BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20322_g1_i2 len=648 path=[1044:0-90 2110:91-288 1345:289-313
2602:314-438 1495:439-647]

Length=648
                                                                      Score     E

gb|KDO42764.1|  hypothetical protein CISIN_1g015862mg                   379   3e-128   
ref|XP_002526414.1|  12-oxophytodienoate reductase opr, putative        377   5e-128   Ricinus communis
ref|XP_006478215.1|  PREDICTED: 12-oxophytodienoate reductase 2-l...    377   2e-127   
ref|XP_006478217.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    377   3e-127   
ref|XP_006478216.1|  PREDICTED: 12-oxophytodienoate reductase 2-l...    377   3e-127   
ref|XP_008219064.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    374   2e-126   
ref|XP_004169282.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    374   3e-126   
ref|XP_008383583.1|  PREDICTED: putative 12-oxophytodienoate redu...    373   5e-126   
ref|XP_009362380.1|  PREDICTED: putative 12-oxophytodienoate redu...    372   7e-126   
ref|XP_009362379.1|  PREDICTED: putative 12-oxophytodienoate redu...    372   1e-125   
ref|XP_008382228.1|  PREDICTED: putative 12-oxophytodienoate redu...    372   2e-125   
ref|XP_009362377.1|  PREDICTED: putative 12-oxophytodienoate redu...    372   2e-125   
ref|XP_008441149.1|  PREDICTED: putative 12-oxophytodienoate redu...    371   4e-125   
ref|XP_004155439.1|  PREDICTED: putative 12-oxophytodienoate redu...    370   5e-125   
gb|AFK34194.1|  unknown                                                 370   6e-125   
ref|XP_007223332.1|  hypothetical protein PRUPE_ppa007377mg             370   6e-125   
emb|CAN60665.1|  hypothetical protein VITISV_033920                     370   6e-125   Vitis vinifera
ref|XP_007020161.1|  12-oxophytodienoate reductase 2                    370   8e-125   
ref|XP_002281119.1|  PREDICTED: putative 12-oxophytodienoate redu...    369   1e-124   Vitis vinifera
ref|XP_009362371.1|  PREDICTED: putative 12-oxophytodienoate redu...    368   6e-124   
ref|XP_007223371.1|  hypothetical protein PRUPE_ppa007490mg             367   6e-124   
ref|XP_010100109.1|  Putative 12-oxophytodienoate reductase 11          367   7e-124   
ref|XP_002281348.1|  PREDICTED: putative 12-oxophytodienoate redu...    367   1e-123   Vitis vinifera
ref|XP_009610272.1|  PREDICTED: 12-oxophytodienoate reductase 1-l...    366   1e-123   
ref|XP_009610270.1|  PREDICTED: 12-oxophytodienoate reductase 1-l...    366   2e-123   
gb|KDP45639.1|  hypothetical protein JCGZ_17246                         366   3e-123   
ref|XP_007023454.1|  12-oxophytodienoate reductase 2                    366   3e-123   
ref|XP_007223370.1|  hypothetical protein PRUPE_ppa007488mg             365   4e-123   
ref|XP_008358699.1|  PREDICTED: LOW QUALITY PROTEIN: putative 12-...    366   4e-123   
ref|XP_009770174.1|  PREDICTED: 12-oxophytodienoate reductase 1-l...    365   5e-123   
ref|XP_008219065.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    364   8e-123   
gb|AHC69824.1|  12-oxophytodienoate reductase 1                         365   1e-122   
ref|XP_009770173.1|  PREDICTED: 12-oxophytodienoate reductase 1-l...    365   1e-122   
ref|XP_008219067.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    364   1e-122   
ref|XP_004294515.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    364   2e-122   
ref|XP_003610767.1|  12-oxophytodienoate reductase                      363   2e-122   
gb|AFK37579.1|  unknown                                                 363   2e-122   
ref|XP_003517567.2|  PREDICTED: 12-oxophytodienoate reductase 2         364   3e-122   
ref|XP_006339339.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    363   4e-122   
dbj|BAD06575.1|  LEDI-5c protein                                        363   4e-122   Lithospermum erythrorhizon
gb|ACR77749.1|  12-oxophytodienoic acid 10,10-reductase                 362   7e-122   Astragalus sinicus
ref|XP_008352796.1|  PREDICTED: putative 12-oxophytodienoate redu...    359   9e-122   
ref|XP_010100111.1|  Putative 12-oxophytodienoate reductase 11          360   9e-122   
ref|XP_007223334.1|  hypothetical protein PRUPE_ppa007381mg             362   1e-121   
ref|XP_006376142.1|  hypothetical protein POPTR_0013s10180g             361   2e-121   
emb|CAN80189.1|  hypothetical protein VITISV_000938                     360   2e-121   Vitis vinifera
ref|XP_010665323.1|  PREDICTED: putative 12-oxophytodienoate redu...    361   2e-121   
ref|XP_010665439.1|  PREDICTED: LOW QUALITY PROTEIN: 12-oxophytod...    360   3e-121   
ref|XP_003610769.1|  12-oxophytodienoate reductase                      360   3e-121   
ref|XP_004294510.1|  PREDICTED: putative 12-oxophytodienoate redu...    360   3e-121   
ref|XP_007223333.1|  hypothetical protein PRUPE_ppa007379mg             360   3e-121   
ref|XP_004150154.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    360   5e-121   
gb|KHG03512.1|  12-oxophytodienoate reductase 2 -like protein           360   7e-121   
ref|XP_004155438.1|  PREDICTED: putative 12-oxophytodienoate redu...    360   8e-121   
ref|XP_008219066.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    359   1e-120   
ref|XP_007224583.1|  hypothetical protein PRUPE_ppa1027192mg            358   1e-120   
ref|XP_004294522.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    358   2e-120   
ref|XP_003537618.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    358   2e-120   
ref|XP_008466854.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    360   2e-120   
ref|XP_007023455.1|  12-oxophytodienoate reductase 2                    358   3e-120   
ref|XP_009362381.1|  PREDICTED: putative 12-oxophytodienoate redu...    358   4e-120   
ref|XP_004295892.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    358   4e-120   
ref|XP_006390164.1|  hypothetical protein EUTSA_v10018727mg             357   6e-120   
ref|XP_004511386.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    357   1e-119   
ref|XP_008219073.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    357   2e-119   
dbj|BAD06521.1|  hypothetical protein                                   356   2e-119   Pisum sativum [garden pea]
ref|XP_008383858.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    356   2e-119   
ref|XP_007226740.1|  hypothetical protein PRUPE_ppa019182mg             355   2e-119   
ref|XP_008349200.1|  PREDICTED: LOW QUALITY PROTEIN: putative 12-...    357   2e-119   
ref|XP_009362376.1|  PREDICTED: putative 12-oxophytodienoate redu...    357   2e-119   
ref|XP_009379104.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    356   2e-119   
gb|KGN43736.1|  hypothetical protein Csa_7G063995                       355   3e-119   
ref|XP_006339340.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    355   4e-119   
ref|XP_007223390.1|  hypothetical protein PRUPE_ppa007498mg             355   4e-119   
ref|XP_011101214.1|  PREDICTED: putative 12-oxophytodienoate redu...    355   6e-119   
ref|XP_008455178.1|  PREDICTED: putative 12-oxophytodienoate redu...    354   1e-118   
ref|XP_010062375.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    353   2e-118   
ref|XP_007023453.1|  12-oxophytodienoate reductase 2 isoform 2          354   2e-118   
ref|XP_007023452.1|  12-oxophytodienoate reductase 2 isoform 1          353   2e-118   
ref|XP_011005431.1|  PREDICTED: putative 12-oxophytodienoate redu...    353   2e-118   
dbj|BAD06522.1|  hypothetical protein                                   353   3e-118   Pisum sativum [garden pea]
ref|XP_007037241.1|  12-oxophytodienoate reductase 1                    353   6e-118   
ref|XP_004294511.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    352   7e-118   
ref|XP_004138673.1|  PREDICTED: LOW QUALITY PROTEIN: 12-oxophytod...    352   8e-118   
ref|XP_007156169.1|  hypothetical protein PHAVU_003G264000g             352   8e-118   
ref|XP_008219071.1|  PREDICTED: 12-oxophytodienoate reductase 2-l...    351   9e-118   
ref|XP_008383862.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    350   1e-117   
ref|XP_008357589.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    352   1e-117   
ref|XP_007157105.1|  hypothetical protein PHAVU_002G043100g             351   1e-117   
dbj|BAD06518.1|  hypothetical protein                                   351   2e-117   Pisum sativum [garden pea]
ref|XP_004511387.1|  PREDICTED: putative 12-oxophytodienoate redu...    352   2e-117   
ref|XP_010683270.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    350   3e-117   
ref|XP_008219069.1|  PREDICTED: 12-oxophytodienoate reductase 2-l...    351   3e-117   
ref|XP_003610759.1|  12-oxophytodienoate reductase                      350   3e-117   
ref|XP_004294509.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    350   3e-117   
ref|XP_008339182.1|  PREDICTED: 12-oxophytodienoate reductase 2-l...    350   4e-117   
dbj|BAD06519.1|  hypothetical protein                                   350   5e-117   Pisum sativum [garden pea]
ref|XP_008383861.1|  PREDICTED: putative 12-oxophytodienoate redu...    352   5e-117   
ref|XP_008339180.1|  PREDICTED: putative 12-oxophytodienoate redu...    350   5e-117   
ref|XP_008339181.1|  PREDICTED: 12-oxophytodienoate reductase 2-l...    349   8e-117   
ref|XP_002887653.1|  12-oxophytodienoate reductase 1                    349   9e-117   
ref|XP_008455176.1|  PREDICTED: putative 12-oxophytodienoate redu...    348   2e-116   
ref|XP_008455177.1|  PREDICTED: putative 12-oxophytodienoate redu...    348   2e-116   
ref|XP_009362378.1|  PREDICTED: putative 12-oxophytodienoate redu...    348   3e-116   
gb|AAB62248.1|  old-yellow-enzyme homolog                               348   3e-116   Catharanthus roseus [chatas]
ref|XP_010547968.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    348   4e-116   
ref|XP_009390777.1|  PREDICTED: putative 12-oxophytodienoate redu...    349   5e-116   
dbj|BAB40340.1|  12-oxophytodienoic acid 10, 11-reductase               347   5e-116   Pisum sativum [garden pea]
emb|CDP10748.1|  unnamed protein product                                347   7e-116   
gb|KHN04141.1|  12-oxophytodienoate reductase 2                         347   8e-116   
emb|CAN66144.1|  hypothetical protein VITISV_031221                     346   1e-115   Vitis vinifera
ref|XP_011095972.1|  PREDICTED: putative 12-oxophytodienoate redu...    345   2e-115   
emb|CBI39235.3|  unnamed protein product                                344   2e-115   
ref|XP_003634577.1|  PREDICTED: putative 12-oxophytodienoate redu...    346   2e-115   
ref|XP_002278356.1|  PREDICTED: putative 12-oxophytodienoate redu...    346   2e-115   Vitis vinifera
ref|XP_010930419.1|  PREDICTED: putative 12-oxophytodienoate redu...    343   3e-115   
ref|XP_011005430.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    345   3e-115   
ref|XP_010930417.1|  PREDICTED: putative 12-oxophytodienoate redu...    345   3e-115   
ref|XP_010471825.1|  PREDICTED: 12-oxophytodienoate reductase 1         345   3e-115   
ref|XP_011095964.1|  PREDICTED: putative 12-oxophytodienoate redu...    345   5e-115   
ref|XP_003610764.1|  12-oxophytodienoate reductase                      345   5e-115   
pdb|1ICP|A  Chain A, Crystal Structure Of 12-Oxophytodienoate Red...    345   5e-115   
ref|NP_001234781.1|  12-oxophytodienoate reductase 1                    345   6e-115   
emb|CAA71627.1|  12-oxophytodienoate reductase                          345   6e-115   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177794.1|  12-oxophytodienoate reductase 1                       344   8e-115   Arabidopsis thaliana [mouse-ear cress]
emb|CDY16975.1|  BnaC09g41020D                                          344   8e-115   
ref|XP_010930420.1|  PREDICTED: putative 12-oxophytodienoate redu...    342   8e-115   
ref|XP_010930418.1|  PREDICTED: putative 12-oxophytodienoate redu...    344   9e-115   
ref|NP_177795.1|  12-oxophytodienoate reductase 2                       344   9e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003553521.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    344   1e-114   
ref|XP_006302416.1|  hypothetical protein CARUB_v10020489mg             344   1e-114   
ref|XP_003610758.1|  12-oxophytodienoate reductase                      343   1e-114   
emb|CAN60666.1|  hypothetical protein VITISV_033921                     344   1e-114   Vitis vinifera
ref|XP_007161761.1|  hypothetical protein PHAVU_001G096300g             343   1e-114   
ref|XP_008364009.1|  PREDICTED: putative 12-oxophytodienoate redu...    352   2e-114   
ref|XP_010312987.1|  PREDICTED: putative 12-oxophytodienoate redu...    343   2e-114   
ref|XP_010245029.1|  PREDICTED: putative 12-oxophytodienoate redu...    344   2e-114   
ref|XP_010416592.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    343   2e-114   
ref|XP_002278405.1|  PREDICTED: putative 12-oxophytodienoate redu...    343   2e-114   Vitis vinifera
ref|XP_004250653.1|  PREDICTED: 12-oxophytodienoate reductase 1-l...    343   2e-114   
ref|XP_010101281.1|  Putative 12-oxophytodienoate reductase 11          344   2e-114   
ref|XP_010101279.1|  Putative 12-oxophytodienoate reductase 11          344   2e-114   
ref|XP_010428733.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    343   2e-114   
ref|XP_010245524.1|  PREDICTED: putative 12-oxophytodienoate redu...    343   2e-114   
dbj|BAI63591.1|  12-oxophytodienoate reductase                          342   3e-114   Lotus japonicus
dbj|BAC42387.1|  putative 12-oxophytodienoate reductase OPR2            343   3e-114   Arabidopsis thaliana [mouse-ear cress]
emb|CDY20395.1|  BnaC02g24210D                                          342   4e-114   
ref|XP_008339185.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    342   4e-114   
ref|XP_009128191.1|  PREDICTED: 12-oxophytodienoate reductase 1         342   4e-114   
emb|CDY45941.1|  BnaA02g17670D                                          342   5e-114   
ref|XP_006339388.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    341   8e-114   
ref|XP_010535056.1|  PREDICTED: 12-oxophytodienoate reductase 1-l...    341   9e-114   
emb|CBI39233.3|  unnamed protein product                                347   9e-114   
ref|XP_009121440.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    342   1e-113   
gb|AAM65337.1|  12-oxophytodienoate reductase (OPR1)                    342   1e-113   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25914.1|  hypothetical protein AALP_AA8G179500                    342   1e-113   
emb|CDX69416.1|  BnaA10g17650D                                          341   1e-113   
ref|XP_008786404.1|  PREDICTED: putative 12-oxophytodienoate redu...    340   2e-113   
emb|CDP18870.1|  unnamed protein product                                341   2e-113   
ref|XP_006376141.1|  hypothetical protein POPTR_0013s10170g             340   2e-113   
ref|XP_010535049.1|  PREDICTED: 12-oxophytodienoate reductase 2-l...    340   2e-113   
ref|XP_006305271.1|  hypothetical protein CARUB_v10009647mg             339   3e-113   
sp|B9FSC8.1|OPR11_ORYSJ  RecName: Full=Putative 12-oxophytodienoa...    340   3e-113   Oryza sativa Japonica Group [Japonica rice]
gb|EMT21994.1|  12-oxophytodienoate reductase 2                         340   4e-113   
gb|ABK95614.1|  unknown                                                 340   4e-113   Populus trichocarpa [western balsam poplar]
ref|XP_004975713.1|  PREDICTED: putative 12-oxophytodienoate redu...    340   6e-113   
ref|NP_001105909.1|  12-oxo-phytodienoic acid reductase5                340   6e-113   Zea mays [maize]
ref|XP_006376140.1|  hypothetical protein POPTR_0013s10160g             339   7e-113   
ref|XP_008786405.1|  PREDICTED: putative 12-oxophytodienoate redu...    339   9e-113   
ref|XP_004975715.1|  PREDICTED: putative 12-oxophytodienoate redu...    338   1e-112   
emb|CDP10746.1|  unnamed protein product                                343   1e-112   
ref|XP_006858592.1|  hypothetical protein AMTR_s00071p00195650          339   1e-112   
ref|XP_006478213.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    338   1e-112   
gb|ACF83071.1|  unknown                                                 339   2e-112   Zea mays [maize]
ref|XP_010912703.1|  PREDICTED: putative 12-oxophytodienoate redu...    338   2e-112   
emb|CAN65589.1|  hypothetical protein VITISV_036518                     337   3e-112   Vitis vinifera
ref|XP_008352810.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    337   4e-112   
dbj|BAJ96259.1|  predicted protein                                      337   4e-112   
gb|KFK43236.1|  hypothetical protein AALP_AA1G097600                    336   1e-111   
ref|NP_172411.1|  putative 12-oxophytodienoate reductase-like pro...    335   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003610878.1|  12-oxophytodienoate reductase                      336   1e-111   
ref|XP_010685532.1|  PREDICTED: putative 12-oxophytodienoate redu...    336   1e-111   
gb|ABK28390.1|  unknown                                                 335   1e-111   Arabidopsis thaliana [mouse-ear cress]
emb|CDP10751.1|  unnamed protein product                                339   1e-111   
ref|XP_010535041.1|  PREDICTED: 12-oxophytodienoate reductase 2-l...    335   2e-111   
ref|XP_002892503.1|  hypothetical protein ARALYDRAFT_888182             335   2e-111   
ref|XP_008786403.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    336   2e-111   
ref|XP_009362373.1|  PREDICTED: putative 12-oxophytodienoate redu...    336   2e-111   
gb|AFK46523.1|  unknown                                                 335   3e-111   
ref|XP_006376139.1|  hypothetical protein POPTR_0013s10150g             335   3e-111   
ref|XP_003579839.1|  PREDICTED: putative 12-oxophytodienoate redu...    335   4e-111   
gb|AGG17918.1|  12-oxophytodienoic acid reductase 2                     334   5e-111   
gb|EMS65404.1|  12-oxophytodienoate reductase 1                         334   6e-111   
emb|CAN74407.1|  hypothetical protein VITISV_033305                     334   6e-111   Vitis vinifera
gb|EYU22758.1|  hypothetical protein MIMGU_mgv1a008135mg                335   7e-111   
gb|EMT02700.1|  12-oxophytodienoate reductase 2                         335   7e-111   
ref|XP_009110833.1|  PREDICTED: putative 12-oxophytodienoate redu...    334   1e-110   
ref|XP_003610762.1|  12-oxophytodienoate reductase                      333   1e-110   
ref|XP_006652323.1|  PREDICTED: putative 12-oxophytodienoate redu...    333   1e-110   
ref|XP_006416647.1|  hypothetical protein EUTSA_v10009775mg             332   3e-110   
ref|XP_004511462.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    333   3e-110   
dbj|BAJ34294.1|  unnamed protein product                                332   3e-110   
emb|CDY31095.1|  BnaA08g26450D                                          333   3e-110   
ref|XP_010930415.1|  PREDICTED: putative 12-oxophytodienoate redu...    332   4e-110   
ref|XP_010912704.1|  PREDICTED: LOW QUALITY PROTEIN: 12-oxophytod...    332   7e-110   
ref|XP_010475773.1|  PREDICTED: putative 12-oxophytodienoate redu...    332   7e-110   
emb|CDP18872.1|  unnamed protein product                                337   2e-109   
gb|EMS57216.1|  12-oxophytodienoate reductase 2                         330   2e-109   
gb|KFK43972.1|  hypothetical protein AALP_AA1G198200                    330   4e-109   
ref|XP_006858593.1|  hypothetical protein AMTR_s00071p00196220          329   4e-109   
ref|NP_974157.1|  12-oxophytodienoate reductase 1                       330   5e-109   Arabidopsis thaliana [mouse-ear cress]
emb|CDY21723.1|  BnaA09g44740D                                          329   6e-109   
ref|XP_006367688.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    329   8e-109   
ref|XP_010458225.1|  PREDICTED: putative 12-oxophytodienoate redu...    326   8e-109   
ref|XP_006400225.1|  hypothetical protein EUTSA_v10013817mg             329   1e-108   
ref|XP_010930422.1|  PREDICTED: putative 12-oxophytodienoate redu...    328   1e-108   
ref|NP_001242398.1|  uncharacterized protein LOC100816003               328   2e-108   
ref|XP_010030202.1|  PREDICTED: putative 12-oxophytodienoate redu...    328   2e-108   
ref|XP_008781981.1|  PREDICTED: putative 12-oxophytodienoate redu...    327   2e-108   
emb|CDP18869.1|  unnamed protein product                                328   3e-108   
dbj|BAD06520.1|  hypothetical protein                                   327   3e-108   Pisum sativum [garden pea]
emb|CBI39234.3|  unnamed protein product                                325   4e-108   
ref|XP_010458224.1|  PREDICTED: putative 12-oxophytodienoate redu...    328   7e-108   
emb|CDP10744.1|  unnamed protein product                                326   1e-107   
emb|CDX81857.1|  BnaC08g37440D                                          325   3e-107   
ref|XP_006417576.1|  hypothetical protein EUTSA_v10009352mg             323   4e-107   
ref|XP_006494221.1|  PREDICTED: putative 12-oxophytodienoate redu...    324   6e-107   
ref|XP_006858594.1|  hypothetical protein AMTR_s00071p00196480          324   7e-107   
emb|CBI39236.3|  unnamed protein product                                326   9e-107   
ref|XP_009390090.1|  PREDICTED: putative 12-oxophytodienoate redu...    323   1e-106   
ref|XP_011088113.1|  PREDICTED: putative 12-oxophytodienoate redu...    324   1e-106   
emb|CBI39238.3|  unnamed protein product                                323   1e-106   
ref|XP_006306255.1|  hypothetical protein CARUB_v10012098mg             323   1e-106   
ref|XP_009390087.1|  PREDICTED: putative 12-oxophytodienoate redu...    323   2e-106   
ref|XP_007157104.1|  hypothetical protein PHAVU_002G043000g             324   3e-106   
emb|CDP10745.1|  unnamed protein product                                322   4e-106   
gb|ABK26573.1|  unknown                                                 322   5e-106   Picea sitchensis
gb|AEZ53109.1|  12-oxophytodienoate reductase                           322   5e-106   
ref|XP_010930414.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    322   5e-106   
gb|KEH36332.1|  12-oxophytodienoate reductase-like protein              320   1e-105   
gb|ABK26588.1|  unknown                                                 321   2e-105   Picea sitchensis
ref|XP_002447902.1|  hypothetical protein SORBIDRAFT_06g017680          319   2e-105   Sorghum bicolor [broomcorn]
ref|XP_009404832.1|  PREDICTED: putative 12-oxophytodienoate redu...    319   6e-105   
ref|XP_006389493.1|  hypothetical protein POPTR_0022s00360g             319   7e-105   
gb|ABK23778.1|  unknown                                                 319   1e-104   Picea sitchensis
gb|EPS65369.1|  hypothetical protein M569_09408                         317   1e-104   
gb|AAF97278.1|AC034106_21  Strong similarity to 12-oxophytodienoa...    318   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006494222.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    318   2e-104   
ref|XP_009390089.1|  PREDICTED: putative 12-oxophytodienoate redu...    317   3e-104   
gb|KFK43238.1|  hypothetical protein AALP_AA1G097900                    318   3e-104   
ref|XP_004500865.1|  PREDICTED: 12-oxophytodienoate reductase 1-l...    317   3e-104   
ref|XP_009390088.1|  PREDICTED: putative 12-oxophytodienoate redu...    317   3e-104   
gb|KHN10155.1|  Putative 12-oxophytodienoate reductase 11               316   4e-104   
ref|XP_007041179.1|  12-oxophytodienoate reductase 1                    317   4e-104   
ref|XP_006858597.1|  hypothetical protein AMTR_s00071p00197300          317   7e-104   
gb|KDO40987.1|  hypothetical protein CISIN_1g017448mg                   316   7e-104   
gb|EMS45299.1|  12-oxophytodienoate reductase 1                         319   1e-103   
emb|CAN66656.1|  hypothetical protein VITISV_011309                     315   1e-103   Vitis vinifera
ref|XP_006494220.1|  PREDICTED: putative 12-oxophytodienoate redu...    315   2e-103   
gb|KDO40988.1|  hypothetical protein CISIN_1g017733mg                   315   2e-103   
gb|EPS67956.1|  hypothetical protein M569_06815                         315   3e-103   
ref|XP_003527317.2|  PREDICTED: putative 12-oxophytodienoate redu...    315   3e-103   
dbj|BAA83084.1|  LEDI-5b protein                                        314   4e-103   Lithospermum erythrorhizon
ref|XP_007018069.1|  12-oxophytodienoate reductase 2 isoform 1          315   4e-103   
gb|KHN20106.1|  Putative 12-oxophytodienoate reductase 11               314   5e-103   
ref|XP_007018070.1|  12-oxophytodienoate reductase 2 isoform 2          314   5e-103   
gb|EMT12588.1|  12-oxophytodienoate reductase 1                         313   6e-103   
ref|XP_011087658.1|  PREDICTED: putative 12-oxophytodienoate redu...    314   7e-103   
ref|XP_011077244.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    313   1e-102   
ref|XP_006389498.1|  hypothetical protein POPTR_0022s00400g             313   2e-102   
gb|EAZ00156.1|  hypothetical protein OsI_22161                          312   2e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_004500866.1|  PREDICTED: 12-oxophytodienoate reductase 1-l...    312   3e-102   
dbj|BAJ97467.1|  predicted protein                                      312   3e-102   
ref|XP_002272489.1|  PREDICTED: 12-oxophytodienoate reductase 2-like    312   3e-102   Vitis vinifera
emb|CBI39239.3|  unnamed protein product                                310   4e-102   
ref|XP_007133560.1|  hypothetical protein PHAVU_011G189200g             311   4e-102   
ref|NP_001266718.1|  12-oxophytodienoate reductase 2                    312   5e-102   
dbj|BAA83083.1|  LEDI-5a protein                                        312   5e-102   Lithospermum erythrorhizon
ref|XP_011087656.1|  PREDICTED: putative 12-oxophytodienoate redu...    311   6e-102   
ref|NP_001057145.1|  Os06g0216300                                       311   8e-102   
ref|NP_001105830.1|  12-oxo-phytodienoic acid reductase3                311   1e-101   
emb|CDP10749.1|  unnamed protein product                                308   2e-101   
ref|XP_011087657.1|  PREDICTED: putative 12-oxophytodienoate redu...    311   2e-101   
gb|AIS40017.1|  OPDA reductase                                          308   2e-101   
ref|XP_003545002.1|  PREDICTED: 12-oxophytodienoate reductase 1 i...    310   3e-101   
ref|NP_001057144.1|  Os06g0216200                                       309   5e-101   
dbj|BAA12160.1|  CPRD8 protein                                          310   5e-101   
gb|AFW76739.1|  12-oxophytodienoate reductase 2                         309   6e-101   
ref|XP_007136030.1|  hypothetical protein PHAVU_009G012100g             309   7e-101   
ref|XP_007157103.1|  hypothetical protein PHAVU_002G042900g             309   7e-101   
gb|EAZ00158.1|  hypothetical protein OsI_22163                          309   9e-101   
gb|KHN12604.1|  Putative 12-oxophytodienoate reductase 11               308   1e-100   
emb|CDP06597.1|  unnamed protein product                                306   2e-100   
gb|EMT21133.1|  12-oxophytodienoate reductase 2                         306   3e-100   
gb|EYU35011.1|  hypothetical protein MIMGU_mgv1a0088781mg               305   4e-100   
ref|XP_006655911.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    307   5e-100   
ref|XP_007041175.1|  12-oxophytodienoate reductase 1 isoform 1          306   6e-100   
ref|XP_004964870.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    306   7e-100   
gb|EPS72305.1|  hypothetical protein M569_02454                         305   8e-100   
gb|EYU35009.1|  hypothetical protein MIMGU_mgv1a0088221mg               303   1e-99    
ref|XP_004964872.1|  PREDICTED: putative 12-oxophytodienoate redu...    305   1e-99    
gb|EMS65332.1|  12-oxophytodienoate reductase 2                         306   1e-99    
ref|XP_004964871.1|  PREDICTED: putative 12-oxophytodienoate redu...    305   1e-99    
ref|XP_009403728.1|  PREDICTED: putative 12-oxophytodienoate redu...    305   2e-99    
sp|Q69TH6.1|OPR3_ORYSJ  RecName: Full=Putative 12-oxophytodienoat...    305   2e-99    
ref|XP_003564097.1|  PREDICTED: putative 12-oxophytodienoate redu...    305   2e-99    
ref|XP_002438052.1|  hypothetical protein SORBIDRAFT_10g007320          305   4e-99    
ref|XP_010100110.1|  12-oxophytodienoate reductase 1                    304   5e-99    
gb|ABV45434.1|  OPR-1                                                   303   7e-99    
gb|EAZ36270.1|  hypothetical protein OsJ_20591                          303   7e-99    
ref|XP_007160595.1|  hypothetical protein PHAVU_001G000800g             304   7e-99    
ref|NP_001057140.1|  Os06g0215600                                       303   8e-99    
ref|XP_007160594.1|  hypothetical protein PHAVU_001G000800g             304   9e-99    
gb|EEC80229.1|  hypothetical protein OsI_22162                          301   9e-99    
ref|XP_004966764.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    303   1e-98    
gb|EEC80226.1|  hypothetical protein OsI_22156                          303   1e-98    
gb|EYU35004.1|  hypothetical protein MIMGU_mgv1a0089181mg               301   2e-98    
ref|XP_003568938.1|  PREDICTED: putative 12-oxophytodienoate redu...    302   2e-98    
gb|EAZ00150.1|  hypothetical protein OsI_22155                          303   3e-98    
emb|CBI40728.3|  unnamed protein product                                300   3e-98    
ref|NP_001057141.1|  Os06g0215900                                       302   4e-98    
sp|Q69TH8.1|OPR4_ORYSJ  RecName: Full=Putative 12-oxophytodienoat...    302   5e-98    
ref|NP_001105899.1|  12-oxo-phytodienoic acid reductase1                301   7e-98    
ref|XP_006656771.1|  PREDICTED: putative 12-oxophytodienoate redu...    301   1e-97    
emb|CDP21815.1|  unnamed protein product                                300   1e-97    
ref|XP_002438053.1|  hypothetical protein SORBIDRAFT_10g007330          301   1e-97    
ref|XP_004964869.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    300   2e-97    
dbj|BAJ93763.1|  predicted protein                                      300   2e-97    
ref|XP_003557698.1|  PREDICTED: putative 12-oxophytodienoate redu...    299   3e-97    
ref|XP_006840161.1|  hypothetical protein AMTR_s00089p00073170          299   3e-97    
ref|XP_002436704.1|  hypothetical protein SORBIDRAFT_10g007290          300   4e-97    
ref|XP_003565762.1|  PREDICTED: putative 12-oxophytodienoate redu...    299   4e-97    
gb|EEC80228.1|  hypothetical protein OsI_22160                          307   4e-97    
gb|AFA51066.1|  12-oxophytodienoic acid reductase                       298   5e-97    
gb|EYU35001.1|  hypothetical protein MIMGU_mgv1a008398mg                299   6e-97    
ref|XP_007133561.1|  hypothetical protein PHAVU_011G189300g             298   7e-97    
ref|XP_010239602.1|  PREDICTED: putative 12-oxophytodienoate redu...    298   8e-97    
ref|XP_004952766.1|  PREDICTED: putative 12-oxophytodienoate redu...    297   2e-96    
gb|EYU35013.1|  hypothetical protein MIMGU_mgv1a007053mg                298   3e-96    
ref|XP_004952765.1|  PREDICTED: putative 12-oxophytodienoate redu...    297   3e-96    
ref|XP_002438051.1|  hypothetical protein SORBIDRAFT_10g007310          297   3e-96    
ref|XP_003610763.1|  12-oxophytodienoate reductase                      296   3e-96    
ref|NP_001241458.1|  uncharacterized protein LOC100797662               296   3e-96    
gb|AGN53435.1|  12-oxophytodienoic acid reductase 1-A4du                296   4e-96    
ref|XP_002447901.1|  hypothetical protein SORBIDRAFT_06g017670          293   4e-96    
dbj|BAD16527.1|  putative 12-oxophytodienoic acid reductase             295   8e-96    
ref|NP_001057139.1|  Os06g0215500                                       296   1e-95    
gb|ACG42962.1|  12-oxophytodienoate reductase 2                         295   1e-95    
gb|AFW85319.1|  12-oxophytodienoate reductase 2                         295   1e-95    
gb|ACF78315.1|  unknown                                                 295   1e-95    
dbj|BAJ85342.1|  predicted protein                                      295   1e-95    
ref|XP_002272677.2|  PREDICTED: 12-oxophytodienoate reductase 2-like    295   1e-95    
dbj|BAK01971.1|  predicted protein                                      295   2e-95    
gb|EMT04351.1|  12-oxophytodienoate reductase 1                         295   2e-95    
ref|XP_004960579.1|  PREDICTED: putative 12-oxophytodienoate redu...    294   4e-95    
ref|XP_003557664.1|  PREDICTED: putative 12-oxophytodienoate redu...    294   4e-95    
gb|EYU35007.1|  hypothetical protein MIMGU_mgv1a008617mg                294   4e-95    
ref|NP_001047148.1|  Os02g0559400                                       295   4e-95    
ref|XP_006596516.1|  PREDICTED: 12-oxophytodienoate reductase 1 i...    295   4e-95    
gb|AGN53431.1|  12-oxophytodienoic acid reductase 1-A2du                293   5e-95    
gb|EMS58160.1|  12-oxophytodienoate reductase 1                         293   5e-95    
ref|NP_001105905.1|  12-oxo-phytodienoic acid reductase2                294   6e-95    
ref|XP_002436706.1|  hypothetical protein SORBIDRAFT_10g007300          294   6e-95    
gb|EMT13803.1|  12-oxophytodienoate reductase 1                         292   6e-95    
gb|EAZ00152.1|  hypothetical protein OsI_22158                          305   7e-95    
ref|NP_001105831.1|  12-oxo-phytodienoic acid reductase                 293   8e-95    
gb|AGN53432.1|  12-oxophytodienoic acid reductase 1-A2a                 292   1e-94    
ref|XP_004968757.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    292   2e-94    
ref|XP_004136880.1|  PREDICTED: LOW QUALITY PROTEIN: putative 12-...    292   2e-94    
dbj|BAJ92300.1|  predicted protein                                      292   2e-94    
ref|XP_006647386.1|  PREDICTED: putative 12-oxophytodienoate redu...    291   2e-94    
ref|NP_001031062.1|  putative 12-oxophytodienoate reductase-like ...    288   3e-94    
ref|NP_173241.2|  putative 12-oxophytodienoate reductase-like pro...    288   3e-94    
gb|EYU35012.1|  hypothetical protein MIMGU_mgv1a022348mg                291   4e-94    
gb|EMS58161.1|  12-oxophytodienoate reductase 1                         290   1e-93    
dbj|BAK06218.1|  predicted protein                                      290   1e-93    
emb|CAN66143.1|  hypothetical protein VITISV_031220                     287   1e-93    
gb|AFC87832.1|  12-oxo-phytodienoic acid reductase                      290   1e-93    
ref|XP_004966765.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    289   4e-93    
gb|EYU35006.1|  hypothetical protein MIMGU_mgv1a008639mg                288   6e-93    
gb|EYU35005.1|  hypothetical protein MIMGU_mgv1a008639mg                288   1e-92    
gb|EAY86302.1|  hypothetical protein OsI_07674                          287   1e-92    
ref|XP_002973753.1|  hypothetical protein SELMODRAFT_173572             286   8e-92    
emb|CDP10747.1|  unnamed protein product                                281   2e-91    
ref|XP_010498182.1|  PREDICTED: LOW QUALITY PROTEIN: putative 12-...    281   2e-91    
gb|EAZ23326.1|  hypothetical protein OsJ_07026                          284   2e-91    
ref|XP_002975802.1|  hypothetical protein SELMODRAFT_103671             285   2e-91    
emb|CBI40729.3|  unnamed protein product                                285   7e-91    
gb|EMS55029.1|  12-oxophytodienoate reductase 2                         284   8e-91    
ref|XP_003568939.1|  PREDICTED: LOW QUALITY PROTEIN: putative 12-...    283   8e-91    
emb|CDY32175.1|  BnaCnng06840D                                          278   1e-90    
gb|AES93718.2|  12-oxophytodienoate reductase-like protein              282   1e-90    
ref|XP_003610760.1|  12-oxophytodienoate reductase                      281   2e-90    
ref|NP_001105832.1|  12-oxo-phytodienoic acid reductase6                282   2e-90    
ref|XP_002440410.1|  hypothetical protein SORBIDRAFT_09g000520          282   2e-90    
ref|XP_009117631.1|  PREDICTED: LOW QUALITY PROTEIN: putative 12-...    278   3e-90    
gb|EAY74071.1|  hypothetical protein OsI_01959                          281   6e-90    
ref|XP_004512606.1|  PREDICTED: putative 12-oxophytodienoate redu...    280   1e-89    
ref|XP_008366050.1|  PREDICTED: putative 12-oxophytodienoate redu...    276   1e-89    
ref|XP_004512605.1|  PREDICTED: putative 12-oxophytodienoate redu...    280   1e-89    
ref|XP_004968758.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    278   3e-89    
ref|XP_008383863.1|  PREDICTED: putative 12-oxophytodienoate redu...    275   3e-89    
sp|B9FFD3.1|OPR13_ORYSJ  RecName: Full=Putative 12-oxophytodienoa...    279   3e-89    
ref|XP_008358700.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    276   4e-89    
ref|XP_001782312.1|  predicted protein                                  276   4e-88    
ref|XP_002447904.1|  hypothetical protein SORBIDRAFT_06g017700          276   6e-88    
ref|XP_003557674.1|  PREDICTED: putative 12-oxophytodienoate redu...    272   2e-86    
gb|EMT05636.1|  12-oxophytodienoate reductase 1                         269   2e-85    
gb|ACU22852.1|  unknown                                                 263   5e-85    
ref|XP_002970494.1|  hypothetical protein SELMODRAFT_270843             267   1e-84    
ref|XP_002991509.1|  hypothetical protein SELMODRAFT_133613             266   3e-84    
ref|XP_002979039.1|  hypothetical protein SELMODRAFT_110026             266   3e-84    
ref|XP_004975716.1|  PREDICTED: putative 12-oxophytodienoate redu...    266   4e-84    
ref|XP_002978572.1|  hypothetical protein SELMODRAFT_271316             266   5e-84    
gb|EMS58159.1|  12-oxophytodienoate reductase 1                         265   5e-84    
gb|EPS74544.1|  hypothetical protein M569_00207                         265   5e-84    
ref|XP_002890257.1|  predicted protein                                  262   1e-83    
ref|XP_002991479.1|  hypothetical protein SELMODRAFT_448442             264   2e-83    
ref|XP_002442026.1|  hypothetical protein SORBIDRAFT_08g007360          264   2e-83    
gb|AGN53428.1|  12-oxophytodienoic acid reductase 1-A1du                264   3e-83    
ref|XP_006342842.1|  PREDICTED: 12-oxophytodienoate reductase 1-like    260   6e-83    
ref|XP_002978919.1|  hypothetical protein SELMODRAFT_233236             261   2e-82    
ref|XP_002454008.1|  hypothetical protein SORBIDRAFT_04g022980          261   2e-82    
gb|AGN53429.1|  12-oxophytodienoic acid reductase 1-A1a                 261   3e-82    
gb|AGN53430.1|  12-oxophytodienoic acid reductase 1-A1b                 261   5e-82    
ref|XP_001767474.1|  predicted protein                                  260   2e-81    
gb|EMT21134.1|  12-oxophytodienoate reductase 2                         258   2e-81    
ref|NP_001242706.1|  uncharacterized protein LOC100817099               258   3e-81    
ref|XP_001753503.1|  predicted protein                                  259   3e-81    
ref|XP_010228561.1|  PREDICTED: putative 12-oxophytodienoate redu...    259   3e-81    
gb|EYU22757.1|  hypothetical protein MIMGU_mgv1a008135mg                253   2e-80    
ref|XP_004151741.1|  PREDICTED: putative 12-oxophytodienoate redu...    253   6e-80    
ref|XP_006656770.1|  PREDICTED: LOW QUALITY PROTEIN: putative 12-...    256   7e-80    
gb|EAY94268.1|  hypothetical protein OsI_16038                          255   2e-79    
dbj|BAD35327.1|  putative 12-oxophytodienoic acid reductase             249   4e-79    
sp|B9FFD2.2|OPR12_ORYSJ  RecName: Full=Putative 12-oxophytodienoa...    254   5e-79    
gb|EMS65403.1|  12-oxophytodienoate reductase 2                         252   7e-79    
dbj|BAK04717.1|  predicted protein                                      249   3e-78    
ref|XP_001751301.1|  predicted protein                                  251   3e-78    
ref|XP_002526421.1|  12-oxophytodienoate reductase opr, putative        247   1e-77    
emb|CDP04186.1|  unnamed protein product                                248   9e-77    
ref|XP_010930421.1|  PREDICTED: putative 12-oxophytodienoate redu...    244   1e-76    
gb|ACJ84713.1|  unknown                                                 241   3e-76    
gb|EEC77352.1|  hypothetical protein OsI_16037                          244   4e-76    
gb|EYU35002.1|  hypothetical protein MIMGU_mgv1a024432mg                243   6e-76    
ref|XP_007041176.1|  12-oxophytodienoate reductase 1 isoform 2          238   7e-75    
ref|XP_010666265.1|  PREDICTED: 12-oxophytodienoate reductase 3-like    243   7e-75    
ref|XP_006652324.1|  PREDICTED: LOW QUALITY PROTEIN: putative 12-...    241   1e-74    
gb|KFK39889.1|  hypothetical protein AALP_AA3G302200                    241   2e-74    
ref|NP_001061975.1|  Os08g0459600                                       241   3e-74    
gb|EMT04430.1|  12-oxophytodienoate reductase 2                         242   3e-74    
gb|AEO13840.1|  12-oxophytodienoate reductase 3                         240   5e-74    
gb|EYU25862.1|  hypothetical protein MIMGU_mgv1a007707mg                240   9e-74    
ref|XP_006659475.1|  PREDICTED: 12-oxophytodienoate reductase 7-like    239   1e-73    
gb|AAG15379.1|AF293653_1  12-oxo-phytodienoate reductase                239   2e-73    
gb|AAD38925.1|AF132212_1  OPDA-reductase homolog                        239   2e-73    
gb|AAF67635.1|AF218257_1  12-oxo-phytodienoate reductase                239   2e-73    
dbj|BAJ94270.1|  predicted protein                                      239   2e-73    
emb|CAB66143.1|  12-oxo-phytodienoate reductase                         239   2e-73    
ref|XP_002979866.1|  hypothetical protein SELMODRAFT_111662             239   4e-73    
ref|XP_005645176.1|  putative 12-oxophytodienoic acid reductase         238   4e-73    
ref|XP_006653446.1|  PREDICTED: putative 12-oxophytodienoate redu...    237   4e-73    
ref|XP_004973624.1|  PREDICTED: 12-oxophytodienoate reductase 7-like    238   4e-73    
gb|EEE61066.1|  hypothetical protein OsJ_14924                          238   5e-73    
ref|NP_001057142.2|  Os06g0216000                                       238   6e-73    
emb|CDY50415.1|  BnaC03g45030D                                          238   6e-73    
ref|XP_002988435.1|  hypothetical protein SELMODRAFT_183867             238   8e-73    
ref|NP_178662.1|  12-oxophytodienoate reductase 3                       237   9e-73    
emb|CDX93099.1|  BnaA03g38210D                                          237   9e-73    
gb|EMT05637.1|  12-oxophytodienoate reductase 2                         235   1e-72    
ref|XP_002885813.1|  opda-reductase 3                                   236   2e-72    
gb|ADN92997.2|  12-oxophytodienoate reductase OPR3                      237   2e-72    
ref|XP_001699402.1|  hypothetical protein CHLREDRAFT_121264             235   2e-72    
ref|XP_009771208.1|  PREDICTED: 12-oxophytodienoate reductase 3         236   3e-72    
ref|XP_006853946.1|  hypothetical protein AMTR_s00036p00209710          236   3e-72    
gb|AIW06651.1|  12-oxo-phytodienoic acid reductase 2                    236   3e-72    
ref|XP_007154589.1|  hypothetical protein PHAVU_003G131500g             235   3e-72    
gb|AGR49303.1|  12-oxo-phytodienoic acid reductase                      235   7e-72    
gb|ACG34147.1|  12-oxophytodienoate reductase 3                         235   9e-72    
ref|XP_009613359.1|  PREDICTED: 12-oxophytodienoate reductase 3         235   9e-72    
gb|AHC69825.1|  12-oxophytodienoate reductase 3                         234   1e-71    
ref|NP_001105833.1|  12-oxo-phytodienoic acid reductase8                234   1e-71    
ref|NP_001043054.1|  Os01g0369900                                       232   1e-71    
ref|XP_009337239.1|  PREDICTED: 12-oxophytodienoate reductase 3-like    232   1e-71    
ref|XP_006475531.1|  PREDICTED: 12-oxophytodienoate reductase 3-like    234   2e-71    
ref|XP_008784306.1|  PREDICTED: 12-oxophytodienoate reductase 7         233   2e-71    
ref|XP_004287624.1|  PREDICTED: 12-oxophytodienoate reductase 3-like    234   2e-71    
gb|EEE54586.1|  hypothetical protein OsJ_01791                          233   2e-71    
ref|XP_010467116.1|  PREDICTED: 12-oxophytodienoate reductase 3-like    234   2e-71    
gb|KDP33907.1|  hypothetical protein JCGZ_07478                         233   3e-71    
ref|XP_010090135.1|  12-oxophytodienoate reductase 3                    233   3e-71    
ref|XP_009136189.1|  PREDICTED: 12-oxophytodienoate reductase 3         233   4e-71    
ref|XP_009361696.1|  PREDICTED: 12-oxophytodienoate reductase 3         233   4e-71    
ref|XP_009408411.1|  PREDICTED: 12-oxophytodienoate reductase 7         233   4e-71    
ref|XP_004287625.1|  PREDICTED: 12-oxophytodienoate reductase 3-like    233   5e-71    
ref|NP_001105910.1|  LOC732830                                          233   5e-71    
gb|EMS56802.1|  12-oxophytodienoate reductase 1                         231   6e-71    
ref|XP_003574589.1|  PREDICTED: 12-oxophytodienoate reductase 7         233   6e-71    
gb|KHG19112.1|  12-oxophytodienoate reductase 3                         233   6e-71    
ref|XP_006297879.1|  hypothetical protein CARUB_v10013922mg             230   8e-71    



