BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20325_g1_i3 len=764 path=[1:0-110 2173:111-168 3048:169-290
3170:291-420 3300:421-421 112:422-763]

Length=764
                                                                      Score     E

ref|XP_004496906.1|  PREDICTED: snakin-1-like                         66.2    8e-11   
gb|AFT92001.1|  gibberellin-regulated protein                         65.9    1e-10   
gb|AFT92002.1|  gibberellin-regulated protein                         65.9    1e-10   
ref|XP_011029030.1|  PREDICTED: peamaclein-like                       64.7    4e-10   
ref|XP_010315202.1|  PREDICTED: peamaclein                            64.7    4e-10   
ref|XP_006346334.1|  PREDICTED: snakin-1-like                         64.3    4e-10   
ref|XP_006374850.1|  hypothetical protein POPTR_0014s02030g           64.3    5e-10   
ref|XP_002518646.1|  GAST1 protein precursor, putative                63.5    9e-10   Ricinus communis
ref|XP_011069770.1|  PREDICTED: peamaclein-like                       63.5    1e-09   
ref|XP_010028389.1|  PREDICTED: peamaclein-like                       62.4    3e-09   
ref|XP_002510126.1|  GAST1 protein precursor, putative                62.0    3e-09   Ricinus communis
ref|XP_004499015.1|  PREDICTED: snakin-1-like                         62.0    3e-09   
gb|KEH44041.1|  gibberellin-regulated family protein                  61.2    6e-09   
gb|KCW68672.1|  hypothetical protein EUGRSUZ_F02269                   61.2    8e-09   
gb|KHN42338.1|  Snakin-1                                              60.8    9e-09   
ref|XP_010105475.1|  hypothetical protein L484_010255                 60.8    1e-08   
ref|XP_007143086.1|  hypothetical protein PHAVU_007G042400g           60.5    1e-08   
ref|XP_003536595.1|  PREDICTED: snakin-1                              60.5    1e-08   
ref|NP_001237325.1|  uncharacterized protein LOC100527527 precursor   60.1    2e-08   
ref|XP_003550315.1|  PREDICTED: snakin-1                              59.7    2e-08   
gb|EYU37603.1|  hypothetical protein MIMGU_mgv1a024675mg              59.7    2e-08   
ref|XP_009339505.1|  PREDICTED: peamaclein-like                       59.7    3e-08   
gb|ACU13365.1|  unknown                                               59.3    4e-08   Glycine max [soybeans]
ref|XP_010271646.1|  PREDICTED: peamaclein-like                       59.3    4e-08   
emb|CDY50148.1|  BnaA01g26080D                                        59.3    4e-08   
gb|KFK39992.1|  hypothetical protein AALP_AA3G316000                  59.3    5e-08   
ref|XP_008236410.1|  PREDICTED: peamaclein                            58.9    5e-08   
gb|KHG20586.1|  Snakin-1                                              58.9    5e-08   
ref|XP_007200798.1|  hypothetical protein PRUPE_ppa024899mg           58.9    5e-08   
gb|ABK94917.1|  unknown                                               58.9    5e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008346370.1|  PREDICTED: peamaclein-like                       58.5    6e-08   
ref|NP_001236984.1|  uncharacterized protein LOC100500113             59.3    6e-08   
ref|XP_010066166.1|  PREDICTED: peamaclein-like                       58.5    6e-08   
ref|XP_002524960.1|  conserved hypothetical protein                   58.5    7e-08   Ricinus communis
gb|EYU25492.1|  hypothetical protein MIMGU_mgv1a017072mg              58.5    8e-08   
ref|XP_007160892.1|  hypothetical protein PHAVU_001G025800g           58.5    8e-08   
ref|XP_007136735.1|  hypothetical protein PHAVU_009G069900g           58.2    1e-07   
gb|AAY51975.1|  GIR1                                                  58.2    1e-07   Vigna radiata [mung bean]
ref|XP_006406493.1|  hypothetical protein EUTSA_v10022254mg           57.4    1e-07   
gb|AGE15502.1|  GA-stimulated transcript-like protein 6               57.8    1e-07   
ref|XP_009135633.1|  PREDICTED: peamaclein-like                       58.2    1e-07   
gb|KHN21405.1|  Snakin-1                                              57.8    1e-07   
ref|XP_002285141.1|  PREDICTED: peamaclein                            57.8    1e-07   Vitis vinifera
gb|KDP41652.1|  hypothetical protein JCGZ_16059                       57.8    1e-07   
ref|XP_010519291.1|  PREDICTED: peamaclein-like                       57.8    2e-07   
gb|KFK39277.1|  hypothetical protein AALP_AA3G223500                  57.0    2e-07   
ref|XP_004152264.1|  PREDICTED: snakin-1-like                         57.4    2e-07   
gb|KHF99282.1|  Snakin-1                                              57.4    2e-07   
ref|XP_002300251.2|  hypothetical protein POPTR_0001s30500g           57.0    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004289740.1|  PREDICTED: snakin-1-like                         57.0    2e-07   
emb|CDY22975.1|  BnaC03g40940D                                        57.4    2e-07   
ref|XP_011069570.1|  PREDICTED: peamaclein                            57.0    3e-07   
gb|EYU22941.1|  hypothetical protein MIMGU_mgv1a022909mg              57.0    3e-07   
gb|KCW63655.1|  hypothetical protein EUGRSUZ_G01294                   57.4    3e-07   
ref|XP_002313889.2|  hypothetical protein POPTR_0009s09560g           56.6    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010065940.1|  PREDICTED: peamaclein-like                       56.6    4e-07   
ref|XP_006829298.1|  hypothetical protein AMTR_s00001p00273070        56.2    5e-07   
gb|AFK41274.1|  unknown                                               56.2    5e-07   
ref|XP_010920764.1|  PREDICTED: peamaclein-like                       56.2    5e-07   
ref|XP_007042576.1|  Uncharacterized protein TCM_007177               56.2    5e-07   
ref|XP_004142881.1|  PREDICTED: snakin-1-like                         56.2    5e-07   
ref|XP_010685204.1|  PREDICTED: peamaclein-like                       56.2    5e-07   
gb|EPS58046.1|  hypothetical protein M569_16773                       56.2    6e-07   
ref|XP_009795533.1|  PREDICTED: snakin-1                              55.8    6e-07   
ref|XP_009620159.1|  PREDICTED: snakin-1                              55.8    6e-07   
ref|XP_008444582.1|  PREDICTED: peamaclein-like                       55.8    6e-07   
ref|XP_010443767.1|  PREDICTED: gibberellin-regulated protein 10-...  55.8    6e-07   
ref|XP_003525918.1|  PREDICTED: snakin-1                              55.8    7e-07   
gb|AGE15499.1|  GA-stimulated transcript-like protein 3               55.8    7e-07   
ref|XP_011074384.1|  PREDICTED: peamaclein-like                       55.8    8e-07   
ref|XP_009123225.1|  PREDICTED: gibberellin-regulated protein 7 i...  55.8    8e-07   
ref|XP_009123227.1|  PREDICTED: gibberellin-regulated protein 7 i...  55.8    9e-07   
emb|CDY54472.1|  BnaA09g52760D                                        55.8    9e-07   
emb|CDY52417.1|  BnaCnng22380D                                        55.8    9e-07   
ref|XP_010556423.1|  PREDICTED: peamaclein                            55.5    9e-07   
gb|KGN52784.1|  hypothetical protein Csa_4G001520                     58.9    1e-06   
gb|ABQ42622.1|  snakin-1                                              55.5    1e-06   Solanum chacoense
ref|XP_010099066.1|  hypothetical protein L484_011500                 55.1    1e-06   
ref|XP_006361222.1|  PREDICTED: snakin-1-like                         55.1    1e-06   
emb|CBI33733.3|  unnamed protein product                              54.7    1e-06   
ref|XP_002283986.1|  PREDICTED: snakin-1-like                         55.8    1e-06   Vitis vinifera
ref|XP_009380091.1|  PREDICTED: peamaclein-like                       55.1    2e-06   
ref|XP_010517902.1|  PREDICTED: gibberellin-regulated protein 7       55.1    2e-06   
emb|CDP01230.1|  unnamed protein product                              54.7    2e-06   
ref|XP_009404126.1|  PREDICTED: peamaclein-like                       54.7    2e-06   
ref|XP_004141992.1|  PREDICTED: snakin-1-like                         54.7    2e-06   
ref|XP_006422868.1|  hypothetical protein CICLE_v10029695mg           54.3    2e-06   
ref|XP_006281389.1|  hypothetical protein CARUB_v10027450mg           54.3    2e-06   
ref|XP_009354124.1|  PREDICTED: peamaclein-like isoform X2            54.3    2e-06   
ref|XP_008440339.1|  PREDICTED: peamaclein-like                       54.3    2e-06   
ref|XP_004252296.1|  PREDICTED: peamaclein-like                       54.3    3e-06   
ref|XP_009126643.1|  PREDICTED: gibberellin-regulated protein 10      54.3    3e-06   
ref|XP_010059861.1|  PREDICTED: peamaclein                            54.3    3e-06   
ref|XP_006472264.1|  PREDICTED: snakin-1-like                         54.3    3e-06   
ref|XP_006433597.1|  hypothetical protein CICLE_v10002979mg           53.9    3e-06   
ref|XP_010028136.1|  PREDICTED: peamaclein-like                       54.3    3e-06   
ref|XP_006409618.1|  hypothetical protein EUTSA_v10022920mg           54.3    3e-06   
ref|XP_006298856.1|  hypothetical protein CARUB_v10014971mg           54.3    3e-06   
ref|XP_008792652.1|  PREDICTED: peamaclein-like                       53.9    3e-06   
ref|XP_006409619.1|  hypothetical protein EUTSA_v10022920mg           54.3    3e-06   
ref|NP_179096.1|  gibberellin-regulated protein                       54.3    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883868.1|  gibberellin-regulated family protein             53.9    4e-06   
ref|XP_002271730.2|  PREDICTED: snakin-1                              54.7    4e-06   Vitis vinifera
gb|ABQ42621.1|  snakin-1                                              53.5    4e-06   Solanum bulbocastanum [ornamental nightshade]
ref|XP_006362074.1|  PREDICTED: snakin-1-like                         53.5    5e-06   
gb|EYU29123.1|  hypothetical protein MIMGU_mgv1a017184mg              53.5    5e-06   
ref|XP_011069640.1|  PREDICTED: peamaclein-like                       53.5    5e-06   
ref|XP_009403760.1|  PREDICTED: peamaclein-like                       53.5    5e-06   
sp|Q948Z4.1|SNAK1_SOLTU  RecName: Full=Snakin-1; Flags: Precursor     53.1    6e-06   Solanum tuberosum [potatoes]
ref|XP_007047444.1|  Gibberellin-regulated family protein, putative   53.5    6e-06   
ref|NP_181486.1|  gibberellin-regulated protein                       53.1    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010066158.1|  PREDICTED: peamaclein-like                       53.1    6e-06   
ref|XP_006346656.1|  PREDICTED: peamaclein-like                       52.8    6e-06   
ref|XP_009354123.1|  PREDICTED: peamaclein-like isoform X1            53.1    7e-06   
emb|CBI22497.3|  unnamed protein product                              53.1    7e-06   
ref|XP_009136261.1|  PREDICTED: gibberellin-regulated protein 7-like  53.5    7e-06   
emb|CDX89647.1|  BnaC03g45610D                                        53.5    7e-06   
ref|XP_006486958.1|  PREDICTED: snakin-1-like                         53.1    7e-06   
ref|XP_008787135.1|  PREDICTED: peamaclein-like                       53.1    7e-06   
ref|XP_006346618.1|  PREDICTED: snakin-1-like                         53.1    8e-06   
ref|XP_010467274.1|  PREDICTED: gibberellin-regulated protein 7-like  53.1    8e-06   
ref|XP_010320309.1|  PREDICTED: LOW QUALITY PROTEIN: snakin-1-like    52.8    9e-06   
ref|XP_010488933.1|  PREDICTED: gibberellin-regulated protein 7-like  53.1    9e-06   
emb|CDY31590.1|  BnaA10g12810D                                        52.8    9e-06   
ref|XP_008360977.1|  PREDICTED: peamaclein                            52.8    1e-05   
ref|XP_004290947.1|  PREDICTED: peamaclein-like                       52.8    1e-05   
ref|XP_010906256.1|  PREDICTED: peamaclein-like                       52.8    1e-05   
ref|XP_009360284.1|  PREDICTED: peamaclein                            52.4    1e-05   
emb|CDX93153.1|  BnaA03g38750D                                        52.8    1e-05   
ref|XP_003559125.1|  PREDICTED: peamaclein-like                       52.4    1e-05   
ref|XP_009120506.1|  PREDICTED: gibberellin-regulated protein 10-...  52.4    1e-05   
ref|NP_001149636.1|  gibberellin-regulated protein 2 precursor        52.4    1e-05   Zea mays [maize]
ref|XP_003636819.1|  Snakin-1                                         52.0    1e-05   
ref|XP_008377985.1|  PREDICTED: peamaclein                            52.0    2e-05   
ref|NP_001183511.1|  gibberellin-regulated protein 2 precursor        52.4    2e-05   
gb|ACG44951.1|  gibberellin-regulated protein 2 precursor             52.4    2e-05   Zea mays [maize]
ref|XP_007223838.1|  hypothetical protein PRUPE_ppa014086mg           52.0    2e-05   
ref|XP_010688303.1|  PREDICTED: peamaclein                            52.0    2e-05   
ref|XP_009773391.1|  PREDICTED: peamaclein-like                       52.0    2e-05   
ref|XP_009120505.1|  PREDICTED: gibberellin-regulated protein 10-...  52.0    2e-05   
emb|CDY31591.1|  BnaA10g12800D                                        52.0    2e-05   
emb|CDX80223.1|  BnaC09g35190D                                        52.0    2e-05   
ref|XP_010909081.1|  PREDICTED: peamaclein-like                       52.0    2e-05   
ref|XP_009403087.1|  PREDICTED: peamaclein-like                       51.6    2e-05   
emb|CDP07216.1|  unnamed protein product                              51.6    2e-05   
gb|EYU29122.1|  hypothetical protein MIMGU_mgv1a017256mg              51.6    2e-05   
ref|XP_009591073.1|  PREDICTED: peamaclein-like                       51.6    2e-05   
ref|XP_006400907.1|  hypothetical protein EUTSA_v10015142mg           51.6    3e-05   
ref|XP_004159914.1|  PREDICTED: snakin-1-like                         51.6    3e-05   
gb|EMT21443.1|  hypothetical protein F775_31764                       51.6    3e-05   
ref|XP_004252297.1|  PREDICTED: peamaclein                            51.6    3e-05   
ref|XP_002864654.1|  gibberellin-regulated family protein             51.2    4e-05   
gb|KFK27525.1|  hypothetical protein AALP_AA8G394700                  50.8    4e-05   
ref|XP_003559118.1|  PREDICTED: peamaclein-like                       50.8    5e-05   
dbj|BAB08352.1|  unnamed protein product                              50.8    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568914.1|  gibberellin-regulated protein                       50.8    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002973082.1|  hypothetical protein SELMODRAFT_99264            50.4    5e-05   
gb|EMS63633.1|  hypothetical protein TRIUR3_22813                     50.8    5e-05   
ref|XP_004136951.1|  PREDICTED: snakin-1-like                         50.4    5e-05   
ref|XP_009414177.1|  PREDICTED: gibberellin-regulated protein 5-l...  51.2    5e-05   
sp|P86888.1|PMLN_PRUPE  RecName: Full=Peamaclein; AltName: Allerg...  50.1    6e-05   
ref|XP_004501536.1|  PREDICTED: peamaclein-like                       50.4    6e-05   
ref|XP_008778332.1|  PREDICTED: peamaclein-like                       50.4    6e-05   
gb|KDP32030.1|  hypothetical protein JCGZ_12491                       49.7    9e-05   
ref|XP_009131966.1|  PREDICTED: gibberellin-regulated protein 10-...  50.1    9e-05   
ref|XP_002463849.1|  hypothetical protein SORBIDRAFT_01g007360        50.1    9e-05   Sorghum bicolor [broomcorn]
emb|CDX80222.1|  BnaC09g35200D                                        50.1    1e-04   
ref|XP_009381473.1|  PREDICTED: peamaclein-like                       50.1    1e-04   
emb|CDX71072.1|  BnaC03g11560D                                        49.7    1e-04   
gb|ACJ68116.1|  hypothetical protein                                  49.7    1e-04   Brassica napus [oilseed rape]
ref|XP_009617608.1|  PREDICTED: peamaclein-like                       49.7    1e-04   
gb|EMS63632.1|  hypothetical protein TRIUR3_22812                     49.7    1e-04   
ref|NP_001051348.1|  Os03g0760800                                     49.3    2e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CDX88727.1|  BnaA03g09220D                                        49.3    2e-04   
gb|EMS47698.1|  hypothetical protein TRIUR3_08559                     49.3    2e-04   
gb|ACR37248.1|  unknown                                               48.9    3e-04   Zea mays [maize]
ref|XP_006650629.1|  PREDICTED: snakin-1-like                         48.9    3e-04   
ref|XP_002986081.1|  hypothetical protein SELMODRAFT_123391           48.1    3e-04   
ref|XP_002982001.1|  hypothetical protein SELMODRAFT_115445           48.1    3e-04   
ref|XP_009414179.1|  PREDICTED: gibberellin-regulated protein 5-l...  48.9    4e-04   
gb|EMT21444.1|  hypothetical protein F775_43887                       48.5    4e-04   
gb|ABK22434.1|  unknown                                               48.1    6e-04   Picea sitchensis
gb|ABK25287.1|  unknown                                               48.1    6e-04   Picea sitchensis
ref|XP_002976786.1|  hypothetical protein SELMODRAFT_105504           47.0    7e-04   
ref|XP_004981680.1|  PREDICTED: snakin-1-like                         47.4    7e-04   



