AL +F+ M     E D  TY+ ++HG CKAG    A EL  S
Sbjct  470   VTYNTLLDGLCNNEKLENALFIFQDMQKSEIELDIATYNIIIHGKCKAGEIEDAQELFCS  529

Query  1052  CIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELK  942
               + G++        +I GL     + EA  L  E+K
Sbjct  530   LRLKGLQPDVITYNTMISGLCSKRLLNEADALFREMK  566


 Score =   204 bits (519),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/389 (30%), Positives = 198/389 (51%), Gaps = 7/389 (2%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC  2004
             G   D++TY  +I   C    +D   ++L ++    IKP+V+ YN++I    ++  ++  
Sbjct  219   GCQPDLLTYGAVINGICKRGSMDLALNLLKKLEAEKIKPNVVIYNTVIDGLCKYRDVNEA  278

Query  2003  LDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSG  1824
             LDL  EM   GI P+  +YN+L+ CL   G+  +  R   D+    + P  VTFN L+  
Sbjct  279   LDLFNEMENKGIKPNVITYNSLISCLCNYGRWSDTSRLLSDMIKRKLNPDVVTFNALIDA  338

Query  1823  LCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPN  1644
             L   G   +A  L++E+      P  +TYN LI+G C   R   A R+   +V     P+
Sbjct  339   LVKEGKLLEAEELYKEMIERSVTPNTITYNSLINGFCMHDRLDEAERMFELMVSKDSLPD  398

Query  1643  AITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVG  1464
              +T  T++    +S+R E+G ++  EM ++G + D+  Y T++    +AG   +A +   
Sbjct  399   IVTCNTLINGLCKSKRVEDGRELFREMSQRGLVADTITYTTLMQGFFQAGDCDNAQEVFK  458

Query  1463  NMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAG  1284
              M+ +G+  D+V YNTL++  C   KL+NA  +  + ++   + D  T+ III G CKAG
Sbjct  459   QMVSDGVPRDIVTYNTLLDGLCNNEKLENALFIFQDMQKSEIELDIATYNIIIHGKCKAG  518

Query  1283  NMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE----KDCFTYS  1116
              +++A       +L G   +++ +N  I GLC    ++ A ++F+ M E        TY+
Sbjct  519   EIEDAQELFCSLRLKGLQPDVITYNTMISGLCSKRLLNEADALFREMKEDGPKPSSGTYN  578

Query  1115  SLVHGLCKAGRFRVASEL---LLSCIIGG  1038
             +L+    K G    +SEL   + SC   G
Sbjct  579   TLIRVHLKNGDKTASSELIKEMRSCKFSG  607


 Score =   159 bits (403),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 112/417 (27%), Positives = 191/417 (46%), Gaps = 4/417 (1%)
 Frame = -1

Query  2168  VVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLE  1989
             +V ++ L++A       D   S+  +M  + I  ++ TYN LI    R   LS    +L 
Sbjct  84    IVDFSKLLSAIAKMKKFDVVISLGEKMEMLRIPHNLYTYNILINCFCRSSQLSSAFAILG  143

Query  1988  EMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNG  1809
             +M+++G  PD  ++N+L++      +  +A      +      P  VTF  L+ GL +N 
Sbjct  144   KMMKLGYEPDLVTFNSLLNGFCHGNRISDAVSLLDQMVELGYKPDTVTFTTLIHGLFLNN  203

Query  1808  YTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYT  1629
                +A+ L   +   G  P L+TY  +I+G+C  G    A  LL +L      PN + Y 
Sbjct  204   KVSEAVALVDRMAAKGCQPDLLTYGAVINGICKRGSMDLALNLLKKLEAEKIKPNVVIYN  263

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
             T++    + R   E L +  EM  KG   +   Y ++IS L   GR  D    + +MI  
Sbjct  264   TVIDGLCKYRDVNEALDLFNEMENKGIKPNVITYNSLISCLCNYGRWSDTSRLLSDMIKR  323

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
              +  D+V +N LI+   KEGKL  A  L  E   +    +  T+  +I+G C    + EA
Sbjct  324   KLNPDVVTFNALIDALVKEGKLLEAEELYKEMIERSVTPNTITYNSLINGFCMHDRLDEA  383

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHG  1101
              R            ++V  N  I+GLCK   V+    +F+ M ++    D  TY++L+ G
Sbjct  384   ERMFELMVSKDSLPDIVTCNTLINGLCKSKRVEDGRELFREMSQRGLVADTITYTTLMQG  443

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
               +AG    A E+    +  G+         ++DGL ++  ++ A  +  +++ S+I
Sbjct  444   FFQAGDCDNAQEVFKQMVSDGVPRDIVTYNTLLDGLCNNEKLENALFIFQDMQKSEI  500


 Score =   155 bits (393),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/360 (27%), Positives = 178/360 (49%), Gaps = 4/360 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCK + + +A  +  +    G+  +V+TYN+LI+  C +        +L  M +
Sbjct  263   NTVIDGLCKYRDVNEALDLFNEMENKGIKPNVITYNSLISCLCNYGRWSDTSRLLSDMIK  322

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               + PDV+T+N+LI +  + G L    +L +EM+E  + P+T +YN+L++      + DE
Sbjct  323   RKLNPDVVTFNALIDALVKEGKLLEAEELYKEMIERSVTPNTITYNSLINGFCMHDRLDE  382

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A R F+ +   D  P  VT N L++GLC +   E    LFRE+   G +   +TY  L+ 
Sbjct  383   AERMFELMVSKDSLPDIVTCNTLINGLCKSKRVEDGRELFREMSQRGLVADTITYTTLMQ  442

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G   +G    A+ +  ++V  G   + +TY T++     + + E  L I ++M++     
Sbjct  443   GFFQAGDCDNAQEVFKQMVSDGVPRDIVTYNTLLDGLCNNEKLENALFIFQDMQKSEIEL  502

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y  +I    KAG ++DA +   ++ + G++ D++ YNT+I+  C +  L+ A  L 
Sbjct  503   DIATYNIIIHGKCKAGEIEDAQELFCSLRLKGLQPDVITYNTMISGLCSKRLLNEADALF  562

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNM---KEALRHLNCTKLMGFDSNL-VAFNCCIDG  1194
              E +  G      T+  +I    K G+     E ++ +   K  G  S + + ++   DG
Sbjct  563   REMKEDGPKPSSGTYNTLIRVHLKNGDKTASSELIKEMRSCKFSGDASTISLVYDMLYDG  622


 Score =   143 bits (361),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/355 (27%), Positives = 173/355 (49%), Gaps = 4/355 (1%)
 Frame = -1

Query  1997  LLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLC  1818
             L  EM++    P    ++ L+  + ++ K D      + +    IP    T+NIL++  C
Sbjct  71    LFGEMVKSRPFPSIVDFSKLLSAIAKMKKFDVVISLGEKMEMLRIPHNLYTYNILINCFC  130

Query  1817  MNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAI  1638
              +     A  +  ++   G+ P LVT+N L++G C+  R + A  LL+++V++GY P+ +
Sbjct  131   RSSQLSSAFAILGKMMKLGYEPDLVTFNSLLNGFCHGNRISDAVSLLDQMVELGYKPDTV  190

Query  1637  TYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNM  1458
             T+TT++   F + +  E + +++ M  KG   D   Y  VI+ + K G M  A + +  +
Sbjct  191   TFTTLIHGLFLNNKVSEAVALVDRMAAKGCQPDLLTYGAVINGICKRGSMDLALNLLKKL  250

Query  1457  IMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNM  1278
                 I+ ++V YNT+I+  CK   ++ A  L  E E KG   +  T+  +I  LC  G  
Sbjct  251   EAEKIKPNVVIYNTVIDGLCKYRDVNEALDLFNEMENKGIKPNVITYNSLISCLCNYGRW  310

Query  1277  KEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSL  1110
              +  R L+       + ++V FN  ID L K G++  A  ++K M E+    +  TY+SL
Sbjct  311   SDTSRLLSDMIKRKLNPDVVTFNALIDALVKEGKLLEAEELYKEMIERSVTPNTITYNSL  370

Query  1109  VHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             ++G C   R   A  +    +             +I+GL  S  +++ R+L  E+
Sbjct  371   INGFCMHDRLDEAERMFELMVSKDSLPDIVTCNTLINGLCKSKRVEDGRELFREM  425


 Score =   137 bits (346),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/280 (30%), Positives = 134/280 (48%), Gaps = 2/280 (1%)
 Frame = -1

Query  2291  IKSRLSTKLL--NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGI  2118
             IK +L+  ++  N  +  L K  +L +AE +  + I   V  + +TYN+LI  +C    +
Sbjct  321   IKRKLNPDVVTFNALIDALVKEGKLLEAEELYKEMIERSVTPNTITYNSLINGFCMHDRL  380

Query  2117  DAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTL  1938
             D    +   M      PD++T N+LI    +   +    +L  EM + G++ DT +Y TL
Sbjct  381   DEAERMFELMVSKDSLPDIVTCNTLINGLCKSKRVEDGRELFREMSQRGLVADTITYTTL  440

Query  1937  MHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGF  1758
             M   F+ G  D A   F+ +    +P   VT+N LL GLC N   E AL +F++++ S  
Sbjct  441   MQGFFQAGDCDNAQEVFKQMVSDGVPRDIVTYNTLLDGLCNNEKLENALFIFQDMQKSEI  500

Query  1757  IPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQ  1578
                + TYNI+IHG C +G    A+ L   L   G  P+ ITY T++      R   E   
Sbjct  501   ELDIATYNIIIHGKCKAGEIEDAQELFCSLRLKGLQPDVITYNTMISGLCSKRLLNEADA  560

Query  1577  ILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNM  1458
             +  EM+  G    S  Y T+I   +K G    + + +  M
Sbjct  561   LFREMKEDGPKPSSGTYNTLIRVHLKNGDKTASSELIKEM  600


 Score =   120 bits (302),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 87/331 (26%), Positives = 154/331 (47%), Gaps = 5/331 (2%)
 Frame = -1

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             K D+A   F ++      P  V F+ LLS +      +  + L  +++       L TYN
Sbjct  64    KLDDAIVLFGEMVKSRPFPSIVDFSKLLSAIAKMKKFDVVISLGEKMEMLRIPHNLYTYN  123

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             ILI+  C S + + A  +L +++ +GY P+ +T+ +++       R  + + +L++M   
Sbjct  124   ILINCFCRSSQLSSAFAILGKMMKLGYEPDLVTFNSLLNGFCHGNRISDAVSLLDQMVEL  183

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
             GY  D+  + T+I  L    ++ +A   V  M   G + DL+ Y  +IN  CK G +D A
Sbjct  184   GYKPDTVTFTTLIHGLFLNNKVSEAVALVDRMAAKGCQPDLLTYGAVINGICKRGSMDLA  243

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               L+ + E +    +   +  +IDGLCK  ++ EAL   N  +  G   N++ +N  I  
Sbjct  244   LNLLKKLEAEKIKPNVVIYNTVIDGLCKYRDVNEALDLFNEMENKGIKPNVITYNSLISC  303

Query  1193  LCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
             LC  G       +   M ++    D  T+++L+  L K G+   A EL    I   +   
Sbjct  304   LCNYGRWSDTSRLLSDMIKRKLNPDVVTFNALIDALVKEGKLLEAEELYKEMIERSVTPN  363

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELKLSK  933
                  ++I+G      + EA ++  EL +SK
Sbjct  364   TITYNSLINGFCMHDRLDEAERMF-ELMVSK  393


 Score =   119 bits (299),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 86/299 (29%), Positives = 140/299 (47%), Gaps = 4/299 (1%)
 Frame = -1

Query  1829  SGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYN  1650
             +G   N   + A++LF E+  S   P +V ++ L+  +    ++     L  ++  +   
Sbjct  57    NGFLQNIKLDDAIVLFGEMVKSRPFPSIVDFSKLLSAIAKMKKFDVVISLGEKMEMLRIP  116

Query  1649  PNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDC  1470
              N  TY  ++ C  RS +      IL +M + GY  D   + ++++      R+ DA   
Sbjct  117   HNLYTYNILINCFCRSSQLSSAFAILGKMMKLGYEPDLVTFNSLLNGFCHGNRISDAVSL  176

Query  1469  VGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCK  1290
             +  M+  G + D V + TLI+      K+  A  LV     KG   D  T+  +I+G+CK
Sbjct  177   LDQMVELGYKPDTVTFTTLIHGLFLNNKVSEAVALVDRMAAKGCQPDLLTYGAVINGICK  236

Query  1289  AGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFT  1122
              G+M  AL  L   +      N+V +N  IDGLCK  +V+ AL +F  M+ K    +  T
Sbjct  237   RGSMDLALNLLKKLEAEKIKPNVVIYNTVIDGLCKYRDVNEALDLFNEMENKGIKPNVIT  296

Query  1121  YSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             Y+SL+  LC  GR+   S LL   I   +        A+ID L   G + EA +L+ E+
Sbjct  297   YNSLISCLCNYGRWSDTSRLLSDMIKRKLNPDVVTFNALIDALVKEGKLLEAEELYKEM  355


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI +   CKA ++E A+ +       G+  DV+TYNT+I+  C    ++   ++   M E
Sbjct  508   NIIIHGKCKAGEIEDAQELFCSLRLKGLQPDVITYNTMISGLCSKRLLNEADALFREMKE  567

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G KP   TYN+LI    ++G  +   +L++EM       D  S  +L++ +   G+ D+
Sbjct  568   DGPKPSSGTYNTLIRVHLKNGDKTASSELIKEMRSCKFSGDA-STISLVYDMLYDGRLDK  626

Query  1901  AY  1896
             ++
Sbjct  627   SF  628



>ref|XP_010431703.1| PREDICTED: pentatricopeptide repeat-containing protein At1g64100-like 
[Camelina sativa]
Length=831

 Score =   224 bits (570),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 135/441 (31%), Positives = 217/441 (49%), Gaps = 9/441 (2%)
 Frame = -1

Query  2237  KAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVI  2058
             K  ++ +AE +  D ++  +  + +TYN+LI  +C    +D    + + M   G  PD+I
Sbjct  385   KEGKVSEAEELYSDMLQRDISPNTITYNSLIDGFCKHSRLDDAKRMFNLMVSKGCSPDII  444

Query  2057  TYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDI  1878
             T N+LI    R   L   + LL EM  +G++PDT SYNTL+H   ++G  + A   FQ++
Sbjct  445   TVNTLIDGCCRAKRLDAGVKLLHEMSRLGLVPDTASYNTLIHGFCQVGDLNAAQDLFQEM  504

Query  1877  FWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRW  1698
                 + P  VT   LL G C +G  +KAL LF  ++ S        YNI+IHG+C S + 
Sbjct  505   ISHGVSPNIVTCGSLLDGFCNDGKIDKALELFEVMQKSKMDLDTAIYNIIIHGMCKSSKV  564

Query  1697  APARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTV  1518
               A  L N L   G  PN  TY  ++        F    ++  EM RKG + D+F Y ++
Sbjct  565   DEAWDLFNSLPLNGVEPNVRTYNIMISSFVNEGNFLRAEELYVEMLRKGVVLDTFTYTSM  624

Query  1517  ISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGF  1338
             +  L K  R+ +A     +M   G   +LV +NTLIN YCK  ++D    L  E  R+G 
Sbjct  625   VDGLCKQNRLDEARQMFDSMASKGCSPNLVTFNTLINGYCKARRVDEGLELFCEMYRRGI  684

Query  1337  DCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALS  1158
               +  T++ +I G C+ G++  AL         G   N + ++  I G C+ G+ + AL 
Sbjct  685   VANTITYSTLIHGFCQVGDLNGALDIFQEMVSSGVCPNTITYSTLIHGFCQEGDFNGALD  744

Query  1157  VFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR---QAVID  999
             +F+ M       +  TYS+L+HG C+ G    A ++    +  G  +   D      ++ 
Sbjct  745   IFQDMVSSGVCPNTITYSTLIHGFCQVGYLNGARDIFQEMVSSG--VCPPDTITFHGMLT  802

Query  998   GLQHSGFIQEARKLHSELKLS  936
             GL     +Q+A+ +  +L+ S
Sbjct  803   GLFSKEELQKAKAMLEDLQKS  823


 Score =   213 bits (541),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/415 (29%), Positives = 207/415 (50%), Gaps = 4/415 (1%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
             + N  +  L K      A+ +  + +  G+  DV TYN +I   C +        +L  M
Sbjct  305   IYNAIIDRLGKDGHHSHAQHLFTEMLEKGIMPDVQTYNCMIYGCCSYGKWSDAEQLLRDM  364

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
              +  + P+V+T+N+LI ++ + G +S   +L  +ML+  I P+T +YN+L+    +  + 
Sbjct  365   IKRSVHPNVVTFNALINASFKEGKVSEAEELYSDMLQRDISPNTITYNSLIDGFCKHSRL  424

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             D+A R F  +      P  +T N L+ G C     +  + L  E+   G +P   +YN L
Sbjct  425   DDAKRMFNLMVSKGCSPDIITVNTLIDGCCRAKRLDAGVKLLHEMSRLGLVPDTASYNTL  484

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             IHG C  G    A+ L  E++  G +PN +T  +++       + ++ L++ E M++   
Sbjct  485   IHGFCQVGDLNAAQDLFQEMISHGVSPNIVTCGSLLDGFCNDGKIDKALELFEVMQKSKM  544

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
               D+  Y  +I  + K+ ++ +A+D   ++ +NG+E ++  YN +I+ +  EG    A  
Sbjct  545   DLDTAIYNIIIHGMCKSSKVDEAWDLFNSLPLNGVEPNVRTYNIMISSFVNEGNFLRAEE  604

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLC  1188
             L VE  RKG   D +T+T ++DGLCK   + EA +  +     G   NLV FN  I+G C
Sbjct  605   LYVEMLRKGVVLDTFTYTSMVDGLCKQNRLDEARQMFDSMASKGCSPNLVTFNTLINGYC  664

Query  1187  KVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGM  1035
             K   VD  L +F  M  +    +  TYS+L+HG C+ G    A ++    +  G+
Sbjct  665   KARRVDEGLELFCEMYRRGIVANTITYSTLIHGFCQVGDLNGALDIFQEMVSSGV  719


 Score =   212 bits (540),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 127/427 (30%), Positives = 213/427 (50%), Gaps = 14/427 (3%)
 Frame = -1

Query  2291  IKSRLSTKLL--NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCF---  2127
             +++RL+  ++  NI +  LC   ++ +A  ++   +  G   + VTY T++   C     
Sbjct  217   VETRLTPDVVTFNILMNGLCMEGRVLEATALLDRMVEEGHEPNEVTYGTIVNGLCMMEVH  276

Query  2126  -----VGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILP  1962
                    I +  ++L +M +  IKP V+ YN++I    + G  S    L  EMLE GI+P
Sbjct  277   DLLQPADIVSALNLLRKMEQTHIKPGVVIYNAIIDRLGKDGHHSHAQHLFTEMLEKGIMP  336

Query  1961  DTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLF  1782
             D  +YN +++     GK  +A +  +D+    + P  VTFN L++     G   +A  L+
Sbjct  337   DVQTYNCMIYGCCSYGKWSDAEQLLRDMIKRSVHPNVVTFNALINASFKEGKVSEAEELY  396

Query  1781  RELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRS  1602
              ++      P  +TYN LI G C   R   A+R+ N +V  G +P+ IT  T++  C R+
Sbjct  397   SDMLQRDISPNTITYNSLIDGFCKHSRLDDAKRMFNLMVSKGCSPDIITVNTLIDGCCRA  456

Query  1601  RRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAY  1422
             +R + G+++L EM R G + D+ +Y T+I    + G +  A D    MI +G+  ++V  
Sbjct  457   KRLDAGVKLLHEMSRLGLVPDTASYNTLIHGFCQVGDLNAAQDLFQEMISHGVSPNIVTC  516

Query  1421  NTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKL  1242
              +L++ +C +GK+D A  L    ++   D D   + III G+CK+  + EA    N   L
Sbjct  517   GSLLDGFCNDGKIDKALELFEVMQKSKMDLDTAIYNIIIHGMCKSSKVDEAWDLFNSLPL  576

Query  1241  MGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRV  1074
              G + N+  +N  I      G    A  ++  M  K    D FTY+S+V GLCK  R   
Sbjct  577   NGVEPNVRTYNIMISSFVNEGNFLRAEELYVEMLRKGVVLDTFTYTSMVDGLCKQNRLDE  636

Query  1073  ASELLLS  1053
             A ++  S
Sbjct  637   ARQMFDS  643


 Score =   188 bits (477),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 121/487 (25%), Positives = 213/487 (44%), Gaps = 47/487 (10%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              NI + C C   +L  A +      ++G   DVVT+NTL+   C    I    ++   M 
Sbjct  123   FNILMKCFCDCHKLSFALSTFGKITKLGFHPDVVTFNTLLHGLCLQDRISEAVALFDHMV  182

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             E    P V+T+N+LI        +S  + L + M+E  + PD  ++N LM+ L   G+  
Sbjct  183   ETRFTPSVVTFNTLIHGLCLQDRISEAVALYDHMVETRLTPDVVTFNILMNGLCMEGRVL  242

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCM------------------------------  1815
             EA      +      P  VT+  +++GLCM                              
Sbjct  243   EATALLDRMVEEGHEPNEVTYGTIVNGLCMMEVHDLLQPADIVSALNLLRKMEQTHIKPG  302

Query  1814  -------------NGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLN  1674
                          +G+   A  LF E+   G +P + TYN +I+G C+ G+W+ A +LL 
Sbjct  303   VVIYNAIIDRLGKDGHHSHAQHLFTEMLEKGIMPDVQTYNCMIYGCCSYGKWSDAEQLLR  362

Query  1673  ELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAG  1494
             +++    +PN +T+  ++   F+  +  E  ++  +M ++    ++  Y ++I    K  
Sbjct  363   DMIKRSVHPNVVTFNALINASFKEGKVSEAEELYSDMLQRDISPNTITYNSLIDGFCKHS  422

Query  1493  RMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHT  1314
             R+ DA      M+  G   D++  NTLI+  C+  +LD    L+ E  R G   D  ++ 
Sbjct  423   RLDDAKRMFNLMVSKGCSPDIITVNTLIDGCCRAKRLDAGVKLLHEMSRLGLVPDTASYN  482

Query  1313  IIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK  1134
              +I G C+ G++  A          G   N+V     +DG C  G++D AL +F+ M + 
Sbjct  483   TLIHGFCQVGDLNAAQDLFQEMISHGVSPNIVTCGSLLDGFCNDGKIDKALELFEVMQKS  542

Query  1133  ----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEA  966
                 D   Y+ ++HG+CK+ +   A +L  S  + G++        +I    + G    A
Sbjct  543   KMDLDTAIYNIIIHGMCKSSKVDEAWDLFNSLPLNGVEPNVRTYNIMISSFVNEGNFLRA  602

Query  965   RKLHSEL  945
              +L+ E+
Sbjct  603   EELYVEM  609


 Score =   178 bits (451),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 112/429 (26%), Positives = 192/429 (45%), Gaps = 12/429 (3%)
 Frame = -1

Query  2180  VPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCL  2001
             +P D+ ++N L+  +C    +    S   ++ ++G  PDV+T+N+L+        +S  +
Sbjct  116   IPFDIYSFNILMKCFCDCHKLSFALSTFGKITKLGFHPDVVTFNTLLHGLCLQDRISEAV  175

Query  2000  DLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGL  1821
              L + M+E    P   ++NTL+H L    +  EA   +  +    + P  VTFNIL++GL
Sbjct  176   ALFDHMVETRFTPSVVTFNTLIHGLCLQDRISEAVALYDHMVETRLTPDVVTFNILMNGL  235

Query  1820  CMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC--------NSGRWAPARRLLNELV  1665
             CM G   +A  L   +   G  P  VTY  +++GLC               A  LL ++ 
Sbjct  236   CMEGRVLEATALLDRMVEEGHEPNEVTYGTIVNGLCMMEVHDLLQPADIVSALNLLRKME  295

Query  1664  DIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMK  1485
                  P  + Y  I+    +         +  EM  KG + D   Y  +I      G+  
Sbjct  296   QTHIKPGVVIYNAIIDRLGKDGHHSHAQHLFTEMLEKGIMPDVQTYNCMIYGCCSYGKWS  355

Query  1484  DAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIII  1305
             DA   + +MI   +  ++V +N LIN   KEGK+  A  L  +  ++    +  T+  +I
Sbjct  356   DAEQLLRDMIKRSVHPNVVTFNALINASFKEGKVSEAEELYSDMLQRDISPNTITYNSLI  415

Query  1304  DGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE----  1137
             DG CK   + +A R  N     G   +++  N  IDG C+   +D  + +   M      
Sbjct  416   DGFCKHSRLDDAKRMFNLMVSKGCSPDIITVNTLIDGCCRAKRLDAGVKLLHEMSRLGLV  475

Query  1136  KDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
              D  +Y++L+HG C+ G    A +L    I  G+        +++DG  + G I +A +L
Sbjct  476   PDTASYNTLIHGFCQVGDLNAAQDLFQEMISHGVSPNIVTCGSLLDGFCNDGKIDKALEL  535

Query  956   HSELKLSKI  930
                ++ SK+
Sbjct  536   FEVMQKSKM  544


 Score =   171 bits (433),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/332 (27%), Positives = 171/332 (52%), Gaps = 0/332 (0%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             +N  +   C+AK+L+    ++ +  R+G+  D  +YNTLI  +C    ++A   +   M 
Sbjct  446   VNTLIDGCCRAKRLDAGVKLLHEMSRLGLVPDTASYNTLIHGFCQVGDLNAAQDLFQEMI  505

