BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20325_g3_i1 len=372 path=[861:0-371]

Length=372
                                                                      Score     E

gb|KHG20586.1|  Snakin-1                                              63.9    1e-10   
gb|KHN21405.1|  Snakin-1                                              63.9    1e-10   
ref|XP_006374850.1|  hypothetical protein POPTR_0014s02030g           63.5    1e-10   
gb|AFT92001.1|  gibberellin-regulated protein                         63.5    2e-10   
ref|XP_011029030.1|  PREDICTED: peamaclein-like                       63.5    2e-10   
ref|NP_001236984.1|  uncharacterized protein LOC100500113             63.9    2e-10   
ref|XP_004499015.1|  PREDICTED: snakin-1-like                         63.5    2e-10   
ref|XP_002510126.1|  GAST1 protein precursor, putative                63.2    2e-10   Ricinus communis
gb|KCW68672.1|  hypothetical protein EUGRSUZ_F02269                   63.2    2e-10   
ref|XP_006346334.1|  PREDICTED: snakin-1-like                         62.8    3e-10   
ref|XP_010315202.1|  PREDICTED: peamaclein                            62.8    3e-10   
gb|AFK41274.1|  unknown                                               62.4    4e-10   
gb|EPS58046.1|  hypothetical protein M569_16773                       62.4    5e-10   
gb|EYU37603.1|  hypothetical protein MIMGU_mgv1a024675mg              62.0    7e-10   
gb|AAY51975.1|  GIR1                                                  61.2    1e-09   Vigna radiata [mung bean]
gb|KDP41652.1|  hypothetical protein JCGZ_16059                       61.2    1e-09   
ref|XP_009617608.1|  PREDICTED: peamaclein-like                       61.2    1e-09   
ref|XP_003550315.1|  PREDICTED: snakin-1                              61.2    1e-09   
gb|ACU13365.1|  unknown                                               60.8    2e-09   Glycine max [soybeans]
ref|XP_011069770.1|  PREDICTED: peamaclein-like                       60.8    2e-09   
gb|AFE82743.1|  snakin-1                                              60.8    2e-09   
ref|XP_003589114.1|  Snakin-1                                         60.5    2e-09   
gb|AFT92002.1|  gibberellin-regulated protein                         60.5    2e-09   
ref|XP_011074384.1|  PREDICTED: peamaclein-like                       60.5    2e-09   
gb|ABK94917.1|  unknown                                               60.5    2e-09   Populus trichocarpa [western balsam poplar]
gb|AFK36243.1|  unknown                                               60.5    2e-09   
ref|XP_002271730.2|  PREDICTED: snakin-1                              60.8    3e-09   Vitis vinifera
ref|XP_002313889.2|  hypothetical protein POPTR_0009s09560g           60.1    4e-09   Populus trichocarpa [western balsam poplar]
emb|CBI22497.3|  unnamed protein product                              59.7    4e-09   
ref|XP_002300251.2|  hypothetical protein POPTR_0001s30500g           59.7    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_007160892.1|  hypothetical protein PHAVU_001G025800g           59.7    4e-09   
ref|XP_010028389.1|  PREDICTED: peamaclein-like                       59.7    4e-09   
ref|XP_010066166.1|  PREDICTED: peamaclein-like                       59.3    6e-09   
ref|XP_008346370.1|  PREDICTED: peamaclein-like                       59.3    6e-09   
ref|XP_009339505.1|  PREDICTED: peamaclein-like                       59.3    6e-09   
ref|XP_006406493.1|  hypothetical protein EUTSA_v10022254mg           58.5    7e-09   
ref|XP_010271646.1|  PREDICTED: peamaclein-like                       59.3    7e-09   
emb|CDP01230.1|  unnamed protein product                              58.9    7e-09   
ref|XP_004152264.1|  PREDICTED: snakin-1-like                         58.9    8e-09   
ref|XP_009620159.1|  PREDICTED: snakin-1                              58.9    8e-09   
ref|XP_002285141.1|  PREDICTED: peamaclein                            58.9    8e-09   Vitis vinifera
ref|XP_009135633.1|  PREDICTED: peamaclein-like                       58.9    9e-09   
emb|CDY22975.1|  BnaC03g40940D                                        58.9    1e-08   
ref|XP_004289740.1|  PREDICTED: snakin-1-like                         58.5    1e-08   
sp|Q948Z4.1|SNAK1_SOLTU  RecName: Full=Snakin-1; Flags: Precursor     58.5    1e-08   Solanum tuberosum [potatoes]
gb|EYU25492.1|  hypothetical protein MIMGU_mgv1a017072mg              58.5    1e-08   
gb|ABQ42622.1|  snakin-1                                              58.2    1e-08   Solanum chacoense
ref|XP_006362074.1|  PREDICTED: snakin-1-like                         58.2    1e-08   
ref|XP_006472264.1|  PREDICTED: snakin-1-like                         58.2    1e-08   
ref|XP_006433597.1|  hypothetical protein CICLE_v10002979mg           58.2    1e-08   
ref|XP_010320309.1|  PREDICTED: LOW QUALITY PROTEIN: snakin-1-like    58.2    2e-08   
ref|XP_004290947.1|  PREDICTED: peamaclein-like                       58.2    2e-08   
gb|AAD01518.1|  Snakin-1                                              57.4    2e-08   Solanum tuberosum [potatoes]
ref|XP_006400907.1|  hypothetical protein EUTSA_v10015142mg           58.2    2e-08   
gb|EYU29122.1|  hypothetical protein MIMGU_mgv1a017256mg              58.2    2e-08   
ref|XP_010679570.1|  PREDICTED: peamaclein-like                       58.2    2e-08   
ref|XP_003536595.1|  PREDICTED: snakin-1                              57.8    2e-08   
ref|XP_011069570.1|  PREDICTED: peamaclein                            57.4    3e-08   
ref|XP_009126643.1|  PREDICTED: gibberellin-regulated protein 10      57.4    3e-08   
ref|XP_007223838.1|  hypothetical protein PRUPE_ppa014086mg           57.4    3e-08   
emb|CDY31590.1|  BnaA10g12810D                                        57.4    3e-08   
ref|XP_004496906.1|  PREDICTED: snakin-1-like                         57.4    3e-08   
ref|XP_010066158.1|  PREDICTED: peamaclein-like                       57.4    3e-08   
ref|XP_009354124.1|  PREDICTED: peamaclein-like isoform X2            57.4    3e-08   
gb|KFK27525.1|  hypothetical protein AALP_AA8G394700                  57.0    3e-08   
gb|KEH44041.1|  gibberellin-regulated family protein                  57.4    3e-08   
ref|XP_002875456.1|  hypothetical protein ARALYDRAFT_484630           57.4    3e-08   
ref|XP_009795533.1|  PREDICTED: snakin-1                              57.0    3e-08   
gb|KHN42338.1|  Snakin-1                                              57.0    4e-08   
ref|XP_009360284.1|  PREDICTED: peamaclein                            57.0    4e-08   
emb|CDY31591.1|  BnaA10g12800D                                        57.0    4e-08   
ref|XP_010491469.1|  PREDICTED: gibberellin-regulated protein 8-like  57.0    4e-08   
ref|XP_010059861.1|  PREDICTED: peamaclein                            57.0    4e-08   
ref|XP_006486958.1|  PREDICTED: snakin-1-like                         57.0    4e-08   
ref|XP_007143086.1|  hypothetical protein PHAVU_007G042400g           57.0    4e-08   
ref|XP_009120505.1|  PREDICTED: gibberellin-regulated protein 10-...  57.0    4e-08   
ref|XP_008377985.1|  PREDICTED: peamaclein                            57.0    4e-08   
ref|XP_010458411.1|  PREDICTED: gibberellin-regulated protein 8-like  57.0    4e-08   
ref|XP_006422868.1|  hypothetical protein CICLE_v10029695mg           57.0    4e-08   
ref|XP_006417449.1|  hypothetical protein EUTSA_v10009615mg           57.0    4e-08   
emb|CDO97247.1|  unnamed protein product                              57.0    4e-08   
ref|XP_009354123.1|  PREDICTED: peamaclein-like isoform X1            57.0    4e-08   
sp|P86888.1|PMLN_PRUPE  RecName: Full=Peamaclein; AltName: Allerg...  56.2    4e-08   
emb|CDX80222.1|  BnaC09g35200D                                        56.6    5e-08   
emb|CDY50148.1|  BnaA01g26080D                                        57.0    5e-08   
ref|XP_010688303.1|  PREDICTED: peamaclein                            56.6    5e-08   
ref|XP_009773391.1|  PREDICTED: peamaclein-like                       56.6    5e-08   
gb|KCW63655.1|  hypothetical protein EUGRSUZ_G01294                   57.0    6e-08   
ref|XP_009144432.1|  PREDICTED: gibberellin-regulated protein 8-like  56.6    6e-08   
ref|XP_007136735.1|  hypothetical protein PHAVU_009G069900g           56.6    6e-08   
gb|KFK39277.1|  hypothetical protein AALP_AA3G223500                  55.8    6e-08   
gb|AGE15499.1|  GA-stimulated transcript-like protein 3               56.2    7e-08   
ref|NP_001237325.1|  uncharacterized protein LOC100527527 precursor   56.2    7e-08   
ref|XP_003525918.1|  PREDICTED: snakin-1                              56.2    7e-08   
ref|XP_006301929.1|  hypothetical protein CARUB_v10022405mg           56.2    7e-08   
gb|ABK25287.1|  unknown                                               56.6    7e-08   Picea sitchensis
ref|XP_002524960.1|  conserved hypothetical protein                   56.6    8e-08   Ricinus communis
gb|KGN52784.1|  hypothetical protein Csa_4G001520                     59.7    8e-08   
ref|XP_008360977.1|  PREDICTED: peamaclein                            56.2    8e-08   
ref|XP_010065940.1|  PREDICTED: peamaclein-like                       56.2    9e-08   
ref|XP_003636819.1|  Snakin-1                                         55.8    9e-08   
gb|ABQ42621.1|  snakin-1                                              55.8    9e-08   Solanum bulbocastanum [ornamental nightshade]
ref|XP_009131966.1|  PREDICTED: gibberellin-regulated protein 10-...  55.8    9e-08   
emb|CDX71072.1|  BnaC03g11560D                                        55.8    1e-07   
gb|ACJ68116.1|  hypothetical protein                                  55.8    1e-07   Brassica napus [oilseed rape]
emb|CDX88727.1|  BnaA03g09220D                                        55.8    1e-07   
ref|XP_009591073.1|  PREDICTED: peamaclein-like                       55.8    1e-07   
ref|XP_006281389.1|  hypothetical protein CARUB_v10027450mg           55.5    1e-07   
ref|XP_009120506.1|  PREDICTED: gibberellin-regulated protein 10-...  55.5    1e-07   
gb|ABK22434.1|  unknown                                               55.8    1e-07   Picea sitchensis
ref|XP_010458413.1|  PREDICTED: gibberellin-regulated protein 8-like  55.5    1e-07   
ref|XP_006361222.1|  PREDICTED: snakin-1-like                         55.5    2e-07   
ref|XP_010105475.1|  hypothetical protein L484_010255                 55.5    2e-07   
ref|XP_010099066.1|  hypothetical protein L484_011500                 55.1    2e-07   
dbj|BAB08352.1|  unnamed protein product                              55.1    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864654.1|  gibberellin-regulated family protein             55.1    2e-07   
emb|CDX80223.1|  BnaC09g35190D                                        55.1    2e-07   
ref|XP_007042576.1|  Uncharacterized protein TCM_007177               55.1    2e-07   
ref|NP_001077503.1|  Gibberellin-regulated GASA/GAST/Snakin famil...  55.1    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077504.1|  Gibberellin-regulated GASA/GAST/Snakin famil...  55.1    2e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CBI33733.3|  unnamed protein product                              54.3    2e-07   
ref|NP_568914.1|  gibberellin-regulated protein                       54.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002518646.1|  GAST1 protein precursor, putative                54.7    2e-07   Ricinus communis
ref|XP_010556423.1|  PREDICTED: peamaclein                            54.7    3e-07   
ref|XP_007047444.1|  Gibberellin-regulated family protein, putative   55.1    3e-07   
ref|XP_010028136.1|  PREDICTED: peamaclein-like                       54.7    3e-07   
ref|XP_002283986.1|  PREDICTED: snakin-1-like                         55.1    3e-07   Vitis vinifera
ref|XP_010475933.1|  PREDICTED: gibberellin-regulated protein 8-like  54.3    3e-07   
gb|AGE15502.1|  GA-stimulated transcript-like protein 6               54.3    3e-07   
ref|XP_010475932.1|  PREDICTED: gibberellin-regulated protein 8-like  54.3    4e-07   
emb|CDY72009.1|  BnaCnng75550D                                        54.3    4e-07   
ref|XP_011069640.1|  PREDICTED: peamaclein-like                       54.3    4e-07   
ref|XP_004501536.1|  PREDICTED: peamaclein-like                       54.3    4e-07   