>ref|XP_004496906.1| PREDICTED: snakin-1-like [Cicer arietinum]
Length=89

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             YCS KCS RC+KAGV+DRC+KYCE+CCA+CKCVPSGT
Sbjct  29   SYCSNKCSDRCSKAGVQDRCVKYCEICCAQCKCVPSGT  66



>gb|AFT92001.1| gibberellin-regulated protein [Populus tomentosa]
 gb|AFT92013.1| gibberellin-regulated protein [Populus tomentosa]
Length=88

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 43/77 (56%), Gaps = 14/77 (18%)
 Frame = -3

Query  231  PTS*ASILFCLVVDGRIDLycnayniyiyiCMDVLIGIVGYCSGKCSGRCAKAGVKDRCI  52
            P   A  L CLV    +               +V +   G+C  KCS RC+KAG+KDRC+
Sbjct  3    PVFAAVFLLCLVFSSSL--------------FEVTMAASGFCDSKCSARCSKAGIKDRCL  48

Query  51   KYCELCCAKCKCVPSGT  1
            KYC +CC KCKCVPSGT
Sbjct  49   KYCGICCEKCKCVPSGT  65



>gb|AFT92002.1| gibberellin-regulated protein [Populus alba x Populus glandulosa]
 gb|AFT92014.1| gibberellin-regulated protein [Populus alba x Populus glandulosa]
Length=88

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 43/77 (56%), Gaps = 14/77 (18%)
 Frame = -3

Query  231  PTS*ASILFCLVVDGRIDLycnayniyiyiCMDVLIGIVGYCSGKCSGRCAKAGVKDRCI  52
            P   A  L CLV    +               +V +   G+C  KCS RC+KAG+KDRC+
Sbjct  3    PVFAAVFLLCLVFSSSL--------------FEVTMAASGFCDSKCSARCSKAGIKDRCL  48

Query  51   KYCELCCAKCKCVPSGT  1
            KYC +CC KCKCVPSGT
Sbjct  49   KYCGICCEKCKCVPSGT  65



>ref|XP_011029030.1| PREDICTED: peamaclein-like [Populus euphratica]
Length=88

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 43/77 (56%), Gaps = 14/77 (18%)
 Frame = -3

Query  231  PTS*ASILFCLVVDGRIDLycnayniyiyiCMDVLIGIVGYCSGKCSGRCAKAGVKDRCI  52
            P   A  L CLV    +               +V +   G+C  KCS RC+KAG+KDRC+
Sbjct  3    PVFAAIFLLCLVFSSSL--------------FEVTVAASGFCDSKCSVRCSKAGIKDRCL  48

Query  51   KYCELCCAKCKCVPSGT  1
            KYC +CC KCKCVPSGT
Sbjct  49   KYCGICCEKCKCVPSGT  65



>ref|XP_010315202.1| PREDICTED: peamaclein [Solanum lycopersicum]
Length=89

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            YC+ KC  RC+KAG+KDRC+KYCELCCAKCKCVP+GT
Sbjct  30   YCTQKCEARCSKAGLKDRCVKYCELCCAKCKCVPNGT  66



>ref|XP_006346334.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            YC+ KC  RC+KAG+KDRC+KYCELCCAKCKCVP+GT
Sbjct  30   YCAQKCEARCSKAGLKDRCVKYCELCCAKCKCVPNGT  66



>ref|XP_006374850.1| hypothetical protein POPTR_0014s02030g [Populus trichocarpa]
 gb|ERP52647.1| hypothetical protein POPTR_0014s02030g [Populus trichocarpa]
Length=88

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 43/77 (56%), Gaps = 14/77 (18%)
 Frame = -3

Query  231  PTS*ASILFCLVVDGRIDLycnayniyiyiCMDVLIGIVGYCSGKCSGRCAKAGVKDRCI  52
            P   A  L CLV    +               +V +   G+C  KCS RC+KAG+KDRC+
Sbjct  3    PVFAAIFLLCLVFSSSL--------------FEVTMAASGFCDSKCSVRCSKAGIKDRCL  48