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
               G+ P+++T  SL+      G + + L+L E M +  +  DT  YN ++H + +  K D
Sbjct  506   SHGVSPNIVTCGSLLDGFCNDGKIDKALELFEVMQKSKMDLDTAIYNIIIHGMCKSSKVD  565

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             EA+  F  +    + P   T+NI++S     G   +A  L+ E+   G +    TY  ++
Sbjct  566   EAWDLFNSLPLNGVEPNVRTYNIMISSFVNEGNFLRAEELYVEMLRKGVVLDTFTYTSMV  625

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
              GLC   R   AR++ + +   G +PN +T+ T++    ++RR +EGL++  EM R+G +
Sbjct  626   DGLCKQNRLDEARQMFDSMASKGCSPNLVTFNTLINGYCKARRVDEGLELFCEMYRRGIV  685

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              ++  Y T+I    + G +  A D    M+ +G+  + + Y+TLI+ +C+EG  + A  +
Sbjct  686   ANTITYSTLIHGFCQVGDLNGALDIFQEMVSSGVCPNTITYSTLIHGFCQEGDFNGALDI  745

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
               +    G   +  T++ +I G C+ G +  A
Sbjct  746   FQDMVSSGVCPNTITYSTLIHGFCQVGYLNGA  777


 Score =   133 bits (334),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 97/349 (28%), Positives = 154/349 (44%), Gaps = 12/349 (3%)
 Frame = -1

Query  2069  PDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRF  1890
             P  I ++ +I    +       + L ++M    I  D +S+N LM C     K   A   
Sbjct  83    PSPIDFSKVIGVVVKMERPDVAISLYQKMGMRRIPFDIYSFNILMKCFCDCHKLSFALST  142

Query  1889  FQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCN  1710
             F  I      P  VTFN LL GLC+     +A+ LF  +  + F P +VT+N LIHGLC 
Sbjct  143   FGKITKLGFHPDVVTFNTLLHGLCLQDRISEAVALFDHMVETRFTPSVVTFNTLIHGLCL  202

Query  1709  SGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFA  1530
               R + A  L + +V+    P+ +T+  +M       R  E   +L+ M  +G+  +   
Sbjct  203   QDRISEAVALYDHMVETRLTPDVVTFNILMNGLCMEGRVLEATALLDRMVEEGHEPNEVT  262

Query  1529  YCTVISF--------LIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
             Y T+++         L++   +  A + +  M    I+  +V YN +I+   K+G   +A
Sbjct  263   YGTIVNGLCMMEVHDLLQPADIVSALNLLRKMEQTHIKPGVVIYNAIIDRLGKDGHHSHA  322

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               L  E   KG   D  T+  +I G C  G   +A + L          N+V FN  I+ 
Sbjct  323   QHLFTEMLEKGIMPDVQTYNCMIYGCCSYGKWSDAEQLLRDMIKRSVHPNVVTFNALINA  382

Query  1193  LCKVGEVDYALSVFKSMDEKD----CFTYSSLVHGLCKAGRFRVASELL  1059
               K G+V  A  ++  M ++D      TY+SL+ G CK  R   A  + 
Sbjct  383   SFKEGKVSEAEELYSDMLQRDISPNTITYNSLIDGFCKHSRLDDAKRMF  431


 Score =   122 bits (307),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/242 (27%), Positives = 121/242 (50%), Gaps = 1/242 (0%)
 Frame = -1

Query  2276  STKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSIL  2097
             + +  NI ++         +AE + ++ +R GV  D  TY +++   C    +D    + 
Sbjct  582   NVRTYNIMISSFVNEGNFLRAEELYVEMLRKGVVLDTFTYTSMVDGLCKQNRLDEARQMF  641

Query  2096  HRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRL  1917
               M   G  P+++T+N+LI    +   +   L+L  EM   GI+ +T +Y+TL+H   ++
Sbjct  642   DSMASKGCSPNLVTFNTLINGYCKARRVDEGLELFCEMYRRGIVANTITYSTLIHGFCQV  701

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTY  1737
             G  + A   FQ++    + P  +T++ L+ G C  G    AL +F+++  SG  P  +TY
Sbjct  702   GDLNGALDIFQEMVSSGVCPNTITYSTLIHGFCQEGDFNGALDIFQDMVSSGVCPNTITY  761

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGY-NPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             + LIHG C  G    AR +  E+V  G   P+ IT+  ++   F     ++   +LE+++
Sbjct  762   STLIHGFCQVGYLNGARDIFQEMVSSGVCPPDTITFHGMLTGLFSKEELQKAKAMLEDLQ  821

Query  1559  RK  1554
             + 
Sbjct  822   KS  823


 Score =   117 bits (292),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 90/369 (24%), Positives = 162/369 (44%), Gaps = 47/369 (13%)
 Frame = -1

Query  2015  LSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNI  1836
             L   +DL ++M+     P    ++ ++  + ++ +PD A   +Q +    IP    +FNI
Sbjct  66    LDDAIDLFDDMVRSHPFPSPIDFSKVIGVVVKMERPDVAISLYQKMGMRRIPFDIYSFNI  125

Query  1835  LLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIG  1656
             L+   C       AL  F ++   GF P +VT+N L+HGLC   R + A  L + +V+  
Sbjct  126   LMKCFCDCHKLSFALSTFGKITKLGFHPDVVTFNTLLHGLCLQDRISEAVALFDHMVETR  185

Query  1655  YNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAY  1476
             + P+ +T+ T++       R  E + +                                Y
Sbjct  186   FTPSVVTFNTLIHGLCLQDRISEAVAL--------------------------------Y  213

Query  1475  DCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGL  1296
             D   +M+   +  D+V +N L+N  C EG++  A  L+     +G + ++ T+  I++GL
Sbjct  214   D---HMVETRLTPDVVTFNILMNGLCMEGRVLEATALLDRMVEEGHEPNEVTYGTIVNGL  270

Query  1295  C--------KAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMD  1140
             C        +  ++  AL  L   +       +V +N  ID L K G   +A  +F  M 
Sbjct  271   CMMEVHDLLQPADIVSALNLLRKMEQTHIKPGVVIYNAIIDRLGKDGHHSHAQHLFTEML  330

Query  1139  EK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQ  972
             EK    D  TY+ +++G C  G++  A +LL   I   +        A+I+     G + 
Sbjct  331   EKGIMPDVQTYNCMIYGCCSYGKWSDAEQLLRDMIKRSVHPNVVTFNALINASFKEGKVS  390

Query  971   EARKLHSEL  945
             EA +L+S++
Sbjct  391   EAEELYSDM  399



>ref|NP_176501.1| transacting siRNA generating locus [Arabidopsis thaliana]
 sp|Q9CAN0.1|PPR99_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g63130, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51613.1|AC010795_17 unknown protein; 64081-65973 [Arabidopsis thaliana]
 gb|AAM91590.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15444.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34059.1| transacting siRNA generating locus [Arabidopsis thaliana]
Length=630

 Score =   221 bits (562),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 133/444 (30%), Positives = 224/444 (50%), Gaps = 4/444 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             +I + C C+  QL  A  V+   +++G   D+VT N+L+  +C    I    S++ +M E
Sbjct  120   SILINCFCRRSQLSLALAVLAKMMKLGYEPDIVTLNSLLNGFCHGNRISDAVSLVGQMVE  179

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G +PD  T+N+LI    RH   S  + L++ M+  G  PD  +Y  +++ L + G  D 
Sbjct  180   MGYQPDSFTFNTLIHGLFRHNRASEAVALVDRMVVKGCQPDLVTYGIVVNGLCKRGDIDL  239

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A    + +  G I P  V +N ++  LC       AL LF E+ + G  P +VTYN LI 
Sbjct  240   ALSLLKKMEQGKIEPGVVIYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIR  299

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LCN GRW+ A RLL+++++   NPN +T++ ++    +  +  E  ++ +EM ++    
Sbjct  300   CLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDP  359

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D F Y ++I+      R+ +A      MI      ++V YNTLI  +CK  ++D    L 
Sbjct  360   DIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVDEGMELF  419

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E  ++G   +  T+T +I G  +A     A          G   +++ ++  +DGLC  
Sbjct  420   REMSQRGLVGNTVTYTTLIHGFFQARECDNAQIVFKQMVSDGVLPDIMTYSILLDGLCNN  479

Query  1181  GEVDYALSVF----KSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G+V+ AL VF    +S  E D +TY+ ++ G+CKAG+     +L  S  + G+K      
Sbjct  480   GKVETALVVFEYLQRSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVVTY  539

Query  1013  QAVIDGLQHSGFIQEARKLHSELK  942
               ++ G    G  +EA  L  E+K
Sbjct  540   TTMMSGFCRKGLKEEADALFREMK  563


 Score =   194 bits (493),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/406 (27%), Positives = 206/406 (51%), Gaps = 4/406 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              N  +  L +  +  +A  ++   +  G   D+VTY  ++   C    ID   S+L +M 
Sbjct  189   FNTLIHGLFRHNRASEAVALVDRMVVKGCQPDLVTYGIVVNGLCKRGDIDLALSLLKKME  248

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             +  I+P V+ YN++I +   +  ++  L+L  EM   GI P+  +YN+L+ CL   G+  
Sbjct  249   QGKIEPGVVIYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWS  308

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             +A R   D+    I P  VTF+ L+      G   +A  L+ E+      P + TY+ LI
Sbjct  309   DASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLI  368

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +G C   R   A+ +   ++     PN +TY T++K   +++R +EG+++  EM ++G +
Sbjct  369   NGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVDEGMELFREMSQRGLV  428

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              ++  Y T+I    +A    +A      M+ +G+  D++ Y+ L++  C  GK++ A ++
Sbjct  429   GNTVTYTTLIHGFFQARECDNAQIVFKQMVSDGVLPDIMTYSILLDGLCNNGKVETALVV  488

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
                 +R   + D YT+ I+I+G+CKAG +++         L G   N+V +   + G C+
Sbjct  489   FEYLQRSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVVTYTTMMSGFCR  548

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELL  1059
              G  + A ++F+ M E+    D  TY++L+    + G    ++EL+
Sbjct  549   KGLKEEADALFREMKEEGPLPDSGTYNTLIRAHLRDGDKAASAELI  594


 Score =   154 bits (390),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/347 (27%), Positives = 174/347 (50%), Gaps = 3/347 (1%)
 Frame = -1

Query  2267  LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRM  2088
             + N  +  LC  K +  A  +  +    G+  +VVTYN+LI   C +        +L  M
Sbjct  258   IYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWSDASRLLSDM  317

Query  2087  NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKP  1908
              E  I P+V+T+++LI +  + G L     L +EM++  I PD ++Y++L++      + 
Sbjct  318   IERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRL  377

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             DEA   F+ +   D  P  VT+N L+ G C     ++ + LFRE+   G +   VTY  L
Sbjct  378   DEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVDEGMELFREMSQRGLVGNTVTYTTL  437

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             IHG   +     A+ +  ++V  G  P+ +TY+ ++     + + E  L + E ++R   
Sbjct  438   IHGFFQARECDNAQIVFKQMVSDGVLPDIMTYSILLDGLCNNGKVETALVVFEYLQRSKM  497

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
               D + Y  +I  + KAG+++D +D   ++ + G++ ++V Y T+++ +C++G  + A  
Sbjct  498   EPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVVTYTTMMSGFCRKGLKEEADA  557

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNM---KEALRHLNCTKLMG  1236
             L  E + +G   D  T+  +I    + G+     E +R +   + +G
Sbjct  558   LFREMKEEGPLPDSGTYNTLIRAHLRDGDKAASAELIREMRSCRFVG  604


 Score =   121 bits (303),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 88/331 (27%), Positives = 152/331 (46%), Gaps = 5/331 (2%)
 Frame = -1

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             K D+A   F D+      P  V F+ LLS +      +  + L  ++++ G    L TY+
Sbjct  61    KLDDAVNLFGDMVKSRPFPSIVEFSKLLSAIAKMNKFDLVISLGEQMQNLGISHNLYTYS  120

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             ILI+  C   + + A  +L +++ +GY P+ +T  +++       R  + + ++ +M   
Sbjct  121   ILINCFCRRSQLSLALAVLAKMMKLGYEPDIVTLNSLLNGFCHGNRISDAVSLVGQMVEM  180

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
             GY  DSF + T+I  L +  R  +A   V  M++ G + DLV Y  ++N  CK G +D A
Sbjct  181   GYQPDSFTFNTLIHGLFRHNRASEAVALVDRMVVKGCQPDLVTYGIVVNGLCKRGDIDLA  240

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               L+ + E+   +     +  IID LC   N+ +AL         G   N+V +N  I  
Sbjct  241   LSLLKKMEQGKIEPGVVIYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRC  300

Query  1193  LCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
             LC  G    A  +   M E+    +  T+S+L+    K G+   A +L    I   +   
Sbjct  301   LCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPD  360

Query  1025  KSDRQAVIDGLQHSGFIQEARKLHSELKLSK  933
                  ++I+G      + EA+ +  EL +SK
Sbjct  361   IFTYSSLINGFCMHDRLDEAKHMF-ELMISK  390



>ref|XP_002961595.1| hypothetical protein SELMODRAFT_76510 [Selaginella moellendorffii]
 gb|EFJ36855.1| hypothetical protein SELMODRAFT_76510 [Selaginella moellendorffii]
Length=603

 Score =   220 bits (560),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 126/386 (33%), Positives = 198/386 (51%), Gaps = 4/386 (1%)
 Frame = -1

Query  2090  MNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGK  1911
             MNE  + PD  +Y  LI    + G L+   DL +++L  G+ P T +Y +L+H L     
Sbjct  1     MNERNVSPDSWSYGILIDGLAKAGKLNDARDLFQKLLHSGVTPSTVAYTSLIHGLCMANS  60

Query  1910  PDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNI  1731
              D+A   F D+     PP PVT+N+++   C  G  E+A  L +++   G +P +VTYN 
Sbjct  61    FDDARELFADMNRRGCPPSPVTYNVIIDASCKRGMLEEACDLIKKMIEDGHVPDVVTYNT  120

Query  1730  LIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKG  1551
             ++ GLC SGR   A  L NE+  +G  PN  ++ TI+    +  + ++  Q+  EM  + 
Sbjct  121   VMDGLCKSGRVEEALLLFNEMERLGCTPNRRSHNTIILGLCQQSKIDQACQVFHEMEARD  180

Query  1550  YIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAY  1371
                DS++Y  +I  L KAG++ +AY     M+ +GI    V YN +I+  C    LD A 
Sbjct  181   IPPDSWSYGILIDGLAKAGKLNEAYKLFRRMLDSGITPSAVTYNVVIHGMCLAYTLDEAL  240

Query  1370  MLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGL  1191
              L      KG    ++T  I+ID  CK G M EA R L      G   ++V ++  I GL
Sbjct  241   ELFKSMRSKGCRPSRFTFNILIDAHCKRGKMDEAFRLLKRMTDDGHVPDVVTYSTLISGL  300

Query  1190  CKVGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILK  1023
             C +  VD A  + + M ++ C     T ++L+HGLCKAGR + A E+L + +  G     
Sbjct  301   CSIARVDDARHLLEDMVKRQCKPTVVTQNTLIHGLCKAGRIKEAREVLDAMVSSGQSPDV  360

Query  1022  SDRQAVIDGLQHSGFIQEARKLHSEL  945
                  ++ G   +G  + AR+L S++
Sbjct  361   VTYNTLVHGHCRAGQTERARELLSDM  386


 Score =   219 bits (559),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 135/442 (31%), Positives = 223/442 (50%), Gaps = 14/442 (3%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N+ +   CK   LE+A  +I   I  G   DVVTYNT++   C    ++    + + M  
Sbjct  84    NVIIDASCKRGMLEEACDLIKKMIEDGHVPDVVTYNTVMDGLCKSGRVEEALLLFNEMER  143

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G  P+  ++N++I    +   + +   +  EM    I PD+WSY  L+  L + GK +E
Sbjct  144   LGCTPNRRSHNTIILGLCQQSKIDQACQVFHEMEARDIPPDSWSYGILIDGLAKAGKLNE  203

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             AY+ F+ +    I P  VT+N+++ G+C+    ++AL LF+ ++  G  P   T+NILI 
Sbjct  204   AYKLFRRMLDSGITPSAVTYNVVIHGMCLAYTLDEALELFKSMRSKGCRPSRFTFNILID  263

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
               C  G+   A RLL  + D G+ P+ +TY+T++       R ++   +LE+M ++    
Sbjct  264   AHCKRGKMDEAFRLLKRMTDDGHVPDVVTYSTLISGLCSIARVDDARHLLEDMVKRQCKP  323

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
                   T+I  L KAGR+K+A + +  M+ +G   D+V YNTL++ +C+ G+ + A  L+
Sbjct  324   TVVTQNTLIHGLCKAGRIKEAREVLDAMVSSGQSPDVVTYNTLVHGHCRAGQTERARELL  383

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              +   +G   +  T+T ++ GLCKA  + EA       K  G   NL  +   I G C  
Sbjct  384   SDMVARGLAPNVVTYTALVSGLCKANRLPEACGVFAQMKSSGCAPNLFTYTALILGFCSA  443

Query  1181  GEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G+VD  L +F  M       D   Y +L   LCK+GR   A E+L      G + L+S+ 
Sbjct  444   GQVDGGLKLFGEMVCAGISPDHVVYGTLAAELCKSGRSARALEILRE----GRESLRSEA  499

Query  1013  QA------VIDGLQHSGFIQEA  966
                      +DGL  +G ++ A
Sbjct  500   WGDEVYRFAVDGLLDAGKMEMA  521


 Score =   202 bits (514),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 120/401 (30%), Positives = 198/401 (49%), Gaps = 4/401 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
              I +  L KA +L  A  +    +  GV    V Y +LI   C     D    +   MN 
Sbjct  14    GILIDGLAKAGKLNDARDLFQKLLHSGVTPSTVAYTSLIHGLCMANSFDDARELFADMNR  73

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G  P  +TYN +I ++ + GML    DL+++M+E G +PD  +YNT+M  L + G+ +E
Sbjct  74    RGCPPSPVTYNVIIDASCKRGMLEEACDLIKKMIEDGHVPDVVTYNTVMDGLCKSGRVEE  133

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F ++      P   + N ++ GLC     ++A  +F E++     P   +Y ILI 
Sbjct  134   ALLLFNEMERLGCTPNRRSHNTIILGLCQQSKIDQACQVFHEMEARDIPPDSWSYGILID  193

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GL  +G+   A +L   ++D G  P+A+TY  ++     +   +E L++ + MR KG   
Sbjct  194   GLAKAGKLNEAYKLFRRMLDSGITPSAVTYNVVIHGMCLAYTLDEALELFKSMRSKGCRP  253

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
               F +  +I    K G+M +A+  +  M  +G   D+V Y+TLI+  C   ++D+A  L+
Sbjct  254   SRFTFNILIDAHCKRGKMDEAFRLLKRMTDDGHVPDVVTYSTLISGLCSIARVDDARHLL  313

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              +  ++       T   +I GLCKAG +KEA   L+     G   ++V +N  + G C+ 
Sbjct  314   EDMVKRQCKPTVVTQNTLIHGLCKAGRIKEAREVLDAMVSSGQSPDVVTYNTLVHGHCRA  373

Query  1181  GEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVA  1071
             G+ + A  +   M  +    +  TY++LV GLCKA R   A
Sbjct  374   GQTERARELLSDMVARGLAPNVVTYTALVSGLCKANRLPEA  414


 Score =   183 bits (465),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 201/445 (45%), Gaps = 6/445 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCK+ ++E+A  +  +  R+G   +  ++NT+I   C    ID    + H M  
Sbjct  119   NTVMDGLCKSGRVEEALLLFNEMERLGCTPNRRSHNTIILGLCQQSKIDQACQVFHEMEA  178

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I PD  +Y  LI    + G L+    L   ML+ GI P   +YN ++H +      DE
Sbjct  179   RDIPPDSWSYGILIDGLAKAGKLNEAYKLFRRMLDSGITPSAVTYNVVIHGMCLAYTLDE  238

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F+ +      P   TFNIL+   C  G  ++A  L + +   G +P +VTY+ LI 
Sbjct  239   ALELFKSMRSKGCRPSRFTFNILIDAHCKRGKMDEAFRLLKRMTDDGHVPDVVTYSTLIS  298

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC+  R   AR LL ++V     P  +T  T++    ++ R +E  ++L+ M   G   
Sbjct  299   GLCSIARVDDARHLLEDMVKRQCKPTVVTQNTLIHGLCKAGRIKEAREVLDAMVSSGQSP  358

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y T++    +AG+ + A + + +M+  G+  ++V Y  L++  CK  +L  A  + 
Sbjct  359   DVVTYNTLVHGHCRAGQTERARELLSDMVARGLAPNVVTYTALVSGLCKANRLPEACGVF  418

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              + +  G   + +T+T +I G C AG +   L+        G   + V +      LCK 
Sbjct  419   AQMKSSGCAPNLFTYTALILGFCSAGQVDGGLKLFGEMVCAGISPDHVVYGTLAAELCKS  478

Query  1181  GEVDYALSVFKSMDEK------DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKS  1020
             G    AL + +   E           Y   V GL  AG+  +A   +   + GG      
Sbjct  479   GRSARALEILREGRESLRSEAWGDEVYRFAVDGLLDAGKMEMALGFVRDMVRGGQLPAPE  538

Query  1019  DRQAVIDGLQHSGFIQEARKLHSEL  945
                +++ GL  SG   EAR +  E+
Sbjct  539   RCASLVAGLCKSGQGGEARAVLEEI  563


 Score =   141 bits (356),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 93/311 (30%), Positives = 149/311 (48%), Gaps = 2/311 (1%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             R S    NI +   CK  ++++A  ++      G   DVVTY+TLI+  C    +D    
Sbjct  252   RPSRFTFNILIDAHCKRGKMDEAFRLLKRMTDDGHVPDVVTYSTLISGLCSIARVDDARH  311

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +L  M +   KP V+T N+LI    + G +    ++L+ M+  G  PD  +YNTL+H   
Sbjct  312   LLEDMVKRQCKPTVVTQNTLIHGLCKAGRIKEAREVLDAMVSSGQSPDVVTYNTLVHGHC  371

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLV  1743
             R G+ + A     D+    + P  VT+  L+SGLC      +A  +F ++K SG  P L 
Sbjct  372   RAGQTERARELLSDMVARGLAPNVVTYTALVSGLCKANRLPEACGVFAQMKSSGCAPNLF  431

Query  1742  TYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEM  1563
             TY  LI G C++G+     +L  E+V  G +P+ + Y T+     +S R    L+IL E 
Sbjct  432   TYTALILGFCSAGQVDGGLKLFGEMVCAGISPDHVVYGTLAAELCKSGRSARALEILREG  491

Query  1562  RR--KGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEG  1389
             R   +   +    Y   +  L+ AG+M+ A   V +M+  G         +L+   CK G
Sbjct  492   RESLRSEAWGDEVYRFAVDGLLDAGKMEMALGFVRDMVRGGQLPAPERCASLVAGLCKSG  551

Query  1388  KLDNAYMLVVE  1356
             +   A  ++ E
Sbjct  552   QGGEARAVLEE  562


 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 80/340 (24%), Positives = 139/340 (41%), Gaps = 54/340 (16%)
 Frame = -1

Query  2408  LRRSQSSPRLPLAASALQLATRTCPMLRLGD*H--LE*MFRIKSRLSTKLLNITVACLCK  2235
             L+R      +P   +   L +  C + R+ D    LE M + + + +    N  +  LCK
Sbjct  278   LKRMTDDGHVPDVVTYSTLISGLCSIARVDDARHLLEDMVKRQCKPTVVTQNTLIHGLCK  337

Query  2234  AKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVIT  2055
             A ++++A  V+   +  G   DVVTYNTL+  +C     +    +L  M   G+ P+V+T
Sbjct  338   AGRIKEAREVLDAMVSSGQSPDVVTYNTLVHGHCRAGQTERARELLSDMVARGLAPNVVT  397

Query  2054  YNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIF  1875
             Y +L++   +   L     +  +M   G  P+ ++Y  L+      G+ D   + F ++ 
Sbjct  398   YTALVSGLCKANRLPEACGVFAQMKSSGCAPNLFTYTALILGFCSAGQVDGGLKLFGEMV  457

Query  1874  WGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHS-----------------------  1764
                I P  V +  L + LC +G + +AL + RE + S                       
Sbjct  458   CAGISPDHVVYGTLAAELCKSGRSARALEILREGRESLRSEAWGDEVYRFAVDGLLDAGK  517

Query  1763  -----GFIPQLVTYN---------ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTT  1626
                  GF+  +V             L+ GLC SG+   AR +L E++D+ Y   A     
Sbjct  518   MEMALGFVRDMVRGGQLPAPERCASLVAGLCKSGQGGEARAVLEEIMDLAYGGKARG---  574

Query  1625  IMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFL  1506
                         +  + +EEM  KGY  +      ++S L
Sbjct  575   ------------KAAKFVEEMVGKGYEIEDGVLKPLLSTL  602



>ref|XP_010431706.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Camelina sativa]
Length=594

 Score =   220 bits (560),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 131/444 (30%), Positives = 225/444 (51%), Gaps = 4/444 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             +I + C C++ QL  A  V+   +++G   DVVT ++L+  YC    I    +++ +M E
Sbjct  84    SILINCFCRSSQLSLALAVLGKMMKLGYEPDVVTLSSLLNGYCHGKRISDAVALVDQMVE  143