>gb|KDO42764.1| hypothetical protein CISIN_1g015862mg [Citrus sinensis]
Length=399

 Score =   379 bits (974),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 196/221 (89%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            P IWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN D+QPNGQAPIS TDKPLTPQ 
Sbjct  98   PSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISCTDKPLTPQI  157

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRLR DEIPQ++NDFRLAARNAI+AGFDGVE+HGAHG+LIDQFLKD 
Sbjct  158  RANGVDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQFLKDQ  217

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE V++EIG +RVGIRLSPF++Y+E GDSNP ALG++M
Sbjct  218  VNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYM  277

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRMK   EKS+ P SLLPMRKAF G
Sbjct  278  AESLNKYGILYCHMVEPRMKTREEKSECPHSLLPMRKAFKG  318



>ref|XP_002526414.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis]
 gb|EEF35990.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis]
Length=360

 Score =   377 bits (969),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 197/221 (89%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN+ FQPNGQAPISSTDKPLTPQ 
Sbjct  66   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGQAPISSTDKPLTPQL  125

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FTPPRRLR DEIPQ+++DFR+AARNA+ AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  126  RSNGIDIAEFTPPRRLRTDEIPQIVHDFRMAARNALNAGFDGVEIHGAHGYLIDQFMKDK  185

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE VA+EIG +++GIRLSPF+DY+E GDSNP ALG++M
Sbjct  186  VNDRTDQYGGSLENRCRFALEVVEAVANEIGADKLGIRLSPFADYMESGDSNPKALGLYM  245

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNK G+LYCHM+EPRMK  WEKSD P SL+PMRKAF G
Sbjct  246  AESLNKLGILYCHMVEPRMKTAWEKSDCPNSLVPMRKAFKG  286



>ref|XP_006478215.1| PREDICTED: 12-oxophytodienoate reductase 2-like isoform X1 [Citrus 
sinensis]
Length=395

 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 197/221 (89%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGG FFCQI HVGRVSN D+QPNGQAPISSTDKPLTPQ 
Sbjct  94   PGIWTKEQVEAWKPIVDAVHAKGGTFFCQIWHVGRVSNQDYQPNGQAPISSTDKPLTPQI  153

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFT PRRLR DEIPQ++NDFRLAARNAI+AGFDG+E+HGAHG+LIDQF+KD 
Sbjct  154  RANGVDIAQFTRPRRLRTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGYLIDQFMKDQ  213

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE V++EIG +RVGIRLSPF++Y+E GDSNP ALG++M
Sbjct  214  VNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYM  273

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRMK + EKS+ P SLLPMRKAF G
Sbjct  274  AESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFKG  314



>ref|XP_006478217.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Citrus sinensis]
Length=399

 Score =   377 bits (968),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 196/221 (89%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            P IWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN D+QPNGQAPISSTDKPLTPQ 
Sbjct  98   PSIWTKEQVEAWKPIVDAVHAKGGIFFCQIRHVGRVSNRDYQPNGQAPISSTDKPLTPQI  157

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQF PPRRLR  EIPQ++NDFRLAARNAI+AGFDGVE+HGAHG+LIDQFLKD 
Sbjct  158  RANGVDVAQFPPPRRLRTGEIPQIVNDFRLAARNAIEAGFDGVELHGAHGYLIDQFLKDQ  217

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE V++EIG +RVGIRLSPF++Y+E GDSNP ALG++M
Sbjct  218  VNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYM  277

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRMK + EKS+ P SLLPMRKAF G
Sbjct  278  AESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFKG  318



>ref|XP_006478216.1| PREDICTED: 12-oxophytodienoate reductase 2-like isoform X2 [Citrus 
sinensis]
Length=395

 Score =   377 bits (967),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 196/221 (89%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGG FFCQI HVGRVSN D+QPNGQAPIS TDKPLTPQ 
Sbjct  94   PGIWTKEQVEAWKPIVDAVHAKGGTFFCQIWHVGRVSNQDYQPNGQAPISCTDKPLTPQI  153

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRL  DEIPQ++NDFRLAARNAI+AGFDG+E+HGAHGFLIDQF+KD 
Sbjct  154  RTNGVDIAQFTPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGFLIDQFMKDQ  213

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE V++EIG +RVGIRLSPF++Y+E GDSNP ALG++M
Sbjct  214  VNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYM  273

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRMK + EKS+ P SLLPMRKAF G
Sbjct  274  AESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFKG  314



>ref|XP_008219064.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Prunus mume]
Length=370

 Score =   374 bits (959),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 197/221 (89%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGG+FFCQI HVGRVSNT FQPNGQAPISS+DKPLTPQ 
Sbjct  76   PGIWTKEQVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNTGFQPNGQAPISSSDKPLTPQL  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FTPPRRLR DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  136  RSNGIDVAEFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDQ  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALEVVE V +EIG ++VGIRLSPF++Y+E GDS+P ALG++M
Sbjct  196  VNDRTDEYGGSLENRCRFALEVVEAVVNEIGADKVGIRLSPFANYMESGDSDPKALGLYM  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A SLNKYG+LYCHM+EPRMK + EK   PQSL+PMRKAFNG
Sbjct  256  ANSLNKYGILYCHMVEPRMKTVGEKCACPQSLVPMRKAFNG  296



>ref|XP_004169282.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Cucumis sativus]
 gb|KGN63055.1| hypothetical protein Csa_2G395815 [Cucumis sativus]
Length=376

 Score =   374 bits (959),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 195/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVH KGG FFCQI HVGRVSN+ FQPNGQAPISS+DKPL PQ 
Sbjct  84   PGIWTKEQVEAWKPIVDAVHRKGGTFFCQIWHVGRVSNSGFQPNGQAPISSSDKPLFPQV  143

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRLR DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LI+QF+KD 
Sbjct  144  RSNGIDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIEQFMKDQ  203

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE V +EIGG+RVGIRLSPF+D++E GDSNP ALGV+M
Sbjct  204  VNDRTDQYGGSLENRCRFALEVVEAVVNEIGGDRVGIRLSPFADFMEAGDSNPKALGVYM  263

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRM+ + EK   P SLLPMRKAFNG
Sbjct  264  AESLNKYGILYCHMVEPRMRNVLEKVQCPHSLLPMRKAFNG  304



>ref|XP_008383583.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Malus domestica]
Length=376

 Score =   373 bits (958),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 194/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAPISSTDKPLTPQ 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTGFQPNGQAPISSTDKPLTPQI  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F+PPRRLR DE+PQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  142  RSNGIDVADFSPPRRLRTDEVPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE V +EIG ++VGIRLSPF+ Y+E GDS+P ALG+++
Sbjct  202  VNDRTDQYGGSLENRCRFALEVVEAVVNEIGADKVGIRLSPFASYMESGDSDPKALGLYL  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A SLNKYG+LYCHM+EPRMK   EK D P SL+PMRKAFNG
Sbjct  262  ANSLNKYGILYCHMVEPRMKTAGEKFDSPHSLVPMRKAFNG  302



>ref|XP_009362380.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Pyrus x 
bretschneideri]
Length=376

 Score =   372 bits (956),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 195/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAPISSTDKPLTPQ 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTGFQPNGQAPISSTDKPLTPQI  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F+PPRRLR DE+PQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  142  RSNGIDVADFSPPRRLRTDEVPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE V +EIG ++VGIRLSPF+ Y+E GDS+P ALG+++
Sbjct  202  VNDRTDQYGGSLENRCRFALEVVEAVVNEIGADKVGIRLSPFASYMESGDSDPKALGLYL  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A SLNKYG+LYCHM+EPRMK + EK D P SL+PMRKAFNG
Sbjct  262  ANSLNKYGILYCHMVEPRMKTVGEKCDCPHSLVPMRKAFNG  302



>ref|XP_009362379.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Pyrus x 
bretschneideri]
Length=376

 Score =   372 bits (955),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 195/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAPISSTDKPLTPQ 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTGFQPNGQAPISSTDKPLTPQI  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+F+PPRRLR DE+PQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  142  RSNGIDVAEFSPPRRLRTDEVPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE V +EIG ++VGIRLSPF+ Y+E GDS+P ALG+++
Sbjct  202  VNDRTDQYGGSLENRCRFALEVVEAVVNEIGADKVGIRLSPFASYMESGDSDPKALGLYL  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A SLNKYG+LYCHM+EPRM  + EK D P SL+PMRKAFNG
Sbjct  262  ANSLNKYGILYCHMVEPRMTTVGEKCDCPHSLVPMRKAFNG  302



>ref|XP_008382228.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Malus domestica]
Length=376

 Score =   372 bits (954),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAPISSTDKPLTPQ 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTGFQPNGQAPISSTDKPLTPQI  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F+PPRRLR DE+PQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  142  RSNGIDVADFSPPRRLRTDEVPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDR D+YGG L NRCRFALEVVE V +EIG ++VGIRLSPF+ Y+E GDS+P ALG+++
Sbjct  202  VNDRXDQYGGSLENRCRFALEVVEAVVNEIGADKVGIRLSPFASYMESGDSDPKALGLYL  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A SLNKYG+LYCHM+EPRMK   EK D P SL+PMRKAFNG
Sbjct  262  ANSLNKYGILYCHMVEPRMKTAGEKXDSPHSLVPMRKAFNG  302



>ref|XP_009362377.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Pyrus x 
bretschneideri]
Length=376