Query  51   KYCELCCAKCKCVPSGT  1
            KYC +CC KCKCVPSGT
Sbjct  49   KYCGICCEKCKCVPSGT  65



>ref|XP_002518646.1| GAST1 protein precursor, putative [Ricinus communis]
 gb|EEF43571.1| GAST1 protein precursor, putative [Ricinus communis]
Length=88

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C+ KC+ RCA+AGVKDRCIKYCE+CCA+CKCVPSGT
Sbjct  29   FCANKCNDRCARAGVKDRCIKYCEICCAECKCVPSGT  65



>ref|XP_011069770.1| PREDICTED: peamaclein-like [Sesamum indicum]
 ref|XP_011069771.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=88

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            MD  + +  YC  KC  RC+KAGVKDRC+KYC +CC +CKCVPSGT
Sbjct  20   MDTTMALASYCEEKCGVRCSKAGVKDRCLKYCGICCEECKCVPSGT  65



>ref|XP_010028389.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW55129.1| hypothetical protein EUGRSUZ_I01086 [Eucalyptus grandis]
Length=87

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            M+ ++G   +C GKC  RCAKA VK RC KYC +CCA+CKCVPSGT
Sbjct  19   MEPVLGKPAFCEGKCRARCAKAKVKGRCAKYCNICCAECKCVPSGT  64



>ref|XP_002510126.1| GAST1 protein precursor, putative [Ricinus communis]
 gb|EEF52313.1| GAST1 protein precursor, putative [Ricinus communis]
Length=88

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +V +   G+C  KC  RC KAGVKDRC+KYC +CC KCKCVPSGT
Sbjct  20   FEVTVAGSGFCDSKCEKRCEKAGVKDRCLKYCGICCEKCKCVPSGT  65



>ref|XP_004499015.1| PREDICTED: snakin-1-like [Cicer arietinum]
Length=89

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  LIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            L G  G+CS KC+ RC+KAG++DRC+K+C +CC+KCKCVPSGT
Sbjct  24   LAGYEGFCSPKCAMRCSKAGMRDRCLKFCGICCSKCKCVPSGT  66



>gb|KEH44041.1| gibberellin-regulated family protein [Medicago truncatula]
Length=90

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            CS KCS RC+KAGV+DRC+KYCE+CC +CKCVPSGT
Sbjct  32   CSSKCSDRCSKAGVQDRCVKYCEICCNECKCVPSGT  67



>gb|KCW68672.1| hypothetical protein EUGRSUZ_F02269 [Eucalyptus grandis]
Length=89

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KCS RCAKAG+KDRC+KYC++CC KCKCVPSGT
Sbjct  30   FCGSKCSARCAKAGLKDRCLKYCQICCDKCKCVPSGT  66



>gb|KHN42338.1| Snakin-1 [Glycine soja]
Length=90

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             YCS KC+ RC+ AGVKDRC+KYC +CCA+CKCVPSGT
Sbjct  30   SYCSNKCADRCSSAGVKDRCVKYCGICCAECKCVPSGT  67



>ref|XP_010105475.1| hypothetical protein L484_010255 [Morus notabilis]
 gb|EXC04831.1| hypothetical protein L484_010255 [Morus notabilis]
Length=87

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 42/73 (58%), Gaps = 14/73 (19%)
 Frame = -3

Query  219  ASILFCLVVDGRIDLycnayniyiyiCMDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCE  40
            A+ L CLV+                  ++  +    +C  KC  RC+KAGVKDRC+KYC+
Sbjct  6    AAFLICLVLSSSF--------------VETTMAGSAFCDSKCEVRCSKAGVKDRCLKYCK  51

Query  39   LCCAKCKCVPSGT  1
            LCC KC+CVPSGT
Sbjct  52   LCCNKCQCVPSGT  64



>ref|XP_007143086.1| hypothetical protein PHAVU_007G042400g [Phaseolus vulgaris]
 gb|ESW15080.1| hypothetical protein PHAVU_007G042400g [Phaseolus vulgaris]
Length=90

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             YCS KCS RC+ AGVKDRC+KYC +CCA+CKCVPSGT
Sbjct  30   SYCSSKCSDRCSAAGVKDRCLKYCGICCAECKCVPSGT  67



>ref|XP_003536595.1| PREDICTED: snakin-1 [Glycine max]
 gb|KHN06785.1| Snakin-1 [Glycine soja]
Length=90

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             YCS KCS RC+ AGVKDRC++YC +CCA+CKCVPSGT
Sbjct  30   SYCSNKCSDRCSSAGVKDRCLRYCGICCAECKCVPSGT  67



>ref|NP_001237325.1| uncharacterized protein LOC100527527 precursor [Glycine max]
 gb|ACU16624.1| unknown [Glycine max]
Length=90

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             YCS KC+ RC+ AGVKDRC+KYC +CCA+CKCVPSGT
Sbjct  30   SYCSNKCADRCSSAGVKDRCVKYCGICCAECKCVPSGT  67



>ref|XP_003550315.1| PREDICTED: snakin-1 [Glycine max]
 gb|KHN45269.1| Snakin-1 [Glycine soja]
Length=88

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +V +    +CS KCS RC++AG+KDRC+K+C +CC+KC CVPSGT
Sbjct  20   FEVSMAGSAFCSSKCSKRCSRAGMKDRCMKFCGICCSKCNCVPSGT  65



>gb|EYU37603.1| hypothetical protein MIMGU_mgv1a024675mg [Erythranthe guttata]
Length=93

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  DVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            D     V YC+  C  RCA+AGVKDRC+KYC +CC KCKCVPSGT
Sbjct  26   DQSYDSVNYCASSCDLRCARAGVKDRCLKYCGICCDKCKCVPSGT  70



>ref|XP_009339505.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
 ref|XP_009339508.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
Length=88

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            + +    YCS KCS RCA AGV+DRCIKYC +CC  CKCVPSGT
Sbjct  22   MALATSPYCSDKCSTRCAVAGVRDRCIKYCGICCEACKCVPSGT  65



>gb|ACU13365.1| unknown [Glycine max]
Length=88

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +V +    +CS KCS RC++AG+KDRC+K+C +CC KC CVPSGT
Sbjct  20   FEVSMAGSAFCSSKCSKRCSRAGMKDRCMKFCGICCGKCNCVPSGT  65



>ref|XP_010271646.1| PREDICTED: peamaclein-like [Nelumbo nucifera]
Length=94

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  LIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            L    G C+ KC+GRC+KAG +DRC+KYC +CC  CKCVPSGT
Sbjct  29   LPDYTGLCTPKCNGRCSKAGYQDRCMKYCMICCQDCKCVPSGT  71



>emb|CDY50148.1| BnaA01g26080D [Brassica napus]
Length=96

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  LIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            + G+  YC  +C GRCAKAG +DRC+KYC +CC +CKCVPSGT
Sbjct  31   IRGMEVYCRSRCRGRCAKAGFQDRCLKYCGICCRQCKCVPSGT  73



>gb|KFK39992.1| hypothetical protein AALP_AA3G316000 [Arabis alpina]
Length=105

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  IVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +  +C GKC GRC +AG+KDRC+KYC +CC +CKCVPSGT
Sbjct  43   LENWCGGKCEGRCKEAGMKDRCLKYCGICCKECKCVPSGT  82



>ref|XP_008236410.1| PREDICTED: peamaclein [Prunus mume]
Length=90

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            YCS KCS RCA AGV+DRCIKYC +CC +CKCVPSGT
Sbjct  31   YCSDKCSSRCAVAGVQDRCIKYCGICCEECKCVPSGT  67



>gb|KHG20586.1| Snakin-1 [Gossypium arboreum]
Length=86

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  126  IGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            + + G+C+ KC  RC+KAG++ RC+KYC +CCAKCKCVPSGT
Sbjct  22   VSMAGFCNSKCKIRCSKAGIRARCLKYCGICCAKCKCVPSGT  63



>ref|XP_007200798.1| hypothetical protein PRUPE_ppa024899mg [Prunus persica]
 gb|EMJ01997.1| hypothetical protein PRUPE_ppa024899mg [Prunus persica]
Length=91

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            YCS KCS RCA AGV+DRCIKYC +CC +CKCVPSGT
Sbjct  32   YCSDKCSTRCAVAGVQDRCIKYCGICCEECKCVPSGT  68



>gb|ABK94917.1| unknown [Populus trichocarpa]
Length=87

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 5/51 (10%)
 Frame = -3

Query  138  MDVLIGIV-----GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +++LI +V      +C+ KC+ RCA AG++DRC+KYC +CC +CKCVPSGT
Sbjct  14   LEILIMLVISCGVAFCTKKCNTRCANAGIQDRCLKYCGICCEQCKCVPSGT  64



>ref|XP_008346370.1| PREDICTED: peamaclein-like [Malus domestica]
Length=88

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            + +    YCS KCS RCA AGV+DRC+KYC +CC  CKCVPSGT
Sbjct  22   MALATSPYCSDKCSTRCAVAGVQDRCMKYCGICCEACKCVPSGT  65



>ref|NP_001236984.1| uncharacterized protein LOC100500113 [Glycine max]
 gb|ACU14995.1| unknown [Glycine max]
Length=115

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 16/92 (17%)
 Frame = -3

Query  276  PFWSMLNNLLATQFSPTS*ASILFCLVVDGRIDLycnayniyiyiCMDVLIGIVGYCSGK  97
            P +S+L+    T+      A +L CLV+   +               +V +    +CS K
Sbjct  17   PLFSILH--CETKMKVAFVAVLLICLVLSSSL--------------FEVSMAGSAFCSSK  60

Query  96   CSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C+ RC++AG+KDRC ++C +CC+KC+CVPSGT
Sbjct  61   CAKRCSRAGMKDRCTRFCGICCSKCRCVPSGT  92



>ref|XP_010066166.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW63994.1| hypothetical protein EUGRSUZ_G01682 [Eucalyptus grandis]
Length=89

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             D  +    +C  KC+ RC+KAG KDRC++YC +CC KC+CVPSGT
Sbjct  21   FDATMAGSSFCDSKCAARCSKAGKKDRCLEYCRICCKKCQCVPSGT  66



>ref|XP_002524960.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37457.1| conserved hypothetical protein [Ricinus communis]
Length=101

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = -3

Query  213  ILFCLVVDGRIDLycnayniyiyiCMDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELC  34
            +L  L+V     L            +        YC  KC  RCA AG KDRC+KYC +C
Sbjct  9    LLIVLIVSSSF-LQSTMAAPPPTGPLTAPSPTASYCELKCGARCANAGYKDRCMKYCGIC  67

Query  33   CAKCKCVPSGT  1
            CA+CKCVPSGT
Sbjct  68   CAECKCVPSGT  78



>gb|EYU25492.1| hypothetical protein MIMGU_mgv1a017072mg [Erythranthe guttata]
Length=94