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G +P+ +T+ +LI     H   S  + L++ M++ G  P   +Y  +++ L + G  D 
Sbjct  144   MGYQPNTVTFTTLIHGLFLHNKASEAVALVDRMVQRGCQPSLVTYGVVINGLCKTGDIDL  203

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A    + +  G I    V +N ++  LC   + + AL LF E++  G    +VTYN LI 
Sbjct  204   ALTLLKKMEQGKIKADVVIYNTVIDSLCKYKHVDDALNLFNEMEKKGIRANVVTYNSLIS  263

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LCN GRW+ A RLL++++    NP+ +T+  ++    +  +  E  ++ EEM ++    
Sbjct  264   CLCNYGRWSDASRLLSDMIKRKINPDLVTFNALIDAFGKEGKLVEAEKLYEEMIKRSIDP  323

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y ++I+      R+  A      M+  G   D+V Y+TLI  +CK  +++    + 
Sbjct  324   DIVTYSSLINGFCMHDRLNAAKQMFSLMVSKGCLPDVVTYSTLIKGFCKSKRVEEGMQVF  383

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              +  ++G   D  T+ I+I GL +AG+   A       +  G   +L  +N  +DGLC  
Sbjct  384   RDMSQRGLLGDTITYNILIQGLFQAGDCDMAQETFCQMETFGVTPDLWTYNILLDGLCSN  443

Query  1181  GEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
              +++ AL VF+ M     E D FTY+++  G+CKAGR   A +L  S  + G+K      
Sbjct  444   KKLEKALVVFEYMQKSKLELDIFTYTTMTEGMCKAGRVGEAWDLFCSLSLKGVKPNSVTY  503

Query  1013  QAVIDGLQHSGFIQEARKLHSELK  942
               +I GL     +QEA  L  E+K
Sbjct  504   NTMISGLCSKSLLQEANDLFREMK  527


 Score =   199 bits (505),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 117/382 (31%), Positives = 195/382 (51%), Gaps = 4/382 (1%)
 Frame = -1

Query  2192  IRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGML  2013
             ++ G    +VTY  +I   C    ID   ++L +M +  IK DV+ YN++I S  ++  +
Sbjct  177   VQRGCQPSLVTYGVVINGLCKTGDIDLALTLLKKMEQGKIKADVVIYNTVIDSLCKYKHV  236

Query  2012  SRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNIL  1833
                L+L  EM + GI  +  +YN+L+ CL   G+  +A R   D+    I P  VTFN L
Sbjct  237   DDALNLFNEMEKKGIRANVVTYNSLISCLCNYGRWSDASRLLSDMIKRKINPDLVTFNAL  296

Query  1832  LSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGY  1653
             +      G   +A  L+ E+      P +VTY+ LI+G C   R   A+++ + +V  G 
Sbjct  297   IDAFGKEGKLVEAEKLYEEMIKRSIDPDIVTYSSLINGFCMHDRLNAAKQMFSLMVSKGC  356

Query  1652  NPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYD  1473
              P+ +TY+T++K   +S+R EEG+Q+  +M ++G + D+  Y  +I  L +AG    A +
Sbjct  357   LPDVVTYSTLIKGFCKSKRVEEGMQVFRDMSQRGLLGDTITYNILIQGLFQAGDCDMAQE  416

Query  1472  CVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLC  1293
                 M   G+  DL  YN L++  C   KL+ A ++    ++   + D +T+T + +G+C
Sbjct  417   TFCQMETFGVTPDLWTYNILLDGLCSNKKLEKALVVFEYMQKSKLELDIFTYTTMTEGMC  476

Query  1292  KAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE----KDCF  1125
             KAG + EA        L G   N V +N  I GLC    +  A  +F+ M E     D  
Sbjct  477   KAGRVGEAWDLFCSLSLKGVKPNSVTYNTMISGLCSKSLLQEANDLFREMKEDGPLPDSG  536

Query  1124  TYSSLVHGLCKAGRFRVASELL  1059
             TY++L+    + G    ++EL+
Sbjct  537   TYNTLIRAHLRDGDKAASAELI  558


 Score =   157 bits (398),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 96/355 (27%), Positives = 174/355 (49%), Gaps = 0/355 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCK K ++ A  +  +  + G+ A+VVTYN+LI+  C +        +L  M +
Sbjct  224   NTVIDSLCKYKHVDDALNLFNEMEKKGIRANVVTYNSLISCLCNYGRWSDASRLLSDMIK  283

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I PD++T+N+LI +  + G L     L EEM++  I PD  +Y++L++      + + 
Sbjct  284   RKINPDLVTFNALIDAFGKEGKLVEAEKLYEEMIKRSIDPDIVTYSSLINGFCMHDRLNA  343

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A + F  +      P  VT++ L+ G C +   E+ + +FR++   G +   +TYNILI 
Sbjct  344   AKQMFSLMVSKGCLPDVVTYSTLIKGFCKSKRVEEGMQVFRDMSQRGLLGDTITYNILIQ  403

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GL  +G    A+    ++   G  P+  TY  ++     +++ E+ L + E M++     
Sbjct  404   GLFQAGDCDMAQETFCQMETFGVTPDLWTYNILLDGLCSNKKLEKALVVFEYMQKSKLEL  463

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D F Y T+   + KAGR+ +A+D   ++ + G++ + V YNT+I+  C +  L  A  L 
Sbjct  464   DIFTYTTMTEGMCKAGRVGEAWDLFCSLSLKGVKPNSVTYNTMISGLCSKSLLQEANDLF  523

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCID  1197
              E +  G   D  T+  +I    + G+   +   +   +  GF  +   F    D
Sbjct  524   REMKEDGPLPDSGTYNTLIRAHLRDGDKAASAELIREMRRCGFVGDASTFGLVTD  578


 Score =   137 bits (346),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/310 (28%), Positives = 153/310 (49%), Gaps = 3/310 (1%)
 Frame = -1

Query  2291  IKSRLSTKLL--NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGI  2118
             IK +++  L+  N  +    K  +L +AE +  + I+  +  D+VTY++LI  +C    +
Sbjct  282   IKRKINPDLVTFNALIDAFGKEGKLVEAEKLYEEMIKRSIDPDIVTYSSLINGFCMHDRL  341

Query  2117  DAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTL  1938
             +A   +   M   G  PDV+TY++LI    +   +   + +  +M + G+L DT +YN L
Sbjct  342   NAAKQMFSLMVSKGCLPDVVTYSTLIKGFCKSKRVEEGMQVFRDMSQRGLLGDTITYNIL  401

Query  1937  MHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGF  1758
             +  LF+ G  D A   F  +    + P   T+NILL GLC N   EKAL++F  ++ S  
Sbjct  402   IQGLFQAGDCDMAQETFCQMETFGVTPDLWTYNILLDGLCSNKKLEKALVVFEYMQKSKL  461

Query  1757  IPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQ  1578
                + TY  +  G+C +GR   A  L   L   G  PN++TY T++         +E   
Sbjct  462   ELDIFTYTTMTEGMCKAGRVGEAWDLFCSLSLKGVKPNSVTYNTMISGLCSKSLLQEAND  521

Query  1577  ILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYC  1398
             +  EM+  G + DS  Y T+I   ++ G    + + +  M   G   D   +  + +++ 
Sbjct  522   LFREMKEDGPLPDSGTYNTLIRAHLRDGDKAASAELIREMRRCGFVGDASTFGLVTDMFF  581

Query  1397  KEGKLDNAYM  1368
              +G+LD +++
Sbjct  582   -DGRLDKSFL  590


 Score =   119 bits (299),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 90/325 (28%), Positives = 149/325 (46%), Gaps = 41/325 (13%)
 Frame = -1

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLC-MNGYTEKALMLFRELKHSGFIPQLVTY  1737
             K D+A   F ++      P  + FN LLS +  MN Y +  + L  +++  G    L TY
Sbjct  25    KLDDAIGLFGNMVKSRPFPSIIEFNKLLSAIAKMNKY-DVVISLGEQMQKLGISHSLYTY  83

Query  1736  NILI-----------------------------------HGLCNSGRWAPARRLLNELVD  1662
             +ILI                                   +G C+  R + A  L++++V+
Sbjct  84    SILINCFCRSSQLSLALAVLGKMMKLGYEPDVVTLSSLLNGYCHGKRISDAVALVDQMVE  143

Query  1661  IGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKD  1482
             +GY PN +T+TT++   F   +  E + +++ M ++G       Y  VI+ L K G +  
Sbjct  144   MGYQPNTVTFTTLIHGLFLHNKASEAVALVDRMVQRGCQPSLVTYGVVINGLCKTGDIDL  203

Query  1481  AYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIID  1302
             A   +  M    I+ D+V YNT+I+  CK   +D+A  L  E E+KG   +  T+  +I 
Sbjct  204   ALTLLKKMEQGKIKADVVIYNTVIDSLCKYKHVDDALNLFNEMEKKGIRANVVTYNSLIS  263

Query  1301  GLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----  1134
              LC  G   +A R L+       + +LV FN  ID   K G++  A  +++ M ++    
Sbjct  264   CLCNYGRWSDASRLLSDMIKRKINPDLVTFNALIDAFGKEGKLVEAEKLYEEMIKRSIDP  323

Query  1133  DCFTYSSLVHGLCKAGRFRVASELL  1059
             D  TYSSL++G C   R   A ++ 
Sbjct  324   DIVTYSSLINGFCMHDRLNAAKQMF  348


 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 107/224 (48%), Gaps = 0/224 (0%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
              CK+K++E+   V  D  + G+  D +TYN LI         D       +M   G+ PD
Sbjct  370   FCKSKRVEEGMQVFRDMSQRGLLGDTITYNILIQGLFQAGDCDMAQETFCQMETFGVTPD  429

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             + TYN L+     +  L + L + E M +  +  D ++Y T+   + + G+  EA+  F 
Sbjct  430   LWTYNILLDGLCSNKKLEKALVVFEYMQKSKLELDIFTYTTMTEGMCKAGRVGEAWDLFC  489

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
              +    + P  VT+N ++SGLC     ++A  LFRE+K  G +P   TYN LI      G
Sbjct  490   SLSLKGVKPNSVTYNTMISGLCSKSLLQEANDLFREMKEDGPLPDSGTYNTLIRAHLRDG  549

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQIL  1572
               A +  L+ E+   G+  +A T+  +    F  R  +  L++L
Sbjct  550   DKAASAELIREMRRCGFVGDASTFGLVTDMFFDGRLDKSFLEML  593



>ref|XP_007029261.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY09763.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=618

 Score =   220 bits (561),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 132/458 (29%), Positives = 231/458 (50%), Gaps = 4/458 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M  +  R S    +  V  + + K    A ++I     +G+  DV T N  +  +C    
Sbjct  84    MVGMHPRPSVMKFDQLVGAIVRMKHYPTALSLIRQMELLGIHPDVCTLNISLNCFCRLHR  143

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +D G+S+  +M ++GI+P ++T+ +LI      G +++ + L  +M++    P+   YNT
Sbjct  144   LDFGFSVFGKMLKLGIQPSIVTFFTLINGLCIGGEVAQAVRLFNDMVQEEYKPNVIHYNT  203

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             +++CL ++   + A RF + +      P   T++I++ GLC + +  +AL LF E+K  G
Sbjct  204   IVNCLCKISDTNGAIRFLKVMKKRGCEPNTTTYSIIIDGLCKDKHAAEALKLFSEMKGKG  263

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P +VTYN LIH +CNS +W    RLLNE+V     P+ +TY  ++    +  R  E  
Sbjct  264   IPPTVVTYNSLIHAMCNSCQWKVVTRLLNEMVANNCKPDVVTYNILVDALCKGGRVLEAQ  323

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
              I+E M + G+  D F Y ++++     G M +A   +  ++ +G  +D   YNT+IN Y
Sbjct  324   DIIERMIQLGFEPDMFTYNSLMNGYCGRGEMDEARKLLNFLVSSGYGVDAFTYNTVINGY  383

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CK  +++ A  L  E  + G   D  T+  +I G+   G +  A          G   + 
Sbjct  384   CKARRMNEAVELFHEMTQNGSIPDTVTYNTLISGMSLIGRLSAAQELFKEMGAHGTVPDK  443

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELLLS  1053
             + +   +DGLCK G+++ AL +F  M     E D   Y+ L++GLC+ G+ +VA +L  +
Sbjct  444   ITYFTLLDGLCKHGQINDALGLFHVMQNSGLEPDIVHYNILINGLCQVGQLKVARKLFYA  503

Query  1052  CIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKL  939
               + G+         +I GL   G   EA KL  ++++
Sbjct  504   LTVRGLHTNVYTYNIMIKGLCKEGLPNEAYKLLRKMEV  541


 Score =   167 bits (422),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 115/412 (28%), Positives = 182/412 (44%), Gaps = 35/412 (8%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             LC   ++ +A  +  D ++     +V+ YNT++   C     +     L  M + G +P+
Sbjct  173   LCIGGEVAQAVRLFNDMVQEEYKPNVIHYNTIVNCLCKISDTNGAIRFLKVMKKRGCEPN  232

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
               TY+ +I    +    +  L L  EM   GI P   +YN+L+H +    +     R   
Sbjct  233   TTTYSIIIDGLCKDKHAAEALKLFSEMKGKGIPPTVVTYNSLIHAMCNSCQWKVVTRLLN  292

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
             ++   +  P  VT+NIL+  LC  G   +A  +   +   GF P + TYN L++G C  G
Sbjct  293   EMVANNCKPDVVTYNILVDALCKGGRVLEAQDIIERMIQLGFEPDMFTYNSLMNGYCGRG  352

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYC  1524
                 AR+LLN LV  GY  +A TY T++    ++RR  E +++  EM + G I D+  Y 
Sbjct  353   EMDEARKLLNFLVSSGYGVDAFTYNTVINGYCKARRMNEAVELFHEMTQNGSIPDTVTYN  412

Query  1523  TVISF-----------------------------------LIKAGRMKDAYDCVGNMIMN  1449
             T+IS                                    L K G++ DA      M  +
Sbjct  413   TLISGMSLIGRLSAAQELFKEMGAHGTVPDKITYFTLLDGLCKHGQINDALGLFHVMQNS  472

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
             G+E D+V YN LIN  C+ G+L  A  L      +G   + YT+ I+I GLCK G   EA
Sbjct  473   GLEPDIVHYNILINGLCQVGQLKVARKLFYALTVRGLHTNVYTYNIMIKGLCKEGLPNEA  532

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCFTYSS  1113
              + L   ++ G   N  ++N  I G  +  ++     +   M +K    Y S
Sbjct  533   YKLLRKMEVDGCMPNSCSYNTMIQGCLQNNDISRVAQILHEMVKKGFSAYIS  584


 Score =   139 bits (351),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/286 (30%), Positives = 145/286 (51%), Gaps = 0/286 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             NI V  LCK  ++ +A+ +I   I++G   D+ TYN+L+  YC    +D    +L+ +  
Sbjct  307   NILVDALCKGGRVLEAQDIIERMIQLGFEPDMFTYNSLMNGYCGRGEMDEARKLLNFLVS  366

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G   D  TYN++I    +   ++  ++L  EM + G +PDT +YNTL+  +  +G+   
Sbjct  367   SGYGVDAFTYNTVINGYCKARRMNEAVELFHEMTQNGSIPDTVTYNTLISGMSLIGRLSA  426

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F+++      P  +T+  LL GLC +G    AL LF  +++SG  P +V YNILI+
Sbjct  427   AQELFKEMGAHGTVPDKITYFTLLDGLCKHGQINDALGLFHVMQNSGLEPDIVHYNILIN  486

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC  G+   AR+L   L   G + N  TY  ++K   +     E  ++L +M   G + 
Sbjct  487   GLCQVGQLKVARKLFYALTVRGLHTNVYTYNIMIKGLCKEGLPNEAYKLLRKMEVDGCMP  546

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINL  1404
             +S +Y T+I   ++   +      +  M+  G    +     L++L
Sbjct  547   NSCSYNTMIQGCLQNNDISRVAQILHEMVKKGFSAYISTAAMLVDL  592


 Score =   124 bits (311),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 151/320 (47%), Gaps = 0/320 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  +C + Q +    ++ + +      DVVTYN L+ A C    +     I+ RM +
Sbjct  272   NSLIHAMCNSCQWKVVTRLLNEMVANNCKPDVVTYNILVDALCKGGRVLEAQDIIERMIQ  331

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G +PD+ TYNSL+      G +     LL  ++  G   D ++YNT+++   +  + +E
Sbjct  332   LGFEPDMFTYNSLMNGYCGRGEMDEARKLLNFLVSSGYGVDAFTYNTVINGYCKARRMNE  391

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F ++      P  VT+N L+SG+ + G    A  LF+E+   G +P  +TY  L+ 
Sbjct  392   AVELFHEMTQNGSIPDTVTYNTLISGMSLIGRLSAAQELFKEMGAHGTVPDKITYFTLLD  451

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLC  G+   A  L + + + G  P+ + Y  ++    +  + +   ++   +  +G   
Sbjct  452   GLCKHGQINDALGLFHVMQNSGLEPDIVHYNILINGLCQVGQLKVARKLFYALTVRGLHT  511

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             + + Y  +I  L K G   +AY  +  M ++G   +  +YNT+I    +   +     ++
Sbjct  512   NVYTYNIMIKGLCKEGLPNEAYKLLRKMEVDGCMPNSCSYNTMIQGCLQNNDISRVAQIL  571

Query  1361  VEAERKGFDCDKYTHTIIID  1302
              E  +KGF     T  +++D
Sbjct  572   HEMVKKGFSAYISTAAMLVD  591



>ref|XP_010431715.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Camelina sativa]
Length=620

 Score =   220 bits (561),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 133/449 (30%), Positives = 226/449 (50%), Gaps = 4/449 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             +I + C C++ QL  A  ++   +++G    +VT N+L+  +C    I    S++ RM  
Sbjct  110   SIFINCFCRSSQLHLALAILGKMMKLGYEPSIVTLNSLLNGFCHGNRITDAVSLVDRMVA  169

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G++PD +T+ +LI     H   S  + L+E M E G  P+  +Y  +++ + + G  D 
Sbjct  170   MGLQPDTVTFTTLIHGLFLHNKASEAVALVERMAEKGCQPNIVTYGVVVNGICKRGDTDL  229

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A R  + +  G I    V +N ++  LC   +   AL LF E++  G  P + TYN LI 
Sbjct  230   ALRLLKRMDEGKIKSGVVIYNTVIDALCKYKHVNDALDLFNEMEIKGIRPDVFTYNSLIS  289

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LCN GRW  + RLL+++++   NPN +T+  ++    +  +  E  ++ +EM ++    
Sbjct  290   CLCNYGRWDESARLLSDMIEKKINPNVVTFNALIDAFAKEGKLSEAEKLYKEMIQRSIDP  349

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D+  Y ++I       R+  A D    MI  G   ++V YNTLI  +CK  ++ +   L 
Sbjct  350   DTATYNSLIYGFCMHDRLIKAKDMFALMISKGCFPNVVTYNTLIKGFCKSKRVKDGMQLF  409

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E  ++G   D  T+T +I G  +AG+   A             ++L+ +N  +DGLC  
Sbjct  410   HEMSQRGLVGDTVTYTTLIKGFFQAGDCDSAQMLFKQMVSDRVPASLMTYNILLDGLCNN  469

Query  1181  GEVDYALSVF----KSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G+++ AL +F    KS  E D FTY++++ G+CKAG      +L  S  + G+K      
Sbjct  470   GKLETALVIFQDLQKSEMELDIFTYTTMIDGMCKAGMVGEGWDLFCSLSLKGLKPDVVTY  529

Query  1013  QAVIDGLQHSGFIQEARKLHSELKLSKIL  927
               +I GL     +QE   L  E+K+  IL
Sbjct  530   TTMISGLCRKSLMQEVDALFREMKVDGIL  558


 Score =   206 bits (524),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/379 (30%), Positives = 191/379 (50%), Gaps = 4/379 (1%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC  2004
             G   ++VTY  ++   C     D    +L RM+E  IK  V+ YN++I +  ++  ++  
Sbjct  206   GCQPNIVTYGVVVNGICKRGDTDLALRLLKRMDEGKIKSGVVIYNTVIDALCKYKHVNDA  265

Query  2003  LDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSG  1824
             LDL  EM   GI PD ++YN+L+ CL   G+ DE+ R   D+    I P  VTFN L+  
Sbjct  266   LDLFNEMEIKGIRPDVFTYNSLISCLCNYGRWDESARLLSDMIEKKINPNVVTFNALIDA  325

Query  1823  LCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPN  1644
                 G   +A  L++E+      P   TYN LI+G C   R   A+ +   ++  G  PN
Sbjct  326   FAKEGKLSEAEKLYKEMIQRSIDPDTATYNSLIYGFCMHDRLIKAKDMFALMISKGCFPN  385

Query  1643  AITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVG  1464
              +TY T++K   +S+R ++G+Q+  EM ++G + D+  Y T+I    +AG    A     
Sbjct  386   VVTYNTLIKGFCKSKRVKDGMQLFHEMSQRGLVGDTVTYTTLIKGFFQAGDCDSAQMLFK  445

Query  1463  NMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAG  1284
              M+ + +   L+ YN L++  C  GKL+ A ++  + ++   + D +T+T +IDG+CKAG
Sbjct  446   QMVSDRVPASLMTYNILLDGLCNNGKLETALVIFQDLQKSEMELDIFTYTTMIDGMCKAG  505

Query  1283  NMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE----KDCFTYS  1116
              + E         L G   ++V +   I GLC+   +    ++F+ M       D   Y+
Sbjct  506   MVGEGWDLFCSLSLKGLKPDVVTYTTMISGLCRKSLMQEVDALFREMKVDGILPDSGAYN  565

Query  1115  SLVHGLCKAGRFRVASELL  1059
             +L+    + G    + EL+
Sbjct  566   TLIRAHLRDGELAASEELI  584


 Score =   148 bits (373),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 93/350 (27%), Positives = 165/350 (47%), Gaps = 0/350 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCK K +  A  +  +    G+  DV TYN+LI+  C +   D    +L  M E
Sbjct  250   NTVIDALCKYKHVNDALDLFNEMEIKGIRPDVFTYNSLISCLCNYGRWDESARLLSDMIE  309

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I P+V+T+N+LI +  + G LS    L +EM++  I PDT +YN+L++      +  +
Sbjct  310   KKINPNVVTFNALIDAFAKEGKLSEAEKLYKEMIQRSIDPDTATYNSLIYGFCMHDRLIK  369

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F  +      P  VT+N L+ G C +   +  + LF E+   G +   VTY  LI 
Sbjct  370   AKDMFALMISKGCFPNVVTYNTLIKGFCKSKRVKDGMQLFHEMSQRGLVGDTVTYTTLIK  429

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G   +G    A+ L  ++V      + +TY  ++     + + E  L I +++++     
Sbjct  430   GFFQAGDCDSAQMLFKQMVSDRVPASLMTYNILLDGLCNNGKLETALVIFQDLQKSEMEL  489

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D F Y T+I  + KAG + + +D   ++ + G++ D+V Y T+I+  C++  +     L 
Sbjct  490   DIFTYTTMIDGMCKAGMVGEGWDLFCSLSLKGLKPDVVTYTTMISGLCRKSLMQEVDALF  549

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAF  1212
              E +  G   D   +  +I    + G +  +   +N  +  GF  +   F
Sbjct  550   REMKVDGILPDSGAYNTLIRAHLRDGELAASEELINEMRSCGFAGDASTF  599


 Score =   135 bits (341),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 90/322 (28%), Positives = 152/322 (47%), Gaps = 0/322 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  ++CLC   + +++  ++ D I   +  +VVT+N LI A+     +     +   M +
Sbjct  285   NSLISCLCNYGRWDESARLLSDMIEKKINPNVVTFNALIDAFAKEGKLSEAEKLYKEMIQ  344

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I PD  TYNSLI     H  L +  D+   M+  G  P+  +YNTL+    +  +  +
Sbjct  345   RSIDPDTATYNSLIYGFCMHDRLIKAKDMFALMISKGCFPNVVTYNTLIKGFCKSKRVKD  404

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
               + F ++    +    VT+  L+ G    G  + A MLF+++        L+TYNIL+ 
Sbjct  405   GMQLFHEMSQRGLVGDTVTYTTLIKGFFQAGDCDSAQMLFKQMVSDRVPASLMTYNILLD  464

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             GLCN+G+   A  +  +L       +  TYTT++    ++    EG  +   +  KG   
Sbjct  465   GLCNNGKLETALVIFQDLQKSEMELDIFTYTTMIDGMCKAGMVGEGWDLFCSLSLKGLKP  524

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y T+IS L +   M++       M ++GI  D  AYNTLI  + ++G+L  +  L+
Sbjct  525   DVVTYTTMISGLCRKSLMQEVDALFREMKVDGILPDSGAYNTLIRAHLRDGELAASEELI  584

Query  1361  VEAERKGFDCDKYTHTIIIDGL  1296
              E    GF  D  T  ++ + L
Sbjct  585   NEMRSCGFAGDASTFGLVTNML  606


 Score =   117 bits (293),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 81/302 (27%), Positives = 132/302 (44%), Gaps = 36/302 (12%)
 Frame = -1