 Score =   372 bits (954),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 196/221 (89%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQIGHVGRVSNT  QPNGQAPISST+KPL+PQ 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTGSQPNGQAPISSTEKPLSPQV  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 +  +FTPPRRLR DEIPQ++NDFRLAARNA++AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  142  PSSGIDIIEFTPPRRLRTDEIPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFLKDE  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG + NRCRFALEV+E V +EIG ++VGIRLSPF++Y+E GDS+P ALG+++
Sbjct  202  VNDRTDQYGGSMENRCRFALEVIEAVVNEIGADKVGIRLSPFANYMESGDSDPEALGLYL  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A SLNKYG+LYCHM+EPRMK   EKSD P SL+PMRKAFNG
Sbjct  262  ANSLNKYGILYCHMVEPRMKTAAEKSDCPNSLVPMRKAFNG  302



>ref|XP_008441149.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Cucumis 
melo]
Length=376

 Score =   371 bits (952),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 194/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVH KGG FFCQI HVGRVSN+ FQPNGQAPISS+DKPL PQ 
Sbjct  84   PGIWTKEQVEAWKPIVDAVHRKGGTFFCQIWHVGRVSNSGFQPNGQAPISSSDKPLFPQV  143

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPP RLR DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LI+QF+KD 
Sbjct  144  RSNGIDVAQFTPPIRLRTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIEQFMKDQ  203

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE V +EIGG+RVGIRLSPF+D++E GDSNP ALGV+M
Sbjct  204  VNDRTDQYGGSLENRCRFALEVVEAVVNEIGGDRVGIRLSPFADFMEAGDSNPKALGVYM  263

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRM+ + EK   P SLLPMRKAFNG
Sbjct  264  AESLNKYGILYCHMVEPRMRNVLEKVQCPHSLLPMRKAFNG  304



>ref|XP_004155439.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like [Cucumis 
sativus]
Length=369

 Score =   370 bits (950),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 194/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQIEAWKPIVDAVH KGG FFCQI HVGRVSN+DFQPNGQAPISS+DKPL P+ 
Sbjct  77   PGIWTKEQIEAWKPIVDAVHCKGGTFFCQIWHVGRVSNSDFQPNGQAPISSSDKPLAPKV  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRLR DEIPQ++N FRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  137  RANGIDVAQFTPPRRLRTDEIPQIVNHFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG + NRCRFALE+VE    EIGG+RVGIRLSPF++Y+E GDSNP ALG++M
Sbjct  197  VNDRTDQYGGSIENRCRFALEIVEAAVKEIGGDRVGIRLSPFANYMEAGDSNPEALGMYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNKYG+LYCHM+EPRM+ + EK + P+SLLPMRKAF G
Sbjct  257  AENLNKYGILYCHMVEPRMETVSEKVESPRSLLPMRKAFKG  297



>gb|AFK34194.1| unknown [Lotus japonicus]
Length=359

 Score =   370 bits (949),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 190/215 (88%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT EQ+EAWKPIVDAVHAKG +FFCQI HVGRVS++ FQPNGQAPISSTDKPL PQ+
Sbjct  74   PGIWTNEQVEAWKPIVDAVHAKGALFFCQIWHVGRVSSSAFQPNGQAPISSTDKPLAPQD  133

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
              QFTPPRRLRADE+P ++NDFRLAARNAI AGFDGVEIHGAHG+L+DQFLKD VNDRTD
Sbjct  134  GMQFTPPRRLRADELPHIVNDFRLAARNAIDAGFDGVEIHGAHGYLLDQFLKDQVNDRTD  193

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            EYGG L NRCRF LEVVE VA+E+G ERVGIRLSPF+DY E GDS+P+ LG++MA +LNK
Sbjct  194  EYGGSLENRCRFPLEVVEAVANEVGAERVGIRLSPFADYAESGDSSPDELGLYMANALNK  253

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y +LYCHM+EPRMK L EK + P SL+PMRKAFNG
Sbjct  254  YNILYCHMVEPRMKTLGEKFETPHSLVPMRKAFNG  288



>ref|XP_007223332.1| hypothetical protein PRUPE_ppa007377mg [Prunus persica]
 gb|EMJ24531.1| hypothetical protein PRUPE_ppa007377mg [Prunus persica]
Length=370

 Score =   370 bits (950),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 197/221 (89%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGG+FFCQI HVGRVSN+ +QPNGQAPISS+DKPLTPQ 
Sbjct  76   PGIWTKEQVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNSGYQPNGQAPISSSDKPLTPQL  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FTPPRRLR DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  136  RSNGIDVAEFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDQ  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALEVVE VA+EIG ++VGIRLSPF++Y+E GDS+P ALG++M
Sbjct  196  VNDRTDEYGGSLENRCRFALEVVEAVANEIGADKVGIRLSPFANYMESGDSDPKALGLYM  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A SLNKYG+LYCHM+EPRM+ + EK   P SL+PMRKAFNG
Sbjct  256  ANSLNKYGILYCHMVEPRMRTVGEKCACPHSLVPMRKAFNG  296



>emb|CAN60665.1| hypothetical protein VITISV_033920 [Vitis vinifera]
Length=379

 Score =   370 bits (951),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNTDFQPNGQAPIS TDKPLTPQ 
Sbjct  85   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTDFQPNGQAPISCTDKPLTPQI  144

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQF+ PR L  DEIPQV+NDFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  145  RSNGIDVAQFSTPRXLTTDEIPQVVNDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDQ  204

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE V DEIG ++VGIRLSPF+ Y E GDSNP ALG++M
Sbjct  205  VNDRTDKYGGSLENRCRFALEVVEAVVDEIGADKVGIRLSPFAAYAEAGDSNPKALGLYM  264

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRMK + EK + P SLLPMRKAFNG
Sbjct  265  AESLNKYGLLYCHMVEPRMKTVGEKCECPHSLLPMRKAFNG  305



>ref|XP_007020161.1| 12-oxophytodienoate reductase 2 [Theobroma cacao]
 gb|EOY17386.1| 12-oxophytodienoate reductase 2 [Theobroma cacao]
Length=383

 Score =   370 bits (950),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 195/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN+ FQPNGQAPISSTDKPL PQ 
Sbjct  89   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGQAPISSTDKPLKPQL  148

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRLR DEI  V+NDFRLAARNA++AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  149  RANGIDIAQFTPPRRLRTDEISLVVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFMKDQ  208

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE +A+EIG ++VGIRLSPF++Y+E GDSNP  LG++M
Sbjct  209  VNDRTDQYGGSLENRCRFALEVVEAIANEIGADKVGIRLSPFANYMESGDSNPKELGLYM  268

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRMK + EK + P SL+PMRKAFNG
Sbjct  269  AESLNKYGILYCHMVEPRMKTVAEKHECPDSLVPMRKAFNG  309



>ref|XP_002281119.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Vitis vinifera]
Length=379

 Score =   369 bits (948),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNTDFQPNGQAPIS TDKPLTPQ 
Sbjct  85   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTDFQPNGQAPISCTDKPLTPQI  144

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQF+ PRRL  DEIPQV+NDFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  145  RSNGIDVAQFSTPRRLTTDEIPQVVNDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDQ  204

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRC FALEVVE V DEIG ++VGIRLSPF+ Y E GDSNP ALG++M
Sbjct  205  VNDRTDKYGGSLENRCGFALEVVEAVVDEIGADKVGIRLSPFAAYAEAGDSNPKALGLYM  264

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRMK + EK + P SLLPMRKAFNG
Sbjct  265  AESLNKYGLLYCHMVEPRMKTVGEKCECPHSLLPMRKAFNG  305



>ref|XP_009362371.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Pyrus x 
bretschneideri]
Length=376

 Score =   368 bits (944),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 194/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAPISSTDKPL P+ 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTVFQPNGQAPISSTDKPLAPKI  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+F+PPRRLR DE+PQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  142  RSNGIDVAEFSPPRRLRTDEVPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
             NDRTD+YGG L NRCRFALEVVE V +EIG ++VGIRLSPF+ Y+E GDS+P ALG+++
Sbjct  202  ANDRTDQYGGSLENRCRFALEVVEAVVNEIGADKVGIRLSPFASYMESGDSDPKALGLYL  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A SLNKYG+LYCHM+EPRMK + EK D P SL+PMRKAFNG
Sbjct  262  ANSLNKYGILYCHMVEPRMKTVGEKCDCPHSLVPMRKAFNG  302



>ref|XP_007223371.1| hypothetical protein PRUPE_ppa007490mg [Prunus persica]
 gb|EMJ24570.1| hypothetical protein PRUPE_ppa007490mg [Prunus persica]
Length=366

 Score =   367 bits (943),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 194/217 (89%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKP--LTP  175
            PGIWTKEQ+EAWKPIVDAVHAK G+FFCQI HVGRVSN+ +QPNGQAPISSTDKP  L  
Sbjct  76   PGIWTKEQVEAWKPIVDAVHAKDGVFFCQIWHVGRVSNSGYQPNGQAPISSTDKPIRLNG  135

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             + ++FTPPRRLR DEIPQ++NDFRLAA+NAI+AGFDGVEIHGAHG+L+DQFLKD VNDR
Sbjct  136  IDASEFTPPRRLRTDEIPQIVNDFRLAAKNAIEAGFDGVEIHGAHGYLLDQFLKDQVNDR  195

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L NRCRF LEVVE V +EIG ++VGIRLSPF+DY++ GDSNPNALG++MA SL
Sbjct  196  TDQYGGSLENRCRFPLEVVEAVVNEIGADKVGIRLSPFADYMDSGDSNPNALGLYMANSL  255

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NKYG+LYCHM+EPRMK + EKS+ P SLLPMRKAFNG
Sbjct  256  NKYGILYCHMVEPRMKTVGEKSESPHSLLPMRKAFNG  292



>ref|XP_010100109.1| Putative 12-oxophytodienoate reductase 11 [Morus notabilis]
 gb|EXB81492.1| Putative 12-oxophytodienoate reductase 11 [Morus notabilis]
Length=372

 Score =   367 bits (943),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 194/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN+ +QPNGQAPISSTDKPLTPQ 
Sbjct  78   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGYQPNGQAPISSTDKPLTPQI  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRLR +EIPQ++NDFRLAARNAI AGFDG+EIHGAHG+LI+QFLKD 
Sbjct  138  RANGVDVAQFTPPRRLRTNEIPQIVNDFRLAARNAIDAGFDGIEIHGAHGYLIEQFLKDQ  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE + +EIG +RVGIRLSPF+ Y+E GDSNP ALG+++
Sbjct  198  VNDRTDKYGGSLENRCRFALEIVEAITNEIGVDRVGIRLSPFASYMESGDSNPEALGLYL  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNK+G+LYCHM+EPRMK + E  + P SL+PMRKAF G
Sbjct  258  AESLNKFGILYCHMVEPRMKTVGEAHETPHSLVPMRKAFKG  298



>ref|XP_002281348.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Vitis vinifera]
Length=379

 Score =   367 bits (942),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 191/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAPIS TDKPLTPQ 
Sbjct  85   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTGFQPNGQAPISCTDKPLTPQI  144

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
             A      QF+PPRRL  DEIPQV+ DFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  145  GANGIDVDQFSPPRRLTTDEIPQVVKDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDQ  204

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRF LEVVE V DEIG ++VGIRLSPF+ Y E GDSNP ALG++M
Sbjct  205  VNDRTDKYGGSLENRCRFPLEVVEAVVDEIGADKVGIRLSPFATYAEAGDSNPRALGLYM  264

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRMK L EKS+   SLLPMRKAFNG
Sbjct  265  AESLNKYGLLYCHMVEPRMKTLGEKSECAHSLLPMRKAFNG  305



>ref|XP_009610272.1| PREDICTED: 12-oxophytodienoate reductase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=352

 Score =   366 bits (939),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGG+FFCQI HVGRVS+ DFQPNGQAPIS TDKPLTPQ 
Sbjct  58   PGIWTKEQVEAWKPIVNAVHAKGGVFFCQIWHVGRVSHKDFQPNGQAPISCTDKPLTPQI  117

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRL  DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  118  RANGVDVAQFTPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDQ  177

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD YGG L NRCRFALE+VE V +EIG +RVGIRLSPF+ Y+E GDSNP ALG++M
Sbjct  178  VNDRTDHYGGSLENRCRFALEIVEAVVNEIGADRVGIRLSPFASYMESGDSNPGALGLYM  237

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+ Y HM+EPRMK + EK++ P+SL+PMRKAF G
Sbjct  238  AESLNKYGIAYSHMVEPRMKTVGEKTECPESLVPMRKAFKG  278



>ref|XP_009610270.1| PREDICTED: 12-oxophytodienoate reductase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=378

 Score =   366 bits (940),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGG+FFCQI HVGRVS+ DFQPNGQAPIS TDKPLTPQ 
Sbjct  84   PGIWTKEQVEAWKPIVNAVHAKGGVFFCQIWHVGRVSHKDFQPNGQAPISCTDKPLTPQI  143

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRL  DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  144  RANGVDVAQFTPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDQ  203

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD YGG L NRCRFALE+VE V +EIG +RVGIRLSPF+ Y+E GDSNP ALG++M
Sbjct  204  VNDRTDHYGGSLENRCRFALEIVEAVVNEIGADRVGIRLSPFASYMESGDSNPGALGLYM  263

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+ Y HM+EPRMK + EK++ P+SL+PMRKAF G
Sbjct  264  AESLNKYGIAYSHMVEPRMKTVGEKTECPESLVPMRKAFKG  304



>gb|KDP45639.1| hypothetical protein JCGZ_17246 [Jatropha curcas]
Length=381

 Score =   366 bits (940),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 195/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGR+SN+ FQPNGQAPISSTDK LTPQ 
Sbjct  87   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRISNSGFQPNGQAPISSTDKGLTPQI  146

Query  182  Q------AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +      AQFTPPRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  147  RGNGFGVAQFTPPRRLRTDEIPNIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  206

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE V++EIG ++VGIRLSPF++Y E GDSNP ALG++M
Sbjct  207  VNDRTDQYGGSLENRCRFALEIVEAVSNEIGADKVGIRLSPFANYGEAGDSNPKALGLYM  266

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG++YCHM+EPRMK + EK +  +SLLPMRKAF G
Sbjct  267  AESLNKYGIVYCHMVEPRMKTVGEKFECKESLLPMRKAFKG  307



>ref|XP_007023454.1| 12-oxophytodienoate reductase 2, partial [Theobroma cacao]
 gb|EOY26076.1| 12-oxophytodienoate reductase 2, partial [Theobroma cacao]
Length=371

 Score =   366 bits (939),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGI FCQI HVGRVSN  FQPNGQAPISSTDK LTPQ 
Sbjct  75   PGIWTKEQVEAWKPIVDAVHAKGGIIFCQIWHVGRVSNYGFQPNGQAPISSTDKSLTPQI  134

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQF+PPRRLR DEIPQ++NDFR AARNA++AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  135  RANGVDVAQFSPPRRLRTDEIPQIVNDFRTAARNAMEAGFDGVEIHGAHGYLIDQFLKDQ  194

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALE+VE VA+EIG +RVGIRLSPF+D++E  DS+P AL ++M
Sbjct  195  VNDRTDEYGGSLENRCRFALEIVEAVANEIGADRVGIRLSPFTDFIEAVDSDPKALALYM  254

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             E+LNKYG+LYCHMIEPR+K + + S+GP +LLPMRKAFNG
Sbjct  255  VEALNKYGILYCHMIEPRLKMMGDVSEGPHTLLPMRKAFNG  295



>ref|XP_007223370.1| hypothetical protein PRUPE_ppa007488mg [Prunus persica]
 gb|EMJ24569.1| hypothetical protein PRUPE_ppa007488mg [Prunus persica]
Length=366

 Score =   365 bits (938),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 192/217 (88%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKP--LTP  175
            PGIWTKEQ+EAWKPIVDAVHAK G+FFCQI HVGRVSN+ +QPNGQAPISSTDKP  L  
Sbjct  76   PGIWTKEQVEAWKPIVDAVHAKDGVFFCQIWHVGRVSNSGYQPNGQAPISSTDKPIRLNG  135

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             +  +FTPPRRLR DEIPQ++NDFRLAA+NAI+AGFDGVEIHGAHG+L+DQFLKD VNDR
Sbjct  136  IDANEFTPPRRLRTDEIPQIVNDFRLAAKNAIEAGFDGVEIHGAHGYLLDQFLKDQVNDR  195

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L NRCRF LEVVE V  EIG ++VGIRLSPF+DY++ GDSNPNALG++MA SL
Sbjct  196  TDQYGGSLENRCRFPLEVVEAVVKEIGADKVGIRLSPFADYMDSGDSNPNALGLYMANSL  255

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NKYG+LYCHM+EPRMK + EKS+ P SLLPMRKAFNG
Sbjct  256  NKYGILYCHMVEPRMKTVGEKSESPHSLLPMRKAFNG  292



>ref|XP_008358699.1| PREDICTED: LOW QUALITY PROTEIN: putative 12-oxophytodienoate 
reductase 11 [Malus domestica]
Length=376

 Score =   366 bits (939),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 195/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT  QPNGQAPISSTD+PL+PQ 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTRSQPNGQAPISSTDEPLSPQL  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 +  ++TPPRRLR DEIPQ++NDFRLA+RNA++AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  142  PSSGIDIIEYTPPRRLRTDEIPQIVNDFRLASRNAMEAGFDGVEIHGAHGYLIDQFLKDE  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG + NRCRFALEVVE V +EIGG++VGIRLSPF++Y E GDS P ALG+++
Sbjct  202  VNDRTDQYGGSMENRCRFALEVVEAVVNEIGGDKVGIRLSPFANYSESGDSGPEALGLYL  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A SLNKYG+LYCHM+EPRM+   EKSD PQSL+PMRKAFNG
Sbjct  262  ANSLNKYGILYCHMVEPRMQTDAEKSDXPQSLVPMRKAFNG  302



>ref|XP_009770174.1| PREDICTED: 12-oxophytodienoate reductase 1-like isoform X2 [Nicotiana 
sylvestris]
Length=361

 Score =   365 bits (936),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGGIFFCQI HVGRVS+ DFQPNGQAPIS TDKPLTPQ 
Sbjct  67   PGIWTKEQVEAWKPIVNAVHAKGGIFFCQIWHVGRVSHKDFQPNGQAPISCTDKPLTPQI  126

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRL  DEIPQ++NDFRLAA+NAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  127  RANGVDVAQFTPPRRLTIDEIPQIVNDFRLAAKNAIEAGFDGVEIHGAHGYLIDQFMKDQ  186

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD YGG L NRCRFA E+VE V +EIG +RVGIRLSPF+ Y+E GDSNP+ALG++M
Sbjct  187  VNDRTDHYGGSLENRCRFAHEIVEAVVNEIGADRVGIRLSPFASYMESGDSNPSALGLYM  246

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+ YCHM+EPRMK + EK + P+SL+PMRKAF G
Sbjct  247  AESLNKYGIAYCHMVEPRMKTVGEKVECPESLVPMRKAFKG  287



>ref|XP_008219065.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Prunus mume]
Length=366

 Score =   364 bits (935),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 193/217 (89%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKP--LTP  175
            PGIWTKEQ+EAWKPIVDAVHAK G+FFCQI HVGRVSN+ +QPNGQAPISSTDKP  L  
Sbjct  76   PGIWTKEQVEAWKPIVDAVHAKDGVFFCQIWHVGRVSNSGYQPNGQAPISSTDKPIRLNG  135

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             + ++FTPPRRLR DEIPQ++NDFRLAA+NAI+AGFDGVEIHGAHG+L+DQFLKD VNDR
Sbjct  136  IDASEFTPPRRLRTDEIPQIVNDFRLAAKNAIEAGFDGVEIHGAHGYLLDQFLKDQVNDR  195

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L NRCRF LEVVE V +EIG ++VGIRLSPF+DY++ GDSNPNALG++MA SL
Sbjct  196  TDQYGGPLENRCRFPLEVVEAVVNEIGADKVGIRLSPFADYMDSGDSNPNALGLYMANSL  255

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             KYG+LYCHM+EPRMK + EKS+ P SLLPMRKAFNG
Sbjct  256  TKYGILYCHMVEPRMKTVGEKSESPHSLLPMRKAFNG  292



>gb|AHC69824.1| 12-oxophytodienoate reductase 1 [Nicotiana tabacum]
Length=377

 Score =   365 bits (936),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGGIFFCQI HVGRVS+ DFQPNGQAPIS TDKPLTPQ 
Sbjct  83   PGIWTKEQVEAWKPIVNAVHAKGGIFFCQIWHVGRVSHKDFQPNGQAPISCTDKPLTPQI  142

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRL  DEIPQ++NDFRLAA+NAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  143  RANGVDVAQFTPPRRLTIDEIPQIVNDFRLAAKNAIEAGFDGVEIHGAHGYLIDQFMKDQ  202

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD YGG L NRCRFA E+VE V +EIG +RVGIRLSPF+ Y+E GDSNP+ALG++M
Sbjct  203  VNDRTDHYGGSLENRCRFAHEIVEAVVNEIGADRVGIRLSPFASYMESGDSNPSALGLYM  262

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+ YCHM+EPRMK + EK + P+SL+PMRKAF G
Sbjct  263  AESLNKYGIAYCHMVEPRMKTVGEKVECPESLVPMRKAFKG  303



>ref|XP_009770173.1| PREDICTED: 12-oxophytodienoate reductase 1-like isoform X1 [Nicotiana 
sylvestris]
Length=377

 Score =   365 bits (936),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGGIFFCQI HVGRVS+ DFQPNGQAPIS TDKPLTPQ 
Sbjct  83   PGIWTKEQVEAWKPIVNAVHAKGGIFFCQIWHVGRVSHKDFQPNGQAPISCTDKPLTPQI  142

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRL  DEIPQ++NDFRLAA+NAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  143  RANGVDVAQFTPPRRLTIDEIPQIVNDFRLAAKNAIEAGFDGVEIHGAHGYLIDQFMKDQ  202

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD YGG L NRCRFA E+VE V +EIG +RVGIRLSPF+ Y+E GDSNP+ALG++M
Sbjct  203  VNDRTDHYGGSLENRCRFAHEIVEAVVNEIGADRVGIRLSPFASYMESGDSNPSALGLYM  262

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+ YCHM+EPRMK + EK + P+SL+PMRKAF G
Sbjct  263  AESLNKYGIAYCHMVEPRMKTVGEKVECPESLVPMRKAFKG  303



>ref|XP_008219067.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Prunus mume]
Length=370

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 194/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PG+WT+EQ+EAWKPIVDAVHAKGG+FFCQI H GRVSN+ FQPNGQAPIS TDKPLTPQ 
Sbjct  76   PGLWTREQVEAWKPIVDAVHAKGGVFFCQIWHAGRVSNSGFQPNGQAPISCTDKPLTPQL  135

Query  182  Q------AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            Q      AQ+TPPRRL+ DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  136  QTNGVDIAQYTPPRRLKIDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDQ  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALE+VE V +EIG ++VGIRLSPF+DY+E  DS+P ALG++M
Sbjct  196  VNDRTDEYGGLLENRCRFALEIVEAVVNEIGADKVGIRLSPFADYMESADSDPKALGLYM  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            ++SLNKYG+LYCHM+EPRMK   +KS+ P SLLPMR+AF G
Sbjct  256  SKSLNKYGILYCHMVEPRMKTPGDKSETPDSLLPMREAFKG  296



>ref|XP_004294515.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Fragaria vesca 
subsp. vesca]
Length=374

 Score =   364 bits (934),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 195/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGGIF CQI HVGRVSN+ +QPNGQAPISSTDKPLTPQ 
Sbjct  76   PGIWTKEQVEAWKPIVNAVHAKGGIFICQIWHVGRVSNSGYQPNGQAPISSTDKPLTPQI  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRLR DEIPQ++NDFRLAARNA++AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  136  RANGIDVAQFTPPRRLRTDEIPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFLKDE  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFAL++VE + +EIG ++VGIRLSPF++Y+E GDSNP  LG+++
Sbjct  196  VNDRTDQYGGSLENRCRFALDIVEAIVNEIGADKVGIRLSPFANYMESGDSNPKELGLYL  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+LYCHM+EPRMK + EK + P SL+PMRKAFNG
Sbjct  256  ANALNKYGILYCHMVEPRMKTVGEKFECPHSLVPMRKAFNG  296



>ref|XP_003610767.1| 12-oxophytodienoate reductase [Medicago truncatula]
 gb|AES93725.1| 12-oxophytodienoate reductase-like protein [Medicago truncatula]
Length=371

 Score =   363 bits (933),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 191/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKG   FCQI HVGRVS++ FQPNGQAPISSTDK LTPQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGATIFCQIWHVGRVSDSVFQPNGQAPISSTDKSLTPQI  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 N A+FTPPRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+L++QF+KD 
Sbjct  140  RSNGFNIAKFTPPRRLRTDEIPNIVNDFRLAARNAIEAGFDGVEIHGAHGYLLEQFMKDK  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALEVVE VA+EIG ERVGIRLSPF++Y ECGDSNPN LG++M
Sbjct  200  VNDRTDEYGGSLENRCRFALEVVEAVANEIGAERVGIRLSPFAEYAECGDSNPNELGLYM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              +LNKYG+LYCHM+EPRMK + EK++ P SL+PMRKAF G
Sbjct  260  VNALNKYGILYCHMVEPRMKTVGEKTECPDSLVPMRKAFKG  300



>gb|AFK37579.1| unknown [Medicago truncatula]
Length=371

 Score =   363 bits (933),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 191/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKG   FCQI HVGRVS++ FQPNGQAPISSTDK LTPQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGATIFCQIWHVGRVSDSVFQPNGQAPISSTDKSLTPQI  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 N A+FTPPRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+L++QF+KD 
Sbjct  140  RSNGFNIAKFTPPRRLRTDEIPNIVNDFRLAARNAIEAGFDGVEIHGAHGYLLEQFMKDK  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALEVVE VA+EIG ERVGIRLSPF++Y ECGDSNPN LG++M
Sbjct  200  VNDRTDEYGGSLENRCRFALEVVEAVANEIGAERVGIRLSPFAEYAECGDSNPNELGLYM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              +LNKYG+LYCHM+EPRMK + EK++ P SL+PMRKAF G
Sbjct  260  VNALNKYGILYCHMVEPRMKTVGEKTECPDSLVPMRKAFKG  300



>ref|XP_003517567.2| PREDICTED: 12-oxophytodienoate reductase 2 [Glycine max]
 gb|KHN34118.1| 12-oxophytodienoate reductase 2 [Glycine soja]
Length=402

 Score =   364 bits (935),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTK+ ++AWKPIVDAVHAKGG+FFCQI HVGRVS++ +QPNGQAPISSTDKPLTPQ 
Sbjct  102  PGIWTKDHVQAWKPIVDAVHAKGGVFFCQIWHVGRVSDSVYQPNGQAPISSTDKPLTPQI  161

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 +Q QFTPPRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+L++QF+KD 
Sbjct  162  RSNGIDQVQFTPPRRLRTDEIPHIVNDFRLAARNAIEAGFDGVEIHGAHGYLLEQFMKDK  221

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALEVVE V +EIG +RVGIRLSPF++Y E GDSNP  LG++M
Sbjct  222  VNDRTDEYGGSLENRCRFALEVVEAVVNEIGADRVGIRLSPFAEYSESGDSNPKELGLYM  281

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              +LNKYG+LYCHM+EPRMK + EK++ P SL+PMRKAFNG
Sbjct  282  MNALNKYGILYCHMVEPRMKTVGEKTECPHSLVPMRKAFNG  322



>ref|XP_006339339.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Solanum tuberosum]
Length=367

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 192/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIV+AVHAKGGIFFCQI HVGRVSNT FQPNGQ PIS TDKPLTPQ 
Sbjct  73   PGIWTKEHVEAWKPIVNAVHAKGGIFFCQIWHVGRVSNTGFQPNGQDPISCTDKPLTPQI  132

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRL  DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  133  RSNGLDVAQFTPPRRLATDEIPHIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDK  192

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFAL++VE + +EIG +RVGIRLSPF+DY+E GDSNP+ALG++M
Sbjct  193  VNDRTDQYGGSLENRCRFALDIVEAIVNEIGADRVGIRLSPFADYMESGDSNPSALGLYM  252