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            GYC  KC+ RC+KAGVKDRC+KYC +CC +CKCVPSGT
Sbjct  34   GYCGKKCAVRCSKAGVKDRCLKYCGICCNECKCVPSGT  71



>ref|XP_007160892.1| hypothetical protein PHAVU_001G025800g [Phaseolus vulgaris]
 gb|ESW32886.1| hypothetical protein PHAVU_001G025800g [Phaseolus vulgaris]
Length=88

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G+C+ KC+ RC+KAG+KDRC+K+C +CC+KCKCVPSGT
Sbjct  28   GFCASKCAQRCSKAGMKDRCLKFCGICCSKCKCVPSGT  65



>ref|XP_007136735.1| hypothetical protein PHAVU_009G069900g [Phaseolus vulgaris]
 gb|ESW08729.1| hypothetical protein PHAVU_009G069900g [Phaseolus vulgaris]
Length=89

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G+C  KC+ RCAKAGVKDRC+K+C +CC KC CVPSGT
Sbjct  29   GFCDSKCARRCAKAGVKDRCLKFCGICCEKCHCVPSGT  66



>gb|AAY51975.1| GIR1 [Vigna radiata]
Length=88

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G+CS KC+ RC+KAG KDRC+K C +CC+KCKCVPSGT
Sbjct  28   GFCSSKCANRCSKAGRKDRCLKLCGICCSKCKCVPSGT  65



>ref|XP_006406493.1| hypothetical protein EUTSA_v10022254mg, partial [Eutrema salsugineum]
 gb|ESQ47946.1| hypothetical protein EUTSA_v10022254mg, partial [Eutrema salsugineum]
Length=67

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  GIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G+  YC  +C  RCAKAG +DRCIKYC +CC +CKCVPSGT
Sbjct  4    GLEAYCGSRCRERCAKAGFQDRCIKYCGICCRECKCVPSGT  44



>gb|AGE15502.1| GA-stimulated transcript-like protein 6 [Gossypium hirsutum]
Length=88

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +V I    +C  KC+ RC+KAGV+DRC+KYC +CC KC CVPSGT
Sbjct  20   FEVSIAGSDFCDSKCAVRCSKAGVQDRCLKYCGICCEKCHCVPSGT  65



>ref|XP_009135633.1| PREDICTED: peamaclein-like [Brassica rapa]
Length=97

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  GIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G+  YC  +C GRC+KAG +DRCIKYC +CC +CKCVPSGT
Sbjct  34   GMGVYCGSRCRGRCSKAGFRDRCIKYCGICCRQCKCVPSGT  74



>gb|KHN21405.1| Snakin-1 [Glycine soja]
Length=88

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +V +    +CS KC+ RC++AG+KDRC ++C +CC+KC+CVPSGT
Sbjct  20   FEVSMAGSAFCSSKCAKRCSRAGMKDRCTRFCGICCSKCRCVPSGT  65



>ref|XP_002285141.1| PREDICTED: peamaclein [Vitis vinifera]
 emb|CBI19434.3| unnamed protein product [Vitis vinifera]
Length=88

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +C  KC+ RC+KAG+KDRC+KYC +CC +CKCVPSGT
Sbjct  28   SFCDSKCAARCSKAGMKDRCLKYCGICCEECKCVPSGT  65



>gb|KDP41652.1| hypothetical protein JCGZ_16059 [Jatropha curcas]
Length=88

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             ++      +C  KC  RCA AGVKDRC+KYC +CC KCKCVPSGT
Sbjct  20   FELTKAGSAFCDSKCGARCANAGVKDRCLKYCGICCEKCKCVPSGT  65



>ref|XP_010519291.1| PREDICTED: peamaclein-like [Tarenaya hassleriana]
Length=99

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  IVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +  YC  +C+GRCAKAG +DRC+KYC +CC +CKCVPSGT
Sbjct  37   LDAYCGKRCNGRCAKAGFQDRCLKYCGICCRECKCVPSGT  76



>gb|KFK39277.1| hypothetical protein AALP_AA3G223500 [Arabis alpina]
Length=63

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            YC  +C GRCAKAG +DRC+KYC +CC +CKCVPSGT
Sbjct  4    YCGSRCRGRCAKAGFQDRCLKYCGICCRQCKCVPSGT  40



>ref|XP_004152264.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004156848.1| PREDICTED: snakin-1-like [Cucumis sativus]
Length=89

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +D++     +C  KC  RC+KAGVKDRCIKYC +CC  CKCVPSGT
Sbjct  21   IDIVNAKPVFCDKKCKKRCSKAGVKDRCIKYCGICCGYCKCVPSGT  66



>gb|KHF99282.1| Snakin-1 [Gossypium arboreum]
 gb|KHF99299.1| Snakin-1 [Gossypium arboreum]
Length=88

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +V I    +C  KC+ RC+KAGV+DRC+KYC +CC KC CVPSGT
Sbjct  20   FEVSIAGSDFCDSKCAVRCSKAGVQDRCLKYCGICCEKCHCVPSGT  65



>ref|XP_002300251.2| hypothetical protein POPTR_0001s30500g [Populus trichocarpa]
 gb|EEE85056.2| hypothetical protein POPTR_0001s30500g [Populus trichocarpa]
Length=88

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  DVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            + ++    +C+ KC+ RCA AG++DRC+KYC +CC +CKCVPSGT
Sbjct  21   EPVMAKSSFCTKKCNTRCANAGIQDRCLKYCGICCEQCKCVPSGT  65



>ref|XP_004289740.1| PREDICTED: snakin-1-like [Fragaria vesca subsp. vesca]
Length=88

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
                    CS KCS RCA AGV+DRC+KYC +CC +CKCVPSGT
Sbjct  22   AFSATSSNCSNKCSNRCAVAGVQDRCLKYCGICCEECKCVPSGT  65



>emb|CDY22975.1| BnaC03g40940D [Brassica napus]
Length=97

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  GIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G+  YC  +C GRC+KAG +DRCIKYC +CC +CKCVPSGT
Sbjct  34   GMGVYCVSRCRGRCSKAGFRDRCIKYCGICCRQCKCVPSGT  74



>ref|XP_011069570.1| PREDICTED: peamaclein [Sesamum indicum]
 ref|XP_011069571.1| PREDICTED: peamaclein [Sesamum indicum]
Length=88

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +C GKCS RC+KAG +DRC+KYC +CC KC CVPSGT
Sbjct  28   SFCDGKCSVRCSKAGRQDRCLKYCGICCEKCHCVPSGT  65



>gb|EYU22941.1| hypothetical protein MIMGU_mgv1a022909mg [Erythranthe guttata]
Length=93

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  IVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            I G+C  KC+ RC+KAG ++RC++YC +CCAKC CVPSGT
Sbjct  31   ISGFCDEKCAVRCSKAGRQNRCLQYCRICCAKCNCVPSGT  70



>gb|KCW63655.1| hypothetical protein EUGRSUZ_G01294 [Eucalyptus grandis]
Length=124

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC GRCAKAGV DRC+KYC +CC +C CVPSGT
Sbjct  65   FCGNKCKGRCAKAGVMDRCVKYCNICCQECGCVPSGT  101



>ref|XP_002313889.2| hypothetical protein POPTR_0009s09560g [Populus trichocarpa]
 gb|EEE87844.2| hypothetical protein POPTR_0009s09560g [Populus trichocarpa]
Length=89

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  DVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            + ++    +C+ KC  RCA AG++DRC+KYC +CC +CKCVPSGT
Sbjct  22   EPVMAKSSFCAKKCETRCANAGIQDRCLKYCGICCEQCKCVPSGT  66



>ref|XP_010065940.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
Length=88

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC GRCAKAGV DRC+KYC +CC +C CVPSGT
Sbjct  29   FCGNKCKGRCAKAGVMDRCVKYCNICCQECGCVPSGT  65



>ref|XP_006829298.1| hypothetical protein AMTR_s00001p00273070 [Amborella trichopoda]
 gb|ERM96714.1| hypothetical protein AMTR_s00001p00273070 [Amborella trichopoda]
Length=87

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            + V +G   +C+ KC  RC+KA V DRCIKYC LCC +C CVPSGT
Sbjct  19   VPVSLGGSPFCNAKCGVRCSKAAVMDRCIKYCRLCCEECNCVPSGT  64



>gb|AFK41274.1| unknown [Lotus japonicus]
Length=90

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G+C  KC  RC+KA ++DRC+K+C +CC KCKCVPSGT
Sbjct  30   GFCDTKCEQRCSKASIQDRCLKFCGICCDKCKCVPSGT  67



>ref|XP_010920764.1| PREDICTED: peamaclein-like [Elaeis guineensis]
Length=90

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             YC  KC  RCAKAGV DRC+KYC +CC +CKCVPSGT
Sbjct  28   AYCDSKCKVRCAKAGVMDRCLKYCGMCCEECKCVPSGT  65



>ref|XP_007042576.1| Uncharacterized protein TCM_007177 [Theobroma cacao]
 gb|EOX98407.1| Uncharacterized protein TCM_007177 [Theobroma cacao]
Length=90

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  IVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +  +C GKC  RC KA V DRCIKYC LCC +CKCVPSGT
Sbjct  28   LSPFCVGKCDARCKKAAVWDRCIKYCGLCCEQCKCVPSGT  67



>ref|XP_004142881.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004156376.1| PREDICTED: snakin-1-like [Cucumis sativus]
 gb|KGN62465.1| hypothetical protein Csa_2G354910 [Cucumis sativus]
Length=85

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  GIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G  G+C  KC  RC+KAGV+DRC+KYC +CC KC CVPSGT
Sbjct  22   GAPGFCGWKCRRRCSKAGVRDRCMKYCGICCEKCGCVPSGT  62



>ref|XP_010685204.1| PREDICTED: peamaclein-like [Beta vulgaris subsp. vulgaris]
Length=101

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  DVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            D +    G+CS KC  RCA  GV  RC+KYC +CC KC CVPSGT
Sbjct  34   DTVESTTGFCSNKCGVRCALKGVNSRCMKYCMMCCGKCSCVPSGT  78



>gb|EPS58046.1| hypothetical protein M569_16773 [Genlisea aurea]
Length=94

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  VGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             G C G C  RC++AGV DRC+KYC +CCAKC CVPSGT
Sbjct  33   AGLCDGSCRSRCSRAGVVDRCLKYCGICCAKCNCVPSGT  71



>ref|XP_009795533.1| PREDICTED: snakin-1 [Nicotiana sylvestris]
Length=88

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    YC  KC  RCAKAGV DRC+KYC +CC +CKCVPSGT
Sbjct  20   IQTTMAGSSYCDSKCKLRCAKAGVMDRCLKYCGICCEECKCVPSGT  65



>ref|XP_009620159.1| PREDICTED: snakin-1 [Nicotiana tomentosiformis]
Length=88

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    YC  KC  RCAKAGV DRC+KYC +CC +CKCVPSGT
Sbjct  20   IQTTMAGSSYCDSKCKLRCAKAGVMDRCLKYCGICCEECKCVPSGT  65