Query  2273  TKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILH  2094
             T   N  +   C   +L KA+ +    I  G   +VVTYNTLI  +C    +  G  + H
Sbjct  351   TATYNSLIYGFCMHDRLIKAKDMFALMISKGCFPNVVTYNTLIKGFCKSKRVKDGMQLFH  410

Query  2093  RMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLG  1914
              M++ G+  D +TY +LI                                      F+ G
Sbjct  411   EMSQRGLVGDTVTYTTLIKG-----------------------------------FFQAG  435

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
               D A   F+ +    +P   +T+NILL GLC NG  E AL++F++L+ S     + TY 
Sbjct  436   DCDSAQMLFKQMVSDRVPASLMTYNILLDGLCNNGKLETALVIFQDLQKSEMELDIFTYT  495

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
              +I G+C +G       L   L   G  P+ +TYTT++    R    +E   +  EM+  
Sbjct  496   TMIDGMCKAGMVGEGWDLFCSLSLKGLKPDVVTYTTMISGLCRKSLMQEVDALFREMKVD  555

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
             G + DS AY T+I   ++ G +  + + +  M   G   D   +  + N+   +G+LD +
Sbjct  556   GILPDSGAYNTLIRAHLRDGELAASEELINEMRSCGFAGDASTFGLVTNM-LHDGRLDKS  614

Query  1373  YM  1368
             ++
Sbjct  615   FL  616


 Score = 99.8 bits (247),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 127/288 (44%), Gaps = 4/288 (1%)
 Frame = -1

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             K D+A   F ++      P  V F+ LL+ +      +  +    +++  G    L TY+
Sbjct  51    KLDDAIGLFGEMVKSRPLPSIVYFSKLLTAIAKMKKFDLVISFGEQMQKLGISHNLFTYS  110

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             I I+  C S +   A  +L +++ +GY P+ +T  +++       R  + + +++ M   
Sbjct  111   IFINCFCRSSQLHLALAILGKMMKLGYEPSIVTLNSLLNGFCHGNRITDAVSLVDRMVAM  170

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
             G   D+  + T+I  L    +  +A   V  M   G + ++V Y  ++N  CK G  D A
Sbjct  171   GLQPDTVTFTTLIHGLFLHNKASEAVALVERMAEKGCQPNIVTYGVVVNGICKRGDTDLA  230

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               L+   +          +  +ID LCK  ++ +AL   N  ++ G   ++  +N  I  
Sbjct  231   LRLLKRMDEGKIKSGVVIYNTVIDALCKYKHVNDALDLFNEMEIKGIRPDVFTYNSLISC  290

Query  1193  LCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASEL  1062
             LC  G  D +  +   M EK    +  T+++L+    K G+   A +L
Sbjct  291   LCNYGRWDESARLLSDMIEKKINPNVVTFNALIDAFAKEGKLSEAEKL  338



>ref|XP_010530383.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530384.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=615

 Score =   220 bits (560),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 126/450 (28%), Positives = 227/450 (50%), Gaps = 4/450 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             LNI + C C+++Q+    +V+   +++G   +V+T+ T I   C    + A  S++ RM 
Sbjct  104   LNILINCFCRSRQVGLGFSVLGKIMKLGYEPNVITFTTFINGLCIEGKLSAALSLVERMV  163

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             + G  P+V+T  +++      G +   + L+++M + G  PD  +Y  +++ + + G   
Sbjct  164   KDGYTPNVVTCTTVVNGLCLQGRIHEAVTLVDQMPKKGYQPDVITYGAIVNGICKSGDSA  223

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A      +    +    V +N ++  LC +G  + AL LF+++   G  P +VTYN LI
Sbjct  224   LALNLLIKMEERHVEVNVVVYNTIIDCLCKDGRVDDALNLFKKMDDRGVAPDVVTYNTLI  283

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +GLC  GRW    RL N+++     PN +T+T ++    +  +F E  ++ E+M ++G +
Sbjct  284   NGLCCYGRWTDVTRLSNDMIKRNITPNVVTFTGLIDDFVKEGKFLEARELYEQMVQRGLV  343

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D+  Y ++I  L    R+ +A     +M   G   D+V +N LIN YCK G++D    L
Sbjct  344   PDTITYTSLIDGLCMQNRLDEAKKMFDSMATKGCSPDVVTFNALINGYCKSGRVDQGMKL  403

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E  R+G   D  T+  +I G  +AGN+  A +     +  G   +LV F   +DGLCK
Sbjct  404   FSEMSRRGVVADTCTYNSLIQGFFRAGNLDAARKLFLEMQCQGQYPDLVTFKVLLDGLCK  463

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G+++ A  ++  M++     D   ++ ++HGLC   +   A  L    +   ++     
Sbjct  464   NGKLEEAFCLYNKMEKSGMNLDIIAHTIIIHGLCVDDKVEDALRLFNGLLDREVEPNVKT  523

Query  1016  RQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
               A+I GL   G + EA KL  ++K++  L
Sbjct  524   YTAMISGLCRKGLLDEAEKLFRDMKVAGCL  553


 Score =   194 bits (493),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 118/422 (28%), Positives = 207/422 (49%), Gaps = 4/422 (1%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             V  LC   ++ +A T++    + G   DV+TY  ++   C         ++L +M E  +
Sbjct  178   VNGLCLQGRIHEAVTLVDQMPKKGYQPDVITYGAIVNGICKSGDSALALNLLIKMEERHV  237

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             + +V+ YN++I    + G +   L+L ++M + G+ PD  +YNTL++ L   G+  +  R
Sbjct  238   EVNVVVYNTIIDCLCKDGRVDDALNLFKKMDDRGVAPDVVTYNTLINGLCCYGRWTDVTR  297

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
                D+   +I P  VTF  L+      G   +A  L+ ++   G +P  +TY  LI GLC
Sbjct  298   LSNDMIKRNITPNVVTFTGLIDDFVKEGKFLEARELYEQMVQRGLVPDTITYTSLIDGLC  357

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
                R   A+++ + +   G +P+ +T+  ++    +S R ++G+++  EM R+G + D+ 
Sbjct  358   MQNRLDEAKKMFDSMATKGCSPDVVTFNALINGYCKSGRVDQGMKLFSEMSRRGVVADTC  417

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              Y ++I    +AG +  A      M   G   DLV +  L++  CK GKL+ A+ L  + 
Sbjct  418   TYNSLIQGFFRAGNLDAARKLFLEMQCQGQYPDLVTFKVLLDGLCKNGKLEEAFCLYNKM  477

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEV  1173
             E+ G + D   HTIII GLC    +++ALR  N       + N+  +   I GLC+ G +
Sbjct  478   EKSGMNLDIIAHTIIIHGLCVDDKVEDALRLFNGLLDREVEPNVKTYTAMISGLCRKGLL  537

Query  1172  DYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAV  1005
             D A  +F+ M    C     TY++L+ G  + G      EL+      G     S  + +
Sbjct  538   DEAEKLFRDMKVAGCLPNDRTYNALIQGHLRNGYTSKGIELVREMRSCGFSADASTTEII  597

Query  1004  ID  999
             +D
Sbjct  598   VD  599


 Score =   186 bits (473),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 124/440 (28%), Positives = 217/440 (49%), Gaps = 8/440 (2%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
             LC   +L  A +++   ++ G   +VVT  T++   C    I    +++ +M + G +PD
Sbjct  146   LCIEGKLSAALSLVERMVKDGYTPNVVTCTTVVNGLCLQGRIHEAVTLVDQMPKKGYQPD  205

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             VITY +++    + G  +  L+LL +M E  +  +   YNT++ CL + G+ D+A   F+
Sbjct  206   VITYGAIVNGICKSGDSALALNLLIKMEERHVEVNVVVYNTIIDCLCKDGRVDDALNLFK  265

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
              +    + P  VT+N L++GLC  G       L  ++      P +VT+  LI      G
Sbjct  266   KMDDRGVAPDVVTYNTLINGLCCYGRWTDVTRLSNDMIKRNITPNVVTFTGLIDDFVKEG  325

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYC  1524
             ++  AR L  ++V  G  P+ ITYT+++       R +E  ++ + M  KG   D   + 
Sbjct  326   KFLEARELYEQMVQRGLVPDTITYTSLIDGLCMQNRLDEAKKMFDSMATKGCSPDVVTFN  385

Query  1523  TVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERK  1344
              +I+   K+GR+         M   G+  D   YN+LI  + + G LD A  L +E + +
Sbjct  386   ALINGYCKSGRVDQGMKLFSEMSRRGVVADTCTYNSLIQGFFRAGNLDAARKLFLEMQCQ  445

Query  1343  GFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYA  1164
             G   D  T  +++DGLCK G ++EA    N  +  G + +++A    I GLC   +V+ A
Sbjct  446   GQYPDLVTFKVLLDGLCKNGKLEEAFCLYNKMEKSGMNLDIIAHTIIIHGLCVDDKVEDA  505

Query  1163  LSVFKSM----DEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR--QAVI  1002
             L +F  +     E +  TY++++ GLC+ G    A +L     + G   L +DR   A+I
Sbjct  506   LRLFNGLLDREVEPNVKTYTAMISGLCRKGLLDEAEKLFRDMKVAG--CLPNDRTYNALI  563

Query  1001  DGLQHSGFIQEARKLHSELK  942
              G   +G+  +  +L  E++
Sbjct  564   QGHLRNGYTSKGIELVREMR  583


 Score =   178 bits (452),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 118/420 (28%), Positives = 199/420 (47%), Gaps = 39/420 (9%)
 Frame = -1

Query  2183  GVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC  2004
             GV  D  + N LI  +C    +  G+S+L ++ ++G +P+VIT+ + I      G LS  
Sbjct  96    GVSHDNYSLNILINCFCRSRQVGLGFSVLGKIMKLGYEPNVITFTTFINGLCIEGKLSAA  155

Query  2003  LDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSG  1824
             L L+E M++ G  P+                                    VT   +++G
Sbjct  156   LSLVERMVKDGYTPNV-----------------------------------VTCTTVVNG  180

Query  1823  LCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPN  1644
             LC+ G   +A+ L  ++   G+ P ++TY  +++G+C SG  A A  LL ++ +     N
Sbjct  181   LCLQGRIHEAVTLVDQMPKKGYQPDVITYGAIVNGICKSGDSALALNLLIKMEERHVEVN  240

Query  1643  AITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVG  1464
              + Y TI+ C  +  R ++ L + ++M  +G   D   Y T+I+ L   GR  D      
Sbjct  241   VVVYNTIIDCLCKDGRVDDALNLFKKMDDRGVAPDVVTYNTLINGLCCYGRWTDVTRLSN  300

Query  1463  NMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAG  1284
             +MI   I  ++V +  LI+ + KEGK   A  L  +  ++G   D  T+T +IDGLC   
Sbjct  301   DMIKRNITPNVVTFTGLIDDFVKEGKFLEARELYEQMVQRGLVPDTITYTSLIDGLCMQN  360

Query  1283  NMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYS  1116
              + EA +  +     G   ++V FN  I+G CK G VD  + +F  M  +    D  TY+
Sbjct  361   RLDEAKKMFDSMATKGCSPDVVTFNALINGYCKSGRVDQGMKLFSEMSRRGVVADTCTYN  420

Query  1115  SLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLS  936
             SL+ G  +AG    A +L L     G        + ++DGL  +G ++EA  L+++++ S
Sbjct  421   SLIQGFFRAGNLDAARKLFLEMQCQGQYPDLVTFKVLLDGLCKNGKLEEAFCLYNKMEKS  480


 Score =   159 bits (401),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 98/364 (27%), Positives = 174/364 (48%), Gaps = 1/364 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  + CLCK  +++ A  +       GV  DVVTYNTLI   CC+        + + M +
Sbjct  245   NTIIDCLCKDGRVDDALNLFKKMDDRGVAPDVVTYNTLINGLCCYGRWTDVTRLSNDMIK  304

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I P+V+T+  LI    + G      +L E+M++ G++PDT +Y +L+  L    + DE
Sbjct  305   RNITPNVVTFTGLIDDFVKEGKFLEARELYEQMVQRGLVPDTITYTSLIDGLCMQNRLDE  364

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A + F  +      P  VTFN L++G C +G  ++ + LF E+   G +    TYN LI 
Sbjct  365   AKKMFDSMATKGCSPDVVTFNALINGYCKSGRVDQGMKLFSEMSRRGVVADTCTYNSLIQ  424

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G   +G    AR+L  E+   G  P+ +T+  ++    ++ + EE   +  +M + G   
Sbjct  425   GFFRAGNLDAARKLFLEMQCQGQYPDLVTFKVLLDGLCKNGKLEEAFCLYNKMEKSGMNL  484

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D  A+  +I  L    +++DA      ++   +E ++  Y  +I+  C++G LD A  L 
Sbjct  485   DIIAHTIIIHGLCVDDKVEDALRLFNGLLDREVEPNVKTYTAMISGLCRKGLLDEAEKLF  544

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              + +  G   +  T+  +I G  + G   + +  +   +  GF ++       +D +C  
Sbjct  545   RDMKVAGCLPNDRTYNALIQGHLRNGYTSKGIELVREMRSCGFSADASTTEIIVDMICD-  603

Query  1181  GEVD  1170
             G +D
Sbjct  604   GRLD  607


 Score =   144 bits (364),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/275 (30%), Positives = 136/275 (49%), Gaps = 1/275 (0%)
 Frame = -1

Query  2192  IRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGML  2013
             ++ G+  D +TY +LI   C    +D    +   M   G  PDV+T+N+LI    + G +
Sbjct  338   VQRGLVPDTITYTSLIDGLCMQNRLDEAKKMFDSMATKGCSPDVVTFNALINGYCKSGRV  397

Query  2012  SRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNIL  1833
              + + L  EM   G++ DT +YN+L+   FR G  D A + F ++      P  VTF +L
Sbjct  398   DQGMKLFSEMSRRGVVADTCTYNSLIQGFFRAGNLDAARKLFLEMQCQGQYPDLVTFKVL  457

Query  1832  LSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGY  1653
             L GLC NG  E+A  L+ +++ SG    ++ + I+IHGLC   +   A RL N L+D   
Sbjct  458   LDGLCKNGKLEEAFCLYNKMEKSGMNLDIIAHTIIIHGLCVDDKVEDALRLFNGLLDREV  517

Query  1652  NPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYD  1473
              PN  TYT ++    R    +E  ++  +M+  G + +   Y  +I   ++ G      +
Sbjct  518   EPNVKTYTAMISGLCRKGLLDEAEKLFRDMKVAGCLPNDRTYNALIQGHLRNGYTSKGIE  577

Query  1472  CVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
              V  M   G   D      ++++ C +G+LD  +M
Sbjct  578   LVREMRSCGFSADASTTEIIVDMIC-DGRLDKKFM  611


 Score =   120 bits (300),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 81/294 (28%), Positives = 146/294 (50%), Gaps = 4/294 (1%)
 Frame = -1

Query  1814  NGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAIT  1635
             N     A+ +F ++  S  +P +V ++ L+  +    R+     L   +   G + +  +
Sbjct  44    NSNVRDAVDVFDQMVRSRPLPSIVDFSKLLSAIAKMKRYDIVISLCKRMELHGVSHDNYS  103

Query  1634  YTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMI  1455
                ++ C  RSR+   G  +L ++ + GY  +   + T I+ L   G++  A   V  M+
Sbjct  104   LNILINCFCRSRQVGLGFSVLGKIMKLGYEPNVITFTTFINGLCIEGKLSAALSLVERMV  163

Query  1454  MNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMK  1275
              +G   ++V   T++N  C +G++  A  LV +  +KG+  D  T+  I++G+CK+G+  
Sbjct  164   KDGYTPNVVTCTTVVNGLCLQGRIHEAVTLVDQMPKKGYQPDVITYGAIVNGICKSGDSA  223

Query  1274  EALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLV  1107
              AL  L   +    + N+V +N  ID LCK G VD AL++FK MD++    D  TY++L+
Sbjct  224   LALNLLIKMEERHVEVNVVVYNTIIDCLCKDGRVDDALNLFKKMDDRGVAPDVVTYNTLI  283

Query  1106  HGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             +GLC  GR+   + L    I   +         +ID     G   EAR+L+ ++
Sbjct  284   NGLCCYGRWTDVTRLSNDMIKRNITPNVVTFTGLIDDFVKEGKFLEARELYEQM  337


 Score =   116 bits (291),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 97/377 (26%), Positives = 160/377 (42%), Gaps = 39/377 (10%)
 Frame = -1

Query  1958  TWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFR  1779
             + SY   +   F      +A   F  +      P  V F+ LLS +      +  + L +
Sbjct  31    SVSYRERLRSGFGNSNVRDAVDVFDQMVRSRPLPSIVDFSKLLSAIAKMKRYDIVISLCK  90

Query  1778  ELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSR  1599
              ++  G      + NILI+  C S +      +L +++ +GY PN IT+TT +       
Sbjct  91    RMELHGVSHDNYSLNILINCFCRSRQVGLGFSVLGKIMKLGYEPNVITFTTFINGLCIEG  150

Query  1598  RFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNM-------------  1458
             +    L ++E M + GY  +     TV++ L   GR+ +A   V  M             
Sbjct  151   KLSAALSLVERMVKDGYTPNVVTCTTVVNGLCLQGRIHEAVTLVDQMPKKGYQPDVITYG  210

Query  1457  -IMNGI---------------------ELDLVAYNTLINLYCKEGKLDNAYMLVVEAERK  1344
              I+NGI                     E+++V YNT+I+  CK+G++D+A  L  + + +
Sbjct  211   AIVNGICKSGDSALALNLLIKMEERHVEVNVVVYNTIIDCLCKDGRVDDALNLFKKMDDR  270

Query  1343  GFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYA  1164
             G   D  T+  +I+GLC  G   +  R  N         N+V F   ID   K G+   A
Sbjct  271   GVAPDVVTYNTLINGLCCYGRWTDVTRLSNDMIKRNITPNVVTFTGLIDDFVKEGKFLEA  330

Query  1163  LSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDG  996
               +++ M ++    D  TY+SL+ GLC   R   A ++  S    G         A+I+G
Sbjct  331   RELYEQMVQRGLVPDTITYTSLIDGLCMQNRLDEAKKMFDSMATKGCSPDVVTFNALING  390

Query  995   LQHSGFIQEARKLHSEL  945
                SG + +  KL SE+
Sbjct  391   YCKSGRVDQGMKLFSEM  407



>ref|XP_009612407.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009612408.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009612409.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009612410.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009612411.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009612412.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009612413.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Nicotiana tomentosiformis]
Length=599

 Score =   219 bits (559),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 133/460 (29%), Positives = 225/460 (49%), Gaps = 45/460 (10%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M  ++S       NI +  + K K      ++    + V    D +T N LI ++C    
Sbjct  61    MLHMQSPPPISSFNILLGAVAKTKHYNDVISLYNKMVAVNYSTDFITLNILINSFCSMKQ  120

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +  G+S+L  + + G  P+V+T+ SLI        ++  + L ++++E+G  P   ++ T
Sbjct  121   VGLGFSVLGGIFKRGYSPNVVTFTSLIKGLFVENKINEAVGLFKKIVELGYKPHVKTWGT  180

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDI------PPCPVTFNILLSGLCMNGYTEKALMLFR  1779
             L++ L R G  + A    Q++  G++       P  VT+++++ GLC  G  +KA+ +F 
Sbjct  181   LINGLCRSGNAERALVLHQEMSKGNVLFGVPFRPNVVTYSMIIDGLCKEGLVDKAVKVFL  240

Query  1778  ELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSR  1599
             E+K     P +V Y  L+HGL ++ +W  A+   NE+VD G  PN +T+  +M    +  
Sbjct  241   EMKEKRISPDVVVYGSLVHGLSDARKWEEAKAFFNEMVDQGIRPNVVTFNVLMNVLCKEG  300

Query  1598  RFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYN  1419
             R EE   +L+ M ++G   DSF Y T++      G++ +A     +M   G E ++++YN
Sbjct  301   RTEEASALLDLMIQRGEKPDSFTYNTLMDGFCLEGKVDNARQLFVSMAAKGEERNVISYN  360

Query  1418  TLINLYCKEGKLDNAYML------------VV-----------------------EAERK  1344
              LIN YCK G++D+ + L            VV                       E +R 
Sbjct  361   ILINGYCKCGRIDDGWRLYKEMLQKDYKPTVVTFNTLLTALFHGGKVGDGRELFDEMQRC  420

Query  1343  GFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYA  1164
             G   D  T TI++DG CK   + EA+      +    +  + AFNC IDGLCK G+++ A
Sbjct  421   GVTPDSSTFTILLDGFCKNNCLTEAMELFQLLERTRHELTIDAFNCVIDGLCKGGKLEDA  480

Query  1163  LSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLL  1056
               +F+S+ +K       TYS ++HG CK G+   A+ L L
Sbjct  481   TKLFESLSQKGLVPTVVTYSIMIHGFCKIGQLEKANNLFL  520


 Score =   166 bits (421),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 110/399 (28%), Positives = 186/399 (47%), Gaps = 10/399 (3%)
 Frame = -1

Query  2243  LCKAKQLEKA----ETVIIDGIRVGVP--ADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             LC++   E+A    + +    +  GVP   +VVTY+ +I   C    +D    +   M E
Sbjct  185   LCRSGNAERALVLHQEMSKGNVLFGVPFRPNVVTYSMIIDGLCKEGLVDKAVKVFLEMKE  244

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I PDV+ Y SL+   +             EM++ GI P+  ++N LM+ L + G+ +E
Sbjct  245   KRISPDVVVYGSLVHGLSDARKWEEAKAFFNEMVDQGIRPNVVTFNVLMNVLCKEGRTEE  304

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A      +      P   T+N L+ G C+ G  + A  LF  +   G    +++YNILI+
Sbjct  305   ASALLDLMIQRGEKPDSFTYNTLMDGFCLEGKVDNARQLFVSMAAKGEERNVISYNILIN  364

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G C  GR     RL  E++   Y P  +T+ T++   F   +  +G ++ +EM+R G   
Sbjct  365   GYCKCGRIDDGWRLYKEMLQKDYKPTVVTFNTLLTALFHGGKVGDGRELFDEMQRCGVTP  424

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             DS  +  ++    K   + +A +    +     EL + A+N +I+  CK GKL++A  L 
Sbjct  425   DSSTFTILLDGFCKNNCLTEAMELFQLLERTRHELTIDAFNCVIDGLCKGGKLEDATKLF  484

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
                 +KG      T++I+I G CK G +++A       +  G   N+V FN  + G C  
Sbjct  485   ESLSQKGLVPTVVTYSIMIHGFCKIGQLEKANNLFLEMEKKGCFPNVVTFNTLMRGFCDN  544

Query  1181  GEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFR  1077
              +    +++ + M EK    D  T S +V  L K  ++ 
Sbjct  545   NDAPQVVNLLQKMAEKHLSPDLSTISLVVELLSKDDKYH  583


 Score =   119 bits (297),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/330 (25%), Positives = 155/330 (47%), Gaps = 10/330 (3%)
 Frame = -1

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             +A  +F ++     PP   +FNILL  +    +    + L+ ++    +    +T NILI
Sbjct  53    DALNYFDNMLHMQSPPPISSFNILLGAVAKTKHYNDVISLYNKMVAVNYSTDFITLNILI  112

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
             +  C+  +      +L  +   GY+PN +T+T+++K  F   +  E + + +++   GY 
Sbjct  113   NSFCSMKQVGLGFSVLGGIFKRGYSPNVVTFTSLIKGLFVENKINEAVGLFKKIVELGYK  172

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNM----IMNGIEL--DLVAYNTLINLYCKEGKL  1383
                  + T+I+ L ++G  + A      M    ++ G+    ++V Y+ +I+  CKEG +
Sbjct  173   PHVKTWGTLINGLCRSGNAERALVLHQEMSKGNVLFGVPFRPNVVTYSMIIDGLCKEGLV  232

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             D A  + +E + K    D   +  ++ GL  A   +EA    N     G   N+V FN  
Sbjct  233   DKAVKVFLEMKEKRISPDVVVYGSLVHGLSDARKWEEAKAFFNEMVDQGIRPNVVTFNVL  292

Query  1202  IDGLCKVGEVDYALSVFKSM----DEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGM  1035
             ++ LCK G  + A ++   M    ++ D FTY++L+ G C  G+   A +L +S    G 
Sbjct  293   MNVLCKEGRTEEASALLDLMIQRGEKPDSFTYNTLMDGFCLEGKVDNARQLFVSMAAKGE  352

Query  1034  KILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             +        +I+G    G I +  +L+ E+
Sbjct  353   ERNVISYNILINGYCKCGRIDDGWRLYKEM  382


 Score =   116 bits (290),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 143/329 (43%), Gaps = 0/329 (0%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             V  L  A++ E+A+    + +  G+  +VVT+N L+   C     +   ++L  M + G 
Sbjct  258   VHGLSDARKWEEAKAFFNEMVDQGIRPNVVTFNVLMNVLCKEGRTEEASALLDLMIQRGE  317

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             KPD  TYN+L+      G +     L   M   G   +  SYN L++   + G+ D+ +R
Sbjct  318   KPDSFTYNTLMDGFCLEGKVDNARQLFVSMAAKGEERNVISYNILINGYCKCGRIDDGWR  377

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
              ++++   D  P  VTFN LL+ L   G       LF E++  G  P   T+ IL+ G C
Sbjct  378   LYKEMLQKDYKPTVVTFNTLLTALFHGGKVGDGRELFDEMQRCGVTPDSSTFTILLDGFC  437