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+ YCHM+EPRMK +  K + P+SL+PMRKAF G
Sbjct  253  AESLNKYGIAYCHMVEPRMKTVGVKVECPESLVPMRKAFKG  293



>dbj|BAD06575.1| LEDI-5c protein [Lithospermum erythrorhizon]
Length=375

 Score =   363 bits (932),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 194/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGGIFFCQI HVGRVS+ + QPNGQAP SSTDKPLT Q 
Sbjct  81   PGIWTKEQVEAWKPIVEAVHAKGGIFFCQIWHVGRVSHQNSQPNGQAPFSSTDKPLTSQI  140

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FTPPRRLR DEIP++INDFRLAARNAI+AGFDGVEIHGAHG+L+DQFLKD 
Sbjct  141  RSNGIDVAEFTPPRRLRTDEIPEIINDFRLAARNAIEAGFDGVEIHGAHGYLVDQFLKDQ  200

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            +NDRTD+YGG L NRCRFALE+VE VA EIG +RVGIRLSP+++Y+E GDSNP ALG++M
Sbjct  201  INDRTDQYGGSLENRCRFALELVEAVATEIGADRVGIRLSPYANYMESGDSNPTALGLYM  260

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+LYCHM+EPRMK + EK++ P SL+PMRKAF G
Sbjct  261  AGALNKYGILYCHMVEPRMKTVGEKTESPYSLMPMRKAFKG  301



>gb|ACR77749.1| 12-oxophytodienoic acid 10,10-reductase [Astragalus sinicus]
Length=379

 Score =   362 bits (930),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 189/216 (88%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ++AWKPIVDAVHAKG IFF QI HVGRVSN  +QPNGQAPISSTDKPLTPQN
Sbjct  93   PGIWTKEQVDAWKPIVDAVHAKGAIFFLQIWHVGRVSNPGYQPNGQAPISSTDKPLTPQN  152

Query  182  QA-QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
               Q TPPRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+L++QF+KD VNDRT
Sbjct  153  DGEQVTPPRRLRTDEIPHIVNDFRLAARNAIEAGFDGVEIHGAHGYLLEQFMKDKVNDRT  212

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D+YGG L NRCRF LEVVE V +EIG ERVGIRLSPF++Y ECGDSNP  LG++MA ++N
Sbjct  213  DKYGGSLENRCRFPLEVVEAVVNEIGAERVGIRLSPFAEYSECGDSNPETLGLYMANAIN  272

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            KYG+LYCH++EPRMK L EK++   SL+PMRKAFNG
Sbjct  273  KYGILYCHVVEPRMKTLGEKAESSHSLVPMRKAFNG  308



>ref|XP_008352796.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Malus domestica]
Length=302

 Score =   359 bits (922),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 193/217 (89%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKP--LTP  175
            PGIWTKEQ+EAWKPIVDAVHAKGG+FFCQI HVGRVSN+ +QPNGQAPISSTDKP  L  
Sbjct  78   PGIWTKEQVEAWKPIVDAVHAKGGLFFCQIWHVGRVSNSGYQPNGQAPISSTDKPIRLNG  137

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             + ++FTPPRRLR DEIPQ++NDFRLAARN+I+AGFDGVEIHGAHG+L+DQFLKD VNDR
Sbjct  138  IDASEFTPPRRLRTDEIPQIVNDFRLAARNSIEAGFDGVEIHGAHGYLLDQFLKDHVNDR  197

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L NRCR  LEVVE VA+EIG ++VGIRLSPF+DY++ GDSNP  LG++MA +L
Sbjct  198  TDQYGGSLENRCRLPLEVVEAVANEIGADKVGIRLSPFADYMDSGDSNPKELGLYMANAL  257

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NKYG++YCHM+EPRMK L EK++  QSLLPMRKAF+G
Sbjct  258  NKYGIVYCHMVEPRMKTLGEKAETHQSLLPMRKAFHG  294



>ref|XP_010100111.1| Putative 12-oxophytodienoate reductase 11 [Morus notabilis]
 gb|EXB81494.1| Putative 12-oxophytodienoate reductase 11 [Morus notabilis]
Length=307

 Score =   360 bits (923),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 190/223 (85%), Gaps = 8/223 (4%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIV--DAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTP  175
            PGIW KEQ+EAW+PIV  DAVHAKGGIFFCQI H GRVSN+ +QPNGQAPISS DKPLTP
Sbjct  10   PGIWRKEQVEAWRPIVIVDAVHAKGGIFFCQIWHAGRVSNSSYQPNGQAPISSMDKPLTP  69

Query  176  QNQA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLK  337
            QNQA      QFT PRRLR DEIPQ++NDFRLAARNAI+AGFDG+EIHGAHG+L+DQFLK
Sbjct  70   QNQADDVDVAQFTTPRRLRTDEIPQIVNDFRLAARNAIEAGFDGIEIHGAHGYLVDQFLK  129

Query  338  DGVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGV  517
            D VNDRT EYGG L  RCRFAL+VVE  ADEIG +RVGIRLSPF+ Y+E GDSNP ALG+
Sbjct  130  DQVNDRTHEYGGSLEKRCRFALKVVEATADEIGADRVGIRLSPFASYMESGDSNPEALGL  189

Query  518  FMAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            ++AESLNK+G+LYCHM+EPRMK + E  + P SL+PMRKAF G
Sbjct  190  YLAESLNKFGILYCHMVEPRMKTVGEAHETPHSLVPMRKAFKG  232



>ref|XP_007223334.1| hypothetical protein PRUPE_ppa007381mg [Prunus persica]
 gb|EMJ24533.1| hypothetical protein PRUPE_ppa007381mg [Prunus persica]
Length=370

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 192/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PG+WT+EQ+EAWKPIVDAVHAKGG+FFCQI H GRVSN+ FQPNGQAPIS TDKPL PQ 
Sbjct  76   PGLWTREQVEAWKPIVDAVHAKGGVFFCQIWHAGRVSNSGFQPNGQAPISCTDKPLPPQL  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQ+TPPRRL+ DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  136  LTNGVDIAQYTPPRRLKTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDQ  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALE+VE V +EIG E+VGIRLSPF+DY+E  DS+P ALG++M
Sbjct  196  VNDRTDEYGGSLENRCRFALEIVEAVVNEIGAEKVGIRLSPFADYMESADSDPKALGLYM  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            ++SLNKYG+LYCHM+EPRMK   + S+ P SLLPMR+AF G
Sbjct  256  SKSLNKYGILYCHMVEPRMKTAGDNSETPDSLLPMREAFKG  296



>ref|XP_006376142.1| hypothetical protein POPTR_0013s10180g [Populus trichocarpa]
 gb|ERP53939.1| hypothetical protein POPTR_0013s10180g [Populus trichocarpa]
Length=381

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 190/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQ+ HVGRVSN DFQPNGQAPIS TDKPL PQ 
Sbjct  87   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQLWHVGRVSNRDFQPNGQAPISCTDKPLAPQI  146

Query  182  QAQ------FTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A       FT PRRLR DEIP V+NDFR+AARNA++AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  147  RANGIDAVDFTTPRRLRTDEIPHVVNDFRIAARNAMEAGFDGVEIHGAHGYLIDQFMKDQ  206

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVV  V DEIG +RVGIRLSP+++Y + GDSNP ALG++M
Sbjct  207  VNDRTDQYGGSLENRCRFALEVVGAVVDEIGADRVGIRLSPYANYGQAGDSNPGALGLYM  266

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKYG+L+CHM+EPRMK + E+ + P SLLPMRKAFNG
Sbjct  267  VESLNKYGILFCHMVEPRMKTVGERVESPHSLLPMRKAFNG  307



>emb|CAN80189.1| hypothetical protein VITISV_000938 [Vitis vinifera]
Length=361

 Score =   360 bits (925),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 191/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNTDFQPNGQAPIS TDKPLTPQ 
Sbjct  67   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTDFQPNGQAPISCTDKPLTPQI  126

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +       QF+PPRRL  DEIPQV+ DFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  127  RGNGIGVDQFSPPRRLTTDEIPQVVKDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDQ  186

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE V DEIG ++VGI+LSP+  + E GDSNP ALG++M
Sbjct  187  VNDRTDKYGGSLENRCRFALEVVEAVVDEIGADKVGIKLSPYDAFGEAGDSNPKALGLYM  246

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRM+ L EK +   SLLPMRKAFNG
Sbjct  247  AESLNKYGLLYCHMVEPRMETLGEKCECAHSLLPMRKAFNG  287



>ref|XP_010665323.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Vitis vinifera]
Length=379

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 191/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNTDFQPNGQAPIS TDKPLTPQ 
Sbjct  85   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTDFQPNGQAPISCTDKPLTPQI  144

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +       QF+PPRRL  DEIPQV+ DFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  145  RGNGIGVDQFSPPRRLTTDEIPQVVKDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDQ  204

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE V DEIG ++VGI+LSP+  + E  DSNP ALG++M
Sbjct  205  VNDRTDKYGGSLENRCRFALEVVEAVVDEIGADKVGIKLSPYDAFGEAEDSNPKALGLYM  264

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRM+ L EKS+   SLLPMRKAFNG
Sbjct  265  AESLNKYGLLYCHMVEPRMETLGEKSECAHSLLPMRKAFNG  305



>ref|XP_010665439.1| PREDICTED: LOW QUALITY PROTEIN: 12-oxophytodienoate reductase 
2-like, partial [Vitis vinifera]
Length=348

 Score =   360 bits (924),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 188/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVD VHAKGGIFFCQI HVGRVSNT FQPNGQAPIS TDKPLTPQ 
Sbjct  54   PGIWTKEQVEAWKPIVDDVHAKGGIFFCQIWHVGRVSNTGFQPNGQAPISCTDKPLTPQI  113

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
             A      QF+PPRRL  DEIPQV+ DFRLAARNAI+AGFDGVEIHGAHG  +DQF+KD 
Sbjct  114  GANGIDVDQFSPPRRLTTDEIPQVVKDFRLAARNAIEAGFDGVEIHGAHGXXLDQFMKDQ  173

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRF LEVVE V DEIG ++VGIRLSPF+ Y E GDSNP ALG++M
Sbjct  174  VNDRTDKYGGSLENRCRFPLEVVEAVVDEIGADKVGIRLSPFATYAEAGDSNPRALGLYM  233

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRMK L EKS+   SLLPMRKAFNG
Sbjct  234  AESLNKYGLLYCHMVEPRMKTLGEKSECAHSLLPMRKAFNG  274



>ref|XP_003610769.1| 12-oxophytodienoate reductase [Medicago truncatula]
 gb|AES93727.1| 12-oxophytodienoate reductase-like protein [Medicago truncatula]
Length=369

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 192/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ++AWKPIVDAVH KGG+FFCQI HVGRVS+T +QPNGQAPISSTDKPL PQ 
Sbjct  78   PGIWTKEQVDAWKPIVDAVHDKGGVFFCQIWHVGRVSDTVYQPNGQAPISSTDKPLKPQI  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FTPPRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+L++QF+KD 
Sbjct  138  RSNGIDVAKFTPPRRLRTDEIPNIVNDFRLAARNAIEAGFDGVEIHGAHGYLLEQFMKDK  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALEVVE VA+EIG ERVGIRLSPF++Y ECGDSNP  LG++M
Sbjct  198  VNDRTDEYGGSLENRCRFALEVVEAVANEIGTERVGIRLSPFAEYSECGDSNPKELGLYM  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              +LNKYG+LYCHM+EPRM  + EK++ P SL+PMRKAF G
Sbjct  258  VNALNKYGILYCHMVEPRMITVGEKTECPDSLVPMRKAFKG  298



>ref|XP_004294510.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like [Fragaria 
vesca subsp. vesca]
Length=370

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 191/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV AVHAKGG+FFCQI HVGRVSN+ FQP+GQAPISSTDK L PQ 
Sbjct  76   PGIWTKEQVEAWKPIVSAVHAKGGVFFCQIWHVGRVSNSGFQPDGQAPISSTDKALKPQI  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 +  +FTPPRRLR DEIPQ++NDFRLAARNA++AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  136  GSNGIDVEEFTPPRRLRTDEIPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFLKDE  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE V +EIG +RVGIR SPF++Y+E GDSNP  LG+++
Sbjct  196  VNDRTDQYGGSLENRCRFALEIVEAVVNEIGADRVGIRFSPFANYMESGDSNPMDLGLYL  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              SLNKYG+LYCHM+EPRMK L EKS+ P SL+PMRKAFNG
Sbjct  256  VNSLNKYGILYCHMVEPRMKTLGEKSECPHSLVPMRKAFNG  296



>ref|XP_007223333.1| hypothetical protein PRUPE_ppa007379mg [Prunus persica]
 gb|EMJ24532.1| hypothetical protein PRUPE_ppa007379mg [Prunus persica]
Length=370

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 192/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PG+WT EQ+EAWKPIVDAVHAKGG+FFCQI H GRVSN+ FQP GQ PISSTDKPLT Q 
Sbjct  76   PGLWTTEQVEAWKPIVDAVHAKGGVFFCQIVHPGRVSNSGFQPRGQTPISSTDKPLTSQI  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                   A++TPPRRLR DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  136  LTNGVAVAEYTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDQ  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRF LE+VE VA+EIG ++VGIRLSPF+DY+E GDSNP ALG++M
Sbjct  196  VNDRTDEYGGSLENRCRFTLEIVEAVANEIGADKVGIRLSPFADYMESGDSNPKALGLYM  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A+SLNKYG+LYCH++EPRMK + +KS+ P SLLPMR+AF G
Sbjct  256  AKSLNKYGILYCHVVEPRMKTVGDKSETPYSLLPMREAFKG  296



>ref|XP_004150154.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Cucumis sativus]
 ref|XP_004167453.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Cucumis sativus]
 gb|KGN49744.1| hypothetical protein Csa_5G098480 [Cucumis sativus]
Length=371

 Score =   360 bits (924),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 195/220 (89%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+E WKPIVDAVH+KGG+FFCQI HVGRVS++  +PNGQAPISSTDKPL+PQ 
Sbjct  80   PGIWTKEQVEGWKPIVDAVHSKGGVFFCQIWHVGRVSDSGSKPNGQAPISSTDKPLSPQV  139

Query  182  QAQ-----FTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
            +A      F+PPRRLR DEIP+++NDFRLAARNAI+AGFDGVEIHGAHG+LI+QF+KD V
Sbjct  140  EANGDIEYFSPPRRLRTDEIPEIVNDFRLAARNAIEAGFDGVEIHGAHGYLIEQFMKDHV  199

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTD+YGG L NRCRFALEVVE V +EIGG+RVGIRLSPF+D +E GDSNPNALG++M 
Sbjct  200  NDRTDQYGGSLENRCRFALEVVEAVVNEIGGDRVGIRLSPFADLMEAGDSNPNALGLYMV  259

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            ESLNKYG+LYCHM+EPRM+ + E+S+ P+SLLPMRK F G
Sbjct  260  ESLNKYGILYCHMVEPRMESVPEESECPRSLLPMRKVFKG  299



>gb|KHG03512.1| 12-oxophytodienoate reductase 2 -like protein [Gossypium arboreum]
Length=371

 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 194/221 (88%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAPIS TDK LTPQ 
Sbjct  75   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQILHVGRVSNTGFQPNGQAPISCTDKALTPQL  134

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            QA      +F+PPRRLR DEIPQ++NDFR+AARNA++AGFDGVEIHGAHG+LI+QFLKD 
Sbjct  135  QASGVDVVEFSPPRRLRTDEIPQIVNDFRIAARNAMEAGFDGVEIHGAHGYLIEQFLKDQ  194

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE VA+EIG ++VGIRLSP+++++E  DS+P ALG++M
Sbjct  195  VNDRTDQYGGSLENRCRFALEIVEAVANEIGADKVGIRLSPYTEFMESVDSDPQALGLYM  254

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             E+LNKYG+LYCHM+EPR+K   E  + PQSL+PMRKAFNG
Sbjct  255  VEALNKYGILYCHMVEPRIKIGMEVCESPQSLVPMRKAFNG  295



>ref|XP_004155438.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like [Cucumis 
sativus]
Length=369

 Score =   360 bits (923),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 190/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIVDAVH KGG FFCQI H GRVSN+ FQPNGQAPISS+DKPL  Q 
Sbjct  77   PGIWTREQVEAWKPIVDAVHCKGGTFFCQIWHAGRVSNSGFQPNGQAPISSSDKPLASQV  136

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            QA      QFT PRRLR DEIPQ+++ FRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  137  QADGTDVAQFTSPRRLRTDEIPQIVDHFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG ++NRCRFALEVVE   +EIGG+RVGIRLSPF++Y+E GDSNP ALG++M
Sbjct  197  VNDRTDQYGGSIKNRCRFALEVVEAAVNEIGGDRVGIRLSPFANYMEAGDSNPKALGMYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNKYG+LYCHM+EPRM+   EK + P SLLPMRKAF G
Sbjct  257  AENLNKYGILYCHMVEPRMETASEKVETPHSLLPMRKAFKG  297



>ref|XP_008219066.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Prunus mume]
Length=370

 Score =   359 bits (922),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PG+WT+EQ+EAWKPIVDAVHAKGG+FFCQI H GRVSN+ FQPNGQAPIS TDKPLTPQ 
Sbjct  76   PGLWTREQVEAWKPIVDAVHAKGGVFFCQIWHAGRVSNSGFQPNGQAPISCTDKPLTPQL  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQ+TPPRRLR DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  136  LANGVDVAQYTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDQ  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALE+VE V +EIG ++VGIRLSPF+DY+E  DS+P ALG++M
Sbjct  196  VNDRTDEYGGSLENRCRFALEIVEAVVNEIGADKVGIRLSPFADYMESADSDPKALGLYM  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A+SLN+YG+ YCH++EPRMK + +K + P SLLPMR+AF G
Sbjct  256  AKSLNRYGIQYCHVVEPRMKTVGDKIESPDSLLPMREAFKG  296



>ref|XP_007224583.1| hypothetical protein PRUPE_ppa1027192mg [Prunus persica]
 gb|EMJ25782.1| hypothetical protein PRUPE_ppa1027192mg [Prunus persica]
Length=338

 Score =   358 bits (918),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 192/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PG+WT+EQ+EAWKPIVDAVHAKGG+FFCQI H GRVSN+ FQPNGQAPIS TDKPLTPQ 
Sbjct  44   PGLWTREQVEAWKPIVDAVHAKGGVFFCQIWHAGRVSNSGFQPNGQAPISCTDKPLTPQL  103

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQ+TPPRRLR DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  104  LANGVDVAQYTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDQ  163

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALE+VE V +EIG ++VGIRLSPF+DY+E  DS+P ALG++M
Sbjct  164  VNDRTDEYGGSLENRCRFALEIVEAVVNEIGADKVGIRLSPFADYMESADSDPKALGLYM  223

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             +SLNKYG+ YCH++EPRMK + +K + P SLLPMR+AF G
Sbjct  224  VKSLNKYGIQYCHVVEPRMKAVGDKIESPDSLLPMREAFKG  264



>ref|XP_004294522.1| PREDICTED: 12-oxophytodienoate reductase 1-like, partial [Fragaria 
vesca subsp. vesca]
Length=368

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 191/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIV+AVHAKGGIFFCQI HVGRVSN+ FQPNGQAPIS TDKPLTPQ 
Sbjct  70   PGIWTKEHVEAWKPIVNAVHAKGGIFFCQIWHVGRVSNSGFQPNGQAPISCTDKPLTPQI  129

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRLR DEIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQFLKD 
Sbjct  130  RSNGIDVAQFTPPRRLRTDEIPHIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFLKDQ  189

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE V +EIG ++VGIR SPF+DY+E GDSNP  LG+++
Sbjct  190  VNDRTDQYGGSLENRCRFALEIVEAVVNEIGADKVGIRSSPFADYMETGDSNPKELGLYL  249

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+LYCHMIEPRMK + E  + P SL+PMRKAFNG
Sbjct  250  ANALNKYGILYCHMIEPRMKTVGENCECPHSLVPMRKAFNG  290



>ref|XP_003537618.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Glycine max]
 gb|KHN35165.1| Putative 12-oxophytodienoate reductase 11 [Glycine soja]
Length=371

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 189/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTK+Q++AWKPIVDAVHAKGGIFFCQI H GRVSN+ +QPNGQAPISSTDK L PQ 
Sbjct  72   PGIWTKQQVQAWKPIVDAVHAKGGIFFCQIWHAGRVSNSVYQPNGQAPISSTDKLLAPQG  131

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++  +TPPRRLR DEIP ++NDFRLAARNAIQAGFDGVEIHGAHG+LIDQFLKD 
Sbjct  132  RGDGIDEVHYTPPRRLRTDEIPHIVNDFRLAARNAIQAGFDGVEIHGAHGYLIDQFLKDK  191

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE + DEIG ERVGIRLSPFS+Y ECGDSNP  LG+++
Sbjct  192  VNDRTDQYGGSLENRCRFALEIVEALVDEIGAERVGIRLSPFSEYCECGDSNPEQLGLYI  251

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              +LNKY +LYCHM+EPRMK + E+ + PQSL+ MRKAFNG
Sbjct  252  VNALNKYSILYCHMVEPRMKTVVERVECPQSLVLMRKAFNG  292



>ref|XP_008466854.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Cucumis melo]
Length=430

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 195/220 (89%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVH+KGG+FFCQI HVGRVS++  +PNGQAP+SSTDKPL+PQ 
Sbjct  139  PGIWTKEQVEAWKPIVDAVHSKGGVFFCQIWHVGRVSDSGSKPNGQAPVSSTDKPLSPQV  198

Query  182  QAQ-----FTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
            +A      F+PPRRLR DEIP+++NDFRLAARNAI+AGFDGVEIHGAHG+LI+QF+KD V
Sbjct  199  EANGDVEYFSPPRRLRTDEIPEIVNDFRLAARNAIEAGFDGVEIHGAHGYLIEQFMKDHV  258

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTD+YGG L NRCRFALEVVE V +EIGG+RVGIRLSPF+D +E GDSNPNALG++M 
Sbjct  259  NDRTDQYGGSLENRCRFALEVVEAVVNEIGGDRVGIRLSPFADLMEAGDSNPNALGLYMV  318

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            ESLNKYG+LYCH++EPRM+ + E S+ P+SLLPMRK F G
Sbjct  319  ESLNKYGILYCHIVEPRMESVPEDSECPRSLLPMRKVFKG  358



>ref|XP_007023455.1| 12-oxophytodienoate reductase 2 [Theobroma cacao]
 gb|EOY26077.1| 12-oxophytodienoate reductase 2 [Theobroma cacao]
Length=382

 Score =   358 bits (920),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 191/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGI FCQI HVGRVSN  FQPNGQAPISSTDK LTPQ 
Sbjct  86   PGIWTKEQVEAWKPIVDAVHAKGGIIFCQIWHVGRVSNYGFQPNGQAPISSTDKSLTPQI  145

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQF+PPRRLR DEIPQ++NDFR AARNA++AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  146  RANGVDVAQFSPPRRLRTDEIPQIVNDFRTAARNAMEAGFDGVEIHGAHGYLIDQFLKDQ  205

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALE+VE VA+EIG +RVGIRLSPF+D++E  DS+P AL ++M
Sbjct  206  VNDRTDEYGGSLENRCRFALEIVEAVANEIGADRVGIRLSPFTDFIEAVDSDPKALALYM  265

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             E+LNKYG+LYCHMIEPR+K + + S+   +LLPMRKAFNG
Sbjct  266  VEALNKYGILYCHMIEPRLKMMGDVSECSHTLLPMRKAFNG  306



>ref|XP_009362381.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Pyrus x 
bretschneideri]
Length=376

 Score =   358 bits (919),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 193/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQIE+WKPIVDAVHAKGGIFFCQI H GR+SNT FQPNGQAPISSTDK L PQ 
Sbjct  82   PGIWTKEQIESWKPIVDAVHAKGGIFFCQIWHGGRISNTGFQPNGQAPISSTDKVLAPQI  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F+PPRRLR DE+PQ++NDFRLAARNA++AGFDGVEIHGAHG+LI+QFLKD 
Sbjct  142  RTNGIDVAVFSPPRRLRTDEVPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIEQFLKDQ  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG + NRCRFALEVVE VA+EIG ++VGIRLSPF++Y    DS+P ALG+++
Sbjct  202  VNDRTDQYGGSMENRCRFALEVVEAVANEIGADKVGIRLSPFANYNGSVDSDPEALGLYL  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+LYCHM+EPRMK + EKSD PQSLLPMRKAFNG
Sbjct  262  ANALNKYGILYCHMVEPRMKTVGEKSDCPQSLLPMRKAFNG  302



>ref|XP_004295892.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Fragaria vesca 
subsp. vesca]
Length=374

 Score =   358 bits (918),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 191/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGG F CQI HVGRVSN+ FQPNGQ+PISSTDKPL PQ 
Sbjct  76   PGIWTKEQVEAWKPIVNAVHAKGGFFICQIVHVGRVSNSGFQPNGQSPISSTDKPLQPQI  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 +  +FTPPRRLRADEIPQ++NDFRLAARNA++AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  136  GSSGIDVEEFTPPRRLRADEIPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFLKDQ  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFAL++VE + +EIG  +VGIRLSPF+DY+E GDSNP  LG+++
Sbjct  196  VNDRTDQYGGSLENRCRFALDIVEALVNEIGAAKVGIRLSPFADYMESGDSNPKELGLYL  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LN YG+LYCHMIEPRMK + EK + P SL+PMRKAFNG
Sbjct  256  ANALNMYGILYCHMIEPRMKTVGEKCECPHSLVPMRKAFNG  296



>ref|XP_006390164.1| hypothetical protein EUTSA_v10018727mg [Eutrema salsugineum]
 dbj|BAJ33636.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27450.1| hypothetical protein EUTSA_v10018727mg [Eutrema salsugineum]
Length=374

 Score =   357 bits (917),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 192/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGGIFFCQI HVGRVSN  FQPNGQAPIS TDKPLTPQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNRGFQPNGQAPISCTDKPLTPQI  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  140  RANGIDEALFTPPRRLSIEEIPSIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+FALE+VE VA+EIG +RVGIRLSPF+DY+E GD+NP AL V M
Sbjct  200  VNDRTDEYGGSLQNRCKFALEIVEAVANEIGPDRVGIRLSPFADYMESGDTNPQALAVHM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IEPRMK + E ++ P +L+PMRKAF G
Sbjct  260  AESLNKYGILYCHVIEPRMKTVGEITECPHTLMPMRKAFQG  300



>ref|XP_004511386.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Cicer arietinum]
Length=372

 Score =   357 bits (915),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 189/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT +QI+AWKPIV AVHA    FFCQI HVGRVS+T +QPNGQAPISSTDKPLTPQ 
Sbjct  81   PGIWTNQQIQAWKPIVHAVHAHRATFFCQIWHVGRVSDTVYQPNGQAPISSTDKPLTPQL  140

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FTPPRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+L++QF+KD 
Sbjct  141  RSNGIDVAKFTPPRRLRTDEIPNIVNDFRLAARNAIEAGFDGVEIHGAHGYLLEQFMKDK  200

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALEVVE VA+EIG ERVGIRLSPF++Y ECGDSNP  LG++M
Sbjct  201  VNDRTDEYGGSLENRCRFALEVVEAVANEIGAERVGIRLSPFAEYAECGDSNPKELGLYM  260

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              +LNKYG+LYCHM+EPRMK + EK + P SL+PMRKAFNG
Sbjct  261  VNALNKYGILYCHMVEPRMKTVNEKIECPHSLVPMRKAFNG  301



>ref|XP_008219073.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Prunus mume]
Length=394

 Score =   357 bits (916),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 192/225 (85%), Gaps = 10/225 (4%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PG+WT+EQ+EAWKPIVDAVHAKGG+FFCQI H GRVSN+ FQP GQ PISSTDKPLT Q 
Sbjct  96   PGLWTREQVEAWKPIVDAVHAKGGVFFCQIMHPGRVSNSGFQPRGQTPISSTDKPLTSQI  155