>ref|XP_008444582.1| PREDICTED: peamaclein-like [Cucumis melo]
Length=85

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  GIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G  G+C  KC  RC+KAGV+DRC+KYC +CC KC CVPSGT
Sbjct  22   GAPGFCGWKCRRRCSKAGVRDRCMKYCGICCVKCGCVPSGT  62



>ref|XP_010443767.1| PREDICTED: gibberellin-regulated protein 10-like [Camelina sativa]
Length=87

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C GKC+ RC+KAG +DRC+KYC +CC KC+CVPSGT
Sbjct  29   CGGKCNVRCSKAGRQDRCLKYCNICCEKCQCVPSGT  64



>ref|XP_003525918.1| PREDICTED: snakin-1 [Glycine max]
 gb|ACU14133.1| unknown [Glycine max]
 gb|KHN45165.1| Snakin-1 [Glycine soja]
Length=88

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  DVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            ++ +    +C  KC+ RCAKAGV+DRC+++C +CC KC CVPSGT
Sbjct  21   EISMAGSPFCDSKCAQRCAKAGVQDRCLRFCGICCEKCNCVPSGT  65



>gb|AGE15499.1| GA-stimulated transcript-like protein 3 [Gossypium hirsutum]
Length=90

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC GRC KA V DRC KYC +CC +CKCVPSGT
Sbjct  31   FCEGKCKGRCNKAAVWDRCFKYCGICCEECKCVPSGT  67



>ref|XP_011074384.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=93

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             L      C  KC  RC+KAGVKDRC+KYC +CCA+CKCVPSGT
Sbjct  27   TLPAASSDCDEKCGVRCSKAGVKDRCLKYCGICCAECKCVPSGT  70



>ref|XP_009123225.1| PREDICTED: gibberellin-regulated protein 7 isoform X1 [Brassica 
rapa]
Length=107

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC  RC +AG+KDRC+KYC +CC +CKCVPSGT
Sbjct  48   WCGGKCEVRCEEAGMKDRCLKYCGICCKECKCVPSGT  84



>ref|XP_009123227.1| PREDICTED: gibberellin-regulated protein 7 isoform X2 [Brassica 
rapa]
Length=100

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC  RC +AG+KDRC+KYC +CC +CKCVPSGT
Sbjct  41   WCGGKCEVRCEEAGMKDRCLKYCGICCKECKCVPSGT  77



>emb|CDY54472.1| BnaA09g52760D [Brassica napus]
Length=109

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC  RC +AG+KDRC+KYC +CC +CKCVPSGT
Sbjct  50   WCGGKCEVRCEEAGMKDRCLKYCGICCKECKCVPSGT  86



>emb|CDY52417.1| BnaCnng22380D [Brassica napus]
Length=108

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC  RC +AG+KDRC+KYC +CC +CKCVPSGT
Sbjct  49   WCGGKCEVRCEEAGMKDRCLKYCGICCKECKCVPSGT  85



>ref|XP_010556423.1| PREDICTED: peamaclein [Tarenaya hassleriana]
Length=90

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC+ RC+KAG +DRC+KYC +CC KC CVPSGT
Sbjct  31   FCEAKCTERCSKAGRQDRCLKYCNICCEKCHCVPSGT  67



>gb|KGN52784.1| hypothetical protein Csa_4G001520 [Cucumis sativus]
Length=422

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +D++     +C  KC  RC+KAGVKDRCIKYC +CC  CKCVPSGT
Sbjct  21   IDIVNAKPVFCDKKCKKRCSKAGVKDRCIKYCGICCGYCKCVPSGT  66



>gb|ABQ42622.1| snakin-1 [Solanum chacoense]
Length=88

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            M   +    +C  KC  RC+KAG+ DRC+KYC +CC +CKCVPSGT
Sbjct  20   MQTTMAGSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGT  65



>ref|XP_010099066.1| hypothetical protein L484_011500 [Morus notabilis]
 gb|EXB76655.1| hypothetical protein L484_011500 [Morus notabilis]
Length=91

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G+C  KC+ RC+KAGV DRC+KYC +CC +C CVPSGT
Sbjct  31   GFCEDKCTTRCSKAGVLDRCMKYCGICCEQCMCVPSGT  68



>ref|XP_006361222.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  DVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +  +    YC  KCS RC KAG+K RC+KYC +CC  C CVPSGT
Sbjct  22   NAAMATSSYCDQKCSARCWKAGLKKRCLKYCGICCVACNCVPSGT  66



>emb|CBI33733.3| unnamed protein product [Vitis vinifera]
Length=67

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  IVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            + G+C  KC  RCA AGV DRC+KYC +CC +CKCVPSGT
Sbjct  5    MKGFCDSKCGVRCANAGVYDRCVKYCGICCQECKCVPSGT  44



>ref|XP_002283986.1| PREDICTED: snakin-1-like [Vitis vinifera]
Length=127

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G+C  KC  RCA AGV DRC+KYC +CC +CKCVPSGT
Sbjct  67   GFCDSKCGVRCANAGVYDRCVKYCGICCQECKCVPSGT  104



>ref|XP_009380091.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    +C  KC  RC+KA VKDRC+KYC LCC +C+CVPSGT
Sbjct  20   LQATMAGSAFCGSKCKVRCSKASVKDRCLKYCGLCCEQCRCVPSGT  65



>ref|XP_010517902.1| PREDICTED: gibberellin-regulated protein 7 [Camelina sativa]
Length=108

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC GRC +AG+KDRC+KYC +CC  C+CVPSGT
Sbjct  49   WCGQKCEGRCKEAGLKDRCLKYCGICCKDCQCVPSGT  85



>emb|CDP01230.1| unnamed protein product [Coffea canephora]
Length=88

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    +C  KC  RC+KAGV+DRC+KYC++CC +C CVPSGT
Sbjct  20   IPATMAGSSFCDSKCGVRCSKAGVQDRCLKYCKICCQECNCVPSGT  65



>ref|XP_009404126.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    +C  KC  RC+KA V+DRC+KYC LCC +C+CVPSGT
Sbjct  20   LQATMAGSAFCESKCKVRCSKASVQDRCLKYCGLCCEQCRCVPSGT  65



>ref|XP_004141992.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004163840.1| PREDICTED: snakin-1-like [Cucumis sativus]
 gb|KGN48576.1| hypothetical protein Csa_6G493840 [Cucumis sativus]
Length=95

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            G C  KC  RC  AGVKDRC+KYC LCC +CKCVPSGT
Sbjct  35   GVCDSKCGVRCLNAGVKDRCLKYCGLCCQQCKCVPSGT  72



>ref|XP_006422868.1| hypothetical protein CICLE_v10029695mg [Citrus clementina]
 gb|ESR36108.1| hypothetical protein CICLE_v10029695mg [Citrus clementina]
 gb|KDO47927.1| hypothetical protein CISIN_1g034644mg [Citrus sinensis]
Length=88

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC+ RC +AGV+DRC+KYC +CC  CKCVPSGT
Sbjct  29   FCDSKCAERCKQAGVQDRCLKYCGICCEDCKCVPSGT  65



>ref|XP_006281389.1| hypothetical protein CARUB_v10027450mg [Capsella rubella]
 gb|EOA14287.1| hypothetical protein CARUB_v10027450mg [Capsella rubella]
Length=88

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C G+C+ RC+KAG +DRC+KYC +CC KC CVPSGT
Sbjct  30   CGGRCNVRCSKAGRQDRCLKYCNICCQKCDCVPSGT  65



>ref|XP_009354124.1| PREDICTED: peamaclein-like isoform X2 [Pyrus x bretschneideri]
Length=86

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  GIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +  +C  KC  RC+KAG KDRC+++C +CC KC+CVPSGT
Sbjct  23   SMAAFCDSKCGVRCSKAGYKDRCLRFCGICCEKCQCVPSGT  63



>ref|XP_008440339.1| PREDICTED: peamaclein-like [Cucumis melo]
Length=94

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C  KC  RC  AGVKDRC+KYC LCC +CKCVPSGT
Sbjct  36   CDSKCGVRCLNAGVKDRCLKYCGLCCQQCKCVPSGT  71



>ref|XP_004252296.1| PREDICTED: peamaclein-like [Solanum lycopersicum]
Length=89

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   I    +C  KC+ RC+KAG +DRC+KYC +CCA+C CVPSGT
Sbjct  21   IPATIAGSEFCDSKCNFRCSKAGRQDRCLKYCGICCAECHCVPSGT  66



>ref|XP_009126643.1| PREDICTED: gibberellin-regulated protein 10 [Brassica rapa]
 emb|CDY09248.1| BnaA02g06740D [Brassica napus]
Length=89

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCK-CVPSGT  1
             ++     C GKC+ RC+KAG KDRC+KYC +CC KC  CVPSGT
Sbjct  22   FMLSEASPCDGKCNARCSKAGRKDRCLKYCNICCEKCNYCVPSGT  66



>ref|XP_010059861.1| PREDICTED: peamaclein [Eucalyptus grandis]
 gb|KCW66306.1| hypothetical protein EUGRSUZ_F00131 [Eucalyptus grandis]
Length=89

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             D  +    +C  KC+ RC+KAG  DRC++YC +CC KC+CVPSGT
Sbjct  21   FDAAMAGSSFCDSKCAVRCSKAGRMDRCLQYCGICCEKCQCVPSGT  66



>ref|XP_006472264.1| PREDICTED: snakin-1-like [Citrus sinensis]
 gb|KDO81573.1| hypothetical protein CISIN_1g039784mg [Citrus sinensis]
Length=88

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +V +    +C  KC+ RC+KAG +DRC+KYC +CC KC CVPSGT
Sbjct  20   FEVSMAGSDFCDSKCAVRCSKAGREDRCLKYCGICCDKCHCVPSGT  65



>ref|XP_006433597.1| hypothetical protein CICLE_v10002979mg [Citrus clementina]
 gb|ESR46837.1| hypothetical protein CICLE_v10002979mg [Citrus clementina]
 gb|KDO36540.1| hypothetical protein CISIN_1g037233mg [Citrus sinensis]
Length=88

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +V +    +C  KC+ RC+KAG +DRC+KYC +CC KC CVPSGT
Sbjct  20   FEVSMAGSDFCDSKCAVRCSKAGREDRCLKYCGICCDKCHCVPSGT  65



>ref|XP_010028136.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW54794.1| hypothetical protein EUGRSUZ_I00735 [Eucalyptus grandis]
Length=93

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C  KC  RC  AGVKDRC+KYC LCC KC+CVPSGT
Sbjct  35   CDAKCGVRCQNAGVKDRCLKYCGLCCQKCQCVPSGT  70



>ref|XP_006409618.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
 gb|ESQ51071.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
Length=107

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC  RC K+G+KDRC+ YC +CC +CKCVPSGT
Sbjct  48   WCGGKCEVRCKKSGMKDRCLNYCGICCKECKCVPSGT  84