ref|XP_010519291.1|  PREDICTED: peamaclein-like                       54.3    4e-07   
ref|XP_010443767.1|  PREDICTED: gibberellin-regulated protein 10-...  53.9    4e-07   
ref|XP_006301392.1|  hypothetical protein CARUB_v10021805mg           53.9    4e-07   
ref|XP_008440339.1|  PREDICTED: peamaclein-like                       54.3    5e-07   
gb|KDP32030.1|  hypothetical protein JCGZ_12491                       53.5    6e-07   
ref|XP_010467274.1|  PREDICTED: gibberellin-regulated protein 7-like  53.9    6e-07   
ref|XP_009148397.1|  PREDICTED: gibberellin-regulated protein 8       53.5    7e-07   
ref|XP_010488933.1|  PREDICTED: gibberellin-regulated protein 7-like  53.9    7e-07   
ref|XP_002889819.1|  hypothetical protein ARALYDRAFT_471179           53.5    7e-07   
ref|XP_010517902.1|  PREDICTED: gibberellin-regulated protein 7       53.9    7e-07   
gb|KHF99282.1|  Snakin-1                                              53.5    8e-07   
ref|XP_009598103.1|  PREDICTED: peamaclein-like                       53.1    9e-07   
ref|XP_006279073.1|  hypothetical protein CARUB_v10012746mg           53.1    9e-07   
emb|CDX93402.1|  BnaA06g06460D                                        53.1    9e-07   
ref|XP_004141992.1|  PREDICTED: snakin-1-like                         53.1    1e-06   
emb|CDX93153.1|  BnaA03g38750D                                        53.5    1e-06   
ref|XP_009136261.1|  PREDICTED: gibberellin-regulated protein 7-like  53.5    1e-06   
ref|XP_002883868.1|  gibberellin-regulated family protein             53.5    1e-06   
emb|CDX89647.1|  BnaC03g45610D                                        53.1    1e-06   
ref|XP_006292427.1|  hypothetical protein CARUB_v10018642mg           52.8    1e-06   
ref|XP_006306379.1|  hypothetical protein CARUB_v10012286mg           52.8    1e-06   
gb|EYU22941.1|  hypothetical protein MIMGU_mgv1a022909mg              52.8    1e-06   
gb|EYU29123.1|  hypothetical protein MIMGU_mgv1a017184mg              52.4    2e-06   
ref|XP_004142881.1|  PREDICTED: snakin-1-like                         52.4    2e-06   
ref|XP_008444582.1|  PREDICTED: peamaclein-like                       52.4    2e-06   
ref|XP_009800618.1|  PREDICTED: peamaclein-like                       52.0    2e-06   
ref|XP_002298694.2|  hypothetical protein POPTR_0001s32270g           51.6    2e-06   Populus trichocarpa [western balsam poplar]
ref|NP_181486.1|  gibberellin-regulated protein                       52.0    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006346656.1|  PREDICTED: peamaclein-like                       51.6    3e-06   
emb|CDP07216.1|  unnamed protein product                              51.6    3e-06   
gb|ABK21371.1|  unknown                                               52.0    3e-06   Picea sitchensis
ref|NP_179096.1|  gibberellin-regulated protein                       52.0    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ABK21812.1|  unknown                                               52.0    3e-06   Picea sitchensis
ref|XP_006662142.1|  PREDICTED: gibberellin-regulated protein 12-...  51.6    4e-06   
emb|CDY52417.1|  BnaCnng22380D                                        51.6    4e-06   
ref|XP_009123225.1|  PREDICTED: gibberellin-regulated protein 7 i...  51.6    4e-06   
emb|CDY54472.1|  BnaA09g52760D                                        51.6    4e-06   
gb|KFK39992.1|  hypothetical protein AALP_AA3G316000                  51.6    4e-06   
ref|XP_009123227.1|  PREDICTED: gibberellin-regulated protein 7 i...  51.2    4e-06   
ref|XP_006298856.1|  hypothetical protein CARUB_v10014971mg           51.6    5e-06   
ref|XP_004252296.1|  PREDICTED: peamaclein-like                       50.8    5e-06   
ref|XP_004252297.1|  PREDICTED: peamaclein                            50.8    6e-06   
ref|XP_006346618.1|  PREDICTED: snakin-1-like                         50.8    6e-06   
ref|XP_002969375.1|  hypothetical protein SELMODRAFT_440818           50.8    7e-06   
ref|XP_011097237.1|  PREDICTED: peamaclein-like                       50.4    1e-05   
ref|XP_004986740.1|  PREDICTED: gibberellin-regulated protein 12-...  50.4    1e-05   
ref|XP_003613454.1|  Gibberellin induced protein                      50.1    1e-05   
ref|XP_010547967.1|  PREDICTED: peamaclein                            50.1    1e-05   
ref|XP_002973082.1|  hypothetical protein SELMODRAFT_99264            49.3    1e-05   
ref|XP_002970705.1|  hypothetical protein SELMODRAFT_94072            48.9    2e-05   
ref|XP_002976786.1|  hypothetical protein SELMODRAFT_105504           48.9    2e-05   
ref|XP_008787135.1|  PREDICTED: peamaclein-like                       49.3    2e-05   
ref|XP_007018557.1|  Gibberellin-regulated family protein             48.9    3e-05   
ref|XP_006409618.1|  hypothetical protein EUTSA_v10022920mg           48.9    4e-05   
ref|XP_006409619.1|  hypothetical protein EUTSA_v10022920mg           48.9    4e-05   
ref|XP_006649745.1|  PREDICTED: gibberellin-regulated protein 12-...  48.5    4e-05   
emb|CDY27104.1|  BnaA08g07420D                                        48.5    5e-05   
ref|XP_002467388.1|  hypothetical protein SORBIDRAFT_01g026925        48.5    6e-05   Sorghum bicolor [broomcorn]
emb|CDY46336.1|  BnaC01g30340D                                        48.1    6e-05   
ref|XP_009106131.1|  PREDICTED: gibberellin-regulated protein 12-...  48.1    7e-05   
gb|AFK37530.1|  unknown                                               47.8    7e-05   
ref|XP_008659198.1|  PREDICTED: gibberellin-regulated protein 12      47.8    9e-05   
ref|XP_010236530.1|  PREDICTED: gibberellin-regulated protein 5-like  47.8    1e-04   
ref|XP_003613456.1|  Gibberellin-regulated protein                    47.4    1e-04   
gb|AES96393.2|  GASA/GAST/Snakin                                      47.0    1e-04   
ref|XP_010273304.1|  PREDICTED: uncharacterized protein LOC104608...  50.4    1e-04   
ref|XP_003629688.1|  Gibberellin induced protein                      47.4    1e-04   
ref|XP_006380659.1|  hypothetical protein POPTR_0007s10250g           47.4    1e-04   
ref|XP_010273303.1|  PREDICTED: uncharacterized protein LOC104608...  50.4    1e-04   
ref|XP_003613435.1|  GAST1                                            47.0    1e-04   
gb|EMT22213.1|  hypothetical protein F775_13483                       47.0    1e-04   
ref|XP_006601874.1|  PREDICTED: gibberellin-regulated protein 12-...  47.0    1e-04   
ref|XP_010038994.1|  PREDICTED: gibberellin-regulated protein 12      47.0    1e-04   
ref|XP_010685206.1|  PREDICTED: peamaclein-like                       47.0    1e-04   
ref|XP_002879804.1|  hypothetical protein ARALYDRAFT_482976           46.6    2e-04   
ref|XP_009383413.1|  PREDICTED: gibberellin-regulated protein 12      46.2    2e-04   
ref|XP_009108078.1|  PREDICTED: gibberellin-regulated protein 12-...  46.6    2e-04   
ref|XP_004517034.1|  PREDICTED: gibberellin-regulated protein 12-...  46.6    2e-04   
ref|XP_007163897.1|  hypothetical protein PHAVU_L007200g              46.6    2e-04   
ref|XP_007034358.1|  Gibberellin-regulated family protein             47.0    2e-04   
ref|XP_004140359.1|  PREDICTED: protein RSI-1-like                    46.6    2e-04   
ref|XP_006416023.1|  hypothetical protein EUTSA_v10009207mg           46.2    2e-04   
ref|XP_010685204.1|  PREDICTED: peamaclein-like                       46.6    2e-04   
gb|KHN24017.1|  Protein GAST1                                         45.8    2e-04   
ref|XP_002530088.1|  GAST1 protein precursor, putative                46.6    2e-04   Ricinus communis
ref|XP_002973289.1|  hypothetical protein SELMODRAFT_99234            45.8    2e-04   
gb|ABF94978.1|  GAST1 protein precursor, putative                     46.2    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003613442.1|  GAST1                                            46.2    3e-04   
gb|KDO41153.1|  hypothetical protein CISIN_1g041400mg                 46.2    3e-04   
ref|XP_006493084.1|  PREDICTED: gibberellin-regulated protein 12-...  46.2    3e-04   
ref|XP_006829298.1|  hypothetical protein AMTR_s00001p00273070        45.8    3e-04   
ref|XP_010920764.1|  PREDICTED: peamaclein-like                       45.8    3e-04   
ref|XP_006446220.1|  hypothetical protein CICLE_v10017244mg           46.2    3e-04   
gb|KDO50409.1|  hypothetical protein CISIN_1g033715mg                 46.2    3e-04   
ref|XP_003541683.1|  PREDICTED: gibberellin-regulated protein 12-...  45.8    4e-04   
gb|EYU34545.1|  hypothetical protein MIMGU_mgv1a023869mg              45.8    4e-04   
ref|XP_006828424.1|  hypothetical protein AMTR_s00060p00095260        45.8    4e-04   
ref|XP_010274741.1|  PREDICTED: protein RSI-1-like                    45.8    4e-04   
gb|EEC79111.1|  hypothetical protein OsI_19744                        46.2    4e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_006296776.1|  hypothetical protein CARUB_v10015821mg           45.4    5e-04   
ref|XP_007034357.1|  Gibberellin-regulated family protein             45.8    5e-04   
gb|EEE58704.1|  hypothetical protein OsJ_10147                        45.8    5e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74871.1|  hypothetical protein OsI_10763                        45.8    5e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010274082.1|  PREDICTED: gibberellin-regulated protein 12      45.8    6e-04   
ref|XP_008236410.1|  PREDICTED: peamaclein                            45.1    6e-04   
ref|XP_006395777.1|  hypothetical protein EUTSA_v10005321mg           45.4    6e-04   
gb|KFK37735.1|  hypothetical protein AALP_AA3G022800                  45.4    6e-04   
ref|XP_002518090.1|  Gibberellin-regulated protein 4 precursor, p...  45.1    6e-04   Ricinus communis
ref|NP_001176009.1|  Os10g0115550                                     45.4    6e-04   
ref|XP_002526822.1|  Gibberellin-regulated protein 1 precursor, p...  45.4    6e-04   Ricinus communis
ref|XP_010045037.1|  PREDICTED: protein GAST1-like                    45.4    6e-04   
ref|NP_001234666.1|  protein RSI-1 precursor                          45.1    6e-04   
ref|XP_002979611.1|  hypothetical protein SELMODRAFT_419248           45.4    6e-04   
ref|XP_009381473.1|  PREDICTED: peamaclein-like                       45.1    6e-04   
ref|XP_002977665.1|  hypothetical protein SELMODRAFT_417581           45.4    6e-04   
ref|XP_006420919.1|  hypothetical protein CICLE_v10006668mg           44.7    7e-04   
ref|XP_007200798.1|  hypothetical protein PRUPE_ppa024899mg           45.1    7e-04   
ref|XP_006338319.1|  PREDICTED: protein GAST1-like                    45.1    7e-04   
ref|XP_009404981.1|  PREDICTED: peamaclein-like                       45.1    7e-04   
ref|XP_002441006.1|  hypothetical protein SORBIDRAFT_09g018790        45.4    7e-04   Sorghum bicolor [broomcorn]
ref|XP_010646211.1|  PREDICTED: gibberellin-regulated protein 12-...  45.1    7e-04   
ref|XP_010414214.1|  PREDICTED: gibberellin-regulated protein 12-...  45.1    8e-04   
ref|XP_004232126.1|  PREDICTED: protein GAST1                         45.1    8e-04   
gb|KCW54793.1|  hypothetical protein EUGRSUZ_I00734                   44.7    8e-04   
emb|CAD10104.1|  gibberellin induced protein 3                        45.1    8e-04   Petunia x hybrida [garden petunia]
emb|CBI25690.3|  unnamed protein product                              45.1    8e-04   
ref|XP_007163594.1|  hypothetical protein PHAVU_001G247600g           44.7    8e-04   
ref|XP_006383339.1|  gibberellin-regulated protein 5                  44.7    8e-04   
gb|AGM20679.1|  GASA5                                                 44.7    8e-04   
ref|XP_007227095.1|  hypothetical protein PRUPE_ppa025589mg           44.7    9e-04   
gb|AAG43509.1|AF210049_1  gibberellin-induced protein 1               45.1    0.001   Petunia x hybrida [garden petunia]
emb|CAA60677.1|  gip1                                                 45.1    0.001   Petunia x hybrida [garden petunia]
ref|XP_011021371.1|  PREDICTED: protein RSI-1                         44.7    0.001   
gb|KDP26211.1|  hypothetical protein JCGZ_22457                       45.1    0.001   
ref|XP_011027306.1|  PREDICTED: protein GAST1-like                    45.1    0.001   
ref|XP_002969591.1|  hypothetical protein SELMODRAFT_91546            44.3    0.001   