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
              +     A  L   L    +      +  ++    +  + E+  ++ E + +KG +    
Sbjct  438   KNNCLTEAMELFQLLERTRHELTIDAFNCVIDGLCKGGKLEDATKLFESLSQKGLVPTVV  497

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              Y  +I    K G+++ A +    M   G   ++V +NTL+  +C          L+ + 
Sbjct  498   TYSIMIHGFCKIGQLEKANNLFLEMEKKGCFPNVVTFNTLMRGFCDNNDAPQVVNLLQKM  557

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEAL  1266
               K    D  T +++++ L K     E L
Sbjct  558   AEKHLSPDLSTISLVVELLSKDDKYHEYL  586


 Score =   114 bits (284),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 124/296 (42%), Gaps = 35/296 (12%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYS  2103
             R +    N+ +  LCK  + E+A  ++   I+ G   D  TYNTL+  +C    +D    
Sbjct  283   RPNVVTFNVLMNVLCKEGRTEEASALLDLMIQRGEKPDSFTYNTLMDGFCLEGKVDNARQ  342

Query  2102  ILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLF  1923
             +   M   G + +VI+YN LI    + G +     L +EML+    P   ++NTL+  LF
Sbjct  343   LFVSMAAKGEERNVISYNILINGYCKCGRIDDGWRLYKEMLQKDYKPTVVTFNTLLTALF  402

Query  1922  RLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMN-----------------------  1812
               GK  +    F ++    + P   TF ILL G C N                       
Sbjct  403   HGGKVGDGRELFDEMQRCGVTPDSSTFTILLDGFCKNNCLTEAMELFQLLERTRHELTID  462

Query  1811  ------------GYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNEL  1668
                         G  E A  LF  L   G +P +VTY+I+IHG C  G+   A  L  E+
Sbjct  463   AFNCVIDGLCKGGKLEDATKLFESLSQKGLVPTVVTYSIMIHGFCKIGQLEKANNLFLEM  522

Query  1667  VDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIK  1500
                G  PN +T+ T+M+    +    + + +L++M  K    D      V+  L K
Sbjct  523   EKKGCFPNVVTFNTLMRGFCDNNDAPQVVNLLQKMAEKHLSPDLSTISLVVELLSK  578


 Score = 99.8 bits (247),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 122/265 (46%), Gaps = 35/265 (13%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +   C   +++ A  + +     G   +V++YN LI  YC    ID G+ +   M +
Sbjct  325   NTLMDGFCLEGKVDNARQLFVSMAAKGEERNVISYNILINGYCKCGRIDDGWRLYKEMLQ  384

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLM------HCL--  1926
                KP V+T+N+L+ +    G +    +L +EM   G+ PD+ ++  L+      +CL  
Sbjct  385   KDYKPTVVTFNTLLTALFHGGKVGDGRELFDEMQRCGVTPDSSTFTILLDGFCKNNCLTE  444

Query  1925  ----FRL-----------------------GKPDEAYRFFQDIFWGDIPPCPVTFNILLS  1827
                 F+L                       GK ++A + F+ +    + P  VT++I++ 
Sbjct  445   AMELFQLLERTRHELTIDAFNCVIDGLCKGGKLEDATKLFESLSQKGLVPTVVTYSIMIH  504

Query  1826  GLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNP  1647
             G C  G  EKA  LF E++  G  P +VT+N L+ G C++        LL ++ +   +P
Sbjct  505   GFCKIGQLEKANNLFLEMEKKGCFPNVVTFNTLMRGFCDNNDAPQVVNLLQKMAEKHLSP  564

Query  1646  NAITYTTIMKCCFRSRRFEEGLQIL  1572
             +  T + +++   +  ++ E L ++
Sbjct  565   DLSTISLVVELLSKDDKYHEYLNLI  589


 Score = 53.5 bits (127),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 71/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  2294  RIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGID  2115
             R +  L+    N  +  LCK  +LE A  +     + G+   VVTY+ +I  +C    ++
Sbjct  454   RTRHELTIDAFNCVIDGLCKGGKLEDATKLFESLSQKGLVPTVVTYSIMIHGFCKIGQLE  513

Query  2114  AGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLM  1935
                ++   M + G  P+V+T+N+L+     +    + ++LL++M E  + PD  + + ++
Sbjct  514   KANNLFLEMEKKGCFPNVVTFNTLMRGFCDNNDAPQVVNLLQKMAEKHLSPDLSTISLVV  573

Query  1934  HCLFRLGKPDEAYRFFQDIFWGDIPPCPV  1848
               L +    D+ Y  + ++    IP  P 
Sbjct  574   ELLSK----DDKYHEYLNL----IPTFPT  594



>emb|CDP00950.1| unnamed protein product [Coffea canephora]
Length=626

 Score =   219 bits (559),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 126/437 (29%), Positives = 227/437 (52%), Gaps = 7/437 (2%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
              CK  + +KA  V+      G   DV+TYN LI+ YC    ID    +L RM+   + PD
Sbjct  20    FCKLGKTKKATRVLEFLEESGAVPDVITYNVLISGYCKSGEIDNALKLLDRMS---VAPD  76

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             V+TYN+++ S    G L + +++L+  L     PD  +Y  L+    R     +A +   
Sbjct  77    VVTYNTILRSLCGSGKLKQAMEVLDRQLRRECYPDVITYTILIEATCRESGVGQAMKLLD  136

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
             ++      P  VT+N+L++G+C  G  ++A+   R +   G  P ++T+NI++  +C++G
Sbjct  137   EMSAKGCKPDVVTYNVLINGICKEGRLDEAIKFLRNMPSYGCQPNVITHNIILRSMCSTG  196

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYC  1524
             RW  A +LL E++  G +P+ +T+  ++    R       + +LE M + G   +S +Y 
Sbjct  197   RWMDAEKLLTEMLRKGCSPSVVTFNILINFLCRKGLLGRAIDVLERMPKYGCTPNSLSYN  256

Query  1523  TVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERK  1344
              ++    K  +M  A + +  M+  G   D+V YNTL+   C++GK D A  ++ +   +
Sbjct  257   PLLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTALCRDGKADVAVEILDQLSSR  316

Query  1343  GFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYA  1164
             G      T+  +IDGL K G  + A++ L+  +  G   +++ ++  + GLC+ G+VD A
Sbjct  317   GCSPVLITYNTVIDGLSKVGKTESAIKLLHEMREKGLQPDIITYSSLVGGLCREGKVDEA  376

Query  1163  LSVFKSMDE----KDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDG  996
             +S    ++E     +  TY++++ GLCKA +   A + L   +  G K  +S    +I+G
Sbjct  377   ISFIHELEELGIKPNAITYNAIMLGLCKARQTDRAIDFLAYMVSKGCKPTESTYTILIEG  436

Query  995   LQHSGFIQEARKLHSEL  945
             + + G   EA +L +EL
Sbjct  437   IAYEGLANEALELLNEL  453


 Score =   192 bits (489),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 120/405 (30%), Positives = 204/405 (50%), Gaps = 7/405 (2%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N+ ++  CK+ +++ A  ++    R+ V  DVVTYNT++ + C    +     +L R   
Sbjct  49    NVLISGYCKSGEIDNALKLLD---RMSVAPDVVTYNTILRSLCGSGKLKQAMEVLDRQLR  105

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
                 PDVITY  LI +  R   + + + LL+EM   G  PD  +YN L++ + + G+ DE
Sbjct  106   RECYPDVITYTILIEATCRESGVGQAMKLLDEMSAKGCKPDVVTYNVLINGICKEGRLDE  165

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A +F +++      P  +T NI+L  +C  G    A  L  E+   G  P +VT+NILI+
Sbjct  166   AIKFLRNMPSYGCQPNVITHNIILRSMCSTGRWMDAEKLLTEMLRKGCSPSVVTFNILIN  225

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LC  G    A  +L  +   G  PN+++Y  ++    + ++ +  ++ LE M  +G   
Sbjct  226   FLCRKGLLGRAIDVLERMPKYGCTPNSLSYNPLLHGFCKEKKMDRAIEYLEIMVSRGCYP  285

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y T+++ L + G+   A + +  +   G    L+ YNT+I+   K GK ++A  L+
Sbjct  286   DIVTYNTLLTALCRDGKADVAVEILDQLSSRGCSPVLITYNTVIDGLSKVGKTESAIKLL  345

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E   KG   D  T++ ++ GLC+ G + EA+  ++  + +G   N + +N  + GLCK 
Sbjct  346   HEMREKGLQPDIITYSSLVGGLCREGKVDEAISFIHELEELGIKPNAITYNAIMLGLCKA  405

Query  1181  GEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELL  1059
              + D A+     M  K C     TY+ L+ G+   G    A ELL
Sbjct  406   RQTDRAIDFLAYMVSKGCKPTESTYTILIEGIAYEGLANEALELL  450


 Score =   152 bits (385),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/352 (29%), Positives = 173/352 (49%), Gaps = 7/352 (2%)
 Frame = -1

Query  1985  MLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGY  1806
             M+  G +PD     +L+    +LGK  +A R  + +      P  +T+N+L+SG C +G 
Sbjct  1     MVYKGDIPDIIPCTSLIRGFCKLGKTKKATRVLEFLEESGAVPDVITYNVLISGYCKSGE  60

Query  1805  TEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTT  1626
              + AL L   L      P +VTYN ++  LC SG+   A  +L+  +     P+ ITYT 
Sbjct  61    IDNALKL---LDRMSVAPDVVTYNTILRSLCGSGKLKQAMEVLDRQLRRECYPDVITYTI  117

Query  1625  IMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNG  1446
             +++   R     + +++L+EM  KG   D   Y  +I+ + K GR+ +A   + NM   G
Sbjct  118   LIEATCRESGVGQAMKLLDEMSAKGCKPDVVTYNVLINGICKEGRLDEAIKFLRNMPSYG  177

Query  1445  IELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEAL  1266
              + +++ +N ++   C  G+  +A  L+ E  RKG      T  I+I+ LC+ G +  A+
Sbjct  178   CQPNVITHNIILRSMCSTGRWMDAEKLLTEMLRKGCSPSVVTFNILINFLCRKGLLGRAI  237

Query  1265  RHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEKDCF----TYSSLVHGL  1098
               L      G   N +++N  + G CK  ++D A+   + M  + C+    TY++L+  L
Sbjct  238   DVLERMPKYGCTPNSLSYNPLLHGFCKEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLTAL  297

Query  1097  CKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELK  942
             C+ G+  VA E+L      G   +      VIDGL   G  + A KL  E++
Sbjct  298   CRDGKADVAVEILDQLSSRGCSPVLITYNTVIDGLSKVGKTESAIKLLHEMR  349


 Score =   112 bits (281),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 128/266 (48%), Gaps = 2/266 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M R     S    NI +  LC+   L +A  V+    + G   + ++YN L+  +C    
Sbjct  208   MLRKGCSPSVVTFNILINFLCRKGLLGRAIDVLERMPKYGCTPNSLSYNPLLHGFCKEKK  267

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +D     L  M   G  PD++TYN+L+ +  R G     +++L+++   G  P   +YNT
Sbjct  268   MDRAIEYLEIMVSRGCYPDIVTYNTLLTALCRDGKADVAVEILDQLSSRGCSPVLITYNT  327

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             ++  L ++GK + A +   ++    + P  +T++ L+ GLC  G  ++A+    EL+  G
Sbjct  328   VIDGLSKVGKTESAIKLLHEMREKGLQPDIITYSSLVGGLCREGKVDEAISFIHELEELG  387

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P  +TYN ++ GLC + +   A   L  +V  G  P   TYT +++         E L
Sbjct  388   IKPNAITYNAIMLGLCKARQTDRAIDFLAYMVSKGCKPTESTYTILIEGIAYEGLANEAL  447

Query  1580  QILEEMRRKGYIFDSFA--YCTVISF  1509
             ++L E+  +G +  S A     V+SF
Sbjct  448   ELLNELCSRGVVKRSSAEQVALVLSF  473



>ref|NP_001031033.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9LPX2.1|PPR39_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g12775, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF78482.1|AC012187_2 Contains similarity to an unknown protein F16M19.7 gi|6598837 
from Arabidopsis thaliana BAC F16M19 gb|AC010795 and contains 
multiple PPR PF|01535 repeats. EST gb|AI999079 comes from 
this gene [Arabidopsis thaliana]
 gb|AEE28927.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=644

 Score =   220 bits (560),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 118/416 (28%), Positives = 221/416 (53%), Gaps = 4/416 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             L+I + C C+ ++L  A + +   +++G   D V +NTL+   C    +     ++ RM 
Sbjct  126   LSIMINCFCRCRKLSYAFSTMGKIMKLGYEPDTVIFNTLLNGLCLECRVSEALELVDRMV  185

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             E+G KP +IT N+L+     +G +S  + L++ M+E G  P+  +Y  +++ + + G+  
Sbjct  186   EMGHKPTLITLNTLVNGLCLNGKVSDAVVLIDRMVETGFQPNEVTYGPVLNVMCKSGQTA  245

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A    + +   +I    V ++I++ GLC +G  + A  LF E++  GF   ++TYN LI
Sbjct  246   LAMELLRKMEERNIKLDAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIITYNTLI  305

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
              G CN+GRW    +LL +++    +PN +T++ ++    +  +  E  Q+L+EM ++G  
Sbjct  306   GGFCNAGRWDDGAKLLRDMIKRKISPNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIA  365

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              ++  Y ++I    K  R+++A   V  MI  G + D++ +N LIN YCK  ++D+   L
Sbjct  366   PNTITYNSLIDGFCKENRLEEAIQMVDLMISKGCDPDIMTFNILINGYCKANRIDDGLEL  425

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E   +G   +  T+  ++ G C++G ++ A +            ++V++   +DGLC 
Sbjct  426   FREMSLRGVIANTVTYNTLVQGFCQSGKLEVAKKLFQEMVSRRVRPDIVSYKILLDGLCD  485

Query  1184  VGEVDYALSVF----KSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKI  1029
              GE++ AL +F    KS  E D   Y  ++HG+C A +   A +L  S  + G+K+
Sbjct  486   NGELEKALEIFGKIEKSKMELDIGIYMIIIHGMCNASKVDDAWDLFCSLPLKGVKL  541


 Score =   181 bits (460),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 113/417 (27%), Positives = 210/417 (50%), Gaps = 4/417 (1%)
 Frame = -1

Query  2168  VVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLE  1989
             V+ +N L +A       +   ++  +M   GI   + T + +I    R   LS     + 
Sbjct  88    VIDFNRLFSAIAKTKQYELVLALCKQMESKGIAHSIYTLSIMINCFCRCRKLSYAFSTMG  147

Query  1988  EMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNG  1809
             +++++G  PDT  +NTL++ L    +  EA      +      P  +T N L++GLC+NG
Sbjct  148   KIMKLGYEPDTVIFNTLLNGLCLECRVSEALELVDRMVEMGHKPTLITLNTLVNGLCLNG  207

Query  1808  YTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYT  1629
                 A++L   +  +GF P  VTY  +++ +C SG+ A A  LL ++ +     +A+ Y+
Sbjct  208   KVSDAVVLIDRMVETGFQPNEVTYGPVLNVMCKSGQTALAMELLRKMEERNIKLDAVKYS  267

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
              I+    +    +    +  EM  KG+  D   Y T+I     AGR  D    + +MI  
Sbjct  268   IIIDGLCKDGSLDNAFNLFNEMEIKGFKADIITYNTLIGGFCNAGRWDDGAKLLRDMIKR  327

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
              I  ++V ++ LI+ + KEGKL  A  L+ E  ++G   +  T+  +IDG CK   ++EA
Sbjct  328   KISPNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIAPNTITYNSLIDGFCKENRLEEA  387

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHG  1101
             ++ ++     G D +++ FN  I+G CK   +D  L +F+ M  +    +  TY++LV G
Sbjct  388   IQMVDLMISKGCDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVIANTVTYNTLVQG  447

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
              C++G+  VA +L    +   ++      + ++DGL  +G +++A ++  +++ SK+
Sbjct  448   FCQSGKLEVAKKLFQEMVSRRVRPDIVSYKILLDGLCDNGELEKALEIFGKIEKSKM  504


 Score =   178 bits (452),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 116/449 (26%), Positives = 216/449 (48%), Gaps = 4/449 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
              N   + + K KQ E    +       G+   + T + +I  +C    +   +S + ++ 
Sbjct  91    FNRLFSAIAKTKQYELVLALCKQMESKGIAHSIYTLSIMINCFCRCRKLSYAFSTMGKIM  150

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             ++G +PD + +N+L+        +S  L+L++ M+E+G  P   + NTL++ L   GK  
Sbjct  151   KLGYEPDTVIFNTLLNGLCLECRVSEALELVDRMVEMGHKPTLITLNTLVNGLCLNGKVS  210

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             +A      +      P  VT+  +L+ +C +G T  A+ L R+++        V Y+I+I
Sbjct  211   DAVVLIDRMVETGFQPNEVTYGPVLNVMCKSGQTALAMELLRKMEERNIKLDAVKYSIII  270

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
              GLC  G    A  L NE+   G+  + ITY T++     + R+++G ++L +M ++   
Sbjct  271   DGLCKDGSLDNAFNLFNEMEIKGFKADIITYNTLIGGFCNAGRWDDGAKLLRDMIKRKIS  330

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              +   +  +I   +K G++++A   +  M+  GI  + + YN+LI+ +CKE +L+ A  +
Sbjct  331   PNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIAPNTITYNSLIDGFCKENRLEEAIQM  390

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
             V     KG D D  T  I+I+G CKA  + + L       L G  +N V +N  + G C+
Sbjct  391   VDLMISKGCDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVIANTVTYNTLVQGFCQ  450

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              G+++ A  +F+ M  +    D  +Y  L+ GLC  G    A E+        M++    
Sbjct  451   SGKLEVAKKLFQEMVSRRVRPDIVSYKILLDGLCDNGELEKALEIFGKIEKSKMELDIGI  510

Query  1016  RQAVIDGLQHSGFIQEARKLHSELKLSKI  930
                +I G+ ++  + +A  L   L L  +
Sbjct  511   YMIIIHGMCNASKVDDAWDLFCSLPLKGV  539


 Score =   173 bits (439),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/367 (29%), Positives = 183/367 (50%), Gaps = 1/367 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             +I +  LCK   L+ A  +  +    G  AD++TYNTLI  +C     D G  +L  M +
Sbjct  267   SIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIITYNTLIGGFCNAGRWDDGAKLLRDMIK  326

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               I P+V+T++ LI S  + G L     LL+EM++ GI P+T +YN+L+    +  + +E
Sbjct  327   RKISPNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIAPNTITYNSLIDGFCKENRLEE  386

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A +    +      P  +TFNIL++G C     +  L LFRE+   G I   VTYN L+ 
Sbjct  387   AIQMVDLMISKGCDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVIANTVTYNTLVQ  446

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G C SG+   A++L  E+V     P+ ++Y  ++     +   E+ L+I  ++ +     
Sbjct  447   GFCQSGKLEVAKKLFQEMVSRRVRPDIVSYKILLDGLCDNGELEKALEIFGKIEKSKMEL  506

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y  +I  +  A ++ DA+D   ++ + G++LD  AYN +I+  C++  L  A +L 
Sbjct  507   DIGIYMIIIHGMCNASKVDDAWDLFCSLPLKGVKLDARAYNIMISELCRKDSLSKADILF  566

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              +   +G   D+ T+ I+I       +   A   +   K  GF +++      I+ L   
Sbjct  567   RKMTEEGHAPDELTYNILIRAHLGDDDATTAAELIEEMKSSGFPADVSTVKMVINMLSS-  625

Query  1181  GEVDYAL  1161
             GE+D + 
Sbjct  626   GELDKSF  632


 Score =   167 bits (424),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/406 (26%), Positives = 188/406 (46%), Gaps = 4/406 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             LN  V  LC   ++  A  +I   +  G   + VTY  ++   C          +L +M 
Sbjct  196   LNTLVNGLCLNGKVSDAVVLIDRMVETGFQPNEVTYGPVLNVMCKSGQTALAMELLRKME  255

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             E  IK D + Y+ +I    + G L    +L  EM   G   D  +YNTL+      G+ D
Sbjct  256   ERNIKLDAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIITYNTLIGGFCNAGRWD  315

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             +  +  +D+    I P  VTF++L+      G   +A  L +E+   G  P  +TYN LI
Sbjct  316   DGAKLLRDMIKRKISPNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIAPNTITYNSLI  375

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
              G C   R   A ++++ ++  G +P+ +T+  ++    ++ R ++GL++  EM  +G I
Sbjct  376   DGFCKENRLEEAIQMVDLMISKGCDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVI  435

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              ++  Y T++    ++G+++ A      M+   +  D+V+Y  L++  C  G+L+ A  +
Sbjct  436   ANTVTYNTLVQGFCQSGKLEVAKKLFQEMVSRRVRPDIVSYKILLDGLCDNGELEKALEI  495

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               + E+   + D   + III G+C A  + +A        L G   +  A+N  I  LC+
Sbjct  496   FGKIEKSKMELDIGIYMIIIHGMCNASKVDDAWDLFCSLPLKGVKLDARAYNIMISELCR  555

Query  1184  VGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELL  1059
                +  A  +F+ M E+    D  TY+ L+           A+EL+
Sbjct  556   KDSLSKADILFRKMTEEGHAPDELTYNILIRAHLGDDDATTAAELI  601


 Score =   167 bits (422),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 104/398 (26%), Positives = 191/398 (48%), Gaps = 4/398 (1%)
 Frame = -1

Query  2273  TKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILH  2094
             T + N  +  LC   ++ +A  ++   + +G    ++T NTL+   C    +     ++ 
Sbjct  158   TVIFNTLLNGLCLECRVSEALELVDRMVEMGHKPTLITLNTLVNGLCLNGKVSDAVVLID  217

Query  2093  RMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLG  1914
             RM E G +P+ +TY  ++    + G  +  ++LL +M E  I  D   Y+ ++  L + G
Sbjct  218   RMVETGFQPNEVTYGPVLNVMCKSGQTALAMELLRKMEERNIKLDAVKYSIIIDGLCKDG  277

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
               D A+  F ++         +T+N L+ G C  G  +    L R++      P +VT++
Sbjct  278   SLDNAFNLFNEMEIKGFKADIITYNTLIGGFCNAGRWDDGAKLLRDMIKRKISPNVVTFS  337

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             +LI      G+   A +LL E++  G  PN ITY +++    +  R EE +Q+++ M  K
Sbjct  338   VLIDSFVKEGKLREADQLLKEMMQRGIAPNTITYNSLIDGFCKENRLEEAIQMVDLMISK  397

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
             G   D   +  +I+   KA R+ D  +    M + G+  + V YNTL+  +C+ GKL+ A
Sbjct  398   GCDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVIANTVTYNTLVQGFCQSGKLEVA  457

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               L  E   +    D  ++ I++DGLC  G +++AL      +    + ++  +   I G
Sbjct  458   KKLFQEMVSRRVRPDIVSYKILLDGLCDNGELEKALEIFGKIEKSKMELDIGIYMIIIHG  517

Query  1193  LCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCK  1092
             +C   +VD A  +F S+  K    D   Y+ ++  LC+
Sbjct  518   MCNASKVDDAWDLFCSLPLKGVKLDARAYNIMISELCR  555


 Score =   134 bits (337),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 152/320 (48%), Gaps = 4/320 (1%)
 Frame = -1

Query  1913  KPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYN  1734
             K D+A   F+D+      P  + FN L S +      E  L L ++++  G    + T +
Sbjct  68    KADDAVDLFRDMIQSRPLPTVIDFNRLFSAIAKTKQYELVLALCKQMESKGIAHSIYTLS  127

Query  1733  ILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRK  1554
             I+I+  C   + + A   + +++ +GY P+ + + T++       R  E L++++ M   
Sbjct  128   IMINCFCRCRKLSYAFSTMGKIMKLGYEPDTVIFNTLLNGLCLECRVSEALELVDRMVEM  187

Query  1553  GYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNA  1374
             G+        T+++ L   G++ DA   +  M+  G + + V Y  ++N+ CK G+   A
Sbjct  188   GHKPTLITLNTLVNGLCLNGKVSDAVVLIDRMVETGFQPNEVTYGPVLNVMCKSGQTALA  247

Query  1373  YMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDG  1194
               L+ + E +    D   ++IIIDGLCK G++  A    N  ++ GF ++++ +N  I G
Sbjct  248   MELLRKMEERNIKLDAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIITYNTLIGG  307

Query  1193  LCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKIL  1026
              C  G  D    + + M ++    +  T+S L+    K G+ R A +LL   +  G+   
Sbjct  308   FCNAGRWDDGAKLLRDMIKRKISPNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIAPN  367

Query  1025  KSDRQAVIDGLQHSGFIQEA  966
                  ++IDG      ++EA
Sbjct  368   TITYNSLIDGFCKENRLEEA  387


 Score =   124 bits (312),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/317 (26%), Positives = 154/317 (49%), Gaps = 3/317 (1%)
 Frame = -1

Query  2291  IKSRLSTKLLNITV--ACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGI  2118
             IK ++S  ++  +V      K  +L +A+ ++ + ++ G+  + +TYN+LI  +C    +
Sbjct  325   IKRKISPNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIAPNTITYNSLIDGFCKENRL  384

Query  2117  DAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTL  1938
             +    ++  M   G  PD++T+N LI    +   +   L+L  EM   G++ +T +YNTL
Sbjct  385   EEAIQMVDLMISKGCDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVIANTVTYNTL  444