Query  179  ---------NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQF  331
                       A++TPPRRLR DEI Q++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF
Sbjct  156  LTNGFAVAVAVAEYTPPRRLRTDEITQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQF  215

Query  332  LKDGVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNAL  511
            +KD VNDRTDEYGG L NRCRF LE+VE VA+EIG ++VGIRLSPF+DY+E GDSNP AL
Sbjct  216  MKDQVNDRTDEYGGSLENRCRFPLEIVEAVANEIGADKVGIRLSPFADYMESGDSNPKAL  275

Query  512  GVFMAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            G++MA+SLNKYG+LYCH++EPRMK + +KS+ P SLLPMR+AF G
Sbjct  276  GLYMAKSLNKYGILYCHVVEPRMKTVGDKSETPYSLLPMREAFKG  320



>dbj|BAD06521.1| hypothetical protein [Pisum sativum]
Length=362

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTK+Q+EAWKPIVDAVHAKG IFFCQI HVGRVSN+ +QPNGQAPISSTDK +T  +
Sbjct  77   PGIWTKQQVEAWKPIVDAVHAKGAIFFCQIWHVGRVSNSSYQPNGQAPISSTDKAITSND  136

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
            Q QFT PRRLR DEIP ++NDF+LAARNAI+AGFDGVEIHGAHG+L+DQF+KD VNDRTD
Sbjct  137  QQQFTAPRRLRTDEIPNIVNDFKLAARNAIEAGFDGVEIHGAHGYLLDQFMKDKVNDRTD  196

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            EYGG L NRCRF LEVVE V +EIG ERVGIRLSPF+++ E GDSNPNALG++MA +LNK
Sbjct  197  EYGGSLENRCRFPLEVVEAVVNEIGAERVGIRLSPFAEFAESGDSNPNALGLYMANALNK  256

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y +LYCHM+EPR+   ++  + P SL PMRKAFNG
Sbjct  257  YNILYCHMVEPRIIDTFDPVETPHSLEPMRKAFNG  291



>ref|XP_008383858.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica]
Length=371

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 191/217 (88%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDK--PLTP  175
            PGIWT EQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAPISST+K  PL  
Sbjct  80   PGIWTXEQVEAWKPIVDAVHAKGGIFFCQILHVGRVSNTGFQPNGQAPISSTEKXVPLNG  139

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             + ++ TPP RLR DEIPQ++NDFRLAARNA++AGFDGVEIHGAHG+LIDQF KD VNDR
Sbjct  140  IDVSEXTPPXRLRTDEIPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFTKDQVNDR  199

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG + NRCRFALEVVE VA+EIG ++VGIRLSPF++Y+  GDS+P ALG+++  SL
Sbjct  200  TDQYGGSMENRCRFALEVVEAVANEIGADKVGIRLSPFANYMGSGDSDPEALGLYLVNSL  259

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NKYG++YCHM+EPRMK + EKSD PQSL+PMRKAFNG
Sbjct  260  NKYGIVYCHMVEPRMKTIGEKSDCPQSLVPMRKAFNG  296



>ref|XP_007226740.1| hypothetical protein PRUPE_ppa019182mg [Prunus persica]
 gb|EMJ27939.1| hypothetical protein PRUPE_ppa019182mg [Prunus persica]
Length=344

 Score =   355 bits (911),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 194/222 (87%), Gaps = 7/222 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PG+WT+EQ+EAWKPIVDAVHAKGG+FFCQI H GRVSN+ FQP GQAPISST+KPLT Q 
Sbjct  49   PGLWTREQVEAWKPIVDAVHAKGGVFFCQIWHPGRVSNSGFQPKGQAPISSTEKPLTSQI  108

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                   A++TPPRRLR DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  109  LTNGVAVAEYTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDQ  168

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L N CRFALE+VE VA+EIG ++VGIRLSPF+DY+E GDSNP ALG++M
Sbjct  169  VNDRTDEYGGSLENCCRFALEIVEAVANEIGADKVGIRLSPFADYMESGDSNPKALGLYM  228

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMR-KAFNG  646
            A+SLNKYG+LYCH++EPRMK + +KS+ P SLLPMR +AF G
Sbjct  229  AKSLNKYGILYCHVVEPRMKTVGDKSETPYSLLPMREEAFKG  270



>ref|XP_008349200.1| PREDICTED: LOW QUALITY PROTEIN: putative 12-oxophytodienoate 
reductase 11 [Malus domestica]
Length=394

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/239 (71%), Positives = 195/239 (82%), Gaps = 24/239 (10%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT  QPNGQAPISSTDKPL+PQ 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTRSQPNGQAPISSTDKPLSPQL  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAG------------------FDG  289
                 +  ++TPPRRLR DEIPQ++NDFRLA+RNA++AG                  FDG
Sbjct  142  PSSGIDIIEYTPPRRLRTDEIPQIVNDFRLASRNAMEAGNLFQIIFGALKLFVXYTGFDG  201

Query  290  VEIHGAHGFLIDQFLKDGVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPF  469
            VEIHGAHG+LIDQFLKD VNDRTD+YGG + NRCRFALEVVE V +EIGG++VGIRLSPF
Sbjct  202  VEIHGAHGYLIDQFLKDEVNDRTDQYGGSMENRCRFALEVVEAVVNEIGGDKVGIRLSPF  261

Query  470  SDYLECGDSNPNALGVFMAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            ++Y E GDS P ALG+++A SLNKYG+LYCHM+EPRM+   EKSD PQSL+PMRKAFNG
Sbjct  262  ANYSESGDSGPEALGLYLANSLNKYGILYCHMVEPRMQTAAEKSDFPQSLVPMRKAFNG  320



>ref|XP_009362376.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Pyrus x 
bretschneideri]
Length=405

 Score =   357 bits (916),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 192/217 (88%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKP--LTP  175
            PGIWTKEQ+EAWKPIVDAVHAKGG+FFCQI HVGRVSN+ +QPNGQAPISSTDKP  L  
Sbjct  115  PGIWTKEQVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNSGYQPNGQAPISSTDKPIRLNG  174

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             + ++FTPPRRLR DEIPQ++NDFRLAARN+I+AGFDGVEIHGAHG+L+DQFLKD VNDR
Sbjct  175  IDASEFTPPRRLRTDEIPQIVNDFRLAARNSIEAGFDGVEIHGAHGYLLDQFLKDHVNDR  234

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L NRCR  LEVVE VA+EIG ++VGIRLSPF+DY++ GDSNP  LG++MA +L
Sbjct  235  TDQYGGSLENRCRLPLEVVEAVANEIGADKVGIRLSPFADYMDSGDSNPKELGLYMANAL  294

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NKYG++YCHM+EPRMK + EK +  QSLLPMRK+F+G
Sbjct  295  NKYGIVYCHMVEPRMKTMGEKDETHQSLLPMRKSFHG  331



>ref|XP_009379104.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Pyrus x bretschneideri]
Length=372

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 192/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT+EQ+EAWKP+VDAVH KGG+FFCQI H GRVSN+ FQPNGQAPIS TDKPLTPQ 
Sbjct  78   PGIWTREQVEAWKPVVDAVHTKGGVFFCQIWHAGRVSNSGFQPNGQAPISCTDKPLTPQL  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FTPPRRL  +EIPQ++NDFRLAARNAI+AGFDGVEIHGA+G++IDQFLKD 
Sbjct  138  LSNGVDVAEFTPPRRLETNEIPQIVNDFRLAARNAIEAGFDGVEIHGANGYIIDQFLKDQ  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE VA+EIG ++VG+RLSPF+DY+E GDSNPNALG++M
Sbjct  198  VNDRTDQYGGSLENRCRFALEIVEAVANEIGADKVGLRLSPFADYMESGDSNPNALGLYM  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IEPRMK   + S+   SL PMR+AF G
Sbjct  258  AESLNKYGILYCHVIEPRMKTPGDISESSDSLAPMREAFKG  298



>gb|KGN43736.1| hypothetical protein Csa_7G063995 [Cucumis sativus]
Length=369

 Score =   355 bits (912),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 188/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIVDAVH KGG FFCQI H GRVSN+ FQPNGQAPISS+DKPL  Q 
Sbjct  77   PGIWTREQVEAWKPIVDAVHCKGGTFFCQIWHAGRVSNSGFQPNGQAPISSSDKPLASQV  136

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            QA      QFT PRRLR DEIPQ+++ FRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  137  QADGTDVAQFTSPRRLRTDEIPQIVDHFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG ++NRCRFALEVVE   +EIGG+RVGIRLS F++Y+E GDSNP ALG++M
Sbjct  197  VNDRTDQYGGSIKNRCRFALEVVEAAVNEIGGDRVGIRLSSFANYMEAGDSNPKALGMYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             E+LNKYG+LYCHM+EPRM+   EK + P SLLPMRKAF G
Sbjct  257  GENLNKYGILYCHMVEPRMETASEKVETPHSLLPMRKAFKG  297



>ref|XP_006339340.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Solanum tuberosum]
Length=374

 Score =   355 bits (912),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 190/220 (86%), Gaps = 6/220 (3%)
 Frame = +2

Query  5    GIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTP---  175
            GIWT EQ+EAWKP+V AVHAKGGIFFCQ+ H GRVS+ DFQPNGQAPIS TDKP  P   
Sbjct  81   GIWTYEQVEAWKPVVSAVHAKGGIFFCQLWHTGRVSSKDFQPNGQAPISCTDKPSKPLIC  140

Query  176  ---QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
               ++ AQF PPRRLR DEIPQ++NDFRLAARNAI+ GFDGVEIHGAHG+LIDQF+KD V
Sbjct  141  SDVRDVAQFPPPRRLRTDEIPQIVNDFRLAARNAIETGFDGVEIHGAHGYLIDQFMKDQV  200

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTD+YGG L NRCRFALE+VE V +EIGG+RVGIRLSPF+DY++ GDSNP+ALG++MA
Sbjct  201  NDRTDQYGGSLENRCRFALEIVEVVVNEIGGDRVGIRLSPFADYMDSGDSNPSALGLYMA  260

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            ESLNKYG+ YCHM+EPRMK L EK + P+SL+PMRKAF G
Sbjct  261  ESLNKYGIAYCHMVEPRMKTLGEKVECPESLIPMRKAFKG  300



>ref|XP_007223390.1| hypothetical protein PRUPE_ppa007498mg [Prunus persica]
 gb|EMJ24589.1| hypothetical protein PRUPE_ppa007498mg [Prunus persica]
Length=366

 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 189/217 (87%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKP--LTP  175
            PGIWTKEQ+EAWKPIVDAVHAK G+FFCQI HVGRVSN+ +QPNGQAPISSTDKP  L  
Sbjct  76   PGIWTKEQVEAWKPIVDAVHAKDGVFFCQIWHVGRVSNSGYQPNGQAPISSTDKPIRLNG  135

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             + ++FTPPRRLR DEIPQ++NDFRLAA+NAI+AGFDGVEIHG HG+L+DQFLKD VNDR
Sbjct  136  IDTSEFTPPRRLRTDEIPQIVNDFRLAAKNAIEAGFDGVEIHGGHGYLLDQFLKDQVNDR  195

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L NRCRF LEVVE V  EIG ++VGI+LSPF DY + GDSNPNALG++MA SL
Sbjct  196  TDQYGGSLENRCRFPLEVVEAVVKEIGADKVGIKLSPFDDYTDSGDSNPNALGLYMANSL  255

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NKYG+LYCHM EPRM+ + EKS+  QSLLPMR+AFNG
Sbjct  256  NKYGILYCHMAEPRMETVGEKSESHQSLLPMREAFNG  292



>ref|XP_011101214.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Sesamum 
indicum]
Length=377

 Score =   355 bits (911),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 189/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG IFFCQI HVGRVS+T FQPN QAP+S TDK L PQ 
Sbjct  83   PGIWTKEQVEAWKPIVDAVHAKGAIFFCQIWHVGRVSSTVFQPNEQAPVSCTDKGLAPQV  142

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQF+PPRRL  DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF KD 
Sbjct  143  RANGVDVAQFSPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFFKDQ  202

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD++GG L NRCRFALE+ E V +E+G  RVG+RLSPF++++EC DSNP ALG++M
Sbjct  203  VNDRTDQFGGSLENRCRFALEIAEAVTNEVGAYRVGMRLSPFANFMECADSNPKALGLYM  262

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNKYG+LYCHM+EPRM+ + EKS+ P SLLPMRKAF G
Sbjct  263  AEALNKYGLLYCHMVEPRMRTVMEKSECPHSLLPMRKAFKG  303



>ref|XP_008455178.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Cucumis 
melo]
Length=369

 Score =   354 bits (908),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 189/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT EQ+EAWKPIVDAVH KGG FFCQI HVGRVSN+DFQPNG  PISS+DKPL  Q 
Sbjct  77   PGIWTMEQVEAWKPIVDAVHCKGGTFFCQIWHVGRVSNSDFQPNGHPPISSSDKPLASQV  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRLR DEIPQ+++ FRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  137  RANGIDIAQFTPPRRLRTDEIPQIVDHFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG + NRCRFALEVVE V +EIGG+RVGIRLSPF++Y+E GDS+P ALG++M
Sbjct  197  VNDRTDQYGGSIENRCRFALEVVEAVVNEIGGDRVGIRLSPFANYMEAGDSDPKALGLYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNKY +LYCHM+EPRM+ +  K + P SLLPMRKAF G
Sbjct  257  AENLNKYEILYCHMVEPRMETVLGKVESPHSLLPMRKAFKG  297



>ref|XP_010062375.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Eucalyptus grandis]
 gb|KCW69513.1| hypothetical protein EUGRSUZ_F02955 [Eucalyptus grandis]
Length=371

 Score =   353 bits (907),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 185/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGI FCQI HVGRVSNT FQPNGQAPISSTDKPLTPQ 
Sbjct  77   PGIWTKEQVEAWKPIVDAVHAKGGILFCQIWHVGRVSNTGFQPNGQAPISSTDKPLTPQL  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRLR DEIP ++NDFRLAARNA++AGFDGVEIHGAHG+L++QF+KD 
Sbjct  137  RSNGIDVAQFTPPRRLRTDEIPNIVNDFRLAARNAMEAGFDGVEIHGAHGYLLEQFMKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRF L++VE + +EIG +RVGIRLSPF+ Y E  DSNP ALG +M
Sbjct  197  VNDRTDQYGGSLENRCRFTLKIVEAIVNEIGADRVGIRLSPFATYSEAADSNPKALGKYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             E LN YG+LYCHM+EPRMK + E S+ P SL+PMR  F G
Sbjct  257  VEQLNNYGILYCHMVEPRMKTVGEMSECPHSLVPMRNLFKG  297



>ref|XP_007023453.1| 12-oxophytodienoate reductase 2 isoform 2, partial [Theobroma 
cacao]
 gb|EOY26075.1| 12-oxophytodienoate reductase 2 isoform 2, partial [Theobroma 
cacao]
Length=389

 Score =   354 bits (908),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 190/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGI FCQI HVGRVSN  FQPNGQAPISSTDK LTPQ 
Sbjct  121  PGIWTKEQVEAWKPIVDAVHAKGGIIFCQIWHVGRVSNYGFQPNGQAPISSTDKSLTPQI  180

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            QA      QF+PPRRLR DEIPQ++NDFR+AARNA++AGFDGVEIHG +G+LIDQFL D 
Sbjct  181  QANGVDVAQFSPPRRLRTDEIPQIVNDFRIAARNAMEAGFDGVEIHGFNGYLIDQFLNDQ  240

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALE+VE VA+EIG +RVGIRLSPF+D++E  DS+P AL ++M
Sbjct  241  VNDRTDEYGGSLVNRCRFALEIVEAVANEIGADRVGIRLSPFTDFIEAVDSDPKALALYM  300

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             E+LNKYG+LYCHMIEPR+K + + S+ P +L PMRKAFNG
Sbjct  301  VEALNKYGILYCHMIEPRLKMMGDVSECPHTLPPMRKAFNG  341



>ref|XP_007023452.1| 12-oxophytodienoate reductase 2 isoform 1 [Theobroma cacao]
 gb|EOY26074.1| 12-oxophytodienoate reductase 2 isoform 1 [Theobroma cacao]
Length=354

 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 190/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGI FCQI HVGRVSN  FQPNGQAPISSTDK LTPQ 
Sbjct  86   PGIWTKEQVEAWKPIVDAVHAKGGIIFCQIWHVGRVSNYGFQPNGQAPISSTDKSLTPQI  145

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            QA      QF+PPRRLR DEIPQ++NDFR+AARNA++AGFDGVEIHG +G+LIDQFL D 
Sbjct  146  QANGVDVAQFSPPRRLRTDEIPQIVNDFRIAARNAMEAGFDGVEIHGFNGYLIDQFLNDQ  205

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALE+VE VA+EIG +RVGIRLSPF+D++E  DS+P AL ++M
Sbjct  206  VNDRTDEYGGSLVNRCRFALEIVEAVANEIGADRVGIRLSPFTDFIEAVDSDPKALALYM  265

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             E+LNKYG+LYCHMIEPR+K + + S+ P +L PMRKAFNG
Sbjct  266  VEALNKYGILYCHMIEPRLKMMGDVSECPHTLPPMRKAFNG  306



>ref|XP_011005431.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Populus 
euphratica]
Length=381

 Score =   353 bits (907),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 190/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQ+ HVGRVSN DFQPNGQAPIS TDKPL PQ 
Sbjct  87   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQLWHVGRVSNRDFQPNGQAPISCTDKPLAPQL  146

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A      +FT PRRLR DEIP V+ND+ +AARNA++AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  147  RANGIDAVEFTTPRRLRTDEIPHVVNDYIIAARNAMEAGFDGVEIHGAHGYLIDQFMKDQ  206

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRC+F+LEVV  V DEIG +RVGIRLSP+++Y + GDSNP ALG++M
Sbjct  207  VNDRTDQYGGSLENRCQFSLEVVGAVVDEIGVDRVGIRLSPYANYGQAGDSNPGALGLYM  266

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKYG+LYCHM+EPRMK + E+ + P SLLPMRKAFNG
Sbjct  267  VESLNKYGILYCHMVEPRMKTVGERVECPHSLLPMRKAFNG  307



>dbj|BAD06522.1| hypothetical protein [Pisum sativum]
Length=362

 Score =   353 bits (905),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTK+Q+EAWKPIVDAVHAKG IFFCQI HVGRVSN+ +QPNGQAPISSTDK +T  +
Sbjct  77   PGIWTKQQVEAWKPIVDAVHAKGSIFFCQIWHVGRVSNSIYQPNGQAPISSTDKSITSND  136

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
            Q QFT PRRLR DEIP ++N F+LAARNAI+AGFDGVEIHGAHG+L+DQF+KD VNDRTD
Sbjct  137  QQQFTAPRRLRTDEIPDIVNHFKLAARNAIEAGFDGVEIHGAHGYLLDQFMKDKVNDRTD  196

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            EYGG L NRCRF LEVVE V +EIG ERVGIRLSPF+++ E GDSNPNALG++M  +LNK
Sbjct  197  EYGGSLENRCRFTLEVVEAVVNEIGAERVGIRLSPFAEFAESGDSNPNALGLYMVNALNK  256

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y +LYCHM+EPR+ + ++  + P SL PMRKAFNG
Sbjct  257  YNILYCHMVEPRLIQTFDPVETPHSLEPMRKAFNG  291



>ref|XP_007037241.1| 12-oxophytodienoate reductase 1 [Theobroma cacao]
 gb|EOY21742.1| 12-oxophytodienoate reductase 1 [Theobroma cacao]
Length=382

 Score =   353 bits (905),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 187/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIW+KEQ+EAWKPIVDAVHAKGGIFFCQI HVGR S  ++QPNGQAP+SST K L PQ 
Sbjct  88   PGIWSKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRASTYEYQPNGQAPVSSTSKQLMPQV  147

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                   A+F+PPRRLR DEIP VINDFR+AARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  148  LANATEPAKFSPPRRLRTDEIPLVINDFRVAARNAIEAGFDGVEIHGAHGYLLDQFMKDH  207

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            +NDRTD YGG L NRCRFALE+VE VA+EIG +RVGIRLSPF+ YL+ GDSNP ALGV+M
Sbjct  208  INDRTDHYGGSLENRCRFALELVEAVANEIGADRVGIRLSPFATYLDSGDSNPTALGVYM  267

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG++YCHM+EPRMK   E  +  ++LLPMRKAF G
Sbjct  268  AESLNKYGIVYCHMVEPRMKTAEESLECAETLLPMRKAFKG  308



>ref|XP_004294511.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Fragaria vesca 
subsp. vesca]
Length=370

 Score =   352 bits (903),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 192/221 (87%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGG+FFCQI H GRVSN+  QPNGQAP+S TDKPLTPQ 
Sbjct  76   PGIWTKEQVEAWKPIVNAVHAKGGVFFCQIWHAGRVSNSVLQPNGQAPVSCTDKPLTPQV  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A++TPPRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGA+G+LIDQFLKD 
Sbjct  136  LSNGVDVAEYTPPRRLRTDEIPHIVNDFRLAARNAIEAGFDGVEIHGANGYLIDQFLKDQ  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+ E V +EIG ++VGIRLSPF+DY+E GDSNP ALG++M
Sbjct  196  VNDRTDQYGGSLENRCRFALEINEAVVNEIGADKVGIRLSPFADYMESGDSNPEALGLYM  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             +SLN+YG+LYCH+IEPRMK+  EKS+   SLLPMR+AF+G
Sbjct  256  VQSLNRYGILYCHVIEPRMKEPGEKSETACSLLPMREAFSG  296



>ref|XP_004138673.1| PREDICTED: LOW QUALITY PROTEIN: 12-oxophytodienoate reductase 
1-like [Cucumis sativus]
Length=368

 Score =   352 bits (902),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 187/221 (85%), Gaps = 14/221 (6%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVH KGG FFCQI HVGRVSN+ FQPNGQAPISS+DKPL PQ 
Sbjct  84   PGIWTKEQVEAWKPIVDAVHRKGGTFFCQIWHVGRVSNSGFQPNGQAPISSSDKPLFPQV  143

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRLR DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+LI+QF+KD 
Sbjct  144  RSNGIDVAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLIEQFMKDQ  203

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE V        V +RLSPF+D++E GDSNP ALGV+M
Sbjct  204  VNDRTDQYGGSLENRCRFALEVVEAV--------VXMRLSPFADFMEAGDSNPKALGVYM  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCHM+EPRM+ + EK   P SLLPMRKAFNG
Sbjct  256  AESLNKYGILYCHMVEPRMRNVLEKVQCPHSLLPMRKAFNG  296



>ref|XP_007156169.1| hypothetical protein PHAVU_003G264000g [Phaseolus vulgaris]
 gb|ESW28163.1| hypothetical protein PHAVU_003G264000g [Phaseolus vulgaris]
Length=379

 Score =   352 bits (903),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 189/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVS++ +QPNGQAP+SSTDKPL PQ 
Sbjct  80   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSSSAYQPNGQAPVSSTDKPLAPQL  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 +    TPPRRL +DEIP ++NDFR+AARNA++AGFDGVEIHGAHG+L++QF+KD 
Sbjct  140  RSNGIDVVHHTPPRRLSSDEIPGIVNDFRVAARNAMEAGFDGVEIHGAHGYLLEQFMKDK  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRF LEVVE V DEIGG+RVGIRLSPF++Y +CGDSNP  LG++M
Sbjct  200  VNDRTDEYGGSLENRCRFPLEVVEAVVDEIGGDRVGIRLSPFAEYSDCGDSNPKQLGLYM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              +LNKYG++YCHM+EPRM+   E+ + P SL+PMRKAFNG
Sbjct  260  VNALNKYGIVYCHMVEPRMRSAGERVECPHSLVPMRKAFNG  300



>ref|XP_008219071.1| PREDICTED: 12-oxophytodienoate reductase 2-like isoform X2 [Prunus 
mume]
Length=352

 Score =   351 bits (901),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 190/225 (84%), Gaps = 10/225 (4%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PG+WT EQ+EAWKPIV AVHAKGG+FFCQI H GRVSN+ FQP GQ PISSTDKPLT Q 
Sbjct  54   PGLWTTEQVEAWKPIVAAVHAKGGVFFCQIMHPGRVSNSGFQPRGQTPISSTDKPLTSQI  113

Query  179  ---------NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQF  331
                       A++TPPRRLR DEI Q++NDFRLAARNAI+AGFDGVEIHGA+G+LIDQF
Sbjct  114  LTNGFAVAVAVAEYTPPRRLRTDEITQIVNDFRLAARNAIEAGFDGVEIHGAYGYLIDQF  173

Query  332  LKDGVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNAL  511
            +KD VNDRTDEYGG L NRCRF LE+VE VA+EIG ++VGIRLSPF+DY+E GDSNP AL
Sbjct  174  MKDQVNDRTDEYGGSLENRCRFPLEIVEAVANEIGADKVGIRLSPFADYMESGDSNPKAL  233

Query  512  GVFMAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            G++MA+SLNKYG+LYCH++EPRMK + +KS+ P SLLPMR+AF G
Sbjct  234  GLYMAKSLNKYGILYCHVVEPRMKTVGDKSETPYSLLPMREAFKG  278



>ref|XP_008383862.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica]
Length=337

 Score =   350 bits (899),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 189/217 (87%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDK--PLTP  175
            PGIWT EQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAPISST+K  PL  
Sbjct  47   PGIWTMEQVEAWKPIVDAVHAKGGIFFCQILHVGRVSNTGFQPNGQAPISSTEKXVPLNG  106

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             + ++ TPP RLR DEIPQ++NDFRLAARNA++AGFDGVEIHGAHG+LIDQF KD VNDR
Sbjct  107  IDVSEXTPPXRLRTDEIPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFTKDQVNDR  166

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG   NRCRFALE VE VA+EIG ++VGIRLSPF++Y+  GDS+P ALG+++  SL
Sbjct  167  TDQYGGSXENRCRFALEXVEXVANEIGADKVGIRLSPFANYMGSGDSDPEALGLYLXNSL  226

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NKYG++YCHM+EPRMK + EKSD PQSL+PMRKAFNG
Sbjct  227  NKYGIVYCHMVEPRMKTIGEKSDCPQSLVPMRKAFNG  263



>ref|XP_008357589.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica]
 ref|XP_008365261.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica]
Length=372

 Score =   352 bits (902),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 190/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKP+VDAVH KGG+FFCQI H GRVSN+ FQPNGQAPIS TDKPLTPQ 
Sbjct  78   PGIWTREQVEAWKPVVDAVHTKGGVFFCQIWHAGRVSNSGFQPNGQAPISCTDKPLTPQL  137

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            Q+      +FTPPRRL  +EIPQ++NDFRLAAR AI+AGFDGVEIHGA+G++IDQFLKD 
Sbjct  138  QSNGIDVXEFTPPRRLETNEIPQIVNDFRLAARKAIEAGFDGVEIHGANGYIIDQFLKDQ  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD YGG L NRCRFALE+VE VA+EIG ++VG+RLSPF+DY+E GDS+PNALG++M
Sbjct  198  VNDRTDHYGGSLENRCRFALEIVEAVANEIGADKVGLRLSPFADYMESGDSDPNALGLYM  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IEPRMK   + S+   SL PMR+AF G
Sbjct  258  AESLNKYGILYCHVIEPRMKTQGDISESSDSLAPMREAFKG  298



>ref|XP_007157105.1| hypothetical protein PHAVU_002G043100g [Phaseolus vulgaris]
 gb|ESW29099.1| hypothetical protein PHAVU_002G043100g [Phaseolus vulgaris]
Length=358

 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 189/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT+EQ+EAWKPIVDAVHAKGGIFF QI H GRVSN+ +QPNGQAP+SSTDKPL+PQ 
Sbjct  61   PGIWTREQVEAWKPIVDAVHAKGGIFFSQIWHAGRVSNSAYQPNGQAPVSSTDKPLSPQI  120

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++   TPPRRL +DEI  ++NDFR+AARNA++AGFDGVEIHGAHG+L++QF+KD 
Sbjct  121  RSNGIDEVHHTPPRRLSSDEIAPIVNDFRVAARNAVEAGFDGVEIHGAHGYLLEQFMKDK  180