>ref|XP_006298856.1| hypothetical protein CARUB_v10014971mg [Capsella rubella]
 gb|EOA31754.1| hypothetical protein CARUB_v10014971mg [Capsella rubella]
Length=108

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC GRC  AG+KDRC+KYC +CC  C+CVPSGT
Sbjct  49   WCGQKCEGRCKAAGMKDRCLKYCGICCKDCQCVPSGT  85



>ref|XP_008792652.1| PREDICTED: peamaclein-like [Phoenix dactylifera]
Length=91

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    +C+ KC  RC+KAGV+DRC+KYC +CC +C CVPSGT
Sbjct  20   LQATMAGSPFCNSKCKVRCSKAGVRDRCLKYCGICCEECHCVPSGT  65



>ref|XP_006409619.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
 gb|ESQ51072.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
Length=112

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC  RC K+G+KDRC+ YC +CC +CKCVPSGT
Sbjct  53   WCGGKCEVRCKKSGMKDRCLNYCGICCKECKCVPSGT  89



>ref|NP_179096.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|O82328.1|GASA7_ARATH RecName: Full=Gibberellin-regulated protein 7; AltName: Full=GAST1 
protein homolog 7; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC61287.1| similar to gibberellin-regulated proteins [Arabidopsis thaliana]
 gb|AAO22720.1| putative gibberellin-regulated protein [Arabidopsis thaliana]
 gb|AAO42417.1| putative gibberellin-regulated protein [Arabidopsis thaliana]
 gb|AEC06348.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=108

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC GRC +AG+KDRC+KYC +CC  C+CVPSGT
Sbjct  49   WCGQKCEGRCKEAGMKDRCLKYCGICCKDCQCVPSGT  85



>ref|XP_002883868.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60127.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=108

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC GRC  AG+KDRC+KYC +CC  C+CVPSGT
Sbjct  49   WCGQKCEGRCKAAGMKDRCLKYCVICCKDCQCVPSGT  85



>ref|XP_002271730.2| PREDICTED: snakin-1 [Vitis vinifera]
Length=139

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  VGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             G+C  KCS RC++A V DRC+KYC +CC +CKCVPSGT
Sbjct  78   AGFCGLKCSKRCSQAAVLDRCMKYCGICCQECKCVPSGT  116



>gb|ABQ42621.1| snakin-1 [Solanum bulbocastanum]
Length=88

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    +C  KC  RC+KAG+ DRC+KYC +CC +CKCVPSGT
Sbjct  20   IQTTMAGSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGT  65



>ref|XP_006362074.1| PREDICTED: snakin-1-like [Solanum tuberosum]
 gb|ABQ42623.1| snakin-1 [Solanum chacoense]
 gb|ABQ42624.1| snakin-1 [Solanum tuberosum]
 gb|ABQ42625.1| snakin-1 [Solanum commersonii]
 gb|ACI23371.1| snakin-1 [Solanum tuberosum]
 gb|ACI23372.1| snakin-1 [Solanum tuberosum]
 gb|ACI23373.1| snakin-1 [Solanum tuberosum]
 gb|ACI23374.1| snakin-1 [Solanum tuberosum]
 gb|ACL79835.1| Snakin-1 [Solanum tuberosum]
 gb|ACZ04322.1| snakin-1 [Solanum tuberosum]
 gb|AFQ40003.1| snakin-1 [Solanum chacoense]
 gb|AFQ40008.1| snakin-1 [Capsicum annuum]
 gb|AFQ40009.1| snakin-1 [Solanum nigrum]
 gb|AFQ40010.1| snakin-1 [Petunia x hybrida]
 gb|AFQ40011.1| snakin-1 [Nicotiana tabacum]
 gb|AFQ40012.1| snakin-1 [Solanum lycopersicum]
 gb|AFQ40013.1| snakin-1 [Solanum bulbocastanum]
 gb|AFQ40014.1| snakin-1 [Solanum palustre]
 gb|AFQ40015.1| snakin-1 [Solanum bulbocastanum]
 gb|AFQ40016.1| snakin-1 [Solanum nigrum]
Length=88

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    +C  KC  RC+KAG+ DRC+KYC +CC +CKCVPSGT
Sbjct  20   IQTTMAGSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGT  65



>gb|EYU29123.1| hypothetical protein MIMGU_mgv1a017184mg [Erythranthe guttata]
Length=89

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +C  KC  RC+KAG+K RCIKYC +CCA C CVPSGT
Sbjct  29   SFCDSKCGERCSKAGLKKRCIKYCGICCAACNCVPSGT  66



>ref|XP_011069640.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=91

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             D    +  +C GKC  RC+ A  KDRC+KYC +CC KC CVPSGT
Sbjct  23   QDPPSDLSAFCKGKCDVRCSLASRKDRCLKYCGICCTKCNCVPSGT  68



>ref|XP_009403760.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  LIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +     YC  KC  RCAKAGV DRC+ YC +CC +CKCVPSGT
Sbjct  24   MAADSAYCKSKCKVRCAKAGVMDRCLYYCGMCCEECKCVPSGT  66



>sp|Q948Z4.1|SNAK1_SOLTU RecName: Full=Snakin-1; Flags: Precursor [Solanum tuberosum]
 emb|CAC44032.1| snakin-1 [Solanum tuberosum]
Length=88

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    +C  KC  RC+KAG+ DRC+KYC +CC +CKCVPSGT
Sbjct  20   IQTTMAGSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGT  65



>ref|XP_007047444.1| Gibberellin-regulated family protein, putative [Theobroma cacao]
 gb|EOX91601.1| Gibberellin-regulated family protein, putative [Theobroma cacao]
Length=107

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C  KC  RC+KAG+KDRC+KYC +CC +C CVPSGT
Sbjct  49   CDSKCGERCSKAGIKDRCLKYCGICCRECNCVPSGT  84



>ref|NP_181486.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|O80641.1|GASA8_ARATH RecName: Full=Gibberellin-regulated protein 8; AltName: Full=GAST1 
protein homolog 8; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27845.1| similar to gibberellin-regulated proteins [Arabidopsis thaliana]
 gb|AEC09692.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=87

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
              VL      C GKC+ RC+KAG  + C+KYC +CC KC CVPSGT
Sbjct  19   FSVLSSADSSCGGKCNVRCSKAGQHEECLKYCNICCQKCNCVPSGT  64



>ref|XP_010066158.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW63991.1| hypothetical protein EUGRSUZ_G01678 [Eucalyptus grandis]
Length=89

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             D  +    +C  KC+ RC+KAG KDRC++YC + C KC+CVPSGT
Sbjct  21   FDATMAGSSFCDSKCAVRCSKAGRKDRCLEYCGIFCDKCQCVPSGT  66



>ref|XP_006346656.1| PREDICTED: peamaclein-like [Solanum tuberosum]
Length=69

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            M++      +C  KC+ RC+KAG +DRC+KYC +CC +C CVPSGT
Sbjct  1    MELCFLQEDFCDSKCNVRCSKAGRQDRCLKYCGICCEECHCVPSGT  46



>ref|XP_009354123.1| PREDICTED: peamaclein-like isoform X1 [Pyrus x bretschneideri]
Length=88

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC  RC+KAG KDRC+++C +CC KC+CVPSGT
Sbjct  29   FCDSKCGVRCSKAGYKDRCLRFCGICCEKCQCVPSGT  65



>emb|CBI22497.3| unnamed protein product [Vitis vinifera]
Length=88

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  VGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             G+C  KCS RC++A V DRC+KYC +CC +CKCVPSGT
Sbjct  27   AGFCGLKCSKRCSQAAVLDRCMKYCGICCQECKCVPSGT  65



>ref|XP_009136261.1| PREDICTED: gibberellin-regulated protein 7-like [Brassica rapa]
Length=106

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC  RC  AG+ DRC+KYC +CC +CKCVPSGT
Sbjct  47   WCGGKCEVRCKDAGMNDRCLKYCGICCKECKCVPSGT  83



>emb|CDX89647.1| BnaC03g45610D [Brassica napus]
Length=106

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC  RC  AG+ DRC+KYC +CC +CKCVPSGT
Sbjct  47   WCGGKCEVRCKDAGMNDRCLKYCGICCKECKCVPSGT  83



>ref|XP_006486958.1| PREDICTED: snakin-1-like [Citrus sinensis]
Length=88

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC+ RC  AGV+DRC+KYC +CC  CKCVPSGT
Sbjct  29   FCDSKCAERCKLAGVQDRCLKYCGICCEDCKCVPSGT  65



>ref|XP_008787135.1| PREDICTED: peamaclein-like [Phoenix dactylifera]
Length=92

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +C  KC  RCAKAGV DRC+ YC +CC +CKCVPSGT
Sbjct  30   AFCDSKCKVRCAKAGVMDRCLHYCGVCCEECKCVPSGT  67



>ref|XP_006346618.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   I    +C  KC+ RC+KAG +DRC+KYC +CC +C CVPSGT
Sbjct  21   IPATIAGSDFCDSKCNYRCSKAGRQDRCLKYCGICCTECHCVPSGT  66



>ref|XP_010467274.1| PREDICTED: gibberellin-regulated protein 7-like [Camelina sativa]
Length=108

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC  RC +AG+KDRC+KYC +CC  C+CVPSGT
Sbjct  49   WCGQKCEARCKEAGLKDRCLKYCGICCKDCQCVPSGT  85



>ref|XP_010320309.1| PREDICTED: LOW QUALITY PROTEIN: snakin-1-like [Solanum lycopersicum]
Length=88

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC  RC+KAG+ DRC+KYC +CC +CKCVPSGT
Sbjct  29   FCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGT  65



>ref|XP_010488933.1| PREDICTED: gibberellin-regulated protein 7-like [Camelina sativa]
Length=108

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC  RC +AG+KDRC+KYC +CC  C+CVPSGT
Sbjct  49   WCGQKCEARCKEAGLKDRCLKYCGICCKDCQCVPSGT  85



>emb|CDY31590.1| BnaA10g12810D [Brassica napus]
Length=92

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 2/43 (5%)
 Frame = -3

Query  123  GIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKC--KCVPSGT  1
            G    C+GKC+ RC+KAG +DRC+KYC +CC KC   CVPSGT
Sbjct  27   GDSSSCNGKCNARCSKAGRQDRCLKYCNICCEKCDDHCVPSGT  69



>ref|XP_008360977.1| PREDICTED: peamaclein [Malus domestica]
Length=88

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC  RC+KAG K+RC+KYC +CC KC CVPSGT
Sbjct  29   FCDSKCGVRCSKAGYKERCLKYCGICCEKCHCVPSGT  65



>ref|XP_004290947.1| PREDICTED: peamaclein-like [Fragaria vesca subsp. vesca]
Length=88

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC  RC+KAG K+RC+KYC +CC KC CVPSGT
Sbjct  29   FCDSKCGVRCSKAGYKERCLKYCGICCDKCNCVPSGT  65