>gb|KHG20586.1| Snakin-1 [Gossypium arboreum]
Length=86

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRDLKNSKGKPKCP
Sbjct  57  KCVPSGTYGNKHECPCYRDLKNSKGKPKCP  86



>gb|KHN21405.1| Snakin-1 [Glycine soja]
Length=88

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYGNKH+CPCYRD+KNSKGKPKCP
Sbjct  59  RCVPSGTYGNKHECPCYRDMKNSKGKPKCP  88



>ref|XP_006374850.1| hypothetical protein POPTR_0014s02030g [Populus trichocarpa]
 gb|ERP52647.1| hypothetical protein POPTR_0014s02030g [Populus trichocarpa]
Length=88

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD+KNSKGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDMKNSKGKPKCP  88



>gb|AFT92001.1| gibberellin-regulated protein [Populus tomentosa]
 gb|AFT92013.1| gibberellin-regulated protein [Populus tomentosa]
Length=88

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD+KNSKGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDMKNSKGKPKCP  88



>ref|XP_011029030.1| PREDICTED: peamaclein-like [Populus euphratica]
Length=88

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD+KNSKGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDMKNSKGKPKCP  88



>ref|NP_001236984.1| uncharacterized protein LOC100500113 [Glycine max]
 gb|ACU14995.1| unknown [Glycine max]
Length=115

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            +CVPSGTYGNKH+CPCYRD+KNSKGKPKCP
Sbjct  86   RCVPSGTYGNKHECPCYRDMKNSKGKPKCP  115



>ref|XP_004499015.1| PREDICTED: snakin-1-like [Cicer arietinum]
Length=89

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD+KNSKGKPKCP
Sbjct  60  KCVPSGTYGNKHECPCYRDMKNSKGKPKCP  89



>ref|XP_002510126.1| GAST1 protein precursor, putative [Ricinus communis]
 gb|EEF52313.1| GAST1 protein precursor, putative [Ricinus communis]
Length=88

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD+KNSKGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDMKNSKGKPKCP  88



>gb|KCW68672.1| hypothetical protein EUGRSUZ_F02269 [Eucalyptus grandis]
Length=89

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRDL+NSKGKPKCP
Sbjct  60  KCVPSGTYGNKHECPCYRDLRNSKGKPKCP  89



>ref|XP_006346334.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVP+GTYGNKHQCPCYRD+KNSKGKPKCP
Sbjct  60  KCVPNGTYGNKHQCPCYRDMKNSKGKPKCP  89



>ref|XP_010315202.1| PREDICTED: peamaclein [Solanum lycopersicum]
Length=89

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVP+GTYGNKHQCPCYRD+KNSKGKPKCP
Sbjct  60  KCVPNGTYGNKHQCPCYRDMKNSKGKPKCP  89



>gb|AFK41274.1| unknown [Lotus japonicus]
Length=90

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRDLKNSKGK KCP
Sbjct  61  KCVPSGTYGNKHECPCYRDLKNSKGKIKCP  90



>gb|EPS58046.1| hypothetical protein M569_16773 [Genlisea aurea]
Length=94

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+GNKHQCPCYRDL+NSKGKPKCP
Sbjct  66  CVPSGTFGNKHQCPCYRDLRNSKGKPKCP  94



>gb|EYU37603.1| hypothetical protein MIMGU_mgv1a024675mg [Erythranthe guttata]
Length=93

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKHQCPCYRD+++SKGKPKCP
Sbjct  64  KCVPSGTYGNKHQCPCYRDMRSSKGKPKCP  93



>gb|AAY51975.1| GIR1 [Vigna radiata]
Length=88

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRDLKNSKGK KCP
Sbjct  59  KCVPSGTYGNKHECPCYRDLKNSKGKGKCP  88



>gb|KDP41652.1| hypothetical protein JCGZ_16059 [Jatropha curcas]
Length=88

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KNSKGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDYKNSKGKPKCP  88



>ref|XP_009617608.1| PREDICTED: peamaclein-like [Nicotiana tomentosiformis]
Length=91

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVP+GTYGNKHQ PCYRD+KNSKGKPKCP
Sbjct  62  KCVPTGTYGNKHQYPCYRDMKNSKGKPKCP  91



>ref|XP_003550315.1| PREDICTED: snakin-1 [Glycine max]
 gb|KHN45269.1| Snakin-1 [Glycine soja]
Length=88

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNKH+CPCYRD+KNSKGK KCP
Sbjct  60  CVPSGTYGNKHECPCYRDMKNSKGKAKCP  88



>gb|ACU13365.1| unknown [Glycine max]
Length=88

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNKH+CPCYRD+KNSKGK KCP
Sbjct  60  CVPSGTYGNKHECPCYRDMKNSKGKAKCP  88



>ref|XP_011069770.1| PREDICTED: peamaclein-like [Sesamum indicum]
 ref|XP_011069771.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=88

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KNSKGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKKNSKGKPKCP  88



>gb|AFE82743.1| snakin-1 [Medicago sativa]
 gb|AFJ54172.1| snakin-1 [Medicago sativa]
Length=91

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +3

Query  9   VPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           VPSGTYGNKH+CPCYRD+KNSKGKPKCP
Sbjct  64  VPSGTYGNKHECPCYRDMKNSKGKPKCP  91



>ref|XP_003589114.1| Snakin-1 [Medicago truncatula]
 gb|ABD33278.1| Gibberellin regulated protein [Medicago truncatula]
 gb|ACJ86188.1| unknown [Medicago truncatula]
 gb|AES59365.1| gibberellin-regulated family protein [Medicago truncatula]
 gb|AFK38793.1| unknown [Medicago truncatula]
Length=91

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +3

Query  9   VPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           VPSGTYGNKH+CPCYRD+KNSKGKPKCP
Sbjct  64  VPSGTYGNKHECPCYRDMKNSKGKPKCP  91



>gb|AFT92002.1| gibberellin-regulated protein [Populus alba x Populus glandulosa]
 gb|AFT92014.1| gibberellin-regulated protein [Populus alba x Populus glandulosa]
Length=88

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNK +CPCYRD+KNSKGKPKCP
Sbjct  59  KCVPSGTYGNKLECPCYRDMKNSKGKPKCP  88



>ref|XP_011074384.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=93

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KNSKGKPKCP
Sbjct  64  KCVPSGTYGNKHECPCYRDKKNSKGKPKCP  93



>gb|ABK94917.1| unknown [Populus trichocarpa]
Length=87

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD +NSKGKPKCP
Sbjct  58  KCVPSGTYGNKHECPCYRDKRNSKGKPKCP  87



>gb|AFK36243.1| unknown [Lotus japonicus]
 gb|AFK45019.1| unknown [Lotus japonicus]
Length=94

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +3

Query  9   VPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           VPSGTYGNKH+CPCYRD+KNSKGKPKCP
Sbjct  67  VPSGTYGNKHECPCYRDMKNSKGKPKCP  94



>ref|XP_002271730.2| PREDICTED: snakin-1 [Vitis vinifera]
Length=139

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNKH+CPCYRD KNSKGKPKCP
Sbjct  110  KCVPSGTYGNKHECPCYRDKKNSKGKPKCP  139



>ref|XP_002313889.2| hypothetical protein POPTR_0009s09560g [Populus trichocarpa]
 gb|EEE87844.2| hypothetical protein POPTR_0009s09560g [Populus trichocarpa]
Length=89

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD +NSKGKPKCP
Sbjct  60  KCVPSGTYGNKHECPCYRDKRNSKGKPKCP  89



>emb|CBI22497.3| unnamed protein product [Vitis vinifera]
Length=88

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KNSKGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKKNSKGKPKCP  88



>ref|XP_002300251.2| hypothetical protein POPTR_0001s30500g [Populus trichocarpa]
 gb|EEE85056.2| hypothetical protein POPTR_0001s30500g [Populus trichocarpa]
Length=88

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD +NSKGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKRNSKGKPKCP  88



>ref|XP_007160892.1| hypothetical protein PHAVU_001G025800g [Phaseolus vulgaris]
 gb|ESW32886.1| hypothetical protein PHAVU_001G025800g [Phaseolus vulgaris]
Length=88

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD+KNSKGK KCP
Sbjct  59  KCVPSGTYGNKHECPCYRDMKNSKGKGKCP  88



>ref|XP_010028389.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW55129.1| hypothetical protein EUGRSUZ_I01086 [Eucalyptus grandis]
Length=87

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKHQCPCYR+ KNSKGKPKCP
Sbjct  58  KCVPSGTYGNKHQCPCYRNKKNSKGKPKCP  87



>ref|XP_010066166.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW63994.1| hypothetical protein EUGRSUZ_G01682 [Eucalyptus grandis]
Length=89

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYGNK +CPCYRD+KNSKG+PKCP
Sbjct  60  QCVPSGTYGNKDECPCYRDMKNSKGQPKCP  89



>ref|XP_008346370.1| PREDICTED: peamaclein-like [Malus domestica]
Length=88

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KN KGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKKNDKGKPKCP  88



>ref|XP_009339505.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
 ref|XP_009339508.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
Length=88

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KN KGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKKNDKGKPKCP  88



>ref|XP_006406493.1| hypothetical protein EUTSA_v10022254mg, partial [Eutrema salsugineum]
 gb|ESQ47946.1| hypothetical protein EUTSA_v10022254mg, partial [Eutrema salsugineum]
Length=67

 Score = 58.5 bits (140),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGT+GNKHQCPCYRD+ +SKGKPKCP
Sbjct  38  KCVPSGTFGNKHQCPCYRDMLSSKGKPKCP  67



>ref|XP_010271646.1| PREDICTED: peamaclein-like [Nelumbo nucifera]
Length=94

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KN+KGKPKCP
Sbjct  65  KCVPSGTYGNKHECPCYRDKKNNKGKPKCP  94



>emb|CDP01230.1| unnamed protein product [Coffea canephora]
Length=88

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNKH+CPCYRD KNSKGKPKCP
Sbjct  60  CVPSGTYGNKHECPCYRDKKNSKGKPKCP  88



>ref|XP_004152264.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004156848.1| PREDICTED: snakin-1-like [Cucumis sativus]
Length=89

 Score = 58.9 bits (141),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD+++SKG+PKCP
Sbjct  60  KCVPSGTYGNKHECPCYRDMRSSKGRPKCP  89



>ref|XP_009620159.1| PREDICTED: snakin-1 [Nicotiana tomentosiformis]
Length=88

 Score = 58.9 bits (141),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KN+KGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKKNNKGKPKCP  88



>ref|XP_002285141.1| PREDICTED: peamaclein [Vitis vinifera]
 emb|CBI19434.3| unnamed protein product [Vitis vinifera]
Length=88

 Score = 58.9 bits (141),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCY+D KNSKG+PKCP
Sbjct  59  KCVPSGTYGNKHECPCYKDKKNSKGQPKCP  88