Query  1937  MHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGF  1758
             +    + GK + A + FQ++    + P  V++ ILL GLC NG  EKAL +F +++ S  
Sbjct  445   VQGFCQSGKLEVAKKLFQEMVSRRVRPDIVSYKILLDGLCDNGELEKALEIFGKIEKSKM  504

Query  1757  IPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQ  1578
                +  Y I+IHG+CN+ +   A  L   L   G   +A  Y  ++    R     +   
Sbjct  505   ELDIGIYMIIIHGMCNASKVDDAWDLFCSLPLKGVKLDARAYNIMISELCRKDSLSKADI  564

Query  1577  ILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYC  1398
             +  +M  +G+  D   Y  +I   +       A + +  M  +G   D+     +IN+  
Sbjct  565   LFRKMTEEGHAPDELTYNILIRAHLGDDDATTAAELIEEMKSSGFPADVSTVKMVINML-  623

Query  1397  KEGKLDNAYMLVVEAER  1347
               G+LD +++ ++   R
Sbjct  624   SSGELDKSFLDMLSTTR  640


 Score =   101 bits (252),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 74/285 (26%), Positives = 127/285 (45%), Gaps = 1/285 (0%)
 Frame = -1

Query  2330  LRLGD*HLE*MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNT  2151
             LR  D  L+ M +     +T   N  +   CK  +LE+A  ++   I  G   D++T+N 
Sbjct  349   LREADQLLKEMMQRGIAPNTITYNSLIDGFCKENRLEEAIQMVDLMISKGCDPDIMTFNI  408

Query  2150  LITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVG  1971
             LI  YC    ID G  +   M+  G+  + +TYN+L+    + G L     L +EM+   
Sbjct  409   LINGYCKANRIDDGLELFREMSLRGVIANTVTYNTLVQGFCQSGKLEVAKKLFQEMVSRR  468

Query  1970  ILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKAL  1791
             + PD  SY  L+  L   G+ ++A   F  I    +      + I++ G+C     + A 
Sbjct  469   VRPDIVSYKILLDGLCDNGELEKALEIFGKIEKSKMELDIGIYMIIIHGMCNASKVDDAW  528

Query  1790  MLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCC  1611
              LF  L   G       YNI+I  LC     + A  L  ++ + G+ P+ +TY  +++  
Sbjct  529   DLFCSLPLKGVKLDARAYNIMISELCRKDSLSKADILFRKMTEEGHAPDELTYNILIRAH  588

Query  1610  FRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAY  1476
                       +++EEM+  G+  D      VI+ L  +G +  ++
Sbjct  589   LGDDDATTAAELIEEMKSSGFPADVSTVKMVINML-SSGELDKSF  632



>ref|XP_006382719.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP60516.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=688

 Score =   221 bits (562),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 131/447 (29%), Positives = 215/447 (48%), Gaps = 4/447 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCK + +  A   + + +  G+P D +TYN+++   CC   ++    +  RM +
Sbjct  237   NTIIDSLCKDRLVNDAMDFLSEMVGRGIPPDAITYNSIVHGLCCLGQLNEATRLFKRMEQ  296

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G KPDV+TYN +I S  +  +++   D L EM++ GI PD  +Y T++H L  LG+ +E
Sbjct  297   NGCKPDVVTYNIIIDSLYKDRLVNDAADFLSEMVDQGIPPDVVTYTTILHGLCYLGQLNE  356

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A R F+ +      P  V +N ++  LC +     A+    E+   G  P  VTY+ ++H
Sbjct  357   AIRLFKKMEQKGCKPDVVAYNTIIDSLCKDRLVNDAMEFLSEMVDRGIPPNAVTYSTILH  416

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G CN G+   A +L  E+V     PN +T++ ++    +     E   + E M  KG   
Sbjct  417   GFCNLGQLDEATQLFKEMVGRNVMPNTLTFSILVDGLCQEGMVSEARWVFETMTEKGVEP  476

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             + + Y  +++      +M +A      M+  G   DL +YN LIN YC   ++D A  L+
Sbjct  477   NIYTYNALMNGYCLRCKMNEARKVFEIMVGKGCAPDLHSYNILINGYCNSRRMDKAKALL  536

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              +   K    +  T+  I+ GLC  G + +A          G    L+ ++  ++GLCK 
Sbjct  537   TQMSVKKLTPNTVTYNTIMKGLCYVGRLLDAQELFKKMCSSGMLPTLMTYSILLNGLCKH  596

Query  1181  GEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G +D AL +FKSM EK    D   Y+ L+ G+   G+  VA  L       G++      
Sbjct  597   GHLDEALKLFKSMKEKKLEPDIILYTILIEGMFIGGKLEVAKGLFSKLSADGIQPPGRTY  656

Query  1013  QAVIDGLQHSGFIQEARKLHSELKLSK  933
               +I GL   G   EA +L  + K+ K
Sbjct  657   NVMIKGLLKEGLSDEAYELFRKWKMMK  683


 Score =   206 bits (525),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 131/450 (29%), Positives = 229/450 (51%), Gaps = 4/450 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             LNI + CLC+   ++ A +V     ++G+  DV+T+ TLI   C    I     + + M 
Sbjct  131   LNILINCLCRLNHVDFAVSVWGKMFKLGIQPDVITFTTLINGVCNEGKIKVAVELYNEMV  190

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
               G +PDVI+YN+LI      G  +  + + ++M + G  P+  +YNT++  L +    +
Sbjct  191   RSGHEPDVISYNTLINGLCNSGNTNMAVHVFKKMEQNGCKPNVVTYNTIIDSLCKDRLVN  250

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
             +A  F  ++    IPP  +T+N ++ GLC  G   +A  LF+ ++ +G  P +VTYNI+I
Sbjct  251   DAMDFLSEMVGRGIPPDAITYNSIVHGLCCLGQLNEATRLFKRMEQNGCKPDVVTYNIII  310

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
               L        A   L+E+VD G  P+ +TYTTI+       +  E +++ ++M +KG  
Sbjct  311   DSLYKDRLVNDAADFLSEMVDQGIPPDVVTYTTILHGLCYLGQLNEAIRLFKKMEQKGCK  370

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              D  AY T+I  L K   + DA + +  M+  GI  + V Y+T+++ +C  G+LD A  L
Sbjct  371   PDVVAYNTIIDSLCKDRLVNDAMEFLSEMVDRGIPPNAVTYSTILHGFCNLGQLDEATQL  430

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               E   +    +  T +I++DGLC+ G + EA          G + N+  +N  ++G C 
Sbjct  431   FKEMVGRNVMPNTLTFSILVDGLCQEGMVSEARWVFETMTEKGVEPNIYTYNALMNGYCL  490

Query  1184  VGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
               +++ A  VF+ M  K C     +Y+ L++G C + R   A  LL    +  +      
Sbjct  491   RCKMNEARKVFEIMVGKGCAPDLHSYNILINGYCNSRRMDKAKALLTQMSVKKLTPNTVT  550

Query  1016  RQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
                ++ GL + G + +A++L  ++  S +L
Sbjct  551   YNTIMKGLCYVGRLLDAQELFKKMCSSGML  580


 Score =   201 bits (510),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 123/461 (27%), Positives = 220/461 (48%), Gaps = 4/461 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             MF++  +         +  +C   +++ A  +  + +R G   DV++YNTLI   C    
Sbjct  154   MFKLGIQPDVITFTTLINGVCNEGKIKVAVELYNEMVRSGHEPDVISYNTLINGLCNSGN  213

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
              +    +  +M + G KP+V+TYN++I S  +  +++  +D L EM+  GI PD  +YN+
Sbjct  214   TNMAVHVFKKMEQNGCKPNVVTYNTIIDSLCKDRLVNDAMDFLSEMVGRGIPPDAITYNS  273

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             ++H L  LG+ +EA R F+ +      P  VT+NI++  L  +     A     E+   G
Sbjct  274   IVHGLCCLGQLNEATRLFKRMEQNGCKPDVVTYNIIIDSLYKDRLVNDAADFLSEMVDQG  333

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P +VTY  ++HGLC  G+   A RL  ++   G  P+ + Y TI+    + R   + +
Sbjct  334   IPPDVVTYTTILHGLCYLGQLNEAIRLFKKMEQKGCKPDVVAYNTIIDSLCKDRLVNDAM  393

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             + L EM  +G   ++  Y T++      G++ +A      M+   +  + + ++ L++  
Sbjct  394   EFLSEMVDRGIPPNAVTYSTILHGFCNLGQLDEATQLFKEMVGRNVMPNTLTFSILVDGL  453

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             C+EG +  A  +      KG + + YT+  +++G C    M EA +        G   +L
Sbjct  454   CQEGMVSEARWVFETMTEKGVEPNIYTYNALMNGYCLRCKMNEARKVFEIMVGKGCAPDL  513

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLS  1053
              ++N  I+G C    +D A ++   M  K    +  TY++++ GLC  GR   A EL   
Sbjct  514   HSYNILINGYCNSRRMDKAKALLTQMSVKKLTPNTVTYNTIMKGLCYVGRLLDAQELFKK  573

Query  1052  CIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
                 GM         +++GL   G + EA KL   +K  K+
Sbjct  574   MCSSGMLPTLMTYSILLNGLCKHGHLDEALKLFKSMKEKKL  614


 Score =   192 bits (487),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 127/461 (28%), Positives = 215/461 (47%), Gaps = 4/461 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M R+  R S       +  + K KQ      +       GV   V + N LI   C    
Sbjct  84    MARMNPRPSIVEFGKFLGSIAKMKQYSTVVYLCNQMDLFGVTHTVYSLNILINCLCRLNH  143

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +D   S+  +M ++GI+PDVIT+ +LI      G +   ++L  EM+  G  PD  SYNT
Sbjct  144   VDFAVSVWGKMFKLGIQPDVITFTTLINGVCNEGKIKVAVELYNEMVRSGHEPDVISYNT  203

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             L++ L   G  + A   F+ +      P  VT+N ++  LC +     A+    E+   G
Sbjct  204   LINGLCNSGNTNMAVHVFKKMEQNGCKPNVVTYNTIIDSLCKDRLVNDAMDFLSEMVGRG  263

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P  +TYN ++HGLC  G+   A RL   +   G  P+ +TY  I+   ++ R   +  
Sbjct  264   IPPDAITYNSIVHGLCCLGQLNEATRLFKRMEQNGCKPDVVTYNIIIDSLYKDRLVNDAA  323

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
               L EM  +G   D   Y T++  L   G++ +A      M   G + D+VAYNT+I+  
Sbjct  324   DFLSEMVDQGIPPDVVTYTTILHGLCYLGQLNEAIRLFKKMEQKGCKPDVVAYNTIIDSL  383

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             CK+  +++A   + E   +G   +  T++ I+ G C  G + EA +            N 
Sbjct  384   CKDRLVNDAMEFLSEMVDRGIPPNAVTYSTILHGFCNLGQLDEATQLFKEMVGRNVMPNT  443

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLS  1053
             + F+  +DGLC+ G V  A  VF++M EK    + +TY++L++G C   +   A ++   
Sbjct  444   LTFSILVDGLCQEGMVSEARWVFETMTEKGVEPNIYTYNALMNGYCLRCKMNEARKVFEI  503

Query  1052  CIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
              +  G          +I+G  +S  + +A+ L +++ + K+
Sbjct  504   MVGKGCAPDLHSYNILINGYCNSRRMDKAKALLTQMSVKKL  544


 Score =   186 bits (472),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 113/394 (29%), Positives = 196/394 (50%), Gaps = 8/394 (2%)
 Frame = -1

Query  2126  VGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSY  1947
             + +D   +  +RM  +  +P ++ +   + S  +    S  + L  +M   G+    +S 
Sbjct  72    ISVDDALASFYRMARMNPRPSIVEFGKFLGSIAKMKQYSTVVYLCNQMDLFGVTHTVYSL  131

Query  1946  NTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKH  1767
             N L++CL RL   D A   +  +F   I P  +TF  L++G+C  G  + A+ L+ E+  
Sbjct  132   NILINCLCRLNHVDFAVSVWGKMFKLGIQPDVITFTTLINGVCNEGKIKVAVELYNEMVR  191

Query  1766  SGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEE  1587
             SG  P +++YN LI+GLCNSG    A  +  ++   G  PN +TY TI+    + R   +
Sbjct  192   SGHEPDVISYNTLINGLCNSGNTNMAVHVFKKMEQNGCKPNVVTYNTIIDSLCKDRLVND  251

Query  1586  GLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
              +  L EM  +G   D+  Y +++  L   G++ +A      M  NG + D+V YN +I+
Sbjct  252   AMDFLSEMVGRGIPPDAITYNSIVHGLCCLGQLNEATRLFKRMEQNGCKPDVVTYNIIID  311

Query  1406  LYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDS  1227
                K+  +++A   + E   +G   D  T+T I+ GLC  G + EA+R     +  G   
Sbjct  312   SLYKDRLVNDAADFLSEMVDQGIPPDVVTYTTILHGLCYLGQLNEAIRLFKKMEQKGCKP  371

Query  1226  NLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELL  1059
             ++VA+N  ID LCK   V+ A+     M ++    +  TYS+++HG C  G+   A++L 
Sbjct  372   DVVAYNTIIDSLCKDRLVNDAMEFLSEMVDRGIPPNAVTYSTILHGFCNLGQLDEATQLF  431

Query  1058  LSCIIGGMKILKSDR--QAVIDGLQHSGFIQEAR  963
                +  G  ++ +      ++DGL   G + EAR
Sbjct  432   KEMV--GRNVMPNTLTFSILVDGLCQEGMVSEAR  463


 Score =   108 bits (271),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/239 (28%), Positives = 117/239 (49%), Gaps = 0/239 (0%)
 Frame = -1

Query  2276  STKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSIL  2097
             +T   +I V  LC+   + +A  V       GV  ++ TYN L+  YC    ++    + 
Sbjct  442   NTLTFSILVDGLCQEGMVSEARWVFETMTEKGVEPNIYTYNALMNGYCLRCKMNEARKVF  501

Query  2096  HRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRL  1917
               M   G  PD+ +YN LI        + +   LL +M    + P+T +YNT+M  L  +
Sbjct  502   EIMVGKGCAPDLHSYNILINGYCNSRRMDKAKALLTQMSVKKLTPNTVTYNTIMKGLCYV  561

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTY  1737
             G+  +A   F+ +    + P  +T++ILL+GLC +G+ ++AL LF+ +K     P ++ Y
Sbjct  562   GRLLDAQELFKKMCSSGMLPTLMTYSILLNGLCKHGHLDEALKLFKSMKEKKLEPDIILY  621

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
              ILI G+   G+   A+ L ++L   G  P   TY  ++K   +    +E  ++  + +
Sbjct  622   TILIEGMFIGGKLEVAKGLFSKLSADGIQPPGRTYNVMIKGLLKEGLSDEAYELFRKWK  680



>ref|XP_007018302.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
 gb|EOY15527.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
Length=606

 Score =   219 bits (557),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 127/437 (29%), Positives = 227/437 (52%), Gaps = 7/437 (2%)
 Frame = -1

Query  2243  LCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPD  2064
              CK  +  KA  V+      G   DV+TYN LI+ YC    ID    +L RM+   + PD
Sbjct  155   FCKKGKTRKATRVMEIIEDSGAVPDVITYNVLISGYCKAGEIDNALQVLDRMS---VAPD  211

Query  2063  VITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQ  1884
             V+TYN+++ S    G L + +++++  L+    PD  +Y  L+    +     +A +   
Sbjct  212   VVTYNTILRSLCDSGKLKQAMEVMDRQLQRECYPDVITYTILIEATCKESGVGQAMKLLD  271

Query  1883  DIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSG  1704
             ++      P  VT+N+L++G+C  G  ++A+     +   G  P ++T+NI++  +C++G
Sbjct  272   EMRSRGCKPDVVTYNVLVNGICKEGRLDEAIKFLNNMPSYGCQPNVITHNIILRSMCSTG  331

Query  1703  RWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYC  1524
             RW  A RLL +++  G +P+ +T+  ++    R       + ILE+M + G   +S +Y 
Sbjct  332   RWMDAERLLADMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYN  391

Query  1523  TVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERK  1344
              ++    K  +M+ A + +  M+  G   D+V YNTL+   CK+GK+D A  ++ +   K
Sbjct  392   PLLHGFCKEKKMERAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSTK  451

Query  1343  GFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYA  1164
             G      T+  +IDGL K G   +A++ L   +  G   +++ ++  + GL + G+VD A
Sbjct  452   GCSPVLITYNTVIDGLSKVGKTDQAIKLLEEMRAKGLKPDIITYSSLVGGLSREGKVDDA  511

Query  1163  LSVFKSMDE----KDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDG  996
             +  F   +      +  TY+S++ GLCKA +   A + L   ++ G K  +S    +I+G
Sbjct  512   IKFFHDFERMGIRPNAITYNSIMLGLCKARQTDRAIDFLAYMVMRGCKPTESTYTILIEG  571

Query  995   LQHSGFIQEARKLHSEL  945
             L + GF  EA +L +EL
Sbjct  572   LAYEGFANEALELLNEL  588


 Score =   192 bits (488),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 126/424 (30%), Positives = 213/424 (50%), Gaps = 8/424 (2%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N+ ++  CKA +++ A  V+    R+ V  DVVTYNT++ + C    +     ++ R  +
Sbjct  184   NVLISGYCKAGEIDNALQVLD---RMSVAPDVVTYNTILRSLCDSGKLKQAMEVMDRQLQ  240

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
                 PDVITY  LI +  +   + + + LL+EM   G  PD  +YN L++ + + G+ DE
Sbjct  241   RECYPDVITYTILIEATCKESGVGQAMKLLDEMRSRGCKPDVVTYNVLVNGICKEGRLDE  300

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A +F  ++      P  +T NI+L  +C  G    A  L  ++   G  P +VT+NILI+
Sbjct  301   AIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWMDAERLLADMLRKGCSPSVVTFNILIN  360

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LC  G    A  +L ++   G  PN+++Y  ++    + ++ E  ++ LE M  +G   
Sbjct  361   FLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMERAIEYLEIMVSRGCYP  420

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D   Y T+++ L K G++  A + +  +   G    L+ YNT+I+   K GK D A  L+
Sbjct  421   DIVTYNTLLTALCKDGKVDVAVEILNQLSTKGCSPVLITYNTVIDGLSKVGKTDQAIKLL  480

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E   KG   D  T++ ++ GL + G + +A++  +  + MG   N + +N  + GLCK 
Sbjct  481   EEMRAKGLKPDIITYSSLVGGLSREGKVDDAIKFFHDFERMGIRPNAITYNSIMLGLCKA  540

Query  1181  GEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLS-CIIGGMKILKSD  1017
              + D A+     M  + C     TY+ L+ GL   G    A ELL   C  G +K   ++
Sbjct  541   RQTDRAIDFLAYMVMRGCKPTESTYTILIEGLAYEGFANEALELLNELCSRGVVKKSSAE  600

Query  1016  RQAV  1005
             + AV
Sbjct  601   QVAV  604


 Score =   159 bits (402),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/390 (28%), Positives = 188/390 (48%), Gaps = 14/390 (4%)
 Frame = -1

Query  2099  LHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFR  1920
             LH   E G        N+ +    R+G L     LLE M+  G +PD  +  +L+    +
Sbjct  105   LHNFEESG-------SNNQLRKFVRNGELEEGFKLLEGMVYHGEIPDIIACTSLIRGFCK  157

Query  1919  LGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
              GK  +A R  + I      P  +T+N+L+SG C  G  + AL +   L      P +VT
Sbjct  158   KGKTRKATRVMEIIEDSGAVPDVITYNVLISGYCKAGEIDNALQV---LDRMSVAPDVVT  214

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
             YN ++  LC+SG+   A  +++  +     P+ ITYT +++   +     + +++L+EMR
Sbjct  215   YNTILRSLCDSGKLKQAMEVMDRQLQRECYPDVITYTILIEATCKESGVGQAMKLLDEMR  274

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLD  1380
              +G   D   Y  +++ + K GR+ +A   + NM   G + +++ +N ++   C  G+  
Sbjct  275   SRGCKPDVVTYNVLVNGICKEGRLDEAIKFLNNMPSYGCQPNVITHNIILRSMCSTGRWM  334

Query  1379  NAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCI  1200
             +A  L+ +  RKG      T  I+I+ LC+ G +  A+  L      G   N +++N  +
Sbjct  335   DAERLLADMLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLL  394

Query  1199  DGLCKVGEVDYALSVFKSMDEKDCF----TYSSLVHGLCKAGRFRVASELLLSCIIGGMK  1032
              G CK  +++ A+   + M  + C+    TY++L+  LCK G+  VA E+L      G  
Sbjct  395   HGFCKEKKMERAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSTKGCS  454

Query  1031  ILKSDRQAVIDGLQHSGFIQEARKLHSELK  942
              +      VIDGL   G   +A KL  E++
Sbjct  455   PVLITYNTVIDGLSKVGKTDQAIKLLEEMR  484


 Score =   107 bits (267),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/257 (26%), Positives = 124/257 (48%), Gaps = 0/257 (0%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             M R     S    NI +  LC+   L +A  ++    + G   + ++YN L+  +C    
Sbjct  343   MLRKGCSPSVVTFNILINFLCRKGLLGRAIDILEKMPKHGCTPNSLSYNPLLHGFCKEKK  402

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             ++     L  M   G  PD++TYN+L+ +  + G +   +++L ++   G  P   +YNT
Sbjct  403   MERAIEYLEIMVSRGCYPDIVTYNTLLTALCKDGKVDVAVEILNQLSTKGCSPVLITYNT  462

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             ++  L ++GK D+A +  +++    + P  +T++ L+ GL   G  + A+  F + +  G
Sbjct  463   VIDGLSKVGKTDQAIKLLEEMRAKGLKPDIITYSSLVGGLSREGKVDDAIKFFHDFERMG  522

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P  +TYN ++ GLC + +   A   L  +V  G  P   TYT +++         E L
Sbjct  523   IRPNAITYNSIMLGLCKARQTDRAIDFLAYMVMRGCKPTESTYTILIEGLAYEGFANEAL  582

Query  1580  QILEEMRRKGYIFDSFA  1530
             ++L E+  +G +  S A
Sbjct  583   ELLNELCSRGVVKKSSA  599



>ref|XP_008362682.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like 
[Malus domestica]
 ref|XP_008362683.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like 
[Malus domestica]
 ref|XP_008362684.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like 
[Malus domestica]
Length=772

 Score =   221 bits (564),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 131/467 (28%), Positives = 230/467 (49%), Gaps = 40/467 (9%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  LCK  QL +A  +++D    G+  +  T+N L+  YC    +     ++  M +
Sbjct  241   NTILNWLCKKGQLSEARDLLLDMKNRGLFPNRNTFNILVCGYCKMGWLKEAMQVIELMTQ  300

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
               + PD+ TYN LI    R G +   L L  EM  + ++PD  +YNTL+   F      E
Sbjct  301   NSLLPDIWTYNVLIKGLCREGRIEEALRLRVEMENLRLMPDVVTYNTLIDGYFEWSSDSE  360

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A++  +D+    +    VT+NI++   C  G  ++A    R+++  GF P  VTYN LI+
Sbjct  361   AFKLVEDMHEKGVKANAVTYNIIVKWFCKEGKLDEASDTIRKMEEDGFAPDCVTYNTLIN  420

Query  1721  GLCNSGRWAPARRLLNEL------VDI-----------------------------GYNP  1647
               C +G+ A A +++N++      +DI                             GY  
Sbjct  421   EYCKAGKMAEAFKMMNKMGTKGLKMDIFTLNTLLYTLCSEKKLDEAFZLLRTATKRGYIL  480

Query  1646  NAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCV  1467
             + ++Y T++  CF++ +  +G ++ +EM+ K  +     Y T+I  L ++G+   A+D +
Sbjct  481   DEVSYGTLITGCFKNEKANKGFKLWDEMKEKQVVPSIVTYNTIIGGLCQSGKTDQAFDKL  540

Query  1466  GNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKA  1287
               ++  G+  D + YNT+I+ YC+EG ++ A+    +   K F  D YT  I++ GLC+ 
Sbjct  541   NELLERGLVPDGITYNTIIHGYCREGNVEKAFQFHNKMVEKSFKPDVYTCNILLCGLCRE  600

Query  1286  GNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTY  1119
             G +++AL+  N     G D + V +N  I  LCK G  D   ++F  M+EK    D +TY
Sbjct  601   GMLEKALKLFNTWISKGKDIDAVTYNTLISSLCKEGRFDDVFALFSEMEEKKLAPDQYTY  660

Query  1118  SSLVHGLCKAGRFRVASELLLSCI-IGGMKILKSDRQAVIDGLQHSG  981
             ++++  L   GR + A E +L  I +G +     + + V +G+  S 
Sbjct  661   TAILGALTDTGRIKEAEEFILKMIDMGKLPDWPPELEKVKNGVAESS  707


 Score =   186 bits (471),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 122/453 (27%), Positives = 215/453 (47%), Gaps = 7/453 (2%)
 Frame = -1

Query  2282  RLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITA---YCCFVGIDA  2112
             + S  LL+ ++    ++ +   A  V     R+ +  +++T NTLI     Y     I  
Sbjct  126   KPSKALLDTSIGAYVESGKPHLAAQVFDKMKRLRLQPNLLTCNTLINGLVRYRSSQSISL  185