>ref|XP_010906256.1| PREDICTED: peamaclein-like [Elaeis guineensis]
Length=91

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC  RC+KAGV+DRC+KYC +CC +C CVPSGT
Sbjct  29   FCDSKCKVRCSKAGVQDRCLKYCGICCEECHCVPSGT  65



>ref|XP_009360284.1| PREDICTED: peamaclein [Pyrus x bretschneideri]
Length=88

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC  RC+KAG K+RC+KYC +CC KC CVPSGT
Sbjct  29   FCDSKCGVRCSKAGYKERCLKYCGICCEKCHCVPSGT  65



>emb|CDX93153.1| BnaA03g38750D [Brassica napus]
Length=106

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC  RC  AG+ DRC+KYC +CC +CKCVPSGT
Sbjct  47   WCGGKCVVRCKDAGMNDRCLKYCGICCKECKCVPSGT  83



>ref|XP_003559125.1| PREDICTED: peamaclein-like [Brachypodium distachyon]
Length=93

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            V +    +C  KCS RC+KAG  D C+KYC +CCA+C CVPSGT
Sbjct  24   VSMSGSAFCDSKCSFRCSKAGRHDDCLKYCGICCAECNCVPSGT  67



>ref|XP_009120506.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=92

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKC--KCVPSGT  1
            C+GKC+ RC+KAG +DRC+KYC +CC KC   CVPSGT
Sbjct  32   CNGKCNARCSKAGRQDRCLKYCNICCEKCDDHCVPSGT  69



>ref|NP_001149636.1| gibberellin-regulated protein 2 precursor [Zea mays]
 gb|ACG36191.1| gibberellin-regulated protein 2 precursor [Zea mays]
Length=95

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            V +   G+C GKC+ RC+KA   D C+KYC +CCA C CVPSGT
Sbjct  26   VSMAGSGFCDGKCAVRCSKASRHDDCLKYCGICCATCNCVPSGT  69



>ref|XP_003636819.1| Snakin-1 [Medicago truncatula]
 ref|XP_003638468.1| Snakin-1 [Medicago truncatula]
 gb|KEH35780.1| GASA/GAST/Snakin [Medicago truncatula]
Length=85

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C+ KC+ RC+KA ++DRC+K+C +CC KC CVPSGT
Sbjct  26   FCNSKCAVRCSKASIQDRCLKFCGICCEKCNCVPSGT  62



>ref|XP_008377985.1| PREDICTED: peamaclein [Malus domestica]
 ref|XP_009354125.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
Length=88

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC  RC+KAG K+RC+++C +CC KC+CVPSGT
Sbjct  29   FCDSKCGVRCSKAGFKNRCLRFCGICCEKCQCVPSGT  65



>ref|NP_001183511.1| gibberellin-regulated protein 2 precursor [Zea mays]
 gb|ACR33840.1| unknown [Zea mays]
 gb|ACR37199.1| unknown [Zea mays]
 gb|ACR37238.1| unknown [Zea mays]
 gb|AFW67550.1| gibberellin-regulated protein 2 [Zea mays]
Length=96

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            V +   G+C GKC+ RC+KA   D C+KYC +CCA C CVPSGT
Sbjct  27   VSMAGSGFCDGKCAVRCSKASRHDDCLKYCGICCATCNCVPSGT  70



>gb|ACG44951.1| gibberellin-regulated protein 2 precursor [Zea mays]
Length=96

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            V +   G+C GKC+ RC+KA   D C+KYC +CCA C CVPSGT
Sbjct  27   VSMAGSGFCDGKCAVRCSKASRHDDCLKYCGICCATCNCVPSGT  70



>ref|XP_007223838.1| hypothetical protein PRUPE_ppa014086mg [Prunus persica]
 gb|EMJ25037.1| hypothetical protein PRUPE_ppa014086mg [Prunus persica]
Length=88

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +  +    +C  KC  RC+KAG ++RC+KYC +CC KC CVPSGT
Sbjct  20   FEATMAGSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGT  65



>ref|XP_010688303.1| PREDICTED: peamaclein [Beta vulgaris subsp. vulgaris]
Length=87

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  DVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            D       +C  KC+ RC+KAG +DRC+KYC +CC  C+CVPSGT
Sbjct  20   DSTNAGSDFCDSKCNVRCSKAGYQDRCLKYCGICCEACQCVPSGT  64



>ref|XP_009773391.1| PREDICTED: peamaclein-like [Nicotiana sylvestris]
Length=88

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    +C  KC  RC+KAG +DRC+KYC +CC +C+CVPSGT
Sbjct  20   IQTTVAGSDFCDSKCKIRCSKAGRQDRCLKYCGICCNECQCVPSGT  65



>ref|XP_009120505.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=92

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKC--KCVPSGT  1
            C+GKC+ RC+KAG +DRC+KYC +CC KC   CVPSGT
Sbjct  32   CNGKCNARCSKAGRQDRCLKYCNICCEKCDDHCVPSGT  69



>emb|CDY31591.1| BnaA10g12800D [Brassica napus]
Length=92

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKC--KCVPSGT  1
            C+GKC+ RC+KAG +DRC+KYC +CC KC   CVPSGT
Sbjct  32   CNGKCNARCSKAGRQDRCLKYCNICCEKCDDHCVPSGT  69



>emb|CDX80223.1| BnaC09g35190D [Brassica napus]
Length=92

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKC--KCVPSGT  1
            C+GKC+ RC+KAG +DRC+KYC +CC KC   CVPSGT
Sbjct  32   CNGKCNARCSKAGRQDRCLKYCNICCEKCDDHCVPSGT  69



>ref|XP_010909081.1| PREDICTED: peamaclein-like [Elaeis guineensis]
Length=91

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    +C  KC  RC+KA  +DRC+KYC LCC +C+CVPSGT
Sbjct  20   LQATMAGSPFCDSKCKVRCSKASYQDRCLKYCGLCCEECRCVPSGT  65



>ref|XP_009403087.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  DVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             + +    +C  KC  RC+KA ++DRC+K+C LCC  C+CVPSGT
Sbjct  21   QLAMARSAFCDSKCKVRCSKASLQDRCLKFCGLCCETCRCVPSGT  65



>emb|CDP07216.1| unnamed protein product [Coffea canephora]
Length=88

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             ++ +    +C  KC  RC+KAG+  RC+KYC +CCA C CVPSGT
Sbjct  20   FEIAMANTSFCDSKCGVRCSKAGLMKRCLKYCGICCAACSCVPSGT  65



>gb|EYU29122.1| hypothetical protein MIMGU_mgv1a017256mg [Erythranthe guttata]
Length=86

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            CS KC  RC+KA  K+ C+KYC +CCAKC+CVPSGT
Sbjct  28   CSPKCEVRCSKASAKENCLKYCGICCAKCQCVPSGT  63



>ref|XP_009591073.1| PREDICTED: peamaclein-like [Nicotiana tomentosiformis]
Length=88

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   +    +C  KC  RC+KAG +DRC+KYC +CC +C+CVPSGT
Sbjct  20   IQTTMAGSDFCDSKCKIRCSKAGRQDRCLKYCGICCKECQCVPSGT  65



>ref|XP_006400907.1| hypothetical protein EUTSA_v10015142mg [Eutrema salsugineum]
 gb|ESQ42360.1| hypothetical protein EUTSA_v10015142mg [Eutrema salsugineum]
Length=91

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKC-KCVPSGT  1
            C GKC+ RC+KAG +DRC+KYC +CC KC  CVPSGT
Sbjct  32   CGGKCNMRCSKAGRQDRCLKYCNICCEKCNNCVPSGT  68



>ref|XP_004159914.1| PREDICTED: snakin-1-like [Cucumis sativus]
Length=88

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSG  4
            MD  I     C+  C  RC+KA +K RC+KYC +CC+KCKCVP G
Sbjct  22   MDTAIADSDRCTRPCRKRCSKAKLKRRCMKYCRICCSKCKCVPGG  66



>gb|EMT21443.1| hypothetical protein F775_31764 [Aegilops tauschii]
Length=94

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC  RC+KAG  D C+KYC +CCA+C CVPSGT
Sbjct  32   FCDGKCGVRCSKAGRHDDCLKYCGICCAECNCVPSGT  68



>ref|XP_004252297.1| PREDICTED: peamaclein [Solanum lycopersicum]
Length=88

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +   I    +C  KC+ RC+KAG +DRC+KYC +CC +C C+PSGT
Sbjct  20   IPATIAGSDFCDSKCNVRCSKAGRQDRCLKYCGICCEECHCLPSGT  65



>ref|XP_002864654.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40913.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=89

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCK-CVPSGT  1
            C GKC+ RC+KAG +DRC+KYC +CC KC  CVPSGT
Sbjct  30   CGGKCNVRCSKAGRQDRCLKYCNICCEKCNYCVPSGT  66



>gb|KFK27525.1| hypothetical protein AALP_AA8G394700 [Arabis alpina]
Length=69

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKC-KCVPSGT  1
            C GKC+ RC+KAG +DRC+KYC +CC KC  CVPSGT
Sbjct  10   CDGKCNMRCSKAGRQDRCLKYCNICCQKCDNCVPSGT  46



>ref|XP_003559118.1| PREDICTED: peamaclein-like [Brachypodium distachyon]
Length=93

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            V +    +C  KCS RC+KA   D C+KYC +CCA+C CVPSGT
Sbjct  24   VSVAGSEFCDSKCSFRCSKASRHDDCLKYCGICCAECNCVPSGT  67



>dbj|BAB08352.1| unnamed protein product [Arabidopsis thaliana]
Length=88

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCK-CVPSGT  1
            + +L      C GKC+ RC+KAG +DRC+KYC +CC KC  CVPSGT
Sbjct  19   LFILSTADSSCGGKCNVRCSKAGRQDRCLKYCNICCEKCNYCVPSGT  65



>ref|NP_568914.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|Q8LFM2.1|GASAA_ARATH RecName: Full=Gibberellin-regulated protein 10; AltName: Full=GAST1 
protein homolog 10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM61329.1| contains similarity to gibberellin-stimulated transcript 1 like 
protein [Arabidopsis thaliana]
 dbj|BAC42796.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00469.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97241.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=89

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCK-CVPSGT  1
            C GKC+ RC+KAG +DRC+KYC +CC KC  CVPSGT
Sbjct  30   CGGKCNVRCSKAGRQDRCLKYCNICCEKCNYCVPSGT  66



>ref|XP_002973082.1| hypothetical protein SELMODRAFT_99264 [Selaginella moellendorffii]
 gb|EFJ25456.1| hypothetical protein SELMODRAFT_99264 [Selaginella moellendorffii]
Length=68

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            ++  I   C   C  RC+KA   DRCIKYC +CC KC CVP GT
Sbjct  2    IVWSIFADCGSACDYRCSKADAHDRCIKYCNICCGKCNCVPPGT  45