>ref|XP_009135633.1| PREDICTED: peamaclein-like [Brassica rapa]
Length=97

 Score = 58.9 bits (141),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGT+GNKHQCPCYRD+ +SKGKPKCP
Sbjct  68  KCVPSGTFGNKHQCPCYRDMLSSKGKPKCP  97



>emb|CDY22975.1| BnaC03g40940D [Brassica napus]
Length=97

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGT+GNKHQCPCYRD+ +SKGKPKCP
Sbjct  68  KCVPSGTFGNKHQCPCYRDMLSSKGKPKCP  97



>ref|XP_004289740.1| PREDICTED: snakin-1-like [Fragaria vesca subsp. vesca]
Length=88

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KN+KG+PKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKKNNKGRPKCP  88



>sp|Q948Z4.1|SNAK1_SOLTU RecName: Full=Snakin-1; Flags: Precursor [Solanum tuberosum]
 emb|CAC44032.1| snakin-1 [Solanum tuberosum]
Length=88

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KNSKGK KCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKKNSKGKSKCP  88



>gb|EYU25492.1| hypothetical protein MIMGU_mgv1a017072mg [Erythranthe guttata]
Length=94

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KNSKG PKCP
Sbjct  65  KCVPSGTYGNKHECPCYRDKKNSKGHPKCP  94



>gb|ABQ42622.1| snakin-1 [Solanum chacoense]
Length=88

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KNSKGK KCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKKNSKGKSKCP  88



>ref|XP_006362074.1| PREDICTED: snakin-1-like [Solanum tuberosum]
 gb|ABQ42623.1| snakin-1 [Solanum chacoense]
 gb|ABQ42624.1| snakin-1 [Solanum tuberosum]
 gb|ABQ42625.1| snakin-1 [Solanum commersonii]
 gb|ACI23371.1| snakin-1 [Solanum tuberosum]
 gb|ACI23372.1| snakin-1 [Solanum tuberosum]
 gb|ACI23373.1| snakin-1 [Solanum tuberosum]
 gb|ACI23374.1| snakin-1 [Solanum tuberosum]
 gb|ACL79835.1| Snakin-1 [Solanum tuberosum]
 gb|ACZ04322.1| snakin-1 [Solanum tuberosum]
 gb|AFQ40003.1| snakin-1 [Solanum chacoense]
 gb|AFQ40008.1| snakin-1 [Capsicum annuum]
 gb|AFQ40009.1| snakin-1 [Solanum nigrum]
 gb|AFQ40010.1| snakin-1 [Petunia x hybrida]
 gb|AFQ40011.1| snakin-1 [Nicotiana tabacum]
 gb|AFQ40012.1| snakin-1 [Solanum lycopersicum]
 gb|AFQ40013.1| snakin-1 [Solanum bulbocastanum]
 gb|AFQ40014.1| snakin-1 [Solanum palustre]
 gb|AFQ40015.1| snakin-1 [Solanum bulbocastanum]
 gb|AFQ40016.1| snakin-1 [Solanum nigrum]
Length=88

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KNSKGK KCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKKNSKGKSKCP  88



>ref|XP_006472264.1| PREDICTED: snakin-1-like [Citrus sinensis]
 gb|KDO81573.1| hypothetical protein CISIN_1g039784mg [Citrus sinensis]
Length=88

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCYRDLKNSKGKPKCP
Sbjct  60  CVPSGTYGHKDECPCYRDLKNSKGKPKCP  88



>ref|XP_006433597.1| hypothetical protein CICLE_v10002979mg [Citrus clementina]
 gb|ESR46837.1| hypothetical protein CICLE_v10002979mg [Citrus clementina]
 gb|KDO36540.1| hypothetical protein CISIN_1g037233mg [Citrus sinensis]
Length=88

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCYRDLKNSKGKPKCP
Sbjct  60  CVPSGTYGHKDECPCYRDLKNSKGKPKCP  88



>ref|XP_010320309.1| PREDICTED: LOW QUALITY PROTEIN: snakin-1-like [Solanum lycopersicum]
Length=88

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KNSKGK KCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKKNSKGKSKCP  88



>ref|XP_004290947.1| PREDICTED: peamaclein-like [Fragaria vesca subsp. vesca]
Length=88

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRDLKNSKG PKCP
Sbjct  60  CVPSGTYGNKDECPCYRDLKNSKGDPKCP  88



>gb|AAD01518.1| Snakin-1 [Solanum tuberosum]
Length=50

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KNSKGK KCP
Sbjct  21  KCVPSGTYGNKHECPCYRDKKNSKGKSKCP  50



>ref|XP_006400907.1| hypothetical protein EUTSA_v10015142mg [Eutrema salsugineum]
 gb|ESQ42360.1| hypothetical protein EUTSA_v10015142mg [Eutrema salsugineum]
Length=91

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG+PKCP
Sbjct  63  CVPSGTYGNKDECPCYRDMKNSKGQPKCP  91



>gb|EYU29122.1| hypothetical protein MIMGU_mgv1a017256mg [Erythranthe guttata]
Length=86

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYGNK +CPCYRD+KNSKG PKCP
Sbjct  57  QCVPSGTYGNKDECPCYRDMKNSKGNPKCP  86



>ref|XP_010679570.1| PREDICTED: peamaclein-like [Beta vulgaris subsp. vulgaris]
Length=95

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNKH+CPCYRD++NSKG  KCP
Sbjct  67  CVPSGTYGNKHECPCYRDMRNSKGTSKCP  95



>ref|XP_003536595.1| PREDICTED: snakin-1 [Glycine max]
 gb|KHN06785.1| Snakin-1 [Glycine soja]
Length=90

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKHQCPCYRD  N KGKPKCP
Sbjct  61  KCVPSGTYGNKHQCPCYRDKLNKKGKPKCP  90



>ref|XP_011069570.1| PREDICTED: peamaclein [Sesamum indicum]
 ref|XP_011069571.1| PREDICTED: peamaclein [Sesamum indicum]
Length=88

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG PKCP
Sbjct  60  CVPSGTYGNKDECPCYRDMKNSKGNPKCP  88



>ref|XP_009126643.1| PREDICTED: gibberellin-regulated protein 10 [Brassica rapa]
 emb|CDY09248.1| BnaA02g06740D [Brassica napus]
Length=89

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG+PKCP
Sbjct  61  CVPSGTYGNKDECPCYRDMKNSKGQPKCP  89



>ref|XP_007223838.1| hypothetical protein PRUPE_ppa014086mg [Prunus persica]
 gb|EMJ25037.1| hypothetical protein PRUPE_ppa014086mg [Prunus persica]
Length=88

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRDLKNSKG PKCP
Sbjct  60  CVPSGTYGNKDECPCYRDLKNSKGNPKCP  88



>emb|CDY31590.1| BnaA10g12810D [Brassica napus]
Length=92

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG+PKCP
Sbjct  64  CVPSGTYGNKDECPCYRDMKNSKGQPKCP  92



>ref|XP_004496906.1| PREDICTED: snakin-1-like [Cicer arietinum]
Length=89

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD  N+KGKPKCP
Sbjct  60  KCVPSGTYGNKHECPCYRDKLNNKGKPKCP  89



>ref|XP_010066158.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW63991.1| hypothetical protein EUGRSUZ_G01678 [Eucalyptus grandis]
Length=89

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYG+K +CPCYRD+KNSKG+PKCP
Sbjct  60  QCVPSGTYGHKDECPCYRDMKNSKGQPKCP  89



>ref|XP_009354124.1| PREDICTED: peamaclein-like isoform X2 [Pyrus x bretschneideri]
Length=86

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYGNK +CPCYRDLKNSKG+ KCP
Sbjct  57  QCVPSGTYGNKDECPCYRDLKNSKGEDKCP  86



>gb|KFK27525.1| hypothetical protein AALP_AA8G394700 [Arabis alpina]
Length=69

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG+PKCP
Sbjct  41  CVPSGTYGNKDECPCYRDMKNSKGQPKCP  69



>gb|KEH44041.1| gibberellin-regulated family protein [Medicago truncatula]
Length=90

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD  N+KGKPKCP
Sbjct  61  KCVPSGTYGNKHECPCYRDKVNNKGKPKCP  90



>ref|XP_002875456.1| hypothetical protein ARALYDRAFT_484630 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51715.1| hypothetical protein ARALYDRAFT_484630 [Arabidopsis lyrata subsp. 
lyrata]
Length=89

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRDLKNSKG+ KCP
Sbjct  61  CVPSGTYGNKDECPCYRDLKNSKGESKCP  89



>ref|XP_009795533.1| PREDICTED: snakin-1 [Nicotiana sylvestris]
Length=88

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD K++KGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKKSNKGKPKCP  88



>gb|KHN42338.1| Snakin-1 [Glycine soja]
Length=90

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD  N KGKPKCP
Sbjct  61  KCVPSGTYGNKHECPCYRDKLNKKGKPKCP  90



>ref|XP_009360284.1| PREDICTED: peamaclein [Pyrus x bretschneideri]
Length=88

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRDLKNSKGK KCP
Sbjct  60  CVPSGTYGNKDECPCYRDLKNSKGKDKCP  88



>emb|CDY31591.1| BnaA10g12800D [Brassica napus]
Length=92

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG+PKCP
Sbjct  64  CVPSGTYGNKDECPCYRDMKNSKGEPKCP  92



>ref|XP_010491469.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
 ref|XP_010491484.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=89

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG PKCP
Sbjct  61  CVPSGTYGNKDECPCYRDIKNSKGGPKCP  89



>ref|XP_010059861.1| PREDICTED: peamaclein [Eucalyptus grandis]
 gb|KCW66306.1| hypothetical protein EUGRSUZ_F00131 [Eucalyptus grandis]
Length=89

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYG+K +CPCYRD+KNSKG+PKCP
Sbjct  60  QCVPSGTYGHKDECPCYRDMKNSKGEPKCP  89



>ref|XP_006486958.1| PREDICTED: snakin-1-like [Citrus sinensis]
Length=88

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD  N KGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKVNKKGKPKCP  88



>ref|XP_007143086.1| hypothetical protein PHAVU_007G042400g [Phaseolus vulgaris]
 gb|ESW15080.1| hypothetical protein PHAVU_007G042400g [Phaseolus vulgaris]
Length=90

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD  N KGKPKCP
Sbjct  61  KCVPSGTYGNKHECPCYRDKLNKKGKPKCP  90



>ref|XP_009120505.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=92

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG+PKCP
Sbjct  64  CVPSGTYGNKDECPCYRDMKNSKGEPKCP  92



>ref|XP_008377985.1| PREDICTED: peamaclein [Malus domestica]
 ref|XP_009354125.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
Length=88

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYGNK +CPCYRDLKNSKG+ KCP
Sbjct  59  QCVPSGTYGNKDECPCYRDLKNSKGEDKCP  88



>ref|XP_010458411.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=88

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG PKCP
Sbjct  60  CVPSGTYGNKDECPCYRDIKNSKGGPKCP  88



>ref|XP_006422868.1| hypothetical protein CICLE_v10029695mg [Citrus clementina]
 gb|ESR36108.1| hypothetical protein CICLE_v10029695mg [Citrus clementina]
 gb|KDO47927.1| hypothetical protein CISIN_1g034644mg [Citrus sinensis]
Length=88

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD  N KGKPKCP
Sbjct  59  KCVPSGTYGNKHECPCYRDKVNKKGKPKCP  88



>ref|XP_006417449.1| hypothetical protein EUTSA_v10009615mg [Eutrema salsugineum]
 gb|ESQ35802.1| hypothetical protein EUTSA_v10009615mg [Eutrema salsugineum]
Length=88

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+GNK +CPCYRDLKNSKG PKCP
Sbjct  60  CVPSGTFGNKDECPCYRDLKNSKGGPKCP  88



>emb|CDO97247.1| unnamed protein product [Coffea canephora]
Length=89

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  9   VPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           VPSGT+GNKHQCPCYRD+KNSKGK KCP
Sbjct  62  VPSGTHGNKHQCPCYRDMKNSKGKAKCP  89



>ref|XP_009354123.1| PREDICTED: peamaclein-like isoform X1 [Pyrus x bretschneideri]
Length=88

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYGNK +CPCYRDLKNSKG+ KCP
Sbjct  59  QCVPSGTYGNKDECPCYRDLKNSKGEDKCP  88



>sp|P86888.1|PMLN_PRUPE RecName: Full=Peamaclein; AltName: Allergen=Pru p 7 [Prunus persica]
Length=63