Query  2111  GYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMH  1932
                +     E+G+K +  T+N LI            ++LL  M E    PD  SYNT+++
Sbjct  186   SRGVFKHAVELGVKVNTNTFNILICGYCLEHKFRDAVELLXRMSEFRCXPDNVSYNTILN  245

Query  1931  CLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIP  1752
              L + G+  EA     D+    + P   TFNIL+ G C  G+ ++A+ +   +  +  +P
Sbjct  246   WLCKKGQLSEARDLLLDMKNRGLFPNRNTFNILVCGYCKMGWLKEAMQVIELMTQNSLLP  305

Query  1751  QLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQIL  1572
              + TYN+LI GLC  GR   A RL  E+ ++   P+ +TY T++   F      E  +++
Sbjct  306   DIWTYNVLIKGLCREGRIEEALRLRVEMENLRLMPDVVTYNTLIDGYFEWSSDSEAFKLV  365

Query  1571  EEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKE  1392
             E+M  KG   ++  Y  ++ +  K G++ +A D +  M  +G   D V YNTLIN YCK 
Sbjct  366   EDMHEKGVKANAVTYNIIVKWFCKEGKLDEASDTIRKMEEDGFAPDCVTYNTLINEYCKA  425

Query  1391  GKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAF  1212
             GK+  A+ ++ +   KG   D +T   ++  LC    + EA   L      G+  + V++
Sbjct  426   GKMAEAFKMMNKMGTKGLKMDIFTLNTLLYTLCSEKKLDEAFZLLRTATKRGYILDEVSY  485

Query  1211  NCCIDGLCKVGEVDYALSVFKSMDEKDC----FTYSSLVHGLCKAGRFRVASELLLSCII  1044
                I G  K  + +    ++  M EK       TY++++ GLC++G+   A + L   + 
Sbjct  486   GTLITGCFKNEKANKGFKLWDEMKEKQVVPSIVTYNTIIGGLCQSGKTDQAFDKLNELLE  545

Query  1043  GGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
              G+         +I G    G +++A + H+++
Sbjct  546   RGLVPDGITYNTIIHGYCREGNVEKAFQFHNKM  578


 Score =   141 bits (355),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 102/352 (29%), Positives = 164/352 (47%), Gaps = 38/352 (11%)
 Frame = -1

Query  2297  FRIKSRLSTK-------LLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITA  2139
             F++ +++ TK        LN  +  LC  K+L++A  ++    + G   D V+Y TLIT 
Sbjct  432   FKMMNKMGTKGLKMDIFTLNTLLYTLCSEKKLDEAFZLLRTATKRGYILDEVSYGTLITG  491

Query  2138  YCCFVGIDA--GYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGIL  1965
               CF    A  G+ +   M E  + P ++TYN++I    + G   +  D L E+LE G++
Sbjct  492   --CFKNEKANKGFKLWDEMKEKQVVPSIVTYNTIIGGLCQSGKTDQAFDKLNELLERGLV  549

Query  1964  PDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALML  1785
             PD  +YNT++H   R G  ++A++F   +      P   T NILL GLC  G  EKAL L
Sbjct  550   PDGITYNTIIHGYCREGNVEKAFQFHNKMVEKSFKPDVYTCNILLCGLCREGMLEKALKL  609

Query  1784  FRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFR  1605
             F      G     VTYN LI  LC  GR+     L +E+ +    P+  TYT I+     
Sbjct  610   FNTWISKGKDIDAVTYNTLISSLCKEGRFDDVFALFSEMEEKKLAPDQYTYTAILGALTD  669

Query  1604  SRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVA  1425
             + R +E  + + +M                   I  G++ D +      + NG+    V 
Sbjct  670   TGRIKEAEEFILKM-------------------IDMGKLPD-WPPELEKVKNGVAESSVE  709

Query  1424  YNTLINLY-------CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCK  1290
             Y++    Y       C +GK  +A  ++ E+ +KG   +K  +  +++GL K
Sbjct  710   YDSSTGAYSEKXIECCFQGKYKDAMHILEESMQKGMTLNKDVYINLMNGLIK  761


 Score =   122 bits (307),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 101/404 (25%), Positives = 184/404 (46%), Gaps = 15/404 (4%)
 Frame = -1

Query  2099  LHRM----NEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMH  1932
             LHR+    +    KP     ++ I +    G       + ++M  + + P+  + NTL++
Sbjct  113   LHRLILHPDPTVPKPSKALLDTSIGAYVESGKPHLAAQVFDKMKRLRLQPNLLTCNTLIN  172

Query  1931  CLFRLGKPDEAYRFFQDIFWG----DIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHS  1764
              L R  +  ++    + +F       +     TFNIL+ G C+      A+ L   +   
Sbjct  173   GLVRY-RSSQSISLSRGVFKHAVELGVKVNTNTFNILICGYCLEHKFRDAVELLXRMSEF  231

Query  1763  GFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCF-RSRRFEE  1587
                P  V+YN +++ LC  G+ + AR LL ++ + G  PN  T+  I+ C + +    +E
Sbjct  232   RCXPDNVSYNTILNWLCKKGQLSEARDLLLDMKNRGLFPNRNTFN-ILVCGYCKMGWLKE  290

Query  1586  GLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
              +Q++E M +   + D + Y  +I  L + GR+++A      M    +  D+V YNTLI+
Sbjct  291   AMQVIELMTQNSLLPDIWTYNVLIKGLCREGRIEEALRLRVEMENLRLMPDVVTYNTLID  350

Query  1406  LYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDS  1227
              Y +      A+ LV +   KG   +  T+ II+   CK G + EA   +   +  GF  
Sbjct  351   GYFEWSSDSEAFKLVEDMHEKGVKANAVTYNIIVKWFCKEGKLDEASDTIRKMEEDGFAP  410

Query  1226  NLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELL  1059
             + V +N  I+  CK G++  A  +   M  K    D FT ++L++ LC   +   A +LL
Sbjct  411   DCVTYNTLINEYCKAGKMAEAFKMMNKMGTKGLKMDIFTLNTLLYTLCSEKKLDEAFZLL  470

Query  1058  LSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
              +    G  + +     +I G   +    +  KL  E+K  +++
Sbjct  471   RTATKRGYILDEVSYGTLITGCFKNEKANKGFKLWDEMKEKQVV  514



>ref|XP_008797845.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, 
mitochondrial [Phoenix dactylifera]
Length=639

 Score =   219 bits (559),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 134/405 (33%), Positives = 205/405 (51%), Gaps = 4/405 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             MFR++   S    NI +  LCK  +L+KA+  I      GV   VVTYNT+I  +C    
Sbjct  223   MFRMRIPSSVVTFNIMINVLCKEGKLKKAKAFIQFMESSGVRPTVVTYNTIIHGHCSREK  282

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             +  G  +L  M E GIKPD  TY +LI+   + G +     + ++MLE G++P   +YN 
Sbjct  283   VQMGLEMLDVMKEKGIKPDAYTYGTLISGMCKEGRVEDASVMFDDMLERGLIPCAVNYNA  342

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             L+      GK D A+R+  ++    I P   T+N+L+  L M G  E+A  L +E++  G
Sbjct  343   LIDGYCNKGKLDVAFRYRDEMGRKGIEPTVCTYNLLVHALFMEGRNEEANALIKEMEAKG  402

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P  +TYNILI+G C  G    A  +  E+   G  P  +TYT+++    +  R  E  
Sbjct  403   MAPDAITYNILINGYCKEGNVKKAFDVFEEMSRKGVRPTMVTYTSLIYVLCKRSRVTEAD  462

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             ++ +E+  KG   D   Y  +I      G M+ A+  +  M    +  D V YNTL+   
Sbjct  463   RMFKEVTEKGLYPDLVMYNALIDGHCANGNMERAFQLLKEMESKKLAPDEVTYNTLMRGL  522

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             C  G+++ A  L+ E  R+G   D  ++  +I G  + G++K+A +  +     GF+  L
Sbjct  523   CLLGEVEEARKLIDEMSRQGIKPDLISYNTLISGYSRRGDVKDAFKVRDEMLSKGFNPTL  582

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGL  1098
             + +N  I GLCK GE D+A  + K M  K    D  TY SL+ GL
Sbjct  583   LTYNALIQGLCKNGEGDHAEGLLKEMVNKGITPDDSTYISLIEGL  627


 Score =   214 bits (546),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 128/429 (30%), Positives = 212/429 (49%), Gaps = 4/429 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  ++   K+ Q EKA  +  +  R+ +P+ VVT+N +I   C    +    + +  M  
Sbjct  201   NCLLSAFLKSHQTEKAWVLYAEMFRMRIPSSVVTFNIMINVLCKEGKLKKAKAFIQFMES  260

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G++P V+TYN++I        +   L++L+ M E GI PD ++Y TL+  + + G+ ++
Sbjct  261   SGVRPTVVTYNTIIHGHCSREKVQMGLEMLDVMKEKGIKPDAYTYGTLISGMCKEGRVED  320

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A   F D+    + PC V +N L+ G C  G  + A     E+   G  P + TYN+L+H
Sbjct  321   ASVMFDDMLERGLIPCAVNYNALIDGYCNKGKLDVAFRYRDEMGRKGIEPTVCTYNLLVH  380

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              L   GR   A  L+ E+   G  P+AITY  ++    +    ++   + EEM RKG   
Sbjct  381   ALFMEGRNEEANALIKEMEAKGMAPDAITYNILINGYCKEGNVKKAFDVFEEMSRKGVRP  440

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
                 Y ++I  L K  R+ +A      +   G+  DLV YN LI+ +C  G ++ A+ L+
Sbjct  441   TMVTYTSLIYVLCKRSRVTEADRMFKEVTEKGLYPDLVMYNALIDGHCANGNMERAFQLL  500

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E E K    D+ T+  ++ GLC  G ++EA + ++     G   +L+++N  I G  + 
Sbjct  501   KEMESKKLAPDEVTYNTLMRGLCLLGEVEEARKLIDEMSRQGIKPDLISYNTLISGYSRR  560

Query  1181  GEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G+V  A  V   M  K       TY++L+ GLCK G    A  LL   +  G+    S  
Sbjct  561   GDVKDAFKVRDEMLSKGFNPTLLTYNALIQGLCKNGEGDHAEGLLKEMVNKGITPDDSTY  620

Query  1013  QAVIDGLQH  987
              ++I+GL +
Sbjct  621   ISLIEGLSN  629


 Score =   166 bits (420),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 141/534 (26%), Positives = 229/534 (43%), Gaps = 38/534 (7%)
 Frame = -1

Query  2429  ADMFVCYLRRSQSS------PRL-PLAASALQLATRTCPMLRLGD*HLE*MFRIK-SRLS  2274
             AD  V  + RSQ +      P L P   SA+ L  R  P     D  L  + R+   RL 
Sbjct  52    ADSIVASVLRSQWTSLDTLLPTLSPPLVSAVLLHLRRYP-----DIILPFLHRLGLHRLD  106

Query  2273  TKLLNITVACLCKAKQLEKAETVIIDGIRVG-------------------VPADV-VTYN  2154
              + L+I  + LC  +    A  ++ + I  G                    P+   + ++
Sbjct  107   LRSLSIAASLLCSLRPPNPAFNLLKEAIATGRFDSSQKFFNALVVAGEELKPSKPQLVFD  166

Query  2153  TLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEV  1974
              L+ AY     I     + + M +    P + + N L+++  +     +   L  EM  +
Sbjct  167   LLLRAYLDSGQIQEALDVFYLMKDANFLPKIESCNCLLSAFLKSHQTEKAWVLYAEMFRM  226

Query  1973  GILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKA  1794
              I     ++N +++ L + GK  +A  F Q +    + P  VT+N ++ G C     +  
Sbjct  227   RIPSSVVTFNIMINVLCKEGKLKKAKAFIQFMESSGVRPTVVTYNTIIHGHCSREKVQMG  286

Query  1793  LMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKC  1614
             L +   +K  G  P   TY  LI G+C  GR   A  + +++++ G  P A+ Y  ++  
Sbjct  287   LEMLDVMKEKGIKPDAYTYGTLISGMCKEGRVEDASVMFDDMLERGLIPCAVNYNALIDG  346

Query  1613  CFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELD  1434
                  + +   +  +EM RKG       Y  ++  L   GR ++A   +  M   G+  D
Sbjct  347   YCNKGKLDVAFRYRDEMGRKGIEPTVCTYNLLVHALFMEGRNEEANALIKEMEAKGMAPD  406

Query  1433  LVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLN  1254
              + YN LIN YCKEG +  A+ +  E  RKG      T+T +I  LCK   + EA R   
Sbjct  407   AITYNILINGYCKEGNVKKAFDVFEEMSRKGVRPTMVTYTSLIYVLCKRSRVTEADRMFK  466

Query  1253  CTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAG  1086
                  G   +LV +N  IDG C  G ++ A  + K M+ K    D  TY++L+ GLC  G
Sbjct  467   EVTEKGLYPDLVMYNALIDGHCANGNMERAFQLLKEMESKKLAPDEVTYNTLMRGLCLLG  526

Query  1085  RFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKILN  924
                 A +L+      G+K        +I G    G +++A K+  E+ LSK  N
Sbjct  527   EVEEARKLIDEMSRQGIKPDLISYNTLISGYSRRGDVKDAFKVRDEM-LSKGFN  579



>ref|XP_010930804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12775, 
mitochondrial-like [Elaeis guineensis]
Length=554

 Score =   218 bits (554),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 157/516 (30%), Positives = 252/516 (49%), Gaps = 19/516 (4%)
 Frame = -1

Query  2480  LLSHINLLNSPAGQPSPADMFVCYLRRSQSSPRLPLAASALQLATRTCPMLRLGD*HLE*  2301
             L SH++  + PA         V  LR S  SP  P  AS++ L        R  +  +  
Sbjct  43    LRSHLDSGDVPAA--------VSLLRHSFYSPLAPPPASSVNLVFSHLSKSRQFESVISL  94

Query  2300  MFRIK-SRLSTKL--LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCC  2130
                ++ S  S  L  LNI + C C+ ++L+ A  V  +        DVV++NTLI  +C 
Sbjct  95    YHSLRESGFSADLVSLNILIHCYCQTRRLDFAFKVFDEIRERSYAPDVVSFNTLIKGFCN  154

Query  2129  FVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRC-LDLLEEMLEVGILPDTW  1953
                +   + +L  M E G  P+V TY+ LI   +R    S   L L+ EML++G+ P   
Sbjct  155   ENRVSDAFKVLREMRENGPSPNVYTYSMLIGLVSRGCSNSELGLGLIREMLQLGLEPSMV  214

Query  1952  SYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFREL  1773
             + N ++  L +  K + A   +  +    I    V++   L  LC      +A MLF E+
Sbjct  215   NCNCVLTALSKQFKINAAKALYGRMSKSGIVGDVVSYTCFLDVLCRKRMIMEAKMLFSEM  274

Query  1772  KHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRF  1593
                G  P +VTYN +IHGLC +G+   A  +L+++V  G  PN +TYTT++    R  + 
Sbjct  275   PDKGVAPNVVTYNTMIHGLCANGQGNNAMGMLDQMVIHGLRPNIVTYTTVIDGLCRYGKL  334

Query  1592  EEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTL  1413
             EE L +L+ MR++G   D   Y T+++ L K GR+++A      +   G   D+ +YN+L
Sbjct  335   EETLNLLDVMRQQGLEPDKQMYGTLLNGLCKGGRVENALKLFREIEAIGFN-DIASYNSL  393

Query  1412  INLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF  1233
             I+ +CK GK++ A  L  E   KGF  D   +T ++DG CK G ++ A   +   +  G 
Sbjct  394   ISGFCKLGKMEEANKLFEEIMEKGFKPDVVMYTTLMDGFCKVGKVEAAQGLIGAMERQGL  453

Query  1232  DSNLVAFNCCIDGLCKVGEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASE  1065
               +L+ ++  +DG C + + D A  +   M+    E +   ++ LV+GLCKAG F  A  
Sbjct  454   KPDLITYSTMVDGFCDIEQFDAAEELLCDMERHGLEPNSVIFNKLVYGLCKAGNFGRAEY  513

Query  1064  LLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
              L      G ++       + +G   +G  Q+A KL
Sbjct  514   YLEEMSRKGQQVNAKTHHILSNG--RAGRFQDAEKL  547


 Score =   115 bits (289),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/331 (25%), Positives = 152/331 (46%), Gaps = 6/331 (2%)
 Frame = -1

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVT-FNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVT  1740
             G    A    +  F+  + P P +  N++ S L  +   E  + L+  L+ SGF   LV+
Sbjct  50    GDVPAAVSLLRHSFYSPLAPPPASSVNLVFSHLSKSRQFESVISLYHSLRESGFSADLVS  109

Query  1739  YNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMR  1560
              NILIH  C + R   A ++ +E+ +  Y P+ +++ T++K      R  +  ++L EMR
Sbjct  110   LNILIHCYCQTRRLDFAFKVFDEIRERSYAPDVVSFNTLIKGFCNENRVSDAFKVLREMR  169

Query  1559  RKGYIFDSFAYCTVISFLIKAGRMKD-AYDCVGNMIMNGIELDLVAYNTLINLYCKEGKL  1383
               G   + + Y  +I  + +     +     +  M+  G+E  +V  N ++    K+ K+
Sbjct  170   ENGPSPNVYTYSMLIGLVSRGCSNSELGLGLIREMLQLGLEPSMVNCNCVLTALSKQFKI  229

Query  1382  DNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCC  1203
             + A  L     + G   D  ++T  +D LC+   + EA    +     G   N+V +N  
Sbjct  230   NAAKALYGRMSKSGIVGDVVSYTCFLDVLCRKRMIMEAKMLFSEMPDKGVAPNVVTYNTM  289

Query  1202  IDGLCKVGEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGM  1035
             I GLC  G+ + A+ +   M       +  TY++++ GLC+ G+      LL      G+
Sbjct  290   IHGLCANGQGNNAMGMLDQMVIHGLRPNIVTYTTVIDGLCRYGKLEETLNLLDVMRQQGL  349

Query  1034  KILKSDRQAVIDGLQHSGFIQEARKLHSELK  942
             +  K     +++GL   G ++ A KL  E++
Sbjct  350   EPDKQMYGTLLNGLCKGGRVENALKLFREIE  380



>ref|XP_010548044.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, 
mitochondrial [Tarenaya hassleriana]
Length=636

 Score =   219 bits (558),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/405 (32%), Positives = 212/405 (52%), Gaps = 4/405 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             MFR++ + S    NI +  LCK  +L+KA+  I     +G+   +V+YNTL+ AYC    
Sbjct  220   MFRMEIKSSLYTYNIMINTLCKEGKLKKAKEFIGCMESLGIKPSIVSYNTLVQAYCFRGR  279

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
             ID    +++ M   G KPD+ TYNSL+    R G L    +LL EM E+G+ PD  SYNT
Sbjct  280   IDGARMVMNEMKFKGCKPDLFTYNSLLGGMCRAGKLVEASELLREMKEMGLNPDVVSYNT  339

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             L++     G  + A+ +  ++          T+N+L++GLCM    E+A  + +E++  G
Sbjct  340   LINGHINKGDLEMAFAYGDEMVKEGNTLTVYTYNVLINGLCMENKMEQAERMIKEMRKKG  399

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
              +P  VTYN LI G C  G    A    +E+V  G  P  +TYT ++       R +E  
Sbjct  400   MVPDSVTYNTLIIGHCRCGDAKKALAFHDEMVIYGIQPTLVTYTALICTLGNRNRMKEAD  459

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
             ++ EE+ RKG   D   +  ++    + G M+ A+  +  M    ++ D V +N L+  +
Sbjct  460   ELFEEVLRKGMKPDLILFNALVGCHCRIGNMERAFSLLKEMEKTKVDPDEVTFNCLMYGF  519

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             C+EGK++ A  L+ E +R+G + D  ++  +I G  K G++ +A +  N    +GFD  +
Sbjct  520   CREGKVEKARELIDEMKRRGIEPDHISYNTLISGYSKRGDINDARKVHNEMLSIGFDPTV  579

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGL  1098
             + +N  I GL K  + D A  +F+ M  K    +  TY SL+  +
Sbjct  580   LTYNALIRGLSKTRDGDLAEELFREMVSKGITPNDSTYCSLIEAM  624


 Score =   162 bits (410),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 128/458 (28%), Positives = 207/458 (45%), Gaps = 13/458 (3%)
 Frame = -1

Query  2294  RIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRV----GVPADVVTYNTLITAYCCF  2127
             R+K++ ST LL+  V C C+    ++A    ++G  +    G    + T N++++     
Sbjct  153   RLKTK-STILLDYLVKCFCELGMADEA----VEGFYMMKGKGFVPKIQTCNSILSLLSRL  207

Query  2126  VGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSY  1947
                +A + I   M  + IK  + TYN +I +  + G L +  + +  M  +GI P   SY
Sbjct  208   NRTEAAWVIYAEMFRMEIKSSLYTYNIMINTLCKEGKLKKAKEFIGCMESLGIKPSIVSY  267

Query  1946  NTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKH  1767
             NTL+      G+ D A     ++ +    P   T+N LL G+C  G   +A  L RE+K 
Sbjct  268   NTLVQAYCFRGRIDGARMVMNEMKFKGCKPDLFTYNSLLGGMCRAGKLVEASELLREMKE  327

Query  1766  SGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEE  1587
              G  P +V+YN LI+G  N G    A    +E+V  G      TY  ++       + E+
Sbjct  328   MGLNPDVVSYNTLINGHINKGDLEMAFAYGDEMVKEGNTLTVYTYNVLINGLCMENKMEQ  387

Query  1586  GLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLIN  1407
               ++++EMR+KG + DS  Y T+I    + G  K A      M++ GI+  LV Y  LI 
Sbjct  388   AERMIKEMRKKGMVPDSVTYNTLIIGHCRCGDAKKALAFHDEMVIYGIQPTLVTYTALIC  447

Query  1406  LYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDS  1227
                   ++  A  L  E  RKG   D      ++   C+ GNM+ A   L   +    D 
Sbjct  448   TLGNRNRMKEADELFEEVLRKGMKPDLILFNALVGCHCRIGNMERAFSLLKEMEKTKVDP  507

Query  1226  NLVAFNCCIDGLCKVGEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELL  1059
             + V FNC + G C+ G+V+ A  +   M     E D  +Y++L+ G  K G    A ++ 
Sbjct  508   DEVTFNCLMYGFCREGKVEKARELIDEMKRRGIEPDHISYNTLISGYSKRGDINDARKVH  567

Query  1058  LSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
                +  G         A+I GL  +     A +L  E+
Sbjct  568   NEMLSIGFDPTVLTYNALIRGLSKTRDGDLAEELFREM  605


 Score =   131 bits (329),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 93/332 (28%), Positives = 158/332 (48%), Gaps = 4/332 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  +  +C+A +L +A  ++ +   +G+  DVV+YNTLI  +     ++  ++    M +
Sbjct  303   NSLLGGMCRAGKLVEASELLREMKEMGLNPDVVSYNTLINGHINKGDLEMAFAYGDEMVK  362

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLM--HCLFRLGKP  1908
              G    V TYN LI        + +   +++EM + G++PD+ +YNTL+  HC  R G  
Sbjct  363   EGNTLTVYTYNVLINGLCMENKMEQAERMIKEMRKKGMVPDSVTYNTLIIGHC--RCGDA  420

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
              +A  F  ++    I P  VT+  L+  L      ++A  LF E+   G  P L+ +N L
Sbjct  421   KKALAFHDEMVIYGIQPTLVTYTALICTLGNRNRMKEADELFEEVLRKGMKPDLILFNAL  480

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             +   C  G    A  LL E+     +P+ +T+  +M    R  + E+  ++++EM+R+G 
Sbjct  481   VGCHCRIGNMERAFSLLKEMEKTKVDPDEVTFNCLMYGFCREGKVEKARELIDEMKRRGI  540

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYM  1368
               D  +Y T+IS   K G + DA      M+  G +  ++ YN LI    K    D A  
Sbjct  541   EPDHISYNTLISGYSKRGDINDARKVHNEMLSIGFDPTVLTYNALIRGLSKTRDGDLAEE  600

Query  1367  LVVEAERKGFDCDKYTHTIIIDGLCKAGNMKE  1272
             L  E   KG   +  T+  +I+ +    N  E
Sbjct  601   LFREMVSKGITPNDSTYCSLIEAMTNLNNDTE  632



>ref|XP_007161634.1| hypothetical protein PHAVU_001G085800g [Phaseolus vulgaris]
 gb|ESW33628.1| hypothetical protein PHAVU_001G085800g [Phaseolus vulgaris]
Length=618

 Score =   218 bits (556),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/407 (32%), Positives = 209/407 (51%), Gaps = 4/407 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121
             MFR+  R S    NI V  LCK  +L+KA   I     +GV  +VVTYNT+I  +C    
Sbjct  202   MFRMNIRSSVYTFNIMVNVLCKEGKLKKANEFIGHMEALGVKPNVVTYNTVIHGHCVRGK  261

Query  2120  IDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNT  1941
                   I   M + G++PD  TYNS I+   +   L     LL +MLE+G+LP+  +YN 
Sbjct  262   FQRARVIFQTMKDKGLEPDCYTYNSFISGLCKERRLEEASGLLCKMLEIGLLPNAVTYNA  321

Query  1940  LMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSG  1761
             L+      G  D+A+ +  ++    +    VT+N+ +  L M G   +A  + +E++  G
Sbjct  322   LIDGYCNKGDLDKAFAYRDEMISKGVTTSLVTYNLFIHALFMEGRMGEADNMVQEMQEKG  381