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDR DEYGG L NRCRF LEVVE V DEIGG+RVGIRLSPF++Y ECGDSNP  LG++M
Sbjct  181  VNDRRDEYGGSLENRCRFPLEVVEAVVDEIGGDRVGIRLSPFAEYAECGDSNPQELGLYM  240

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              +LNKYGVLYCHM+EPR+ ++ EK +G QSL+PMRKAFNG
Sbjct  241  VNALNKYGVLYCHMVEPRIGRVAEKVEGSQSLVPMRKAFNG  281



>dbj|BAD06518.1| hypothetical protein [Pisum sativum]
 dbj|BAD12184.1| 12-oxophytodienoic acid 10, 11-reductase [Pisum sativum]
 gb|AAX54688.1| 12-oxophytodienoic acid 10,10-reductase [Pisum sativum]
Length=362

 Score =   351 bits (900),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 184/215 (86%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTK+Q+EAWKPIVDAVHAKG IFFCQI HVGRVSN+ +QPNGQAPISSTDK +T  +
Sbjct  77   PGIWTKQQVEAWKPIVDAVHAKGAIFFCQIWHVGRVSNSSYQPNGQAPISSTDKAITSND  136

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
            Q QFT PRRLR DEIP ++NDF+LAARNAI+AGFDGVEIHGAHG+L+DQF+KD VNDRTD
Sbjct  137  QQQFTAPRRLRTDEIPNIVNDFKLAARNAIEAGFDGVEIHGAHGYLLDQFMKDKVNDRTD  196

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            EYGG L NRCRF LEVVE V +EIG ERVGIRLSPF+++ E GDSNPNALG++M  +LNK
Sbjct  197  EYGGSLENRCRFPLEVVEAVVNEIGAERVGIRLSPFAEFAESGDSNPNALGLYMVNALNK  256

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y +LYCHM+EPR+   ++  + P  L PMRKAFNG
Sbjct  257  YNILYCHMVEPRIIVTFDPVETPHCLEPMRKAFNG  291



>ref|XP_004511387.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like [Cicer 
arietinum]
Length=406

 Score =   352 bits (903),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 187/216 (87%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTP-Q  178
            PGIWT+EQ++AWKPIVDAVHAKG +FFCQI HVGRVS+  FQPNGQAPISSTDKPLT  +
Sbjct  120  PGIWTQEQVQAWKPIVDAVHAKGSVFFCQIWHVGRVSSPAFQPNGQAPISSTDKPLTSSK  179

Query  179  NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            +  + TPPRRLR DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD VNDRT
Sbjct  180  DSEKVTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDKVNDRT  239

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            DEYGG + NRCRFALEVVE V +EIG ERVGIRLSPF++Y E  DSNPNALG+++  +LN
Sbjct  240  DEYGGSIENRCRFALEVVEAVVNEIGAERVGIRLSPFAEYAESRDSNPNALGLYIVNALN  299

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            KY +LYCHM+EPR+K   E  + P SL+PMRKAFNG
Sbjct  300  KYNILYCHMVEPRIKSADEVIETPHSLVPMRKAFNG  335



>ref|XP_010683270.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=370

 Score =   350 bits (899),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 189/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGG+FFCQI HVGRVSN  FQP+GQAPIS TDKPLTPQ 
Sbjct  76   PGIWTKEQVEAWKPIVDAVHAKGGLFFCQIWHVGRVSNEGFQPDGQAPISCTDKPLTPQI  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQF+PPRRLR DEIP V+NDFRLAARNA++AGFDGVEIHGA+G+LI+QF+KD 
Sbjct  136  RANGIDTAQFSPPRRLRTDEIPLVVNDFRLAARNAMEAGFDGVEIHGANGYLIEQFMKDK  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALE+VE +  EIG +RVG R+SPF++Y+E  DSNP ALG++M
Sbjct  196  VNDRTDEYGGSLENRCRFALEIVEAIVKEIGADRVGFRISPFANYMESEDSNPKALGLYM  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESL+K+G+LYCH IEPRM K+ EK +   SLLPMRKAF G
Sbjct  256  AESLSKHGILYCHAIEPRMIKVGEKKECSDSLLPMRKAFTG  296



>ref|XP_008219069.1| PREDICTED: 12-oxophytodienoate reductase 2-like isoform X1 [Prunus 
mume]
 ref|XP_008219070.1| PREDICTED: 12-oxophytodienoate reductase 2-like isoform X1 [Prunus 
mume]
Length=394

 Score =   351 bits (901),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 190/225 (84%), Gaps = 10/225 (4%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PG+WT EQ+EAWKPIV AVHAKGG+FFCQI H GRVSN+ FQP GQ PISSTDKPLT Q 
Sbjct  96   PGLWTTEQVEAWKPIVAAVHAKGGVFFCQIMHPGRVSNSGFQPRGQTPISSTDKPLTSQI  155

Query  179  ---------NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQF  331
                       A++TPPRRLR DEI Q++NDFRLAARNAI+AGFDGVEIHGA+G+LIDQF
Sbjct  156  LTNGFAVAVAVAEYTPPRRLRTDEITQIVNDFRLAARNAIEAGFDGVEIHGAYGYLIDQF  215

Query  332  LKDGVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNAL  511
            +KD VNDRTDEYGG L NRCRF LE+VE VA+EIG ++VGIRLSPF+DY+E GDSNP AL
Sbjct  216  MKDQVNDRTDEYGGSLENRCRFPLEIVEAVANEIGADKVGIRLSPFADYMESGDSNPKAL  275

Query  512  GVFMAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            G++MA+SLNKYG+LYCH++EPRMK + +KS+ P SLLPMR+AF G
Sbjct  276  GLYMAKSLNKYGILYCHVVEPRMKTVGDKSETPYSLLPMREAFKG  320



>ref|XP_003610759.1| 12-oxophytodienoate reductase [Medicago truncatula]
 gb|AES93717.1| 12-oxophytodienoate reductase-like protein [Medicago truncatula]
Length=363

 Score =   350 bits (898),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 182/215 (85%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVH KGGIFFCQI HVGRVSN+ +QPNGQAPISSTDK LT  +
Sbjct  78   PGIWTKEQVEAWKPIVDAVHDKGGIFFCQIWHVGRVSNSVYQPNGQAPISSTDKSLTSND  137

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
              QFT PRRL  DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+L++QF+KD VNDRTD
Sbjct  138  VQQFTKPRRLSTDEIPHIVNDFRLAARNAIEAGFDGVEIHGAHGYLLEQFMKDKVNDRTD  197

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            EYGG L NRCRF LEVVE V +EIG ++VGIRLSPF++Y E GDSNPN LG+ M  +LNK
Sbjct  198  EYGGSLENRCRFPLEVVEAVVNEIGADKVGIRLSPFAEYAESGDSNPNELGLHMVNALNK  257

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y +LYCHM+EPR+K   E  + P SL+PMRKAFNG
Sbjct  258  YNILYCHMVEPRIKSASETIESPYSLVPMRKAFNG  292



>ref|XP_004294509.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   350 bits (898),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 189/221 (86%), Gaps = 11/221 (5%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGGIF CQI HVGRVSN+ +QPNGQAP+SSTDKPLTPQ 
Sbjct  76   PGIWTKEQVEAWKPIVNAVHAKGGIFICQIWHVGRVSNSGYQPNGQAPVSSTDKPLTPQI  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQFTPPRRLR DEIPQ++NDFRLAARNA++AGFDGVEIHGAHG+LI+QFLKD 
Sbjct  136  RGNGIDVAQFTPPRRLRTDEIPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIEQFLKDE  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFAL++VE V +EIG ++VGIR SPFSDY+E GDS P  LG+++
Sbjct  196  VNDRTDQYGGSLENRCRFALDIVEAVVNEIGADKVGIRFSPFSDYMESGDSKPKELGLYL  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+LYCHM EPR     EK + P SL+PMRKAFNG
Sbjct  256  ANALNKYGILYCHMFEPR-----EKIECPHSLVPMRKAFNG  291



>ref|XP_008339182.1| PREDICTED: 12-oxophytodienoate reductase 2-like isoform X3 [Malus 
domestica]
Length=350

 Score =   350 bits (897),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 190/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQIE+WKPIVDAVHAKGGIFFCQI H GR+SNT FQPNGQAPISSTDK L PQ 
Sbjct  56   PGIWTKEQIESWKPIVDAVHAKGGIFFCQIWHGGRISNTGFQPNGQAPISSTDKVLAPQI  115

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F+PPRRLR DE+PQ++NDFRLAARNA++AGFDGVEIHGAHG+LI+QFLKD 
Sbjct  116  RTNGIDVAVFSPPRRLRTDEVPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIEQFLKDQ  175

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG + NRCRFALEVVE    EIG ++VGIRLSPF++Y    DS+P ALG+++
Sbjct  176  VNDRTDQYGGSMENRCRFALEVVEAXXXEIGXDKVGIRLSPFANYNGSVDSDPEALGLYL  235

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+LYCHM+EPRMK + EKSD PQ+L+PMRKAFNG
Sbjct  236  ANALNKYGILYCHMVEPRMKTVGEKSDCPQTLVPMRKAFNG  276



>dbj|BAD06519.1| hypothetical protein [Pisum sativum]
 dbj|BAD12186.1| 12-oxophytodienoic acid 10,11-reductase [Pisum sativum]
Length=368

 Score =   350 bits (898),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PG+WTK+Q+EAWKPIVDAVHAKG +FFCQI H GRVSN+ +QPNGQAPISSTDK LT   
Sbjct  83   PGVWTKDQVEAWKPIVDAVHAKGSVFFCQIWHAGRVSNSIYQPNGQAPISSTDKSLTSNE  142

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
            + QFT PRRLR DEIP ++NDF++AARNAI+AGFDGVEIHGAHG+L+DQF+KD VNDRTD
Sbjct  143  EQQFTAPRRLRTDEIPDIVNDFKIAARNAIEAGFDGVEIHGAHGYLVDQFMKDKVNDRTD  202

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            EYGG L NRCRFAL+VVE VA+EIG +++GIRLSPF++Y E GDSNPNALG++M  +LNK
Sbjct  203  EYGGSLENRCRFALQVVEAVANEIGADKLGIRLSPFAEYAESGDSNPNALGLYMVNALNK  262

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y +LYCHM+EPR+   ++  + P SL PMRKAFNG
Sbjct  263  YNILYCHMVEPRLIHTFDPVETPHSLEPMRKAFNG  297



>ref|XP_008383861.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Malus domestica]
Length=428

 Score =   352 bits (903),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 190/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI H+GRVSNT  QPNGQAPISSTDK LT + 
Sbjct  134  PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHIGRVSNTGSQPNGQAPISSTDKSLTSET  193

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
             +      +F+PPRRLR DE+PQ++NDFRLAARNA++AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  194  PSTGVYVIEFSPPRRLRTDEVPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFLKDQ  253

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG + NRCRFALE+V+ VA+EIG ++VGIRLSPF+D+++ GDSNP  LG+ M
Sbjct  254  VNDRTDQYGGSVENRCRFALEIVDAVANEIGADKVGIRLSPFADFMDSGDSNPKZLGLCM  313

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A SLNKYG+LYCHM+EPRMK   EKSD PQ L P RKAFNG
Sbjct  314  ANSLNKYGILYCHMVEPRMKIGAEKSDYPQGLAPXRKAFNG  354



>ref|XP_008339180.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform 
X1 [Malus domestica]
Length=376

 Score =   350 bits (898),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 190/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQIE+WKPIVDAVHAKGGIFFCQI H GR+SNT FQPNGQAPISSTDK L PQ 
Sbjct  82   PGIWTKEQIESWKPIVDAVHAKGGIFFCQIWHGGRISNTGFQPNGQAPISSTDKVLAPQI  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F+PPRRLR DE+PQ++NDFRLAARNA++AGFDGVEIHGAHG+LI+QFLKD 
Sbjct  142  RTNGIDVAVFSPPRRLRTDEVPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIEQFLKDQ  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG + NRCRFALEVVE    EIG ++VGIRLSPF++Y    DS+P ALG+++
Sbjct  202  VNDRTDQYGGSMENRCRFALEVVEAXXXEIGXDKVGIRLSPFANYNGSVDSDPEALGLYL  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+LYCHM+EPRMK + EKSD PQ+L+PMRKAFNG
Sbjct  262  ANALNKYGILYCHMVEPRMKTVGEKSDCPQTLVPMRKAFNG  302



>ref|XP_008339181.1| PREDICTED: 12-oxophytodienoate reductase 2-like isoform X2 [Malus 
domestica]
Length=361

 Score =   349 bits (895),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 190/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQIE+WKPIVDAVHAKGGIFFCQI H GR+SNT FQPNGQAPISSTDK L PQ 
Sbjct  67   PGIWTKEQIESWKPIVDAVHAKGGIFFCQIWHGGRISNTGFQPNGQAPISSTDKVLAPQI  126

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F+PPRRLR DE+PQ++NDFRLAARNA++AGFDGVEIHGAHG+LI+QFLKD 
Sbjct  127  RTNGIDVAVFSPPRRLRTDEVPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLIEQFLKDQ  186

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG + NRCRFALEVVE    EIG ++VGIRLSPF++Y    DS+P ALG+++
Sbjct  187  VNDRTDQYGGSMENRCRFALEVVEAXXXEIGXDKVGIRLSPFANYNGSVDSDPEALGLYL  246

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+LYCHM+EPRMK + EKSD PQ+L+PMRKAFNG
Sbjct  247  ANALNKYGILYCHMVEPRMKTVGEKSDCPQTLVPMRKAFNG  287



>ref|XP_002887653.1| 12-oxophytodienoate reductase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63912.1| 12-oxophytodienoate reductase 1 [Arabidopsis lyrata subsp. lyrata]
Length=372

 Score =   349 bits (896),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 190/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGGIFFCQI HVGRVSN  FQPNGQAPIS +DKPL PQ 
Sbjct  78   PGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNRGFQPNGQAPISCSDKPLMPQI  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  138  RSNGIDEAMFTPPRRLSIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+FAL++V+ VA EIG +RVGIRLSPF+DY+E GD+NP ALG++M
Sbjct  198  VNDRTDEYGGSLQNRCKFALDIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYM  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IE RMK + E S  P +L+PMRKAF G
Sbjct  258  AESLNKYGILYCHVIEARMKTMGEISACPHTLMPMRKAFKG  298



>ref|XP_008455176.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform 
X1 [Cucumis melo]
Length=360

 Score =   348 bits (893),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 184/215 (86%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVH +GG FFCQI H GRVSN+DFQPNGQAPISS+DKPL  Q 
Sbjct  77   PGIWTKEQVEAWKPIVDAVHCQGGTFFCQIWHAGRVSNSDFQPNGQAPISSSDKPLASQV  136

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
            QA   PPRRL  DEIPQV++ FRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD VNDRTD
Sbjct  137  QA---PPRRLMTDEIPQVVHHFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQVNDRTD  193

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG + NRCRFALEVVE   +EIGG++VGI+LSPFS+ +E GDSNP ALG++MAE+LNK
Sbjct  194  QYGGSIENRCRFALEVVEAAVNEIGGDKVGIKLSPFSNDMEVGDSNPKALGLYMAENLNK  253

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y +LYCHM+EPRM    EK + P SLLPMRKAF G
Sbjct  254  YEILYCHMVEPRMVTALEKVESPHSLLPMRKAFKG  288



>ref|XP_008455177.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform 
X2 [Cucumis melo]
Length=360

 Score =   348 bits (893),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 184/215 (86%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVH +GG FFCQI H GRVSN+DFQPNGQAPISS+DKPL  Q 
Sbjct  77   PGIWTKEQVEAWKPIVDAVHCQGGTFFCQIWHAGRVSNSDFQPNGQAPISSSDKPLASQV  136

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
            QA   PPRRL  DEIPQV++ FRLAARNAI+AGFDGVEIHGAHG+LIDQFLKD VNDRTD
Sbjct  137  QA---PPRRLMTDEIPQVVHHFRLAARNAIEAGFDGVEIHGAHGYLIDQFLKDQVNDRTD  193

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG + NRCRFALEVVE   +EIGG++VGI+LSPFS+ +E GDSNP ALG++MAE+LNK
Sbjct  194  QYGGSIENRCRFALEVVEAAVNEIGGDKVGIKLSPFSNDMEVGDSNPKALGLYMAENLNK  253

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y +LYCHM+EPRM    EK + P SLLPMRKAF G
Sbjct  254  YEILYCHMVEPRMVTALEKVESPHSLLPMRKAFKG  288



>ref|XP_009362378.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Pyrus x 
bretschneideri]
Length=376

 Score =   348 bits (893),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 187/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT  QPNGQAPIS TDK LT + 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTGSQPNGQAPISCTDKSLTSET  141

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
             +      +F+PPRRLR DE+PQ++NDFRLAARNA++AGFDGVEIHGAHG+L+DQFLKD 
Sbjct  142  PSNGVYAIEFSPPRRLRTDEVPQIVNDFRLAARNAMEAGFDGVEIHGAHGYLVDQFLKDH  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG + NRCRFALE+VE V +EIG ++VGIRLSPF+D+++ GDSNP  LG+ M
Sbjct  202  VNDRTDQYGGSVENRCRFALEIVEAVVNEIGADKVGIRLSPFADFMDSGDSNPKELGLCM  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A SLNKYG+LYCHM+EPR+    EK D   SL+PMRKAFNG
Sbjct  262  ANSLNKYGILYCHMVEPRITIAAEKRDHSHSLVPMRKAFNG  302



>gb|AAB62248.1| old-yellow-enzyme homolog [Catharanthus roseus]
Length=379

 Score =   348 bits (893),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 186/221 (84%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGG+FFCQIGHVGRVSN  +QPNGQAPISSTDK LTP  
Sbjct  86   PGIWTKEQVEAWKPIVDAVHAKGGVFFCQIGHVGRVSNYSYQPNGQAPISSTDKGLTPLY  145

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A      + TPPRRL  DE+P ++NDFR AA NAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  146  RANGIGYVEHTPPRRLTTDELPGIVNDFR-AALNAIEAGFDGVEIHGAHGYLIDQFLKDQ  204

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VND TDEYGG L NRCRFALE+VE V++ IG +RVGIRLSPF+ Y+E GDSNP ALG++M
Sbjct  205  VNDSTDEYGGSLENRCRFALEIVEAVSNAIGADRVGIRLSPFAGYMESGDSNPEALGLYM  264

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNKYG+LYCHM+ PRMK L E  + P SLLPMRKAF G
Sbjct  265  AEALNKYGILYCHMVNPRMKTLGENCEVPHSLLPMRKAFRG  305



>ref|XP_010547968.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Tarenaya hassleriana]
Length=378

 Score =   348 bits (892),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 188/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+E WKPIV+AVHAKGG+FFCQI H GRVS+  FQPNGQAPISSTDKPLTPQ 
Sbjct  83   PGIWTKEQVEGWKPIVEAVHAKGGVFFCQIWHTGRVSSRGFQPNGQAPISSTDKPLTPQL  142

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            ++      +F+PPRRLR DEIP V+N+FRLAARNA++AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  143  RSNGIDVDEFSPPRRLRTDEIPSVVNEFRLAARNAMEAGFDGVEIHGAHGYLIDQFLKDQ  202

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRCRFA+EVVE VA+EIG  RVGIRLSPFS+Y E  DSNP  LG+ M
Sbjct  203  VNDRTDEYGGSLQNRCRFAVEVVEAVANEIGPGRVGIRLSPFSNYKEAADSNPEVLGIHM  262

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLN+Y +LYCHM+EPRMK + + S   ++L+PMRKAF G
Sbjct  263  AESLNRYNILYCHMVEPRMKTVGDISTCVETLIPMRKAFQG  303



>ref|XP_009390777.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Musa acuminata 
subsp. malaccensis]
Length=415

 Score =   349 bits (895),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 186/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIV+AVH KGGIFFCQI HVGRVSN DFQPNGQAPISST KP+TPQ 
Sbjct  121  PGIWTKEQVEAWKPIVNAVHEKGGIFFCQIWHVGRVSNHDFQPNGQAPISSTAKPITPQV  180

Query  182  QAQ------FTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A       F+ PRRLR +EIP V+NDFR+AARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  181  RANGIDVAIFSTPRRLRTEEIPLVVNDFRVAARNAIEAGFDGVEIHGAHGYLIDQFLKDK  240

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD YGG L NRCRFALE+VE V DEIG +RVGIRLSP++ Y++ GDSNP ALG++M
Sbjct  241  VNDRTDRYGGSLENRCRFALEIVEAVVDEIGADRVGIRLSPYASYMQSGDSNPEALGLYM  300

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+ Y HM+EPRM  + EK + P SLLPMRKAF G
Sbjct  301  ANALNKYGISYLHMVEPRMINVGEKVEVPHSLLPMRKAFKG  341



>dbj|BAB40340.1| 12-oxophytodienoic acid 10, 11-reductase [Pisum sativum]
 dbj|BAD12185.1| 12-oxophytodienoic acid 10,11-reductase [Pisum sativum]
Length=371

 Score =   347 bits (891),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIV+AVHAK  +FF QI HVGRVSN+ +QPNGQAPISSTDK +T  +
Sbjct  77   PGIWTKEQVEAWKPIVEAVHAKDSVFFLQIWHVGRVSNSIYQPNGQAPISSTDKAITSND  136

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
            Q QFT PRRLR +EIP ++NDF+LAARNAI+AGFDGVEIHGAHG+L+DQF+KD VNDRTD
Sbjct  137  QQQFTAPRRLRTNEIPNIVNDFKLAARNAIEAGFDGVEIHGAHGYLLDQFMKDKVNDRTD  196

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            EYGG L NRCRF  EVVE VA+EIG ++VGIRLSPF++Y E GDSNPNALG++MA +LNK
Sbjct  197  EYGGSLENRCRFTFEVVEAVANEIGADKVGIRLSPFAEYAESGDSNPNALGLYMANALNK  256

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y +LYCHM+EPR+ + ++  + P SL PMRKAFNG
Sbjct  257  YNILYCHMVEPRLIQTFDPVETPHSLEPMRKAFNG  291



>emb|CDP10748.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   347 bits (890),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 188/217 (87%), Gaps = 4/217 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGI FCQI HVGRVS +  QP+GQAPISSTDKPLTP+ 
Sbjct  87   PGIWTKEQVEAWKPIVDAVHAKGGIIFCQIAHVGRVSGS--QPDGQAPISSTDKPLTPEG  144

Query  179  -NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             +  +++PPRRL+ +EIP ++NDFRLAA NAI+AGFDGVEIHGAHGFLIDQFLKD +NDR
Sbjct  145  FDAPKYSPPRRLKTEEIPGIVNDFRLAAINAIEAGFDGVEIHGAHGFLIDQFLKDQINDR  204

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TDEYGG L NRCRFALE+VE V+D IG  RVG+RLSPF++Y E GDSNP ALG+++AE+L
Sbjct  205  TDEYGGSLENRCRFALEIVEAVSDAIGSHRVGLRLSPFANYYEAGDSNPKALGLYIAEAL  264

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NK  +LYCHM+EPRMK L EKS+   SL+PMRKAFNG
Sbjct  265  NKPKILYCHMVEPRMKTLGEKSESADSLMPMRKAFNG  301



>gb|KHN04141.1| 12-oxophytodienoate reductase 2 [Glycine soja]
Length=365

 Score =   347 bits (889),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 188/218 (86%), Gaps = 4/218 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIV+AVHAKGG+FFCQI HVGRVS+  FQPNGQAPISSTDKPL  QN
Sbjct  78   PGIWTKEQVEAWKPIVNAVHAKGGVFFCQIWHVGRVSSPVFQPNGQAPISSTDKPLK-QN  136

Query  182  ---QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVND  352
               +AQ TPPRRLR DEIP ++NDFR+AARNAI+AGFDGVEIHGAHG+L++QF+KD VND
Sbjct  137  GIEEAQVTPPRRLRTDEIPHIVNDFRVAARNAIKAGFDGVEIHGAHGYLLEQFIKDKVND  196

Query  353  RTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAES  532
            R+D YGG L NRCRFALEVVE V  EIG ERVG+RLSPF+++ ECGDS+P ALG+++A +
Sbjct  197  RSDGYGGSLENRCRFALEVVEAVVKEIGAERVGVRLSPFTEHAECGDSDPKALGLYLANA  256

Query  533  LNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            L+KY +LYCHM+EPRMK   E  + P SL+PMRKAFNG
Sbjct  257  LSKYNILYCHMVEPRMKNALEVVECPHSLMPMRKAFNG  294



>emb|CAN66144.1| hypothetical protein VITISV_031221 [Vitis vinifera]
Length=367

 Score =   346 bits (888),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 182/215 (85%), Gaps = 6/215 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAPIS TDKPLTPQ 
Sbjct  85   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTGFQPNGQAPISCTDKPLTPQI  144

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
             A           EIPQV+ DFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD VNDRTD
Sbjct  145  GANGI------EYEIPQVVKDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDQVNDRTD  198

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG L NRCRF LEVVE V DEIG ++VGIRLSPF+ Y E GDSNP ALG++MAESLNK
Sbjct  199  KYGGSLENRCRFPLEVVEAVVDEIGADKVGIRLSPFATYAEAGDSNPRALGLYMAESLNK  258

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            YG+LYCHM+EPRMK L EKS+   SLLPMRKAFNG
Sbjct  259  YGLLYCHMVEPRMKTLGEKSECAHSLLPMRKAFNG  293



>ref|XP_011095972.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform 
X2 [Sesamum indicum]
Length=341

 Score =   345 bits (885),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 185/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG IFFCQI HVGRVS+T FQPNGQAP+S TDK L PQ 
Sbjct  47   PGIWTKEQVEAWKPIVDAVHAKGAIFFCQIWHVGRVSSTVFQPNGQAPVSCTDKGLAPQV  106

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 +  QF+PPRRL  DEIPQ++NDFRLAARNAI+AGFDGVEIHG+ G+LIDQF KD 
Sbjct  107  RNNGVDVVQFSPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGVEIHGSCGYLIDQFFKDQ  166

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+ E V +E+G  RVG+RLSPF++  EC DSNP ALG++M
Sbjct  167  VNDRTDQYGGSLENRCRFALEIAEAVTNEVGAYRVGMRLSPFANSNECADSNPKALGLYM  226

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNKYG+LYCHM+EPRM+ + E S+ P SLLPMRKAF G
Sbjct  227  AEALNKYGLLYCHMVEPRMRTVLEISECPHSLLPMRKAFKG  267



>emb|CBI39235.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   344 bits (883),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 178/205 (87%), Gaps = 6/205 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAPIS TDKPLTPQ 
Sbjct  85   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTGFQPNGQAPISCTDKPLTPQI  144

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
             A      QF+PPRRL  DEIPQV+ DFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  145  GANGIDVDQFSPPRRLTTDEIPQVVKDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDQ  204

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRF LEVVE V DEIG ++VGIRLSPF+ Y E GDSNP ALG++M
Sbjct  205  VNDRTDKYGGSLENRCRFPLEVVEAVVDEIGADKVGIRLSPFATYAEAGDSNPRALGLYM  264

Query  524  AESLNKYGVLYCHMIEPRMKKLWEK  598
            AESLNKYG+LYCHM+EPRMK L EK
Sbjct  265  AESLNKYGLLYCHMVEPRMKTLGEK  289



>ref|XP_003634577.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Vitis vinifera]
Length=372

 Score =   346 bits (888),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 187/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG IF CQ+ HVGRVSNT+FQPNGQAP+SSTDK LTPQ 
Sbjct  77   PGIWTKEQVEAWKPIVDAVHAKGSIFICQLWHVGRVSNTEFQPNGQAPLSSTDKALTPQV  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FT PRRL  DE+P+V+NDFRLAARNA++AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  137  RSNGFDVAEFTAPRRLTTDEVPRVVNDFRLAARNAMEAGFDGVEIHGAHGYLLDQFMKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRF LEVVE V +EIG ++VGIRLSPF  + E GDSNP ALG++M
Sbjct  197  VNDRTDKYGGSLENRCRFPLEVVEAVVNEIGADKVGIRLSPFGHHAEAGDSNPTALGLYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKYGVLYCHM+EPR++   E  + P SL+P+RKAFNG
Sbjct  257  VESLNKYGVLYCHMVEPRIRAAGEMCECPHSLVPLRKAFNG  297