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRDLKNSKG PKCP
Sbjct  35  CVPSGTYGNKDECPCYRDLKNSKGNPKCP  63



>emb|CDX80222.1| BnaC09g35200D [Brassica napus]
Length=92

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGN+ +CPCYRD+KNSKG+PKCP
Sbjct  64  CVPSGTYGNRDECPCYRDMKNSKGQPKCP  92



>emb|CDY50148.1| BnaA01g26080D [Brassica napus]
Length=96

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGT+GNKHQCPCYRD  +SKGKPKCP
Sbjct  67  KCVPSGTFGNKHQCPCYRDKLSSKGKPKCP  96



>ref|XP_010688303.1| PREDICTED: peamaclein [Beta vulgaris subsp. vulgaris]
Length=87

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYGNK +CPCYRD KNSKGKPKCP
Sbjct  58  QCVPSGTYGNKDECPCYRDKKNSKGKPKCP  87



>ref|XP_009773391.1| PREDICTED: peamaclein-like [Nicotiana sylvestris]
Length=88

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYGNK +CPCYRD KNSKGKPKCP
Sbjct  59  QCVPSGTYGNKDECPCYRDKKNSKGKPKCP  88



>gb|KCW63655.1| hypothetical protein EUGRSUZ_G01294 [Eucalyptus grandis]
Length=124

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGNKH+CPCYRD ++SKGKPKCP
Sbjct  96   CVPSGTYGNKHECPCYRDKRSSKGKPKCP  124



>ref|XP_009144432.1| PREDICTED: gibberellin-regulated protein 8-like [Brassica rapa]
 emb|CDY20958.1| BnaA08g25670D [Brassica napus]
 emb|CDY20617.1| BnaC08g14410D [Brassica napus]
Length=88

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG PKCP
Sbjct  60  CVPSGTYGNKDECPCYRDIKNSKGGPKCP  88



>ref|XP_007136735.1| hypothetical protein PHAVU_009G069900g [Phaseolus vulgaris]
 gb|ESW08729.1| hypothetical protein PHAVU_009G069900g [Phaseolus vulgaris]
Length=89

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRDLKNSKGK KCP
Sbjct  61  CVPSGTYGNKDECPCYRDLKNSKGKGKCP  89



>gb|KFK39277.1| hypothetical protein AALP_AA3G223500 [Arabis alpina]
Length=63

 Score = 55.8 bits (133),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGT+GNKHQCPCYRD  +SKGKPKCP
Sbjct  34  KCVPSGTFGNKHQCPCYRDKLSSKGKPKCP  63



>gb|AGE15499.1| GA-stimulated transcript-like protein 3 [Gossypium hirsutum]
Length=90

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD  N+KGKPKCP
Sbjct  61  KCVPSGTYGNKHECPCYRDKVNNKGKPKCP  90



>ref|NP_001237325.1| uncharacterized protein LOC100527527 precursor [Glycine max]
 gb|ACU16624.1| unknown [Glycine max]
Length=90

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD  N KGKPKCP
Sbjct  61  KCVPSGTYGNKHECPCYRDKLNKKGKPKCP  90



>ref|XP_003525918.1| PREDICTED: snakin-1 [Glycine max]
 gb|ACU14133.1| unknown [Glycine max]
 gb|KHN45165.1| Snakin-1 [Glycine soja]
Length=88

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKGK KCP
Sbjct  60  CVPSGTYGNKDECPCYRDMKNSKGKDKCP  88



>ref|XP_006301929.1| hypothetical protein CARUB_v10022405mg [Capsella rubella]
 gb|EOA34827.1| hypothetical protein CARUB_v10022405mg [Capsella rubella]
Length=86

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGT+GNK +CPCYRDLKNSKG  KCP
Sbjct  57  KCVPSGTFGNKDECPCYRDLKNSKGGSKCP  86



>gb|ABK25287.1| unknown [Picea sitchensis]
Length=111

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            +CVP GTYGNK+ CPCYRDLKN+KGKPKCP
Sbjct  82   QCVPPGTYGNKNACPCYRDLKNAKGKPKCP  111



>ref|XP_002524960.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37457.1| conserved hypothetical protein [Ricinus communis]
Length=101

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNK +CPCYRD KNSKG PKCP
Sbjct  72   KCVPSGTYGNKSECPCYRDKKNSKGNPKCP  101



>gb|KGN52784.1| hypothetical protein Csa_4G001520 [Cucumis sativus]
Length=422

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKP  83
           KCVPSGTYGNKH+CPCYRD+++SKG+P
Sbjct  60  KCVPSGTYGNKHECPCYRDMRSSKGRP  86



>ref|XP_008360977.1| PREDICTED: peamaclein [Malus domestica]
Length=88

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRDLKNSKG+ KCP
Sbjct  60  CVPSGTYGNKDECPCYRDLKNSKGEDKCP  88



>ref|XP_010065940.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
Length=88

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNKH+CPCYRD ++SKGKPKCP
Sbjct  60  CVPSGTYGNKHECPCYRDKRSSKGKPKCP  88



>ref|XP_003636819.1| Snakin-1 [Medicago truncatula]
 ref|XP_003638468.1| Snakin-1 [Medicago truncatula]
 gb|KEH35780.1| GASA/GAST/Snakin [Medicago truncatula]
Length=85

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKGK KCP
Sbjct  57  CVPSGTYGNKDECPCYRDMKNSKGKGKCP  85



>gb|ABQ42621.1| snakin-1 [Solanum bulbocastanum]
Length=88

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKC  89
           KCVPSGTYGNKH+CPCYRD KNSKGK KC
Sbjct  59  KCVPSGTYGNKHECPCYRDKKNSKGKSKC  87



>ref|XP_009131966.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=89

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG PKCP
Sbjct  61  CVPSGTYGNKDECPCYRDMKNSKGGPKCP  89



>emb|CDX71072.1| BnaC03g11560D [Brassica napus]
Length=91

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG PKCP
Sbjct  63  CVPSGTYGNKDECPCYRDMKNSKGGPKCP  91



>gb|ACJ68116.1| hypothetical protein [Brassica napus]
Length=89

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG PKCP
Sbjct  61  CVPSGTYGNKDECPCYRDMKNSKGGPKCP  89



>emb|CDX88727.1| BnaA03g09220D [Brassica napus]
Length=91

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG PKCP
Sbjct  63  CVPSGTYGNKDECPCYRDMKNSKGGPKCP  91



>ref|XP_009591073.1| PREDICTED: peamaclein-like [Nicotiana tomentosiformis]
Length=88

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYGNK +CPCYRD KNSKG+PKCP
Sbjct  59  QCVPSGTYGNKDECPCYRDKKNSKGQPKCP  88



>ref|XP_006281389.1| hypothetical protein CARUB_v10027450mg [Capsella rubella]
 gb|EOA14287.1| hypothetical protein CARUB_v10027450mg [Capsella rubella]
Length=88

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK++CPCYRD+KNSKG  KCP
Sbjct  60  CVPSGTYGNKNECPCYRDMKNSKGTSKCP  88



>ref|XP_009120506.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=92

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCYRD+KNSKG+PKCP
Sbjct  64  CVPSGTYGHKDECPCYRDMKNSKGQPKCP  92



>gb|ABK22434.1| unknown [Picea sitchensis]
 gb|ABK25425.1| unknown [Picea sitchensis]
Length=111

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            +CVP GTYGNK+ CPCYRD+KN+KGKPKCP
Sbjct  82   QCVPPGTYGNKNACPCYRDMKNAKGKPKCP  111



>ref|XP_010458413.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=89

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNK +CPCYRD+KNS+G  KCP
Sbjct  60  KCVPSGTYGNKDECPCYRDMKNSQGGSKCP  89



>ref|XP_006361222.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD  NSKGKPKCP
Sbjct  61  CVPSGTYGNKSECPCYRDKLNSKGKPKCP  89



>ref|XP_010105475.1| hypothetical protein L484_010255 [Morus notabilis]
 gb|EXC04831.1| hypothetical protein L484_010255 [Morus notabilis]
Length=87

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYG+K +CPCYRDLKNSKG+ KCP
Sbjct  58  QCVPSGTYGHKDECPCYRDLKNSKGQSKCP  87



>ref|XP_010099066.1| hypothetical protein L484_011500 [Morus notabilis]
 gb|EXB76655.1| hypothetical protein L484_011500 [Morus notabilis]
Length=91

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNKH+CPCYRD ++ KGKPKCP
Sbjct  63  CVPSGTYGNKHECPCYRDKRSKKGKPKCP  91



>dbj|BAB08352.1| unnamed protein product [Arabidopsis thaliana]
Length=88

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG  KCP
Sbjct  60  CVPSGTYGNKDECPCYRDMKNSKGTSKCP  88



>ref|XP_002864654.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40913.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=89

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG  KCP
Sbjct  61  CVPSGTYGNKDECPCYRDMKNSKGTSKCP  89



>emb|CDX80223.1| BnaC09g35190D [Brassica napus]
Length=92

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD KNS GKPKCP
Sbjct  64  CVPSGTYGNKDECPCYRDTKNSNGKPKCP  92



>ref|XP_007042576.1| Uncharacterized protein TCM_007177 [Theobroma cacao]
 gb|EOX98407.1| Uncharacterized protein TCM_007177 [Theobroma cacao]
Length=90

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD K+ KG PKCP
Sbjct  61  KCVPSGTYGNKHECPCYRDKKSKKGTPKCP  90



>ref|NP_001077503.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
 gb|ABF59173.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28601.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
Length=90

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG  KCP
Sbjct  62  CVPSGTYGNKDECPCYRDMKNSKGGSKCP  90



>ref|NP_001077504.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
 gb|ABF59285.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28602.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
Length=89

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG  KCP
Sbjct  61  CVPSGTYGNKDECPCYRDMKNSKGGSKCP  89



>emb|CBI33733.3| unnamed protein product [Vitis vinifera]
Length=67

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNK +CPCYRD  NSKGKPKCP
Sbjct  38  KCVPSGTYGNKSECPCYRDKLNSKGKPKCP  67



>ref|NP_568914.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|Q8LFM2.1|GASAA_ARATH RecName: Full=Gibberellin-regulated protein 10; AltName: Full=GAST1 
protein homolog 10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM61329.1| contains similarity to gibberellin-stimulated transcript 1 like 
protein [Arabidopsis thaliana]
 dbj|BAC42796.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00469.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97241.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=89

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG  KCP
Sbjct  61  CVPSGTYGNKDECPCYRDMKNSKGTSKCP  89



>ref|XP_002518646.1| GAST1 protein precursor, putative [Ricinus communis]
 gb|EEF43571.1| GAST1 protein precursor, putative [Ricinus communis]
Length=88

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNK +CPCYRD KNSKGK KCP
Sbjct  59  KCVPSGTYGNKLECPCYRDKKNSKGKSKCP  88



>ref|XP_010556423.1| PREDICTED: peamaclein [Tarenaya hassleriana]
Length=90

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCYRD+KNSKG PKCP
Sbjct  62  CVPSGTYGHKDECPCYRDMKNSKGDPKCP  90



>ref|XP_007047444.1| Gibberellin-regulated family protein, putative [Theobroma cacao]
 gb|EOX91601.1| Gibberellin-regulated family protein, putative [Theobroma cacao]
Length=107

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGNK +CPCYRD  NSKGKPKCP
Sbjct  79   CVPSGTYGNKSECPCYRDKLNSKGKPKCP  107



>ref|XP_010028136.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW54794.1| hypothetical protein EUGRSUZ_I00735 [Eucalyptus grandis]
Length=93

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYGNK +CPCYRD+KNSKG  KCP
Sbjct  64  QCVPSGTYGNKSECPCYRDMKNSKGTAKCP  93



>ref|XP_002283986.1| PREDICTED: snakin-1-like [Vitis vinifera]
Length=127

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNK +CPCYRD  NSKGKPKCP
Sbjct  98   KCVPSGTYGNKSECPCYRDKLNSKGKPKCP  127



>ref|XP_010475933.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=89

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG  KCP
Sbjct  61  CVPSGTYGNKDECPCYRDMKNSKGGSKCP  89



>gb|AGE15502.1| GA-stimulated transcript-like protein 6 [Gossypium hirsutum]
Length=88

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+G+K +CPCYRD+KNSKGK KCP
Sbjct  60  CVPSGTFGHKDECPCYRDMKNSKGKSKCP  88



>ref|XP_010475932.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=90

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGN+ +CPCYRD+KNSKG  KCP
Sbjct  62  CVPSGTYGNRDECPCYRDMKNSKGGSKCP  90