>gb|EMS63633.1| hypothetical protein TRIUR3_22813 [Triticum urartu]
Length=98

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            + V +    +C  KC  RC+KAG  D C+KYC +CCA+C CVPSGT
Sbjct  27   LRVAMAGSAFCDSKCGVRCSKAGRHDDCLKYCGICCAECNCVPSGT  72



>ref|XP_004136951.1| PREDICTED: snakin-1-like [Cucumis sativus]
 gb|KGN43868.1| hypothetical protein Csa_7G071570 [Cucumis sativus]
Length=88

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSG  4
            MD  +     C+  C  RC+KA +K RC+KYC +CC+KCKCVP G
Sbjct  22   MDTAMADSDRCTRPCRKRCSKAKLKRRCMKYCRICCSKCKCVPGG  66



>ref|XP_009414177.1| PREDICTED: gibberellin-regulated protein 5-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=132

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 37/80 (46%), Gaps = 11/80 (14%)
 Frame = -3

Query  207  FCLVVDGRIDLycnayniyiyiCMDVLIGIVGY-----------CSGKCSGRCAKAGVKD  61
            F LVV GRI L   A            I    Y           CSG+C+GRC+    K 
Sbjct  30   FLLVVQGRISLAPTAQPGNPLGPTPQPIKFPMYGATPGSLQPQECSGRCAGRCSATAYKK  89

Query  60   RCIKYCELCCAKCKCVPSGT  1
             C+ +C+ CCAKC CVP GT
Sbjct  90   PCMFFCQKCCAKCLCVPPGT  109



>sp|P86888.1|PMLN_PRUPE RecName: Full=Peamaclein; AltName: Allergen=Pru p 7 [Prunus persica]
Length=63

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC  RC+KAG ++RC+KYC +CC KC CVPSGT
Sbjct  4    FCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGT  40



>ref|XP_004501536.1| PREDICTED: peamaclein-like [Cicer arietinum]
Length=86

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  +C  RC+KA  +DRC+KYC +CC KC CVPSGT
Sbjct  27   FCDTRCGERCSKASFQDRCLKYCGICCEKCNCVPSGT  63



>ref|XP_008778332.1| PREDICTED: peamaclein-like [Phoenix dactylifera]
Length=91

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  DVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +  I    +C  KC  RC+KA  +DRC+KYC +CC +C CVPSGT
Sbjct  21   EATIAGSPFCDSKCKVRCSKASFQDRCLKYCGVCCEECHCVPSGT  65



>gb|KDP32030.1| hypothetical protein JCGZ_12491 [Jatropha curcas]
Length=79

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C  KC  RC+ AG KDRC+KYC +CC +CKCVPSGT
Sbjct  21   CDLKCGTRCSNAGYKDRCLKYCGICCQECKCVPSGT  56



>ref|XP_009131966.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=89

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKC-KCVPSGT  1
            C+GKC+ RC+KA ++DRC+KYC +CC KC  CVPSGT
Sbjct  30   CNGKCNVRCSKARIQDRCLKYCNICCGKCDNCVPSGT  66



>ref|XP_002463849.1| hypothetical protein SORBIDRAFT_01g007360 [Sorghum bicolor]
 gb|EER90847.1| hypothetical protein SORBIDRAFT_01g007360 [Sorghum bicolor]
Length=93

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -3

Query  138  MDVLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            + V +    +C GKC  RC+KA   D C+KYC +CCA C CVPSGT
Sbjct  22   LRVSMAGSAFCDGKCGVRCSKASRHDDCLKYCGICCASCNCVPSGT  67



>emb|CDX80222.1| BnaC09g35200D [Brassica napus]
Length=92

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKC--KCVPSGT  1
            C+GKC+ RC+KAG +DRC++YC +CC KC   CVPSGT
Sbjct  32   CNGKCNVRCSKAGRQDRCLQYCNICCEKCDDHCVPSGT  69



>ref|XP_009381473.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=94

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
             +C  KC  RC+KA ++DRCIK C LCC  C+CVPSGT
Sbjct  31   AFCGSKCKVRCSKASLQDRCIKVCGLCCEACRCVPSGT  68



>emb|CDX71072.1| BnaC03g11560D [Brassica napus]
Length=91

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCK-CVPSGT  1
            C+GKC+ RC+KA ++DRC+KYC +CC KC  CVPSGT
Sbjct  32   CNGKCNVRCSKARIQDRCLKYCNICCGKCDYCVPSGT  68



>gb|ACJ68116.1| hypothetical protein [Brassica napus]
Length=89

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCK-CVPSGT  1
            C+GKC+ RC+KA ++DRC+KYC +CC KC  CVPSGT
Sbjct  30   CNGKCNVRCSKARIQDRCLKYCNICCGKCDYCVPSGT  66



>ref|XP_009617608.1| PREDICTED: peamaclein-like [Nicotiana tomentosiformis]
Length=91

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 2/37 (5%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            YC+ K +   AK GV  +C+KYCELCCAKCKCVP+GT
Sbjct  34   YCAHKATN--AKLGVPSQCVKYCELCCAKCKCVPTGT  68



>gb|EMS63632.1| hypothetical protein TRIUR3_22812 [Triticum urartu]
Length=94

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C  KC  RC+KAG  D C+KYC +CCA+C CVPSGT
Sbjct  32   FCDSKCGVRCSKAGRHDDCLKYCGICCAQCNCVPSGT  68



>ref|NP_001051348.1| Os03g0760800 [Oryza sativa Japonica Group]
 gb|AAK63933.1|AC084282_14 putative protein of gibberellin-stimulated transcript [Oryza 
sativa Japonica Group]
 dbj|BAD67542.1| Gibberellin stimulated transcript related protein 1 [Oryza sativa 
Japonica Group]
 gb|ABF99002.1| Gibberellin-regulated protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13262.1| Os03g0760800 [Oryza sativa Japonica Group]
 gb|EAY91938.1| hypothetical protein OsI_13625 [Oryza sativa Indica Group]
 gb|EAZ28663.1| hypothetical protein OsJ_12674 [Oryza sativa Japonica Group]
 dbj|BAH00426.1| unnamed protein product [Oryza sativa Japonica Group]
Length=93

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            V +    +C GKC  RC+KA   D C+KYC +CCA C CVPSGT
Sbjct  24   VSMAGSDFCDGKCKVRCSKASRHDDCLKYCGVCCASCNCVPSGT  67



>emb|CDX88727.1| BnaA03g09220D [Brassica napus]
Length=91

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCK-CVPSGT  1
            C+GKC+ RC+KA + DRC+KYC +CC KC  CVPSGT
Sbjct  32   CNGKCNVRCSKARIHDRCLKYCNICCGKCDYCVPSGT  68



>gb|EMS47698.1| hypothetical protein TRIUR3_08559 [Triticum urartu]
Length=94

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C GKC  RC+KA   D C+KYC +CCA+C CVPSGT
Sbjct  32   FCDGKCGVRCSKASRHDDCLKYCGICCAECNCVPSGT  68



>gb|ACR37248.1| unknown [Zea mays]
 gb|ACR37359.1| unknown [Zea mays]
Length=96

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            V +   G+C GKC+ RC+KA   D  +KYC +CCA C CVPSGT
Sbjct  27   VSMAGSGFCDGKCAVRCSKASRHDDRLKYCGICCATCNCVPSGT  70



>ref|XP_006650629.1| PREDICTED: snakin-1-like [Oryza brachyantha]
Length=94

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            V +    +C GKC  RC+KA   D C++YC +CCA C CVPSGT
Sbjct  25   VAMAGSDFCDGKCKVRCSKASRHDDCLRYCGVCCASCNCVPSGT  68



>ref|XP_002986081.1| hypothetical protein SELMODRAFT_123391 [Selaginella moellendorffii]
 gb|EFJ12900.1| hypothetical protein SELMODRAFT_123391 [Selaginella moellendorffii]
Length=69

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C+  C  RC+KAG+  RC+KYC +CC KC+CVP GT
Sbjct  11   CAAACDYRCSKAGLHKRCLKYCNICCGKCQCVPPGT  46



>ref|XP_002982001.1| hypothetical protein SELMODRAFT_115445 [Selaginella moellendorffii]
 gb|EFJ17094.1| hypothetical protein SELMODRAFT_115445 [Selaginella moellendorffii]
Length=69

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C+  C  RC+KAG+  RC+KYC +CC KC+CVP GT
Sbjct  11   CAAACDYRCSKAGLHKRCLKYCNICCGKCQCVPPGT  46



>ref|XP_009414179.1| PREDICTED: gibberellin-regulated protein 5-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=121

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 39/84 (46%), Gaps = 13/84 (15%)
 Frame = -3

Query  213  ILFCLVVD--GRIDLycnayniyiyiCMDVLIGIVGY-----------CSGKCSGRCAKA  73
            +L CLV+   GRI L   A            I    Y           CSG+C+GRC+  
Sbjct  15   VLHCLVIQAQGRISLAPTAQPGNPLGPTPQPIKFPMYGATPGSLQPQECSGRCAGRCSAT  74

Query  72   GVKDRCIKYCELCCAKCKCVPSGT  1
              K  C+ +C+ CCAKC CVP GT
Sbjct  75   AYKKPCMFFCQKCCAKCLCVPPGT  98



>gb|EMT21444.1| hypothetical protein F775_43887 [Aegilops tauschii]
Length=98

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  VLIGIVGYCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            V +    +C  KC  RC+KA   D C+KYC +CCA+C CVPSGT
Sbjct  29   VAMAGSAFCDSKCGVRCSKASRHDDCLKYCGICCAECNCVPSGT  72



>gb|ABK22434.1| unknown [Picea sitchensis]
 gb|ABK25425.1| unknown [Picea sitchensis]
Length=111

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C   C  RCA A VKDRC+KYC +CC+ C+CVP GT
Sbjct  53   CGSACGKRCALASVKDRCLKYCGICCSSCQCVPPGT  88



>gb|ABK25287.1| unknown [Picea sitchensis]
Length=111

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C   C  RCA A VKDRC+KYC +CC+ C+CVP GT
Sbjct  53   CGSACGKRCALASVKDRCLKYCGICCSSCQCVPPGT  88



>ref|XP_002976786.1| hypothetical protein SELMODRAFT_105504, partial [Selaginella 
moellendorffii]
 gb|EFJ22455.1| hypothetical protein SELMODRAFT_105504, partial [Selaginella 
moellendorffii]
Length=61

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  CSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            C   C  RC+KA   DRCIKYC +CC KC CVP GT
Sbjct  3    CGSACDYRCSKADAHDRCIKYCNICCGKCNCVPPGT  38



>ref|XP_004981680.1| PREDICTED: snakin-1-like [Setaria italica]
Length=94

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  YCSGKCSGRCAKAGVKDRCIKYCELCCAKCKCVPSGT  1
            +C   C+ RC+KA   D C+KYC +CCA C CVPSGT
Sbjct  32   FCDSNCARRCSKASRHDDCLKYCGICCADCNCVPSGT  68



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1346324970506