>ref|XP_002278356.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Vitis vinifera]
Length=372

 Score =   346 bits (887),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 187/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG IF CQ+ HVGRVSNT+FQPNGQAP+SSTDK LTPQ 
Sbjct  77   PGIWTKEQVEAWKPIVDAVHAKGSIFICQLWHVGRVSNTEFQPNGQAPLSSTDKALTPQV  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FT PRRL  DE+P+V+NDFRLAARNA++AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  137  RSNGFDVAEFTAPRRLTTDEVPRVVNDFRLAARNAMEAGFDGVEIHGAHGYLLDQFMKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRF LEVVE V +EIG ++VGIRLSPF  + E GDSNP ALG++M
Sbjct  197  VNDRTDKYGGSLENRCRFPLEVVEAVVNEIGADKVGIRLSPFGHHAEAGDSNPTALGLYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKYGVLYCHM+EPR++   E  + P SL+P+RKAFNG
Sbjct  257  VESLNKYGVLYCHMVEPRIRAAGEMCECPHSLVPLRKAFNG  297



>ref|XP_010930419.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform 
X3 [Elaeis guineensis]
Length=316

 Score =   343 bits (881),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 189/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAW+PIVDAVH KGGIFFCQI H GRVSN DFQP+GQAPIS TDKPL PQ 
Sbjct  25   PGIWTKEQVEAWRPIVDAVHEKGGIFFCQIWHAGRVSNYDFQPDGQAPISCTDKPLAPQV  84

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+F+PPRRL A+EIP +++DFR AA+NAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  85   RANGVDVARFSPPRRLAAEEIPLIVDDFRTAAKNAIEAGFDGVEIHGAHGYLIDQFLKDQ  144

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+V+ V DEIG +RVGIRLSP+++Y+E GDS+P+ALG++M
Sbjct  145  VNDRTDQYGGSLENRCRFALEIVQAVVDEIGPDRVGIRLSPYANYMEAGDSDPDALGLYM  204

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              SLN++G+ YCHM+EPRM K+ EK + P SLLPMRKAF G
Sbjct  205  VNSLNRFGISYCHMVEPRMGKVGEKVETPHSLLPMRKAFKG  245



>ref|XP_011005430.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Populus euphratica]
Length=358

 Score =   345 bits (885),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN+ FQP+GQAP+SSTDKP++ Q 
Sbjct  69   PGIWTREQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPDGQAPVSSTDKPISSQL  128

Query  182  QA-QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            +  +FTPPRRLR DEIPQ++NDFR+AARNAI+AGFDGVEIHGAHG+LIDQF+KD VN+RT
Sbjct  129  EGMEFTPPRRLRTDEIPQIVNDFRIAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNNRT  188

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D+YGG L NRCRF LE+VE +A+EIG ++VGIRLSP  +Y+E GDS+P ALG++M +SLN
Sbjct  189  DQYGGSLENRCRFTLEIVEAIANEIGSDKVGIRLSPHVNYMESGDSDPEALGLYMVKSLN  248

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFN  643
            KYG+ YCHM+EPRMK     +   +SLLPMRKAFN
Sbjct  249  KYGIAYCHMVEPRMKIGAGNTKFSESLLPMRKAFN  283



>ref|XP_010930417.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform 
X1 [Elaeis guineensis]
Length=363

 Score =   345 bits (885),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 189/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAW+PIVDAVH KGGIFFCQI H GRVSN DFQP+GQAPIS TDKPL PQ 
Sbjct  72   PGIWTKEQVEAWRPIVDAVHEKGGIFFCQIWHAGRVSNYDFQPDGQAPISCTDKPLAPQV  131

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+F+PPRRL A+EIP +++DFR AA+NAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  132  RANGVDVARFSPPRRLAAEEIPLIVDDFRTAAKNAIEAGFDGVEIHGAHGYLIDQFLKDQ  191

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+V+ V DEIG +RVGIRLSP+++Y+E GDS+P+ALG++M
Sbjct  192  VNDRTDQYGGSLENRCRFALEIVQAVVDEIGPDRVGIRLSPYANYMEAGDSDPDALGLYM  251

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              SLN++G+ YCHM+EPRM K+ EK + P SLLPMRKAF G
Sbjct  252  VNSLNRFGISYCHMVEPRMGKVGEKVETPHSLLPMRKAFKG  292



>ref|XP_010471825.1| PREDICTED: 12-oxophytodienoate reductase 1 [Camelina sativa]
Length=375

 Score =   345 bits (886),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 187/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGG+FFCQI HVGRVSN  FQPNGQAPIS +DKPL PQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNRGFQPNGQAPISCSDKPLMPQI  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  140  RSNGIDEAMFTPPRRLDIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L  RCRFALE+V+ V+ EIG +RVGIRLSPF+DY+E GD+NP ALG++M
Sbjct  200  VNDRTDEYGGSLEKRCRFALEIVDAVSKEIGPDRVGIRLSPFADYMESGDTNPGALGLYM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IE RMK + E    P +L+PMRKAF G
Sbjct  260  AESLNKYGILYCHVIEARMKTMGEVHACPHTLMPMRKAFKG  300



>ref|XP_011095964.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform 
X1 [Sesamum indicum]
Length=377

 Score =   345 bits (885),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 185/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG IFFCQI HVGRVS+T FQPNGQAP+S TDK L PQ 
Sbjct  83   PGIWTKEQVEAWKPIVDAVHAKGAIFFCQIWHVGRVSSTVFQPNGQAPVSCTDKGLAPQV  142

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 +  QF+PPRRL  DEIPQ++NDFRLAARNAI+AGFDGVEIHG+ G+LIDQF KD 
Sbjct  143  RNNGVDVVQFSPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGVEIHGSCGYLIDQFFKDQ  202

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+ E V +E+G  RVG+RLSPF++  EC DSNP ALG++M
Sbjct  203  VNDRTDQYGGSLENRCRFALEIAEAVTNEVGAYRVGMRLSPFANSNECADSNPKALGLYM  262

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNKYG+LYCHM+EPRM+ + E S+ P SLLPMRKAF G
Sbjct  263  AEALNKYGLLYCHMVEPRMRTVLEISECPHSLLPMRKAFKG  303



>ref|XP_003610764.1| 12-oxophytodienoate reductase [Medicago truncatula]
 gb|ACJ84418.1| unknown [Medicago truncatula]
 gb|AES93722.1| 12-oxophytodienoate reductase-like protein [Medicago truncatula]
 gb|AFK43590.1| unknown [Medicago truncatula]
Length=371

 Score =   345 bits (884),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 186/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKG  FFCQI HVGRVS+T FQPNGQAPIS TDKPLTPQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGATFFCQIWHVGRVSDTVFQPNGQAPISPTDKPLTPQL  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FTPPRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGA+G++++QF+KD 
Sbjct  140  RSNGIDVAEFTPPRRLRIDEIPNLVNDFRLAARNAIEAGFDGVEIHGANGYILEQFMKDQ  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCR  LEVVE VA+EIG +R GIRLSPFS+Y EC DSNP  LG++M
Sbjct  200  VNDRTDEYGGSLENRCRIVLEVVEAVANEIGADRTGIRLSPFSEYAECVDSNPRELGLYM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+LYCH++EPRMK + E+ +   SL+PMRKAF G
Sbjct  260  ANALNKYGILYCHVVEPRMKTVNERIECSHSLVPMRKAFKG  300



>pdb|1ICP|A Chain A, Crystal Structure Of 12-Oxophytodienoate Reductase 1 
From Tomato Complexed With Peg400
 pdb|1ICP|B Chain B, Crystal Structure Of 12-Oxophytodienoate Reductase 1 
From Tomato Complexed With Peg400
 pdb|1ICQ|A Chain A, Crystal Structure Of 12-Oxophytodienoate Reductase 1 
From Tomato Complexed With 9r,13r-Opda
 pdb|1ICQ|B Chain B, Crystal Structure Of 12-Oxophytodienoate Reductase 1 
From Tomato Complexed With 9r,13r-Opda
 pdb|1ICS|A Chain A, Crystal Structure Of 12-Oxophytodienoate Reductase 1 
From Tomato
 pdb|1ICS|B Chain B, Crystal Structure Of 12-Oxophytodienoate Reductase 1 
From Tomato
 pdb|3HGR|A Chain A, Crystal Structure Of Tomato Opr1 In Complex With Phb
 pdb|3HGR|B Chain B, Crystal Structure Of Tomato Opr1 In Complex With Phb
Length=376

 Score =   345 bits (885),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 187/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN DFQPNG+ PIS TD+ LTPQ 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNKDFQPNGEDPISCTDRGLTPQI  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A FT PRRL  DEIPQ++N+FR+AARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  142  MSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQ  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDR+D+YGG L NRCRFALE+VE VA+EIG +RVGIR+SPF+ Y E GD+NP ALG++M
Sbjct  202  VNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNPTALGLYM  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKY + YCH++EPRMK  WEK +  +SL+PMRKA+ G
Sbjct  262  VESLNKYDLAYCHVVEPRMKTAWEKIECTESLVPMRKAYKG  302



>ref|NP_001234781.1| 12-oxophytodienoate reductase 1 [Solanum lycopersicum]
 sp|Q9XG54.1|OPR1_SOLLC RecName: Full=12-oxophytodienoate reductase 1; AltName: Full=12-oxophytodienoate-10,11-reductase 
1; Short=OPDA-reductase 
1; AltName: Full=LeOPR1 [Solanum lycopersicum]
 emb|CAB43506.1| 12-oxophytodienoate reductase [Solanum lycopersicum]
Length=376

 Score =   345 bits (884),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 187/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN DFQPNG+ PIS TD+ LTPQ 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNKDFQPNGEDPISCTDRGLTPQI  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A FT PRRL  DEIPQ++N+FR+AARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  142  RSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQ  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDR+D+YGG L NRCRFALE+VE VA+EIG +RVGIR+SPF+ Y E GD+NP ALG++M
Sbjct  202  VNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNPTALGLYM  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKY + YCH++EPRMK  WEK +  +SL+PMRKA+ G
Sbjct  262  VESLNKYDLAYCHVVEPRMKTAWEKIECTESLVPMRKAYKG  302



>emb|CAA71627.1| 12-oxophytodienoate reductase [Arabidopsis thaliana]
Length=370

 Score =   345 bits (884),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 189/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGGIFFCQI HVGRVSN+ FQPNG+APIS +DKPL PQ 
Sbjct  76   PGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQI  135

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  136  RSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  195

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+F LE+V+ VA EIG +RVGIRLSPF+DY+E GD+NP ALG++M
Sbjct  196  VNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYM  255

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IE RMK + E    P +L+PMRKAF G
Sbjct  256  AESLNKYGILYCHVIEARMKTMGEVHACPHTLMPMRKAFKG  296



>ref|NP_177794.1| 12-oxophytodienoate reductase 1 [Arabidopsis thaliana]
 sp|Q8LAH7.2|OPR1_ARATH RecName: Full=12-oxophytodienoate reductase 1; AltName: Full=12-oxophytodienoate-10,11-reductase 
1; Short=AtOPR1; Short=OPDA-reductase 
1; AltName: Full=FS-AT-I [Arabidopsis thaliana]
 pdb|1VJI|A Chain A, Gene Product Of At1g76680 From Arabidopsis Thaliana
 pdb|2Q3R|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of At1g76680 From Arabidopsis Thaliana
 gb|AAF04448.1|AC010718_17 12-oxophytodienoate reductase (OPR1); 13754-15043 [Arabidopsis 
thaliana]
 gb|AAC78440.1| 12-oxophytodienoate reductase OPR1 [Arabidopsis thaliana]
 gb|AAL75894.1| At1g76680/F28O16_5 [Arabidopsis thaliana]
 gb|AAV85720.1| At1g76680 [Arabidopsis thaliana]
 gb|AEE35875.1| 12-oxophytodienoate reductase 1 [Arabidopsis thaliana]
Length=372

 Score =   344 bits (883),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 189/221 (86%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGGIFFCQI HVGRVSN+ FQPNG+APIS +DKPL PQ 
Sbjct  78   PGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQI  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  138  RSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+F LE+V+ VA EIG +RVGIRLSPF+DY+E GD+NP ALG++M
Sbjct  198  VNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYM  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IE RMK + E    P +L+PMRKAF G
Sbjct  258  AESLNKYGILYCHVIEARMKTMGEVHACPHTLMPMRKAFKG  298



>emb|CDY16975.1| BnaC09g41020D [Brassica napus]
Length=373

 Score =   344 bits (883),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 188/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGGI FCQI HVGRVSN  FQPNGQAPIS TDKPL PQ 
Sbjct  78   PGIWTKEHVEAWKPIVDAVHAKGGIIFCQIWHVGRVSNKGFQPNGQAPISCTDKPLMPQI  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP +++ FRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  138  RSNGIDEAMFTPPRRLSTEEIPTIVSHFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VN+RTDEYGG L+NRC+FAL++VE VA+EIG +RVGIRLSPF+DY+E GD+NP AL V M
Sbjct  198  VNNRTDEYGGSLQNRCKFALDIVEAVANEIGPDRVGIRLSPFADYMESGDTNPQALAVHM  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IE RMK + E ++ P +L PMRKAF+G
Sbjct  258  AESLNKYGILYCHVIEARMKTMGEVTECPHTLTPMRKAFSG  298



>ref|XP_010930420.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform 
X4 [Elaeis guineensis]
Length=315

 Score =   342 bits (878),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 187/220 (85%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAW+PIVDAVH KGGIFFCQI H GRVSN DFQPNGQAPIS TDKPL PQ 
Sbjct  25   PGIWTKEQVEAWRPIVDAVHEKGGIFFCQIWHAGRVSNYDFQPNGQAPISCTDKPLAPQV  84

Query  179  ----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
                + A+F  PR+L  +EIP ++NDFR+AA+NAI+AGFDGVEIHGAHG+L+DQFLKD V
Sbjct  85   RTNGDIARFARPRQLATEEIPLIVNDFRIAAKNAIEAGFDGVEIHGAHGYLVDQFLKDQV  144

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTD+YGG L NRCRFALE+V+ V DEIG +RVGIRLSP+++Y+E GDS+P+ALG++M 
Sbjct  145  NDRTDQYGGSLENRCRFALEIVQAVVDEIGADRVGIRLSPYANYMEAGDSDPDALGLYMV  204

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             SLNK+G+ YCHM+EPRM KL E+ + P SLLPMRKAF G
Sbjct  205  NSLNKFGISYCHMVEPRMVKLGERVETPHSLLPMRKAFKG  244



>ref|XP_010930418.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform 
X2 [Elaeis guineensis]
Length=362

 Score =   344 bits (882),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 187/220 (85%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAW+PIVDAVH KGGIFFCQI H GRVSN DFQPNGQAPIS TDKPL PQ 
Sbjct  72   PGIWTKEQVEAWRPIVDAVHEKGGIFFCQIWHAGRVSNYDFQPNGQAPISCTDKPLAPQV  131

Query  179  ----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
                + A+F  PR+L  +EIP ++NDFR+AA+NAI+AGFDGVEIHGAHG+L+DQFLKD V
Sbjct  132  RTNGDIARFARPRQLATEEIPLIVNDFRIAAKNAIEAGFDGVEIHGAHGYLVDQFLKDQV  191

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTD+YGG L NRCRFALE+V+ V DEIG +RVGIRLSP+++Y+E GDS+P+ALG++M 
Sbjct  192  NDRTDQYGGSLENRCRFALEIVQAVVDEIGADRVGIRLSPYANYMEAGDSDPDALGLYMV  251

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             SLNK+G+ YCHM+EPRM KL E+ + P SLLPMRKAF G
Sbjct  252  NSLNKFGISYCHMVEPRMVKLGERVETPHSLLPMRKAFKG  291



>ref|NP_177795.1| 12-oxophytodienoate reductase 2 [Arabidopsis thaliana]
 sp|Q8GYB8.2|OPR2_ARATH RecName: Full=12-oxophytodienoate reductase 2; AltName: Full=12-oxophytodienoate-10,11-reductase 
2; Short=AtOPR2; Short=OPDA-reductase 
2 [Arabidopsis thaliana]
 gb|AAF04449.1|AC010718_18 12-oxophytodienoate reductase (OPR2); 15748-17127 [Arabidopsis 
thaliana]
 gb|AAC78441.1| 12-oxophytodienoate reductase OPR2 [Arabidopsis thaliana]
 gb|ABF19004.1| At1g76690 [Arabidopsis thaliana]
 gb|AEE35876.1| 12-oxophytodienoate reductase 2 [Arabidopsis thaliana]
Length=374

 Score =   344 bits (883),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 187/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGGIFFCQI HVGRVSN  FQP  QAPIS T KP+ PQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNRGFQPRRQAPISCTGKPIMPQM  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A+FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  140  RANGIDEARFTPPRRLSIEEIPGIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFMKDK  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+FALEVV+ VA EIG +RVGIRLSPF+DY+E GD+NP ALG++M
Sbjct  200  VNDRTDEYGGSLQNRCKFALEVVDAVAKEIGPDRVGIRLSPFADYMESGDTNPEALGLYM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKYG+LYCHMIEPRMK + E +    +L+PMR+AF G
Sbjct  260  VESLNKYGILYCHMIEPRMKTVGEIAACSHTLMPMREAFKG  300



>ref|XP_003553521.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Glycine max]
Length=365

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 187/218 (86%), Gaps = 4/218 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW KEQ+EAWKPIV+AVHAKGG+FFCQI HVGRVS+  FQPNGQAPISSTDKPL  QN
Sbjct  78   PGIWRKEQVEAWKPIVNAVHAKGGVFFCQIWHVGRVSSPVFQPNGQAPISSTDKPLK-QN  136

Query  182  ---QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVND  352
               +AQ TPPRRLR DEIP ++NDFR+AARNAI+AGFDGVEIHGAHG+L++QF+KD VND
Sbjct  137  GIEEAQVTPPRRLRTDEIPHIVNDFRVAARNAIKAGFDGVEIHGAHGYLLEQFIKDKVND  196

Query  353  RTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAES  532
            R+D YGG L NRCRFALEVVE V  EIG ERVG+RLSPF+++ ECGDS+P ALG+++A +
Sbjct  197  RSDGYGGSLENRCRFALEVVEAVVKEIGAERVGVRLSPFTEHAECGDSDPKALGLYLANA  256

Query  533  LNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            L+KY +LYCHM+EPRMK   E  + P SL+PMRKAFNG
Sbjct  257  LSKYNILYCHMVEPRMKNALEVVECPHSLMPMRKAFNG  294



>ref|XP_006302416.1| hypothetical protein CARUB_v10020489mg [Capsella rubella]
 gb|EOA35314.1| hypothetical protein CARUB_v10020489mg [Capsella rubella]
Length=374

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 186/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGG+FFCQI HVGRVSN  FQPNGQAPIS +DKPL PQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNRGFQPNGQAPISCSDKPLMPQI  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  140  RSNGIDEAMFTPPRRLSIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L  RC+FALE+V+ VA EIG +RVGIRLSPF+DY+E  D+NP ALG++M
Sbjct  200  VNDRTDEYGGSLEKRCKFALEIVDAVAKEIGPDRVGIRLSPFADYMESADTNPGALGLYM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IE RMK + E    P +L+PMRKAF G
Sbjct  260  AESLNKYGILYCHVIEARMKTMGEVHACPHTLMPMRKAFKG  300



>ref|XP_003610758.1| 12-oxophytodienoate reductase [Medicago truncatula]
 gb|AES93716.1| 12-oxophytodienoate reductase-like protein [Medicago truncatula]
Length=359

 Score =   343 bits (881),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 181/215 (84%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKE +EAWKPIVDAVHAKG  FFCQI HVGRVSN+ FQPNGQ PISSTDK LT  +
Sbjct  74   PGIWTKEHVEAWKPIVDAVHAKGATFFCQIWHVGRVSNSSFQPNGQEPISSTDKSLTSND  133

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
              +F+PPRRLR DEIP ++NDFRLAARNAI+AGFDGVE+HGAHG+L++QF+KD VNDRTD
Sbjct  134  FEKFSPPRRLRTDEIPNIVNDFRLAARNAIEAGFDGVELHGAHGYLLEQFMKDKVNDRTD  193

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            EYGG L NRCRFALEVV+ V +EIG ERVGIRLSPF+++ E  DSNP  LG++M  +LNK
Sbjct  194  EYGGSLENRCRFALEVVDAVVNEIGAERVGIRLSPFAEHSESRDSNPTELGLYMVNALNK  253

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y +LYCHM+EPR+K   E  + P SL+PMRKAFNG
Sbjct  254  YNILYCHMVEPRIKSNDETIESPYSLVPMRKAFNG  288



>emb|CAN60666.1| hypothetical protein VITISV_033921 [Vitis vinifera]
Length=372

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 186/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG IF CQ+ HVGRVSNT+FQPNGQAP+SSTDK L PQ 
Sbjct  77   PGIWTKEQVEAWKPIVDAVHAKGSIFICQLWHVGRVSNTEFQPNGQAPLSSTDKALMPQV  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FT PRRL  DE+P+V+NDFRLAARNA++AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  137  RSNGFDVAEFTAPRRLTTDEVPRVVNDFRLAARNAMEAGFDGVEIHGAHGYLLDQFMKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRF LEVVE V +EIG ++VGIRLSPF  + E GDSNP ALG++M
Sbjct  197  VNDRTDKYGGSLENRCRFPLEVVEAVVNEIGADKVGIRLSPFGHHAEAGDSNPTALGLYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKYGVLYCHM+EPR++   E  + P SL+P+RKAFNG
Sbjct  257  VESLNKYGVLYCHMVEPRIRAAGEMCECPHSLVPLRKAFNG  297



>ref|XP_007161761.1| hypothetical protein PHAVU_001G096300g [Phaseolus vulgaris]
 gb|ESW33755.1| hypothetical protein PHAVU_001G096300g [Phaseolus vulgaris]
Length=367

 Score =   343 bits (881),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 184/219 (84%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGGIFFCQI HVGR+S TDFQPNGQAPISSTDKPL  Q 
Sbjct  78   PGIWTKEQVEAWKPIVNAVHAKGGIFFCQIWHVGRISTTDFQPNGQAPISSTDKPLKQQM  137

Query  179  ---NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVN  349
               +  +   PRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+L++QF+KD VN
Sbjct  138  GSKSDGETQLPRRLRTDEIPHIVNDFRLAARNAIEAGFDGVEIHGAHGYLLEQFMKDTVN  197

Query  350  DRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAE  529
            DR+DEYGG L NRCRFALEVVE V  EIG ERVG+RLSPF+++ EC DS+P ALGV+MA 
Sbjct  198  DRSDEYGGSLENRCRFALEVVESVVKEIGAERVGVRLSPFTEHGECEDSDPRALGVYMAS  257

Query  530  SLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            +L+KY +LYCHM+EPRMK   E  +   SL+PMRKAF+G
Sbjct  258  ALSKYNILYCHMVEPRMKTALEVVESSHSLVPMRKAFSG  296



>ref|XP_008364009.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Malus domestica]
Length=616

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 189/217 (87%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKP--LTP  175
            PGIWTKEQ+EAWKPIVDAVHAKGG+FFCQI HVGRVSN+ +QPNGQAPISSTDKP  L  
Sbjct  326  PGIWTKEQVEAWKPIVDAVHAKGGLFFCQIWHVGRVSNSGYQPNGQAPISSTDKPIRLNG  385

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             + ++FTPPRRLR DEIPQ++NDFRL ARN+I+AGFDGVEIHGAHG+L+DQFLKD VNDR
Sbjct  386  IDASEFTPPRRLRTDEIPQIVNDFRLXARNSIEAGFDGVEIHGAHGYLLDQFLKDHVNDR  445

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L NRCR  LEVVE VA+EIG ++VGIRLSPF+DY++ GDSNP  LG++MA +L
Sbjct  446  TDQYGGSLENRCRLPLEVVEAVANEIGADKVGIRLSPFADYMDSGDSNPKELGLYMANAL  505

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NKYG++YCHM+EPRMK   EK +  QSLLPMRK F+G
Sbjct  506  NKYGIVYCHMVEPRMKTXGEKXETHQSLLPMRKXFHG  542



>ref|XP_010312987.1| PREDICTED: putative 12-oxophytodienoate reductase-like protein 
1 isoform X2 [Solanum lycopersicum]
Length=350

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 183/215 (85%), Gaps = 5/215 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW K+QIEAWKPIV AVH KGGIFFCQ+ H GR+S  DFQPNGQ PISSTDKP+    
Sbjct  71   PGIWRKDQIEAWKPIVSAVHDKGGIFFCQLWHTGRISTKDFQPNGQVPISSTDKPVKTH-  129

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
                TPPRRL  +EIPQ++NDFR+AARNAI+AGFDGVEIHGAHG+LIDQF+KD VNDRTD
Sbjct  130  ----TPPRRLSTNEIPQIVNDFRIAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRTD  185

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG L NRCRFALE+VE V +EIG +RVGIRLSP+++Y++ GDSNP+ALG++MAESLNK
Sbjct  186  QYGGSLENRCRFALEIVEAVVNEIGADRVGIRLSPYANYMDSGDSNPSALGLYMAESLNK  245

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y + YCHM+EPRMK L EK + P+SL+PMRKAF G
Sbjct  246  YSIAYCHMVEPRMKTLGEKVECPESLVPMRKAFRG  280



>ref|XP_010245029.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Nelumbo 
nucifera]
Length=383

 Score =   344 bits (882),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 187/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ++AWKPIVDAVHAKGGIFFCQI HVGRVSN  FQPNGQAPISSTDKPL PQ 
Sbjct  89   PGIWTKEQVDAWKPIVDAVHAKGGIFFCQIWHVGRVSNYGFQPNGQAPISSTDKPLKPQI  148

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F+PPRRL+  EIP+++NDFR+AARNA++AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  149  RSNGIDTADFSPPRRLKTSEIPEIVNDFRVAARNAMEAGFDGVEIHGAHGYLLDQFMKDE  208

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDR D+YGG L NRCRF LEVVE + DEIG ++VGIRLSPF  + + GDS+P+ALG++M
Sbjct  209  VNDRNDQYGGSLENRCRFPLEVVEAIVDEIGADKVGIRLSPFGSHSDSGDSDPDALGLYM  268

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNK+G+LYCH++EPR+K   +  + P SLLPMRK FNG
Sbjct  269  AEALNKFGILYCHVVEPRIKNAEQNCESPHSLLPMRKVFNG  309



>ref|XP_010416592.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Camelina sativa]
Length=375

 Score =   343 bits (881),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 186/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGG+FFCQI HVGRVSN  FQPNGQAPIS + KPL PQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNRGFQPNGQAPISCSAKPLMPQI  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  140  RSNGIDEAMFTPPRRLDIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L  RCRFALE+V+ VA EIG +RVGIRLSPF+DY+E GD+NP ALG++M
Sbjct  200  VNDRTDEYGGSLEKRCRFALEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IE RMK + E    P +L+PMRKAF G
Sbjct  260  AESLNKYGILYCHVIEARMKTMGEVHACPHTLMPMRKAFKG  300



>ref|XP_002278405.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Vitis vinifera]
Length=371

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 186/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG IF CQ+ HVGRVSNT+FQPNGQAP+SSTDK LTPQ 
Sbjct  77   PGIWTKEQVEAWKPIVDAVHAKGSIFNCQLWHVGRVSNTEFQPNGQAPLSSTDKALTPQV  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FT PRRL  DE+P+V+NDFRLAARNA++AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  137  RSNGFDVAEFTAPRRLTTDEVPRVVNDFRLAARNAMEAGFDGVEIHGAHGYLLDQFMKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG   NRCRF LEVVE V +EIG ++VGIRLSPF  + + GDSNP ALG +M
Sbjct  197  VNDRTDKYGGSQENRCRFPLEVVEAVVNEIGADKVGIRLSPFGHHAQAGDSNPTALGRYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKYGVLYCHM+EPR++   E  +GP SL+P+RKAFNG
Sbjct  257  VESLNKYGVLYCHMVEPRIRAAGEMYEGPHSLVPLRKAFNG  297