>emb|CDY72009.1| BnaCnng75550D [Brassica napus]
Length=88

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG++ +CPCYRD+KNSKG PKCP
Sbjct  60  CVPSGTYGHRDECPCYRDIKNSKGGPKCP  88



>ref|XP_011069640.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=91

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+GNK +CPCYRDLKNSKG+ KCP
Sbjct  63  CVPSGTFGNKDECPCYRDLKNSKGESKCP  91



>ref|XP_004501536.1| PREDICTED: peamaclein-like [Cicer arietinum]
Length=86

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD+KNSKG+ KCP
Sbjct  58  CVPSGTYGNKDECPCYRDMKNSKGQGKCP  86



>ref|XP_010519291.1| PREDICTED: peamaclein-like [Tarenaya hassleriana]
Length=99

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYG+KH+CPCYRD  +SKG+PKCP
Sbjct  70  KCVPSGTYGHKHECPCYRDKMSSKGRPKCP  99



>ref|XP_010443767.1| PREDICTED: gibberellin-regulated protein 10-like [Camelina sativa]
Length=87

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           +CVPSGTYG+K +CPCYRD+K+SKG PKCP
Sbjct  58  QCVPSGTYGHKDECPCYRDMKSSKGTPKCP  87



>ref|XP_006301392.1| hypothetical protein CARUB_v10021805mg [Capsella rubella]
 gb|EOA34290.1| hypothetical protein CARUB_v10021805mg [Capsella rubella]
Length=88

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+GNK +CPCYRDL+NSKG  KCP
Sbjct  60  CVPSGTFGNKDECPCYRDLQNSKGGSKCP  88



>ref|XP_008440339.1| PREDICTED: peamaclein-like [Cucumis melo]
Length=94

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNK +CPCYRD  NSKGK KCP
Sbjct  65  KCVPSGTYGNKSECPCYRDKLNSKGKSKCP  94



>gb|KDP32030.1| hypothetical protein JCGZ_12491 [Jatropha curcas]
Length=79

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNK +CPCYRD KNSKG+ KCP
Sbjct  50  KCVPSGTYGNKSECPCYRDKKNSKGQSKCP  79



>ref|XP_010467274.1| PREDICTED: gibberellin-regulated protein 7-like [Camelina sativa]
Length=108

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            +CVPSGTYGNKH+CPCYRD   +KG PKCP
Sbjct  79   QCVPSGTYGNKHECPCYRDKLTNKGTPKCP  108



>ref|XP_009148397.1| PREDICTED: gibberellin-regulated protein 8 [Brassica rapa]
Length=88

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+G++ +CPCYRD+KNSKG PKCP
Sbjct  60  CVPSGTFGHRDECPCYRDMKNSKGGPKCP  88



>ref|XP_010488933.1| PREDICTED: gibberellin-regulated protein 7-like [Camelina sativa]
Length=108

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            +CVPSGTYGNKH+CPCYRD   +KG PKCP
Sbjct  79   QCVPSGTYGNKHECPCYRDKLTNKGTPKCP  108



>ref|XP_002889819.1| hypothetical protein ARALYDRAFT_471179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66078.1| hypothetical protein ARALYDRAFT_471179 [Arabidopsis lyrata subsp. 
lyrata]
Length=90

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  9   VPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           VPSGTYGNK +CPCYRD+KNSKG  KCP
Sbjct  63  VPSGTYGNKDECPCYRDMKNSKGGSKCP  90



>ref|XP_010517902.1| PREDICTED: gibberellin-regulated protein 7 [Camelina sativa]
Length=108

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            +CVPSGTYGNKH+CPCYRD   +KG PKCP
Sbjct  79   QCVPSGTYGNKHECPCYRDKLTNKGTPKCP  108



>gb|KHF99282.1| Snakin-1 [Gossypium arboreum]
 gb|KHF99299.1| Snakin-1 [Gossypium arboreum]
Length=88

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+G+K +CPCYRD+KNSKGK KCP
Sbjct  60  CVPSGTFGHKDECPCYRDMKNSKGKSKCP  88



>ref|XP_009598103.1| PREDICTED: peamaclein-like [Nicotiana tomentosiformis]
Length=90

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSG YGNK +CPCYRD+ NSKGK KCP
Sbjct  62  CVPSGNYGNKSECPCYRDMLNSKGKSKCP  90



>ref|XP_006279073.1| hypothetical protein CARUB_v10012746mg [Capsella rubella]
 gb|EOA11971.1| hypothetical protein CARUB_v10012746mg [Capsella rubella]
Length=88

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+GNK +CPCYRDL NSKG  KCP
Sbjct  60  CVPSGTFGNKDECPCYRDLINSKGGSKCP  88



>emb|CDX93402.1| BnaA06g06460D [Brassica napus]
Length=94

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+G++ +CPCYRD+KNSKG PKCP
Sbjct  66  CVPSGTFGHRDECPCYRDMKNSKGGPKCP  94



>ref|XP_004141992.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004163840.1| PREDICTED: snakin-1-like [Cucumis sativus]
 gb|KGN48576.1| hypothetical protein Csa_6G493840 [Cucumis sativus]
Length=95

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNK +CPCYRD  NSKGK KCP
Sbjct  66  KCVPSGTYGNKSECPCYRDKLNSKGKSKCP  95



>emb|CDX93153.1| BnaA03g38750D [Brassica napus]
Length=106

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNKH+CPCYRD  +SK  PKCP
Sbjct  77   KCVPSGTYGNKHECPCYRDKLSSKKTPKCP  106



>ref|XP_009136261.1| PREDICTED: gibberellin-regulated protein 7-like [Brassica rapa]
Length=106

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNKH+CPCYRD  +SK  PKCP
Sbjct  77   KCVPSGTYGNKHECPCYRDKLSSKKTPKCP  106



>ref|XP_002883868.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60127.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=108

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            +CVPSGTYGNKH+C CYRD  +SKG PKCP
Sbjct  79   QCVPSGTYGNKHECACYRDKLSSKGTPKCP  108



>emb|CDX89647.1| BnaC03g45610D [Brassica napus]
Length=106

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNKH+CPCYRD  +SK  PKCP
Sbjct  77   KCVPSGTYGNKHECPCYRDKLSSKKTPKCP  106



>ref|XP_006292427.1| hypothetical protein CARUB_v10018642mg [Capsella rubella]
 gb|EOA25325.1| hypothetical protein CARUB_v10018642mg [Capsella rubella]
Length=88

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+GNK +CPCYRDL NSKG  KCP
Sbjct  60  CVPSGTFGNKDECPCYRDLINSKGGSKCP  88



>ref|XP_006306379.1| hypothetical protein CARUB_v10012286mg [Capsella rubella]
 gb|EOA39277.1| hypothetical protein CARUB_v10012286mg [Capsella rubella]
Length=89

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+GNK +CPCYRD+ NSKG  KCP
Sbjct  61  CVPSGTFGNKDECPCYRDMTNSKGGSKCP  89



>gb|EYU22941.1| hypothetical protein MIMGU_mgv1a022909mg [Erythranthe guttata]
Length=93

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGN+ +CPCYRD KN KG PKCP
Sbjct  65  CVPSGTYGNRDECPCYRDWKNPKGGPKCP  93



>gb|EYU29123.1| hypothetical protein MIMGU_mgv1a017184mg [Erythranthe guttata]
Length=89

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCYRD  NSKGK KCP
Sbjct  61  CVPSGTYGNKSECPCYRDKLNSKGKSKCP  89



>ref|XP_004142881.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004156376.1| PREDICTED: snakin-1-like [Cucumis sativus]
 gb|KGN62465.1| hypothetical protein Csa_2G354910 [Cucumis sativus]
Length=85

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNKH+CPCY +LKNSKG  KCP
Sbjct  57  CVPSGTYGNKHECPCYGNLKNSKGNSKCP  85



>ref|XP_008444582.1| PREDICTED: peamaclein-like [Cucumis melo]
Length=85

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNKH+CPCY +LKNSKG  KCP
Sbjct  57  CVPSGTYGNKHECPCYGNLKNSKGNSKCP  85



>ref|XP_009800618.1| PREDICTED: peamaclein-like, partial [Nicotiana sylvestris]
Length=72

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSG YGNK +CPCYRD+ NSKGK KCP
Sbjct  44  CVPSGNYGNKSECPCYRDMLNSKGKSKCP  72



>ref|XP_002298694.2| hypothetical protein POPTR_0001s32270g, partial [Populus trichocarpa]
 gb|EEE83499.2| hypothetical protein POPTR_0001s32270g, partial [Populus trichocarpa]
Length=70

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCYRD+K  +GKPKCP
Sbjct  42  CVPSGTYGHKDECPCYRDMKTQEGKPKCP  70



>ref|NP_181486.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|O80641.1|GASA8_ARATH RecName: Full=Gibberellin-regulated protein 8; AltName: Full=GAST1 
protein homolog 8; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27845.1| similar to gibberellin-regulated proteins [Arabidopsis thaliana]
 gb|AEC09692.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=87

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT+G+K +CPCYRD+KNSKG  KCP
Sbjct  59  CVPSGTFGHKDECPCYRDMKNSKGGSKCP  87



>ref|XP_006346656.1| PREDICTED: peamaclein-like [Solanum tuberosum]
Length=69

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCYRD KNSKG PKCP
Sbjct  41  CVPSGTYGHKDECPCYRDKKNSKGGPKCP  69



>emb|CDP07216.1| unnamed protein product [Coffea canephora]
Length=88

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +C CYRD  NSKGKPKCP
Sbjct  60  CVPSGTYGNKSECRCYRDKLNSKGKPKCP  88



>gb|ABK21371.1| unknown [Picea sitchensis]
Length=117

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGT GNK +CPCYRD ++S+GKPKCP
Sbjct  88   KCVPSGTRGNKDECPCYRDKRSSQGKPKCP  117



>ref|NP_179096.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|O82328.1|GASA7_ARATH RecName: Full=Gibberellin-regulated protein 7; AltName: Full=GAST1 
protein homolog 7; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC61287.1| similar to gibberellin-regulated proteins [Arabidopsis thaliana]
 gb|AAO22720.1| putative gibberellin-regulated protein [Arabidopsis thaliana]
 gb|AAO42417.1| putative gibberellin-regulated protein [Arabidopsis thaliana]
 gb|AEC06348.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=108

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            +CVPSGTYGNKH+C CYRD  +SKG PKCP
Sbjct  79   QCVPSGTYGNKHECACYRDKLSSKGTPKCP  108



>gb|ABK21812.1| unknown [Picea sitchensis]
Length=121

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGT GNK +CPCYRD ++S+GKPKCP
Sbjct  92   KCVPSGTRGNKDECPCYRDKRSSQGKPKCP  121



>ref|XP_006662142.1| PREDICTED: gibberellin-regulated protein 12-like [Oryza brachyantha]
Length=104

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGNK +CPCY +LK  +GKPKCP
Sbjct  76   CVPSGTYGNKEECPCYNNLKTQEGKPKCP  104



>emb|CDY52417.1| BnaCnng22380D [Brassica napus]
Length=108

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNKH+C CYRD  +SK  PKCP
Sbjct  79   KCVPSGTYGNKHECACYRDKLSSKKTPKCP  108



>ref|XP_009123225.1| PREDICTED: gibberellin-regulated protein 7 isoform X1 [Brassica 
rapa]
Length=107

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNKH+C CYRD  +SK  PKCP
Sbjct  78   KCVPSGTYGNKHECACYRDKLSSKKTPKCP  107



>emb|CDY54472.1| BnaA09g52760D [Brassica napus]
Length=109

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNKH+C CYRD  +SK  PKCP
Sbjct  80   KCVPSGTYGNKHECACYRDKLSSKKTPKCP  109



>gb|KFK39992.1| hypothetical protein AALP_AA3G316000 [Arabis alpina]
Length=105

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNKH+C CYRD   SK  PKCP
Sbjct  76   KCVPSGTYGNKHECACYRDKLTSKKTPKCP  105



>ref|XP_009123227.1| PREDICTED: gibberellin-regulated protein 7 isoform X2 [Brassica 
rapa]
Length=100

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+C CYRD  +SK  PKCP
Sbjct  71  KCVPSGTYGNKHECACYRDKLSSKKTPKCP  100



>ref|XP_006298856.1| hypothetical protein CARUB_v10014971mg [Capsella rubella]
 gb|EOA31754.1| hypothetical protein CARUB_v10014971mg [Capsella rubella]
Length=108