Query  1760  FIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGL  1581
               P  VTYNILI+G C  G    A  LL+E+V  G  P  +TYT+++    +  R +E  
Sbjct  382   MKPDAVTYNILINGYCRCGDAKRAFSLLDEMVGKGIQPTLVTYTSLIYVLGKRNRMKEAD  441

Query  1580  QILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLY  1401
              +  +++++G + D+  +  +I      G +  A+  +  M    +  D + YNTL+  Y
Sbjct  442   ALFIKIQQEGLLLDTVMFNALIDGHCANGNIDRAFQLLEQMDNMKVLPDEITYNTLMQGY  501

Query  1400  CKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNL  1221
             C+EGK++ A  L+ + +R+G   D  ++  +I G  K G+MK+A R  +     GFD  +
Sbjct  502   CREGKVEEARQLLDKMKRRGIKPDHISYNTLISGYSKRGDMKDAFRVRDEMMTTGFDPTI  561

Query  1220  VAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCK  1092
             + +N  I GLCK  E ++A  + K M  K    D  TY S++  + K
Sbjct  562   LTYNALIQGLCKNREGEHAEELLKEMVSKGITPDDTTYLSIIEAMEK  608


 Score =   175 bits (443),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 120/419 (29%), Positives = 195/419 (47%), Gaps = 5/419 (1%)
 Frame = -1

Query  2189  RVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLS  2010
             RV   + ++ ++ L+ AYC     +      + M E G++P++ T N +++   +     
Sbjct  135   RVDAKSSLI-FDLLVRAYCELKKPNEALECFYLMKEKGVEPNIETCNQMLSLFLKLNRTQ  193

Query  2009  RCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILL  1830
                 L  EM  + I    +++N +++ L + GK  +A  F   +    + P  VT+N ++
Sbjct  194   MAWVLYAEMFRMNIRSSVYTFNIMVNVLCKEGKLKKANEFIGHMEALGVKPNVVTYNTVI  253

Query  1829  SGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYN  1650
              G C+ G  ++A ++F+ +K  G  P   TYN  I GLC   R   A  LL ++++IG  
Sbjct  254   HGHCVRGKFQRARVIFQTMKDKGLEPDCYTYNSFISGLCKERRLEEASGLLCKMLEIGLL  313

Query  1649  PNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDC  1470
             PNA+TY  ++         ++     +EM  KG       Y   I  L   GRM +A + 
Sbjct  314   PNAVTYNALIDGYCNKGDLDKAFAYRDEMISKGVTTSLVTYNLFIHALFMEGRMGEADNM  373

Query  1469  VGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCK  1290
             V  M   G++ D V YN LIN YC+ G    A+ L+ E   KG      T+T +I  L K
Sbjct  374   VQEMQEKGMKPDAVTYNILINGYCRCGDAKRAFSLLDEMVGKGIQPTLVTYTSLIYVLGK  433

Query  1289  AGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDE----KDCFT  1122
                MKEA       +  G   + V FN  IDG C  G +D A  + + MD      D  T
Sbjct  434   RNRMKEADALFIKIQQEGLLLDTVMFNALIDGHCANGNIDRAFQLLEQMDNMKVLPDEIT  493

Query  1121  YSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSEL  945
             Y++L+ G C+ G+   A +LL      G+K        +I G    G +++A ++  E+
Sbjct  494   YNTLMQGYCREGKVEEARQLLDKMKRRGIKPDHISYNTLISGYSKRGDMKDAFRVRDEM  552


 Score =   169 bits (427),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 171/330 (52%), Gaps = 0/330 (0%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N  ++ LCK ++LE+A  ++   + +G+  + VTYN LI  YC    +D  ++    M  
Sbjct  285   NSFISGLCKERRLEEASGLLCKMLEIGLLPNAVTYNALIDGYCNKGDLDKAFAYRDEMIS  344

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
              G+   ++TYN  I +    G +    ++++EM E G+ PD  +YN L++   R G    
Sbjct  345   KGVTTSLVTYNLFIHALFMEGRMGEADNMVQEMQEKGMKPDAVTYNILINGYCRCGDAKR  404

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A+    ++    I P  VT+  L+  L      ++A  LF +++  G +   V +N LI 
Sbjct  405   AFSLLDEMVGKGIQPTLVTYTSLIYVLGKRNRMKEADALFIKIQQEGLLLDTVMFNALID  464

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
             G C +G    A +LL ++ ++   P+ ITY T+M+   R  + EE  Q+L++M+R+G   
Sbjct  465   GHCANGNIDRAFQLLEQMDNMKVLPDEITYNTLMQGYCREGKVEEARQLLDKMKRRGIKP  524

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             D  +Y T+IS   K G MKDA+     M+  G +  ++ YN LI   CK  + ++A  L+
Sbjct  525   DHISYNTLISGYSKRGDMKDAFRVRDEMMTTGFDPTILTYNALIQGLCKNREGEHAEELL  584

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKE  1272
              E   KG   D  T+  II+ + K  +++E
Sbjct  585   KEMVSKGITPDDTTYLSIIEAMEKVDDLEE  614


 Score =   159 bits (401),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 107/416 (26%), Positives = 191/416 (46%), Gaps = 8/416 (2%)
 Frame = -1

Query  2276  STKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSIL  2097
             S+ + ++ V   C+ K+  +A          GV  ++ T N +++ +         + + 
Sbjct  140   SSLIFDLLVRAYCELKKPNEALECFYLMKEKGVEPNIETCNQMLSLFLKLNRTQMAWVLY  199

Query  2096  HRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRL  1917
               M  + I+  V T+N ++    + G L +  + +  M  +G+ P+  +YNT++H     
Sbjct  200   AEMFRMNIRSSVYTFNIMVNVLCKEGKLKKANEFIGHMEALGVKPNVVTYNTVIHGHCVR  259

Query  1916  GKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTY  1737
             GK   A   FQ +    + P   T+N  +SGLC     E+A  L  ++   G +P  VTY
Sbjct  260   GKFQRARVIFQTMKDKGLEPDCYTYNSFISGLCKERRLEEASGLLCKMLEIGLLPNAVTY  319

Query  1736  NILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRR  1557
             N LI G CN G    A    +E++  G   + +TY   +   F   R  E   +++EM+ 
Sbjct  320   NALIDGYCNKGDLDKAFAYRDEMISKGVTTSLVTYNLFIHALFMEGRMGEADNMVQEMQE  379

Query  1556  KGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDN  1377
             KG   D+  Y  +I+   + G  K A+  +  M+  GI+  LV Y +LI +  K  ++  
Sbjct  380   KGMKPDAVTYNILINGYCRCGDAKRAFSLLDEMVGKGIQPTLVTYTSLIYVLGKRNRMKE  439

Query  1376  AYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCID  1197
             A  L ++ +++G   D      +IDG C  GN+  A + L     M    + + +N  + 
Sbjct  440   ADALFIKIQQEGLLLDTVMFNALIDGHCANGNIDRAFQLLEQMDNMKVLPDEITYNTLMQ  499

Query  1196  GLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAG----RFRVASELLLS  1053
             G C+ G+V+ A  +   M  +    D  +Y++L+ G  K G     FRV  E++ +
Sbjct  500   GYCREGKVEEARQLLDKMKRRGIKPDHISYNTLISGYSKRGDMKDAFRVRDEMMTT  555


 Score =   130 bits (326),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 98/346 (28%), Positives = 160/346 (46%), Gaps = 6/346 (2%)
 Frame = -1

Query  1949  YNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELK  1770
             ++ L+     L KP+EA   F  +    + P   T N +LS       T+ A +L+ E+ 
Sbjct  144   FDLLVRAYCELKKPNEALECFYLMKEKGVEPNIETCNQMLSLFLKLNRTQMAWVLYAEMF  203

Query  1769  HSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKC-CFRSRRF  1593
                    + T+NI+++ LC  G+   A   +  +  +G  PN +TY T++   C R + F
Sbjct  204   RMNIRSSVYTFNIMVNVLCKEGKLKKANEFIGHMEALGVKPNVVTYNTVIHGHCVRGK-F  262

Query  1592  EEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTL  1413
             +    I + M+ KG   D + Y + IS L K  R+++A   +  M+  G+  + V YN L
Sbjct  263   QRARVIFQTMKDKGLEPDCYTYNSFISGLCKERRLEEASGLLCKMLEIGLLPNAVTYNAL  322

Query  1412  INLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGF  1233
             I+ YC +G LD A+    E   KG      T+ + I  L   G M EA   +   +  G 
Sbjct  323   IDGYCNKGDLDKAFAYRDEMISKGVTTSLVTYNLFIHALFMEGRMGEADNMVQEMQEKGM  382

Query  1232  DSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVASE  1065
               + V +N  I+G C+ G+   A S+   M  K       TY+SL++ L K  R + A  
Sbjct  383   KPDAVTYNILINGYCRCGDAKRAFSLLDEMVGKGIQPTLVTYTSLIYVLGKRNRMKEADA  442

Query  1064  LLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKIL  927
             L +     G+ +      A+IDG   +G I  A +L  ++   K+L
Sbjct  443   LFIKIQQEGLLLDTVMFNALIDGHCANGNIDRAFQLLEQMDNMKVL  488


 Score =   125 bits (313),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/265 (28%), Positives = 131/265 (49%), Gaps = 4/265 (2%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             N+ +  L    ++ +A+ ++ +    G+  D VTYN LI  YC        +S+L  M  
Sbjct  355   NLFIHALFMEGRMGEADNMVQEMQEKGMKPDAVTYNILINGYCRCGDAKRAFSLLDEMVG  414

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLM--HCLFRLGKP  1908
              GI+P ++TY SLI    +   +     L  ++ + G+L DT  +N L+  HC    G  
Sbjct  415   KGIQPTLVTYTSLIYVLGKRNRMKEADALFIKIQQEGLLLDTVMFNALIDGHCAN--GNI  472

Query  1907  DEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNIL  1728
             D A++  + +    + P  +T+N L+ G C  G  E+A  L  ++K  G  P  ++YN L
Sbjct  473   DRAFQLLEQMDNMKVLPDEITYNTLMQGYCREGKVEEARQLLDKMKRRGIKPDHISYNTL  532

Query  1727  IHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGY  1548
             I G    G    A R+ +E++  G++P  +TY  +++   ++R  E   ++L+EM  KG 
Sbjct  533   ISGYSKRGDMKDAFRVRDEMMTTGFDPTILTYNALIQGLCKNREGEHAEELLKEMVSKGI  592

Query  1547  IFDSFAYCTVISFLIKAGRMKDAYD  1473
               D   Y ++I  + K   +++  D
Sbjct  593   TPDDTTYLSIIEAMEKVDDLEENDD  617



>ref|XP_010476232.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12620-like 
[Camelina sativa]
Length=625

 Score =   219 bits (557),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 122/445 (27%), Positives = 227/445 (51%), Gaps = 4/445 (1%)
 Frame = -1

Query  2264  LNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMN  2085
             L+I + C C+ ++L  A +V+   +++G   D + +NTL+   C    +     ++ RM 
Sbjct  114   LSIMINCFCRRRKLGFAFSVLGKILKLGYEPDTIAFNTLLNGLCLEGRVSEAVGLVDRMV  173

Query  2084  EVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPD  1905
             E+G  P+VIT ++L+      G +S  + L+++M+  G  PD  +Y  +++ + + GK  
Sbjct  174   EMGHTPNVITISTLVNGLCLKGQVSEAVVLIDQMVANGFRPDEVTYGPVLNVMCKSGKTA  233

Query  1904  EAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILI  1725
              A    + +    +      +N+L+ GLC +G  + A  LF E+   G    ++TY  LI
Sbjct  234   LAMELLRKMEERKMKLDAAKYNVLIDGLCKDGSLDDAFNLFNEMGLKGIKANVITYTSLI  293

Query  1724  HGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYI  1545
              G CN+GRW    +LL +++     PN +T+ +++    +  +  E  ++ +EM  +G  
Sbjct  294   RGFCNAGRWDDGAQLLRDMITRNITPNIVTFNSLIDSFVKEGKLPEAEELYKEMILRGIA  353

Query  1544  FDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYML  1365
              DSF Y ++I  L K  R+ +A   +  M+    + D+V Y++LIN YCK  ++D+ + L
Sbjct  354   PDSFTYTSLIDGLCKENRLDEANQMLDLMVSKRCDPDIVTYSSLINGYCKAKRVDDGFQL  413

Query  1364  VVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCK  1185
               +   +G   +  T++ +I G C++G ++ A          G   N+V +   +DGLC 
Sbjct  414   FRKMSLRGVAANTVTYSTLIQGFCQSGKLEVAKELFQEMVSRGVPPNIVTYKILLDGLCD  473

Query  1184  VGEVDYALSVFKSMD----EKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSD  1017
              GE++ A+ +F+ M     E D   Y+ ++HG+C A +   A +L  S  + G+K     
Sbjct  474   NGEIEKAMEIFEKMQKSKMELDIGIYNIIIHGMCNARKVDDAWDLFCSLPVRGVKPDVKT  533

Query  1016  RQAVIDGLQHSGFIQEARKLHSELK  942
                +I GL   G + EA  L  +++
Sbjct  534   YNVLIGGLCKKGSLFEADLLFRKME  558


 Score =   186 bits (473),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 119/417 (29%), Positives = 210/417 (50%), Gaps = 4/417 (1%)
 Frame = -1

Query  2168  VVTYNTLITAYCCFVGIDAGYSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLE  1989
             V+ +N L +A       D   ++  R   VGI  D+ T + +I    R   L     +L 
Sbjct  76    VIDFNRLFSAVSRTKQYDLVLALSKRTELVGIAYDLYTLSIMINCFCRRRKLGFAFSVLG  135

Query  1988  EMLEVGILPDTWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNG  1809
             ++L++G  PDT ++NTL++ L   G+  EA      +      P  +T + L++GLC+ G
Sbjct  136   KILKLGYEPDTIAFNTLLNGLCLEGRVSEAVGLVDRMVEMGHTPNVITISTLVNGLCLKG  195

Query  1808  YTEKALMLFRELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYT  1629
                +A++L  ++  +GF P  VTY  +++ +C SG+ A A  LL ++ +     +A  Y 
Sbjct  196   QVSEAVVLIDQMVANGFRPDEVTYGPVLNVMCKSGKTALAMELLRKMEERKMKLDAAKYN  255

Query  1628  TIMKCCFRSRRFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMN  1449
              ++    +    ++   +  EM  KG   +   Y ++I     AGR  D    + +MI  
Sbjct  256   VLIDGLCKDGSLDDAFNLFNEMGLKGIKANVITYTSLIRGFCNAGRWDDGAQLLRDMITR  315

Query  1448  GIELDLVAYNTLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEA  1269
              I  ++V +N+LI+ + KEGKL  A  L  E   +G   D +T+T +IDGLCK   + EA
Sbjct  316   NITPNIVTFNSLIDSFVKEGKLPEAEELYKEMILRGIAPDSFTYTSLIDGLCKENRLDEA  375

Query  1268  LRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHG  1101
              + L+       D ++V ++  I+G CK   VD    +F+ M  +    +  TYS+L+ G
Sbjct  376   NQMLDLMVSKRCDPDIVTYSSLINGYCKAKRVDDGFQLFRKMSLRGVAANTVTYSTLIQG  435

Query  1100  LCKAGRFRVASELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKLHSELKLSKI  930
              C++G+  VA EL    +  G+       + ++DGL  +G I++A ++  +++ SK+
Sbjct  436   FCQSGKLEVAKELFQEMVSRGVPPNIVTYKILLDGLCDNGEIEKAMEIFEKMQKSKM  492


 Score =   166 bits (420),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 110/426 (26%), Positives = 199/426 (47%), Gaps = 6/426 (1%)
 Frame = -1

Query  2252  VACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNEVGI  2073
             V  LC   Q+ +A  +I   +  G   D VTY  ++   C          +L +M E  +
Sbjct  188   VNGLCLKGQVSEAVVLIDQMVANGFRPDEVTYGPVLNVMCKSGKTALAMELLRKMEERKM  247

Query  2072  KPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDEAYR  1893
             K D   YN LI    + G L    +L  EM   GI  +  +Y +L+      G+ D+  +
Sbjct  248   KLDAAKYNVLIDGLCKDGSLDDAFNLFNEMGLKGIKANVITYTSLIRGFCNAGRWDDGAQ  307

Query  1892  FFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIHGLC  1713
               +D+   +I P  VTFN L+      G   +A  L++E+   G  P   TY  LI GLC
Sbjct  308   LLRDMITRNITPNIVTFNSLIDSFVKEGKLPEAEELYKEMILRGIAPDSFTYTSLIDGLC  367

Query  1712  NSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIFDSF  1533
                R   A ++L+ +V    +P+ +TY++++    +++R ++G Q+  +M  +G   ++ 
Sbjct  368   KENRLDEANQMLDLMVSKRCDPDIVTYSSLINGYCKAKRVDDGFQLFRKMSLRGVAANTV  427

Query  1532  AYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLVVEA  1353
              Y T+I    ++G+++ A +    M+  G+  ++V Y  L++  C  G+++ A  +  + 
Sbjct  428   TYSTLIQGFCQSGKLEVAKELFQEMVSRGVPPNIVTYKILLDGLCDNGEIEKAMEIFEKM  487

Query  1352  ERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKVGEV  1173
             ++   + D   + III G+C A  + +A        + G   ++  +N  I GLCK G +
Sbjct  488   QKSKMELDIGIYNIIIHGMCNARKVDDAWDLFCSLPVRGVKPDVKTYNVLIGGLCKKGSL  547

Query  1172  DYALSVFKSMDE-----KDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDRQA  1008
               A  +F+ M+E      DC TY++L+           +++L+     GG     S  + 
Sbjct  548   FEADLLFRKMEEDGHAPNDC-TYNTLIRAHLLVSDVIKSAQLIEEMKRGGFAADASTIKM  606

Query  1007  VIDGLQ  990
             V+D L 
Sbjct  607   VMDMLS  612


 Score =   166 bits (419),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/366 (28%), Positives = 179/366 (49%), Gaps = 0/366 (0%)
 Frame = -1

Query  2288  KSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAG  2109
             K +L     N+ +  LCK   L+ A  +  +    G+ A+V+TY +LI  +C     D G
Sbjct  246   KMKLDAAKYNVLIDGLCKDGSLDDAFNLFNEMGLKGIKANVITYTSLIRGFCNAGRWDDG  305

Query  2108  YSILHRMNEVGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHC  1929
               +L  M    I P+++T+NSLI S  + G L    +L +EM+  GI PD+++Y +L+  
Sbjct  306   AQLLRDMITRNITPNIVTFNSLIDSFVKEGKLPEAEELYKEMILRGIAPDSFTYTSLIDG  365

Query  1928  LFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQ  1749
             L +  + DEA +    +      P  VT++ L++G C     +    LFR++   G    
Sbjct  366   LCKENRLDEANQMLDLMVSKRCDPDIVTYSSLINGYCKAKRVDDGFQLFRKMSLRGVAAN  425

Query  1748  LVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILE  1569
              VTY+ LI G C SG+   A+ L  E+V  G  PN +TY  ++     +   E+ ++I E
Sbjct  426   TVTYSTLIQGFCQSGKLEVAKELFQEMVSRGVPPNIVTYKILLDGLCDNGEIEKAMEIFE  485

Query  1568  EMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEG  1389
             +M++     D   Y  +I  +  A ++ DA+D   ++ + G++ D+  YN LI   CK+G
Sbjct  486   KMQKSKMELDIGIYNIIIHGMCNARKVDDAWDLFCSLPVRGVKPDVKTYNVLIGGLCKKG  545

Query  1388  KLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFN  1209
              L  A +L  + E  G   +  T+  +I       ++ ++ + +   K  GF ++     
Sbjct  546   SLFEADLLFRKMEEDGHAPNDCTYNTLIRAHLLVSDVIKSAQLIEEMKRGGFAADASTIK  605

Query  1208  CCIDGL  1191
               +D L
Sbjct  606   MVMDML  611


 Score =   131 bits (329),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/338 (25%), Positives = 152/338 (45%), Gaps = 4/338 (1%)
 Frame = -1

Query  1958  TWSYNTLMHCLFRLGKPDEAYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFR  1779
             ++SY   +       K D+A   FQ +      P  + FN L S +      +  L L +
Sbjct  41    SFSYRERLRSGLLDFKEDDAVDLFQSMIRSRPLPTVIDFNRLFSAVSRTKQYDLVLALSK  100

Query  1778  ELKHSGFIPQLVTYNILIHGLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSR  1599
               +  G    L T +I+I+  C   +   A  +L +++ +GY P+ I + T++       
Sbjct  101   RTELVGIAYDLYTLSIMINCFCRRRKLGFAFSVLGKILKLGYEPDTIAFNTLLNGLCLEG  160

Query  1598  RFEEGLQILEEMRRKGYIFDSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYN  1419
             R  E + +++ M   G+  +     T+++ L   G++ +A   +  M+ NG   D V Y 
Sbjct  161   RVSEAVGLVDRMVEMGHTPNVITISTLVNGLCLKGQVSEAVVLIDQMVANGFRPDEVTYG  220

Query  1418  TLINLYCKEGKLDNAYMLVVEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLM  1239
              ++N+ CK GK   A  L+ + E +    D   + ++IDGLCK G++ +A    N   L 
Sbjct  221   PVLNVMCKSGKTALAMELLRKMEERKMKLDAAKYNVLIDGLCKDGSLDDAFNLFNEMGLK  280

Query  1238  GFDSNLVAFNCCIDGLCKVGEVDYALSVFKSMDEK----DCFTYSSLVHGLCKAGRFRVA  1071
             G  +N++ +   I G C  G  D    + + M  +    +  T++SL+    K G+   A
Sbjct  281   GIKANVITYTSLIRGFCNAGRWDDGAQLLRDMITRNITPNIVTFNSLIDSFVKEGKLPEA  340

Query  1070  SELLLSCIIGGMKILKSDRQAVIDGLQHSGFIQEARKL  957
              EL    I+ G+        ++IDGL     + EA ++
Sbjct  341   EELYKEMILRGIAPDSFTYTSLIDGLCKENRLDEANQM  378



>emb|CBJ23782.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis 
thaliana]
Length=630

 Score =   219 bits (557),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/444 (29%), Positives = 229/444 (52%), Gaps = 4/444 (1%)
 Frame = -1

Query  2261  NITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVGIDAGYSILHRMNE  2082
             +I + C C+  QL  A  V+   +++G   D+VT ++L+  YC    I    +++ +M E
Sbjct  120   SILLNCFCRRSQLPLALAVLGKMMKLGYEPDIVTLSSLLNGYCHGKRISEAVALVDQMVE  179

Query  2081  VGIKPDVITYNSLIASATRHGMLSRCLDLLEEMLEVGILPDTWSYNTLMHCLFRLGKPDE  1902
             +G KPD +T+N+LI     H   S  + L++ M+  G  PD ++Y T+++ L + G  D 
Sbjct  180   MGYKPDTVTFNTLIHGLFLHNKASEAVALIDRMVARGCQPDLFTYGTVVNGLCKRGDIDL  239

Query  1901  AYRFFQDIFWGDIPPCPVTFNILLSGLCMNGYTEKALMLFRELKHSGFIPQLVTYNILIH  1722
             A    + +  G I    V +N ++ GLC   + + A  LF +++  G  P + TYN LI 
Sbjct  240   ALSLLKKMEKGKIEANVVIYNTIIDGLCKYKHMDDAFDLFNKMETKGIKPDVFTYNSLIS  299

Query  1721  GLCNSGRWAPARRLLNELVDIGYNPNAITYTTIMKCCFRSRRFEEGLQILEEMRRKGYIF  1542
              LCN GRW+ A RLL+++++   NPN +T+ +++    +  +  E  ++ +EM ++    
Sbjct  300   CLCNYGRWSDASRLLSDMIERKINPNVVTFNSLIDAFAKEGKLIEAEKLFDEMIQRSIDP  359

Query  1541  DSFAYCTVISFLIKAGRMKDAYDCVGNMIMNGIELDLVAYNTLINLYCKEGKLDNAYMLV  1362
             +   Y ++I+      R+ +A      M+      D+V YNTLI  +CK  +++    L 
Sbjct  360   NIVTYNSLINGFCMHDRLDEAQQIFTLMVSKDCLPDVVTYNTLIKGFCKAKRVEEGMELF  419

Query  1361  VEAERKGFDCDKYTHTIIIDGLCKAGNMKEALRHLNCTKLMGFDSNLVAFNCCIDGLCKV  1182
              E  ++G   +  T+  +I GL +AG+   A +        G   +++ ++  +DGLCK 
Sbjct  420   REMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKY  479

Query  1181  GEVDYALSVF----KSMDEKDCFTYSSLVHGLCKAGRFRVASELLLSCIIGGMKILKSDR  1014
             G+++ AL VF    KS  E + +TY+ ++ G+CKAG+     +L  S  + G+K      
Sbjct  480   GKLEKALVVFEYLQKSKMEPNIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVIIY  539

Query  1013  QAVIDGLQHSGFIQEARKLHSELK  942
               +I G    G  +EA  L  E+K
Sbjct  540   TTMISGFCRKGLKEEADALFREMK  563


 Score =   202 bits (514),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 210/418 (50%), Gaps = 4/418 (1%)
 Frame = -1

Query  2300  MFRIKSRLSTKLLNITVACLCKAKQLEKAETVIIDGIRVGVPADVVTYNTLITAYCCFVG  2121