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            +CVPSGTYGNKH+C CYRD   +KG PKCP
Sbjct  79   QCVPSGTYGNKHECACYRDKLTNKGTPKCP  108



>ref|XP_004252296.1| PREDICTED: peamaclein-like [Solanum lycopersicum]
Length=89

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT GNK +CPCYRD KNSKG PKCP
Sbjct  61  CVPSGTSGNKDECPCYRDKKNSKGGPKCP  89



>ref|XP_004252297.1| PREDICTED: peamaclein [Solanum lycopersicum]
Length=88

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           C+PSGTYG+K +CPCYRD KNSKG PKCP
Sbjct  60  CLPSGTYGHKDECPCYRDKKNSKGGPKCP  88



>ref|XP_006346618.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT GNK +CPCYRD KNSKG PKCP
Sbjct  61  CVPSGTSGNKDECPCYRDKKNSKGGPKCP  89



>ref|XP_002969375.1| hypothetical protein SELMODRAFT_440818 [Selaginella moellendorffii]
 gb|EFJ29463.1| hypothetical protein SELMODRAFT_440818 [Selaginella moellendorffii]
Length=101

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSG YGNK +C CYRD KNSKGK KCP
Sbjct  73   CVPSGHYGNKDECSCYRDKKNSKGKAKCP  101



>ref|XP_011097237.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=94

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  12  PSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           PSGTYGNK +CPCYRD+ NSKGK KCP
Sbjct  68  PSGTYGNKSECPCYRDMLNSKGKSKCP  94



>ref|XP_004986740.1| PREDICTED: gibberellin-regulated protein 12-like [Setaria italica]
Length=101

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGNK +CPCY ++KN +G PKCP
Sbjct  73   CVPSGTYGNKEECPCYNNMKNKEGGPKCP  101



>ref|XP_003613454.1| Gibberellin induced protein [Medicago truncatula]
 gb|AES96412.1| Thionin-like protein [Medicago truncatula]
Length=92

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCY + KN KG PKCP
Sbjct  64  CVPSGTYGNKEECPCYNNWKNKKGGPKCP  92



>ref|XP_010547967.1| PREDICTED: peamaclein [Tarenaya hassleriana]
Length=105

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGT GNKH+C CYRD  +SKG PKCP
Sbjct  76   KCVPSGTSGNKHECACYRDKLSSKGTPKCP  105



>ref|XP_002973082.1| hypothetical protein SELMODRAFT_99264 [Selaginella moellendorffii]
 gb|EFJ25456.1| hypothetical protein SELMODRAFT_99264 [Selaginella moellendorffii]
Length=68

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVP GTYGNK  CPCY +LKNSKG PKCP
Sbjct  40  CVPPGTYGNKETCPCYNNLKNSKGGPKCP  68



>ref|XP_002970705.1| hypothetical protein SELMODRAFT_94072, partial [Selaginella moellendorffii]
 gb|EFJ28031.1| hypothetical protein SELMODRAFT_94072, partial [Selaginella moellendorffii]
Length=59

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSG YGNK +C CYRD KNSKGK KCP
Sbjct  31  CVPSGHYGNKDECSCYRDKKNSKGKAKCP  59



>ref|XP_002976786.1| hypothetical protein SELMODRAFT_105504, partial [Selaginella 
moellendorffii]
 gb|EFJ22455.1| hypothetical protein SELMODRAFT_105504, partial [Selaginella 
moellendorffii]
Length=61

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVP GTYGNK  CPCY +LKNSKG PKCP
Sbjct  33  CVPPGTYGNKETCPCYNNLKNSKGGPKCP  61



>ref|XP_008787135.1| PREDICTED: peamaclein-like [Phoenix dactylifera]
Length=92

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 2/32 (6%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRD--LKNSKGKPKCP  92
           KCVPSGTYGNK +CPCYRD   KN K KPKCP
Sbjct  61  KCVPSGTYGNKDECPCYRDKVTKNDKKKPKCP  92



>ref|XP_007018557.1| Gibberellin-regulated family protein [Theobroma cacao]
 gb|EOY15782.1| Gibberellin-regulated family protein [Theobroma cacao]
Length=95

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  9   VPSGTYGNKHQCPCYRDLKNSKGK  80
           VPSGTYGNK +CPCYRD+KNSKG+
Sbjct  61  VPSGTYGNKQECPCYRDMKNSKGQ  84



>ref|XP_006409618.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
 gb|ESQ51071.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
Length=107

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNK +C CYRD  +SK  PKCP
Sbjct  78   KCVPSGTYGNKDECACYRDKLSSKMTPKCP  107



>ref|XP_006409619.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
 gb|ESQ51072.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
Length=112

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            KCVPSGTYGNK +C CYRD  +SK  PKCP
Sbjct  83   KCVPSGTYGNKDECACYRDKLSSKMTPKCP  112



>ref|XP_006649745.1| PREDICTED: gibberellin-regulated protein 12-like [Oryza brachyantha]
Length=101

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYG+K +CPCY ++K+S+G PKCP
Sbjct  73   CVPSGTYGHKEECPCYNNMKSSQGNPKCP  101



>emb|CDY27104.1| BnaA08g07420D [Brassica napus]
Length=105

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYG+K +CPCY +LK  +G+PKCP
Sbjct  77   CVPSGTYGHKEECPCYNNLKTKEGEPKCP  105



>ref|XP_002467388.1| hypothetical protein SORBIDRAFT_01g026925 [Sorghum bicolor]
 gb|EER94386.1| hypothetical protein SORBIDRAFT_01g026925 [Sorghum bicolor]
Length=127

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGNK +CPCY +LK  +G PKCP
Sbjct  99   CVPSGTYGNKEECPCYDNLKTKEGGPKCP  127



>emb|CDY46336.1| BnaC01g30340D [Brassica napus]
Length=104

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGNK +CPCY + K  +G PKCP
Sbjct  76   CVPSGTYGNKEECPCYNNWKTQEGGPKCP  104



>ref|XP_009106131.1| PREDICTED: gibberellin-regulated protein 12-like [Brassica rapa]
 emb|CDY18069.1| BnaA01g23300D [Brassica napus]
Length=104

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGNK +CPCY + K  +G PKCP
Sbjct  76   CVPSGTYGNKQECPCYNNWKTQEGGPKCP  104



>gb|AFK37530.1| unknown [Lotus japonicus]
Length=92

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY D K  KG PKCP
Sbjct  64  CVPSGTYGHKEECPCYNDWKTKKGGPKCP  92



>ref|XP_008659198.1| PREDICTED: gibberellin-regulated protein 12 [Zea mays]
 tpg|DAA46650.1| TPA: hypothetical protein ZEAMMB73_484923 [Zea mays]
Length=105

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGNK +CPCY ++K  +G PKCP
Sbjct  77   CVPSGTYGNKEECPCYDNMKTKQGGPKCP  105



>ref|XP_010236530.1| PREDICTED: gibberellin-regulated protein 5-like [Brachypodium 
distachyon]
Length=116

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGT GNK +CPCY ++K  +GKPKCP
Sbjct  88   CVPSGTVGNKEECPCYNNMKTQEGKPKCP  116



>ref|XP_003613456.1| Gibberellin-regulated protein [Medicago truncatula]
 gb|AES96414.1| Thionin-like protein [Medicago truncatula]
Length=92

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY +LK  +G PKCP
Sbjct  64  CVPSGTYGHKEECPCYANLKTHEGGPKCP  92



>gb|AES96393.2| GASA/GAST/Snakin [Medicago truncatula]
Length=83

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCY + +N  G PKCP
Sbjct  55  CVPSGTYGNKQECPCYDNWRNKNGGPKCP  83



>ref|XP_010273304.1| PREDICTED: uncharacterized protein LOC104608881 isoform X2 [Nelumbo 
nucifera]
Length=787

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVP GTYGNK  CPCY + K  +G PKCP
Sbjct  759  CVPPGTYGNKQFCPCYNNWKTKRGGPKCP  787



>ref|XP_003629688.1| Gibberellin induced protein [Medicago truncatula]
 gb|AET04164.1| gibberellin-regulated family protein [Medicago truncatula]
Length=95

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  9   VPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           VPSGTYGNK +CPCY + K  +GKPKCP
Sbjct  68  VPSGTYGNKQECPCYNNWKTKEGKPKCP  95



>ref|XP_006380659.1| hypothetical protein POPTR_0007s10250g [Populus trichocarpa]
 gb|ERP58456.1| hypothetical protein POPTR_0007s10250g [Populus trichocarpa]
Length=102

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  9    VPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            VPSGTYGNK +CPCYRD  NSKG  KCP
Sbjct  75   VPSGTYGNKSECPCYRDKLNSKGTSKCP  102



>ref|XP_010273303.1| PREDICTED: uncharacterized protein LOC104608881 isoform X1 [Nelumbo 
nucifera]
Length=810

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVP GTYGNK  CPCY + K  +G PKCP
Sbjct  782  CVPPGTYGNKQFCPCYNNWKTKRGGPKCP  810



>ref|XP_003613435.1| GAST1 [Medicago truncatula]
Length=92

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCY + +N  G PKCP
Sbjct  64  CVPSGTYGNKQECPCYDNWRNKNGGPKCP  92



>gb|EMT22213.1| hypothetical protein F775_13483 [Aegilops tauschii]
Length=78

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT GNK +CPCY +LK   GKPKCP
Sbjct  50  CVPSGTVGNKEECPCYNNLKTQDGKPKCP  78



>ref|XP_006601874.1| PREDICTED: gibberellin-regulated protein 12-like [Glycine max]
Length=92

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY + K +KG PKCP
Sbjct  64  CVPSGTYGHKEECPCYNNWKTNKGTPKCP  92



>ref|XP_010038994.1| PREDICTED: gibberellin-regulated protein 12 [Eucalyptus grandis]
 gb|KCW48453.1| hypothetical protein EUGRSUZ_K02150 [Eucalyptus grandis]
Length=96

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY + K  +GKPKCP
Sbjct  68  CVPSGTYGHKEECPCYNNWKTKEGKPKCP  96



>ref|XP_010685206.1| PREDICTED: peamaclein-like [Beta vulgaris subsp. vulgaris]
Length=104

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVP G +G+K+QCPCYRD+KN++G+ KCP
Sbjct  76   CVPYGPFGDKNQCPCYRDIKNNEGESKCP  104



>ref|XP_002879804.1| hypothetical protein ARALYDRAFT_482976 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56063.1| hypothetical protein ARALYDRAFT_482976 [Arabidopsis lyrata subsp. 
lyrata]
Length=81

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +3

Query  12  PSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           PS T+GNK +CPCYRD+KNSKG  KCP
Sbjct  55  PSDTFGNKDECPCYRDMKNSKGGSKCP  81



>ref|XP_009383413.1| PREDICTED: gibberellin-regulated protein 12 [Musa acuminata subsp. 
malaccensis]
Length=73

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY + K  +GKPKCP
Sbjct  45  CVPSGTYGHKEECPCYNNWKTKEGKPKCP  73



>ref|XP_009108078.1| PREDICTED: gibberellin-regulated protein 12-like [Brassica rapa]
Length=106

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYG+K +CPCY +LK   G PKCP
Sbjct  78   CVPSGTYGHKEECPCYNNLKTKDGGPKCP  106



>ref|XP_004517034.1| PREDICTED: gibberellin-regulated protein 12-like [Cicer arietinum]
Length=92

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY + K  KG PKCP
Sbjct  64  CVPSGTYGHKEECPCYNNWKTKKGGPKCP  92



>ref|XP_007163897.1| hypothetical protein PHAVU_L007200g [Phaseolus vulgaris]
 gb|ESW35891.1| hypothetical protein PHAVU_L007200g [Phaseolus vulgaris]
Length=92

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGT GNK +CPCY + KN  G PKCP
Sbjct  64  CVPSGTVGNKEECPCYNNWKNENGGPKCP  92



>ref|XP_007034358.1| Gibberellin-regulated family protein [Theobroma cacao]
 gb|EOY05284.1| Gibberellin-regulated family protein [Theobroma cacao]
Length=132

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGN+ +CPCY ++K  +GK KCP
Sbjct  104  CVPSGTYGNREECPCYNNIKTKEGKNKCP  132



>ref|XP_004140359.1| PREDICTED: protein RSI-1-like [Cucumis sativus]
Length=122

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGNK +CPCY + K  +G PKCP
Sbjct  94   CVPSGTYGNKQECPCYNNWKTQQGGPKCP  122



>ref|XP_006416023.1| hypothetical protein EUTSA_v10009207mg [Eutrema salsugineum]
 gb|ESQ34376.1| hypothetical protein EUTSA_v10009207mg [Eutrema salsugineum]
Length=91

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK +CPCY + KN    PKCP
Sbjct  63  CVPSGTYGNKEECPCYNNWKNKSDGPKCP  91



>ref|XP_010685204.1| PREDICTED: peamaclein-like [Beta vulgaris subsp. vulgaris]
Length=101

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
             CVPSGT GN ++CPCYRD K   G+PKCP
Sbjct  72   SCVPSGTSGNLNECPCYRDWKAPNGRPKCP  101



>gb|KHN24017.1| Protein GAST1, partial [Glycine soja]
Length=60

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY + K +KG PKCP
Sbjct  32  CVPSGTYGHKEECPCYNNWKTNKGTPKCP  60



>ref|XP_002530088.1| GAST1 protein precursor, putative [Ricinus communis]
 gb|EEF32287.1| GAST1 protein precursor, putative [Ricinus communis]
Length=116

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGNK  CPCY + K  +G PKCP
Sbjct  88   CVPSGTYGNKQTCPCYNNWKTKRGGPKCP  116



>ref|XP_002973289.1| hypothetical protein SELMODRAFT_99234, partial [Selaginella moellendorffii]
 ref|XP_002976615.1| hypothetical protein SELMODRAFT_105312, partial [Selaginella 
moellendorffii]
 gb|EFJ22284.1| hypothetical protein SELMODRAFT_105312, partial [Selaginella 
moellendorffii]
 gb|EFJ25663.1| hypothetical protein SELMODRAFT_99234, partial [Selaginella moellendorffii]
Length=60

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVP GT GNK +CPCY ++KNSKG PKCP
Sbjct  32  CVPPGTAGNKEKCPCYNNIKNSKGGPKCP  60



>gb|ABF94978.1| GAST1 protein precursor, putative [Oryza sativa Japonica Group]
Length=101

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGT GNK +CPCY +LK+S+G  KCP
Sbjct  73   CVPSGTSGNKEECPCYNNLKSSQGNSKCP  101



>ref|XP_003613442.1| GAST1 [Medicago truncatula]
 gb|AES96400.1| Thionin-like protein [Medicago truncatula]
Length=92

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY +++  +G PKCP
Sbjct  64  CVPSGTYGHKEECPCYANMRTKRGGPKCP  92



>gb|KDO41153.1| hypothetical protein CISIN_1g041400mg [Citrus sinensis]
Length=95

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY + K  +G PKCP
Sbjct  67  CVPSGTYGHKEECPCYNNWKTKEGTPKCP  95



>ref|XP_006493084.1| PREDICTED: gibberellin-regulated protein 12-like [Citrus sinensis]
Length=95

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY + K  +G PKCP
Sbjct  67  CVPSGTYGHKEECPCYNNWKTKEGTPKCP  95



>ref|XP_006829298.1| hypothetical protein AMTR_s00001p00273070 [Amborella trichopoda]
 gb|ERM96714.1| hypothetical protein AMTR_s00001p00273070 [Amborella trichopoda]
Length=87

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYGNK QCPCYRD  +    PKCP
Sbjct  59  CVPSGTYGNKDQCPCYRDKLSKNRNPKCP  87



>ref|XP_010920764.1| PREDICTED: peamaclein-like [Elaeis guineensis]
Length=90

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 24/32 (75%), Gaps = 2/32 (6%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRD--LKNSKGKPKCP  92
           KCVPSGTYGNK +CPCYRD   K    KPKCP
Sbjct  59  KCVPSGTYGNKDECPCYRDKVTKGDSKKPKCP  90



>ref|XP_006446220.1| hypothetical protein CICLE_v10017244mg [Citrus clementina]
 gb|ESR59460.1| hypothetical protein CICLE_v10017244mg [Citrus clementina]
Length=113

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVP+GTYGNK  CPCY + K  +G PKCP
Sbjct  85   CVPAGTYGNKQTCPCYNNWKTKRGGPKCP  113



>gb|KDO50409.1| hypothetical protein CISIN_1g033715mg [Citrus sinensis]
Length=113

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVP+GTYGNK  CPCY + K  +G PKCP
Sbjct  85   CVPAGTYGNKQTCPCYNNWKTKRGGPKCP  113



>ref|XP_003541683.1| PREDICTED: gibberellin-regulated protein 12-like [Glycine max]
 ref|XP_003541688.1| PREDICTED: gibberellin-regulated protein 12-like [Glycine max]
 gb|KHN09239.1| Protein GAST1 [Glycine soja]
 gb|KHN09240.1| Protein GAST1 [Glycine soja]
Length=93

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY + K  +G PKCP
Sbjct  65  CVPSGTYGHKEECPCYNNWKTKRGTPKCP  93



>gb|EYU34545.1| hypothetical protein MIMGU_mgv1a023869mg [Erythranthe guttata]
Length=100

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  9   VPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           VPSGT GNK +CPC RD+ NSKGK KCP
Sbjct  73  VPSGTSGNKSECPCCRDMVNSKGKSKCP  100



>ref|XP_006828424.1| hypothetical protein AMTR_s00060p00095260 [Amborella trichopoda]
 gb|ERM95840.1| hypothetical protein AMTR_s00060p00095260 [Amborella trichopoda]
Length=91

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVP GTYGNK  CPCY + K  +G+PKCP
Sbjct  63  CVPPGTYGNKQSCPCYNNWKTQEGRPKCP  91



>ref|XP_010274741.1| PREDICTED: protein RSI-1-like [Nelumbo nucifera]
Length=98

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVP GTYG K+ CPCY ++K  +GKPKCP
Sbjct  69  KCVPPGTYGKKNACPCYSNMKTKEGKPKCP  98



>gb|EEC79111.1| hypothetical protein OsI_19744 [Oryza sativa Indica Group]
Length=152

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVP GTYGNK  CPCY D K  +G PKCP
Sbjct  124  CVPPGTYGNKQSCPCYNDWKTKRGGPKCP  152



>ref|XP_006296776.1| hypothetical protein CARUB_v10015821mg [Capsella rubella]
 gb|EOA29674.1| hypothetical protein CARUB_v10015821mg [Capsella rubella]
Length=91

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY + K  +G PKCP
Sbjct  63  CVPSGTYGHKEECPCYNNWKTQEGGPKCP  91



>ref|XP_007034357.1| Gibberellin-regulated family protein [Theobroma cacao]
 gb|EOY05283.1| Gibberellin-regulated family protein [Theobroma cacao]
Length=123

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYGN+ +CPCY ++K  +G  KCP
Sbjct  95   CVPSGTYGNREECPCYNNIKTKEGANKCP  123



>gb|EEE58704.1| hypothetical protein OsJ_10147 [Oryza sativa Japonica Group]
Length=119

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGT GNK +CPCY +LK+S+G  KCP
Sbjct  91   CVPSGTSGNKEECPCYNNLKSSQGNSKCP  119



>gb|EEC74871.1| hypothetical protein OsI_10763 [Oryza sativa Indica Group]
Length=119

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGT GNK +CPCY +LK+S+G  KCP
Sbjct  91   CVPSGTSGNKEECPCYNNLKSSQGNSKCP  119



>ref|XP_010274082.1| PREDICTED: gibberellin-regulated protein 12 [Nelumbo nucifera]
Length=124

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYG+K +CPCY + K  +G PKCP
Sbjct  96   CVPSGTYGHKGECPCYNNWKTQRGTPKCP  124



>ref|XP_008236410.1| PREDICTED: peamaclein [Prunus mume]
Length=90

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KN KGKPKCP
Sbjct  61  KCVPSGTYGNKHECPCYRDKKNKKGKPKCP  90



>ref|XP_006395777.1| hypothetical protein EUTSA_v10005321mg [Eutrema salsugineum]
 gb|ESQ33063.1| hypothetical protein EUTSA_v10005321mg [Eutrema salsugineum]
Length=104

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVPSGTYG+K +CPCY + K  +G PKCP
Sbjct  76   CVPSGTYGHKEECPCYNNWKTHEGGPKCP  104



>gb|KFK37735.1| hypothetical protein AALP_AA3G022800 [Arabis alpina]
Length=96

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  9   VPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           VPSGTYGNK  CPCY + K  +G+PKCP
Sbjct  69  VPSGTYGNKQNCPCYNNWKTQEGRPKCP  96



>ref|XP_002518090.1| Gibberellin-regulated protein 4 precursor, putative [Ricinus 
communis]
 gb|EEF44223.1| Gibberellin-regulated protein 4 precursor, putative [Ricinus 
communis]
Length=79

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY + K  +G PKCP
Sbjct  51  CVPSGTYGHKEECPCYNNWKTKEGTPKCP  79



>ref|NP_001176009.1| Os10g0115550 [Oryza sativa Japonica Group]
 dbj|BAH94737.1| Os10g0115550 [Oryza sativa Japonica Group]
Length=117

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKP  83
            CVPSGTYGNK +CPCY ++K  +GKP
Sbjct  76   CVPSGTYGNKEECPCYNNMKTQEGKP  101



>ref|XP_002526822.1| Gibberellin-regulated protein 1 precursor, putative [Ricinus 
communis]
 gb|EEF35557.1| Gibberellin-regulated protein 1 precursor, putative [Ricinus 
communis]
Length=113

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            +CVP GTYGNKH CPCY  L+    KPKCP
Sbjct  84   QCVPPGTYGNKHVCPCYASLRTHGNKPKCP  113



>ref|XP_010045037.1| PREDICTED: protein GAST1-like [Eucalyptus grandis]
 gb|KCW87192.1| hypothetical protein EUGRSUZ_B03715 [Eucalyptus grandis]
Length=116

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVP+GTYGNK  CPCY + K  +G PKCP
Sbjct  88   CVPAGTYGNKQTCPCYNNWKTKRGGPKCP  116



>ref|NP_001234666.1| protein RSI-1 precursor [Solanum lycopersicum]
 sp|P47926.1|RSI1_SOLLC RecName: Full=Protein RSI-1; AltName: Full=TR132; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA20129.1| RSI-1 protein [Solanum lycopersicum]
 gb|AAA20130.1| RSI-1 protein [Solanum lycopersicum]
Length=96

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVP G YGNK  CPCY + K  +GKPKCP
Sbjct  68  CVPKGVYGNKQSCPCYNNWKTQEGKPKCP  96



>ref|XP_002979611.1| hypothetical protein SELMODRAFT_419248 [Selaginella moellendorffii]
 gb|EFJ19500.1| hypothetical protein SELMODRAFT_419248 [Selaginella moellendorffii]
Length=106

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVP G YGNK  CPCY ++KN++G PKCP
Sbjct  78   CVPPGFYGNKQVCPCYNNMKNARGGPKCP  106



>ref|XP_009381473.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=94

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 3/33 (9%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKG---KPKCP  92
           +CVPSGTYGNK +CPCYRD    +G   +PKCP
Sbjct  62  RCVPSGTYGNKDECPCYRDKYTGEGVRRRPKCP  94



>ref|XP_002977665.1| hypothetical protein SELMODRAFT_417581 [Selaginella moellendorffii]
 gb|EFJ21003.1| hypothetical protein SELMODRAFT_417581 [Selaginella moellendorffii]
Length=106

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6    CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
            CVP G YGNK  CPCY ++KN++G PKCP
Sbjct  78   CVPPGFYGNKQVCPCYNNMKNARGGPKCP  106



>ref|XP_006420919.1| hypothetical protein CICLE_v10006668mg, partial [Citrus clementina]
 gb|ESR34159.1| hypothetical protein CICLE_v10006668mg, partial [Citrus clementina]
Length=70

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   CVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           CVPSGTYG+K +CPCY + K  +G PKCP
Sbjct  42  CVPSGTYGHKEECPCYNNWKTKEGTPKCP  70



>ref|XP_007200798.1| hypothetical protein PRUPE_ppa024899mg [Prunus persica]
 gb|EMJ01997.1| hypothetical protein PRUPE_ppa024899mg [Prunus persica]
Length=91

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  3   KCVPSGTYGNKHQCPCYRDLKNSKGKPKCP  92
           KCVPSGTYGNKH+CPCYRD KN KGKPKCP
Sbjct  62  KCVPSGTYGNKHECPCYRDKKNKKGKPKCP  91



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 523223486973