>ref|XP_004250653.1| PREDICTED: 12-oxophytodienoate reductase 1-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010312986.1| PREDICTED: 12-oxophytodienoate reductase 1-like isoform X1 [Solanum 
lycopersicum]
Length=354

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 183/215 (85%), Gaps = 5/215 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW K+QIEAWKPIV AVH KGGIFFCQ+ H GR+S  DFQPNGQ PISSTDKP+    
Sbjct  71   PGIWRKDQIEAWKPIVSAVHDKGGIFFCQLWHTGRISTKDFQPNGQVPISSTDKPVKTH-  129

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
                TPPRRL  +EIPQ++NDFR+AARNAI+AGFDGVEIHGAHG+LIDQF+KD VNDRTD
Sbjct  130  ----TPPRRLSTNEIPQIVNDFRIAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRTD  185

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG L NRCRFALE+VE V +EIG +RVGIRLSP+++Y++ GDSNP+ALG++MAESLNK
Sbjct  186  QYGGSLENRCRFALEIVEAVVNEIGADRVGIRLSPYANYMDSGDSNPSALGLYMAESLNK  245

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y + YCHM+EPRMK L EK + P+SL+PMRKAF G
Sbjct  246  YSIAYCHMVEPRMKTLGEKVECPESLVPMRKAFRG  280



>ref|XP_010101281.1| Putative 12-oxophytodienoate reductase 11 [Morus notabilis]
 gb|EXB88216.1| Putative 12-oxophytodienoate reductase 11 [Morus notabilis]
Length=390

 Score =   344 bits (882),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 184/221 (83%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVD VHAKGGIFFCQI H GR S TDFQPNGQAPISSTDKP++P+ 
Sbjct  96   PGIWTKEQVEAWKPIVDVVHAKGGIFFCQIWHSGRSSKTDFQPNGQAPISSTDKPISPEL  155

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            ++       FTPPRRLR +EIP V+NDFR+AAR AI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  156  RSDATELPSFTPPRRLRTEEIPLVVNDFRIAARKAIEAGFDGVEIHGAHGYLIDQFLKDQ  215

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDR D+YGG L NRCRFALEVVE + +EIG +RVGIRLSPF+++ +  DSNP  LG++M
Sbjct  216  VNDRKDKYGGSLENRCRFALEVVEAIVNEIGADRVGIRLSPFTEFNDAKDSNPEELGLYM  275

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A+SLNKYG+LYCHM+EPRMK   E S    SL+PMRKAF G
Sbjct  276  AKSLNKYGILYCHMVEPRMKMAIEVSKTDLSLVPMRKAFKG  316



>ref|XP_010101279.1| Putative 12-oxophytodienoate reductase 11 [Morus notabilis]
 gb|EXB88214.1| Putative 12-oxophytodienoate reductase 11 [Morus notabilis]
Length=390

 Score =   344 bits (882),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 186/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI H+GR SNTDFQPNGQAPISSTDKP++ + 
Sbjct  96   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHMGRSSNTDFQPNGQAPISSTDKPISAEL  155

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
             +      +FTPPRRLR +EIP V+NDFR+AARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  156  HSDVIELPKFTPPRRLRTEEIPLVVNDFRIAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  215

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDR D+YGG L NRCRFALEVVE + +EIG +RVGIRLSPF+++ +  D+NP  LG++M
Sbjct  216  VNDRKDKYGGSLENRCRFALEVVEAIVNEIGADRVGIRLSPFAEFNDAKDTNPEELGLYM  275

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A+SLNKYG+LYCHM+EPRM    + S    SL+PMRKAF G
Sbjct  276  AKSLNKYGILYCHMVEPRMTMTLDVSKTDLSLVPMRKAFKG  316



>ref|XP_010428733.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Camelina sativa]
Length=375

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 186/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGG+FFCQI HVGRVSN  FQPNGQAPIS + KPL PQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNRGFQPNGQAPISCSAKPLMPQI  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  140  RSNGIDEAMFTPPRRLDIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L  RCRFALE+V+ VA EIG +RVGIRLSPF+DY+E GD+NP ALG++M
Sbjct  200  VNDRTDEYGGSLEKRCRFALEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IE RMK + E    P +L+PMRKAF G
Sbjct  260  AESLNKYGILYCHVIEARMKTMGEVHACPHTLIPMRKAFKG  300



>ref|XP_010245524.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Nelumbo 
nucifera]
Length=368

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 187/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVH KGGIFFCQI HVGRVSN  FQPNG+APIS TDKPL  Q 
Sbjct  74   PGIWTKEQVEAWKPIVDAVHMKGGIFFCQIWHVGRVSNYGFQPNGRAPISCTDKPLKAQL  133

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+F+PPRRL+ +EI QV+NDFR+AARNA++ GFDGVEIHGAHG+L+DQF+KD 
Sbjct  134  RANGVDVAEFSPPRRLKTEEIYQVVNDFRIAARNAMEVGFDGVEIHGAHGYLLDQFMKDQ  193

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDR D YGG L NRCRF LEVVE + + IG ++VGIRLSPF++Y+E GDSNP ALG++M
Sbjct  194  VNDREDIYGGTLENRCRFPLEVVEAIVNVIGPDKVGIRLSPFANYMESGDSNPEALGLYM  253

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+ YCHM+EPRMK + EK + PQSLLPMRK+FNG
Sbjct  254  AESLNKYGICYCHMVEPRMKTVSEKVECPQSLLPMRKSFNG  294



>dbj|BAI63591.1| 12-oxophytodienoate reductase [Lotus japonicus]
Length=356

 Score =   342 bits (878),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 182/215 (85%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKG  FFCQI H GRVSN+ FQPNGQAPIS TDKPL   N
Sbjct  74   PGIWTKEQVEAWKPIVDAVHAKGATFFCQIWHCGRVSNSGFQPNGQAPISPTDKPL---N  130

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
             +QFTPPRRLR DEIP ++NDF+LAARNAI+AGFDG+EIHGAHG+L DQF+KD VNDRTD
Sbjct  131  GSQFTPPRRLRTDEIPHIVNDFKLAARNAIEAGFDGIEIHGAHGYLPDQFMKDKVNDRTD  190

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG L NRCRF LE+VE VA+EIG ERVG+RLSPF+++ ECGDSNP  LG++M  +LNK
Sbjct  191  KYGGSLENRCRFILEIVEAVANEIGPERVGVRLSPFAEHGECGDSNPKELGLYMVNALNK  250

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y VLYCHM+EPRMK   E+ +   SL+P+RKAF G
Sbjct  251  YSVLYCHMVEPRMKNAAEQVESSHSLVPIRKAFKG  285



>dbj|BAC42387.1| putative 12-oxophytodienoate reductase OPR2 [Arabidopsis thaliana]
Length=374

 Score =   343 bits (879),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 186/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGGIFFCQI HVGRVSN  FQP  QAPIS T KP+ PQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNRGFQPRRQAPISCTGKPIMPQM  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A+FTPPRRL  +EIP ++NDFRLAARN ++AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  140  RANGIDEARFTPPRRLSIEEIPGIVNDFRLAARNTMEAGFDGVEIHGAHGYLIDQFMKDK  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+FALEVV+ VA EIG +RVGIRLSPF+DY+E GD+NP ALG++M
Sbjct  200  VNDRTDEYGGSLQNRCKFALEVVDAVAKEIGPDRVGIRLSPFADYMESGDTNPEALGLYM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKYG+LYCHMIEPRMK + E +    +L+PMR+AF G
Sbjct  260  VESLNKYGILYCHMIEPRMKTVGEIAACSHTLMPMREAFKG  300



>emb|CDY20395.1| BnaC02g24210D [Brassica napus]
Length=372

 Score =   342 bits (878),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 188/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGG+FFCQI HVGRVSN  FQPNGQAPIS +DKPL PQ 
Sbjct  78   PGIWTKEHVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNRGFQPNGQAPISCSDKPLMPQI  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  138  RSNGIDEALFTPPRRLSTEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+FAL++VE VA+EIG +RVGIRLSPF+DY+E  D+NP AL + M
Sbjct  198  VNDRTDEYGGSLQNRCKFALDIVEAVANEIGPDRVGIRLSPFADYMESADTNPQALALHM  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A+SLNKYG+LYCH+IE RMK + E ++ P  L+PMRKAF G
Sbjct  258  AQSLNKYGILYCHVIEARMKTMGEITECPHLLVPMRKAFQG  298



>ref|XP_008339185.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica]
Length=369

 Score =   342 bits (878),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 189/218 (87%), Gaps = 3/218 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKP--LTP  175
            PGIWTKEQ+EAWKPIVDAVHA+GG+FFCQI HVGRVSN+ +QPNGQAPISSTDKP  L  
Sbjct  78   PGIWTKEQVEAWKPIVDAVHAEGGVFFCQIWHVGRVSNSGYQPNGQAPISSTDKPIRLNG  137

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             + ++FTPPRRLR DEIPQ++NDFRLAARN+I+AGFDGVEIHGAHG+L+DQFLKD VNDR
Sbjct  138  IDASEFTPPRRLRTDEIPQIVNDFRLAARNSIEAGFDGVEIHGAHGYLLDQFLKDHVNDR  197

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L NRCR  LEVVE V +EIG + VGIRL PF+D+++ GDSNP  LG++MA +L
Sbjct  198  TDQYGGSLENRCRLPLEVVEAVVNEIGADXVGIRLGPFADFMDAGDSNPKELGLYMANAL  257

Query  536  NKYGVLYCH-MIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NKYG++YCH M+EPRMK + E ++  QSLLPMRKAF+G
Sbjct  258  NKYGIVYCHMMVEPRMKAVGEIAETHQSLLPMRKAFHG  295



>ref|XP_009128191.1| PREDICTED: 12-oxophytodienoate reductase 1 [Brassica rapa]
Length=374

 Score =   342 bits (878),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 188/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGG+FFCQI HVGRVSN  FQPNGQAPIS +DKPL PQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNRGFQPNGQAPISCSDKPLMPQI  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  140  RSNGIDEALFTPPRRLSTEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+FAL++VE VA+EIG +RVGIRLSPF+DY+E  D+NP AL + M
Sbjct  200  VNDRTDEYGGSLQNRCKFALDIVEAVANEIGPDRVGIRLSPFADYMESADTNPQALALHM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A+SLNKYG+LYCH+IE RMK + E ++ P  L+PMRKAF G
Sbjct  260  AQSLNKYGILYCHVIEARMKTMGEITECPHLLVPMRKAFQG  300



>emb|CDY45941.1| BnaA02g17670D [Brassica napus]
Length=372

 Score =   342 bits (878),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 188/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGG+FFCQI HVGRVSN  FQPNGQAPIS +DKPL PQ 
Sbjct  78   PGIWTKEHVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNRGFQPNGQAPISCSDKPLMPQI  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  138  RSNGIDEALFTPPRRLSTEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+FAL++VE VA+EIG +RVGIRLSPF+DY+E  D+NP AL + M
Sbjct  198  VNDRTDEYGGSLQNRCKFALDIVEAVANEIGPDRVGIRLSPFADYMESADTNPQALALHM  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A+SLNKYG+LYCH+IE RMK + E ++ P  L+PMRKAF G
Sbjct  258  AQSLNKYGILYCHVIEARMKTMGEITECPHLLVPMRKAFQG  298



>ref|XP_006339388.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Solanum tuberosum]
Length=354

 Score =   341 bits (875),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 185/215 (86%), Gaps = 5/215 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW K+Q+EAWKPIV AVH KGGIFFCQ+ H GR+S  DFQPN QAPISSTDKP+  Q 
Sbjct  71   PGIWRKDQVEAWKPIVSAVHDKGGIFFCQLWHTGRISTKDFQPNRQAPISSTDKPVKTQ-  129

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
                TPPR+L  +EIPQ++NDFR+AARNAI+AGFDGVEIHGAHG+LIDQF+KD VN+RTD
Sbjct  130  ----TPPRQLSTNEIPQIVNDFRIAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNNRTD  185

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG L NRCRFALE+VE V +EIG +RVGIRLSPF++Y++ GDSNP+ALG++MAESLNK
Sbjct  186  QYGGTLENRCRFALEIVEAVVNEIGADRVGIRLSPFANYMDSGDSNPSALGLYMAESLNK  245

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            YG+ YCHM+EPRMK + EK + P+SL+PMRKAF G
Sbjct  246  YGISYCHMVEPRMKTIGEKVECPKSLVPMRKAFRG  280



>ref|XP_010535056.1| PREDICTED: 12-oxophytodienoate reductase 1-like isoform X3 [Tarenaya 
hassleriana]
Length=360

 Score =   341 bits (875),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 186/216 (86%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT+EQ+EAWKPIVDAVHAKGG FFCQI H GRVSN  FQPNGQ PISSTDKPLTP  
Sbjct  77   PGIWTREQVEAWKPIVDAVHAKGGFFFCQIWHCGRVSNRGFQPNGQDPISSTDKPLTPGI  136

Query  179  NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            ++A+FTPPRRLR +EIP +++DFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD VNDRT
Sbjct  137  DEARFTPPRRLRTEEIPAIVDDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDEVNDRT  196

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D+YGG L  RCRFALE+VE VA+EIG +RVGIRLSPF+DY+E GDSNP ALG+ MAESLN
Sbjct  197  DKYGGSLEKRCRFALEIVEAVANEIGPDRVGIRLSPFADYMESGDSNPEALGLHMAESLN  256

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            +YG+LYCHM+EPRM  + E    P++L   RKAF G
Sbjct  257  QYGILYCHMVEPRMTAVGEMEQCPRTL---RKAFKG  289



>emb|CBI39233.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   347 bits (891),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 177/200 (89%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNTDFQPNGQAPIS TDKPLTPQ 
Sbjct  154  PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTDFQPNGQAPISCTDKPLTPQI  213

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQF+ PRRL  DEIPQV+NDFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  214  RSNGIDVAQFSTPRRLTTDEIPQVVNDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDQ  273

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRC FALEVVE V DEIG ++VGIRLSPF+ Y E GDSNP ALG++M
Sbjct  274  VNDRTDKYGGSLENRCGFALEVVEAVVDEIGADKVGIRLSPFAAYAEAGDSNPKALGLYM  333

Query  524  AESLNKYGVLYCHMIEPRMK  583
            AESLNKYG+LYCHM+EPRMK
Sbjct  334  AESLNKYGLLYCHMVEPRMK  353



>ref|XP_009121440.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Brassica rapa]
Length=374

 Score =   342 bits (876),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/222 (71%), Positives = 188/222 (85%), Gaps = 7/222 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIV+AVHAKGGI FCQI HVGRVSN  FQPNGQAPIS TDKPL PQ 
Sbjct  78   PGIWTKEHVEAWKPIVEAVHAKGGIIFCQIWHVGRVSNKSFQPNGQAPISCTDKPLMPQI  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++N FRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  138  RSNGIDEAMFTPPRRLSTEEIPTIVNHFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+FAL++VE VA+EIG +RVGIRLSPF+DY+E GD+NP AL + M
Sbjct  198  VNDRTDEYGGSLQNRCKFALDIVEAVANEIGPDRVGIRLSPFADYMESGDTNPQALALHM  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSD-GPQSLLPMRKAFNG  646
            AESLNKYG+LYCH++E RMK + E ++  P +L PMRKAF+G
Sbjct  258  AESLNKYGILYCHVVEARMKTMGEITECHPHTLTPMRKAFSG  299



>gb|AAM65337.1| 12-oxophytodienoate reductase (OPR1) [Arabidopsis thaliana]
Length=372

 Score =   342 bits (876),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 188/221 (85%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGGIFFCQI HVGRVSN+ FQPNG+APIS +DKPL PQ 
Sbjct  78   PGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQI  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AGFDGVEIH A+G+LIDQF+KD 
Sbjct  138  RSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHRANGYLIDQFMKDT  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+F LE+V+ VA EIG +RVGIRLSPF+DY+E GD+NP ALG++M
Sbjct  198  VNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYM  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AESLNKYG+LYCH+IE RMK + E    P +L+PMRKAF G
Sbjct  258  AESLNKYGILYCHVIEARMKTMGEVHACPHTLMPMRKAFKG  298



>gb|KFK25914.1| hypothetical protein AALP_AA8G179500 [Arabis alpina]
Length=374

 Score =   342 bits (876),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 185/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGG+FFCQI HVGRVSN  FQPNGQAPIS TDKPL PQ 
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNRGFQPNGQAPISCTDKPLMPQI  139

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTP RRL  +EIP ++NDFRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  140  RANGIDEALFTPARRLSIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L  RCRFALE+VE V+ EIG +RVGIRLSPF+DY+E  D+NP AL V M
Sbjct  200  VNDRTDEYGGSLEKRCRFALEIVEAVSKEIGPDRVGIRLSPFADYMESADTNPQALAVHM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A+SLNKYG+LYCH+IE RMK + E ++ P +L+PMRKAF G
Sbjct  260  AKSLNKYGILYCHVIEARMKTMGEITECPHTLMPMRKAFRG  300



>emb|CDX69416.1| BnaA10g17650D [Brassica napus]
Length=374

 Score =   341 bits (875),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/222 (71%), Positives = 188/222 (85%), Gaps = 7/222 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIV+AVHAKGGI FCQI HVGRVSN  FQPNGQAPIS TDKPL PQ 
Sbjct  78   PGIWTKEHVEAWKPIVEAVHAKGGIIFCQIWHVGRVSNKSFQPNGQAPISCTDKPLMPQI  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 ++A FTPPRRL  +EIP ++N FRLAARNA++AGFDGVEIHGA+G+LIDQF+KD 
Sbjct  138  RSNGIDEAMFTPPRRLSTEEIPTIVNHFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDT  197

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L+NRC+FAL++VE VA+EIG +RVGIRLSPF+DY+E GD+NP AL + M
Sbjct  198  VNDRTDEYGGSLQNRCKFALDIVEAVANEIGPDRVGIRLSPFADYMESGDTNPQALALHM  257

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSD-GPQSLLPMRKAFNG  646
            AESLNKYG+LYCH++E RMK + E ++  P +L PMRKAF+G
Sbjct  258  AESLNKYGILYCHVVEARMKTMGEITECHPHTLTPMRKAFSG  299



>ref|XP_008786404.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform 
X1 [Phoenix dactylifera]
Length=363

 Score =   340 bits (873),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 184/221 (83%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAW+PIVDAVH KGGIFFCQI HVGRVSN  FQPNGQAPIS TDKPL  Q 
Sbjct  72   PGIWTKEQVEAWRPIVDAVHEKGGIFFCQIWHVGRVSNYGFQPNGQAPISCTDKPLASQV  131

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A      QF+PPRRL  +EIP ++NDFR AA+NAI+AGFDGVEIHGAHG+L+DQFLKD 
Sbjct  132  RANGVDITQFSPPRRLATEEIPLIVNDFRNAAKNAIEAGFDGVEIHGAHGYLVDQFLKDQ  191

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+V+ V DEIG + VGIRLSP++DY+E  DS+P ALG++M
Sbjct  192  VNDRTDQYGGSLENRCRFALEIVQAVVDEIGADSVGIRLSPYADYMESRDSDPAALGLYM  251

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              SLNK+G+ YCHMIEPRM K+ EK + P SLLPMRKAF G
Sbjct  252  VNSLNKFGISYCHMIEPRMVKVGEKVETPHSLLPMRKAFKG  292



>emb|CDP18870.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   341 bits (874),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 185/221 (84%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQIEAWKPIVDAVHAKGG+FFCQ+ H GRVSN DFQPNGQAPISSTDK L PQ 
Sbjct  85   PGIWTKEQIEAWKPIVDAVHAKGGVFFCQLWHGGRVSNNDFQPNGQAPISSTDKLLAPQV  144

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+F+PPRRLR +EIPQV+NDFRLAA +AI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  145  RTNGIDVAEFSPPRRLRTEEIPQVVNDFRLAALSAIEAGFDGVEIHGAHGYLIDQFLKDR  204

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            +NDRTDEYGG L NRCRFALE+VE V+  IG +RVGIRLSPF++Y    DSNP AL + M
Sbjct  205  LNDRTDEYGGSLENRCRFALEIVEAVSVAIGADRVGIRLSPFANYNGASDSNPKALALHM  264

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNKYG+LY HM+EPRM K+ EK +   SLLPMRKAF G
Sbjct  265  AEALNKYGILYLHMVEPRMIKVGEKFECADSLLPMRKAFKG  305



>ref|XP_006376141.1| hypothetical protein POPTR_0013s10170g [Populus trichocarpa]
 gb|ERP53938.1| hypothetical protein POPTR_0013s10170g [Populus trichocarpa]
Length=365

 Score =   340 bits (873),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 186/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN+ FQP+GQAP+SSTDKP++ Q 
Sbjct  76   PGIWTREQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPDGQAPVSSTDKPISSQV  135

Query  182  QA-QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            +  +FTPPRRLR DEIPQ++NDFR+AARNAI+AGFDGVEIHGAHG+LIDQF+KD VN+RT
Sbjct  136  EGMEFTPPRRLRTDEIPQIVNDFRIAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNNRT  195

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D+YGG L NRCRF LE+VE +A+EIG ++VGIRLSP  +Y+E  DS+P ALG+ M +SLN
Sbjct  196  DQYGGSLENRCRFPLEIVEAIANEIGSDKVGIRLSPHVNYMESADSDPEALGLHMVKSLN  255

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFN  643
            KYG+ YCHM+EPRMK     +   +SLLPMRKAFN
Sbjct  256  KYGIAYCHMVEPRMKIGAGNAKFSESLLPMRKAFN  290



>ref|XP_010535049.1| PREDICTED: 12-oxophytodienoate reductase 2-like isoform X2 [Tarenaya 
hassleriana]
Length=362

 Score =   340 bits (873),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 186/216 (86%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT+EQ+EAWKPIVDAVHAKGG FFCQI H GRVSN  FQPNGQ PISSTDKPLTP  
Sbjct  79   PGIWTREQVEAWKPIVDAVHAKGGFFFCQIWHCGRVSNRGFQPNGQDPISSTDKPLTPGI  138

Query  179  NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            ++A+FTPPRRLR +EIP +++DFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD VNDRT
Sbjct  139  DEARFTPPRRLRTEEIPAIVDDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDEVNDRT  198

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D+YGG L  RCRFALE+VE VA+EIG +RVGIRLSPF+DY+E GDSNP ALG+ MAESLN
Sbjct  199  DKYGGSLEKRCRFALEIVEAVANEIGPDRVGIRLSPFADYMESGDSNPEALGLHMAESLN  258

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            +YG+LYCHM+EPRM  + E    P++L   RKAF G
Sbjct  259  QYGILYCHMVEPRMTAVGEMEQCPRTL---RKAFKG  291



>ref|XP_006305271.1| hypothetical protein CARUB_v10009647mg [Capsella rubella]
 gb|EOA38169.1| hypothetical protein CARUB_v10009647mg [Capsella rubella]
Length=340

 Score =   339 bits (869),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = +2

Query  5    GIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLT--PQ  178
            GIW KEQIEAWKPIVDAVH++GG+FFCQ+ H GRVS+ D+QPNG+AP+SSTDKP+   P 
Sbjct  51   GIWRKEQIEAWKPIVDAVHSRGGVFFCQLWHAGRVSHRDWQPNGEAPVSSTDKPVADDPS  110

Query  179  NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            +Q +FTPPRRL  +EIP ++NDFRLAARNAI+AGFDGVEIHGAHG+L+DQFLKD VNDRT
Sbjct  111  SQYRFTPPRRLTTEEIPTIVNDFRLAARNAIEAGFDGVEIHGAHGYLVDQFLKDSVNDRT  170

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D YGG L NRCRFALEV+E V++EIG +RVGIRLSPF++Y+E GDS+P +LG++MA+SLN
Sbjct  171  DSYGGSLENRCRFALEVIEAVSNEIGPDRVGIRLSPFANYMESGDSDPKSLGLYMAKSLN  230

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            ++ +LYCHM+EPRMK + E  +  +SL PMRKAFNG
Sbjct  231  RFEILYCHMVEPRMKTVSEIFECTESLTPMRKAFNG  266



>sp|B9FSC8.1|OPR11_ORYSJ RecName: Full=Putative 12-oxophytodienoate reductase 11; AltName: 
Full=OPDA-reductase 11; Short=OsOPR11 [Oryza sativa Japonica 
Group]
 gb|EEE65389.1| hypothetical protein OsJ_20711 [Oryza sativa Japonica Group]
Length=367

 Score =   340 bits (872),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 182/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVD VHAKGGIFFCQI HVGRVSN  FQPNGQAPISST+K L P  
Sbjct  73   PGIWTKEQVEAWKPIVDGVHAKGGIFFCQIWHVGRVSNNTFQPNGQAPISSTNKSLKPAV  132

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F+ PRRL  DEIP V+ND+R+AARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  133  RANGIDVATFSTPRRLETDEIPFVVNDYRVAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  192

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDR+D+YGG L NRCRFALEVV+ V DEIG ++VGIRLSPF+ Y E  DSNP ALG++M
Sbjct  193  VNDRSDKYGGSLENRCRFALEVVQAVTDEIGADKVGIRLSPFASYSEAADSNPEALGLYM  252

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNK+G+LYCHM+EPRM KL EK + P SL P+R AF G
Sbjct  253  ANALNKFGILYCHMVEPRMVKLGEKFETPHSLRPIRDAFKG  293



>gb|EMT21994.1| 12-oxophytodienoate reductase 2 [Aegilops tauschii]
Length=360

 Score =   340 bits (871),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 183/221 (83%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTK+Q+EAWKPIVD VHAKGGIFFCQI HVGRVSN  FQPNGQAPISSTDKP+ P  
Sbjct  66   PGIWTKKQVEAWKPIVDGVHAKGGIFFCQIWHVGRVSNHAFQPNGQAPISSTDKPIKPAT  125

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A      + + PRRL  DEIP VI+DFR+AARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  126  RADGIGLAKVSTPRRLETDEIPLVIDDFRVAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  185

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVV+ VADEIG ++VGIRLSPF+ Y E  DSNP ALG++M
Sbjct  186  VNDRTDKYGGSLENRCRFALEVVQAVADEIGADKVGIRLSPFASYSEASDSNPEALGLYM  245

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A++LNK G+LYCHM+EPRM  + EK + P SL PMR AF G
Sbjct  246  AQALNKLGILYCHMVEPRMVNIGEKLETPHSLRPMRDAFKG  286



>gb|ABK95614.1| unknown [Populus trichocarpa]
Length=365

 Score =   340 bits (871),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 186/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN+ FQP+GQAP+SSTDKP++ Q 
Sbjct  76   PGIWTREQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPDGQAPVSSTDKPISSQV  135

Query  182  QA-QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            +  +FTPPRRLR DEIPQ++NDFR+AARNAI+AGFDGVEIHGAHG+LIDQF+KD VN+RT
Sbjct  136  EGMEFTPPRRLRTDEIPQIVNDFRIAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNNRT  195

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D+YGG L NRCRF LE+VE +A+EIG ++VGIRLSP  +Y+E  DS+P ALG+ M +SLN
Sbjct  196  DQYGGSLENRCRFPLEIVEAIANEIGSDKVGIRLSPHVNYMESEDSDPEALGLHMVKSLN  255

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFN  643
            KYG+ YCHM+EPRMK     +   +SLLPMRKAFN
Sbjct  256  KYGIAYCHMVEPRMKIGAGNAKFSESLLPMRKAFN  290



>ref|XP_004975713.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like isoform 
X1 [Setaria italica]
 ref|XP_004975714.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like isoform 
X2 [Setaria italica]
Length=371

 Score =   340 bits (871),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 182/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW+ EQ+EAWKPIV  VH KGGIFFCQ+ HVGRVSN+ FQPNGQAPISSTDKPL PQ 
Sbjct  77   PGIWSNEQVEAWKPIVHGVHEKGGIFFCQLWHVGRVSNSTFQPNGQAPISSTDKPLKPQV  136

Query  182  QAQ------FTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A       F PPRRL  DEIP ++NDFR+AARNA++AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  137  RANGVDVTTFAPPRRLETDEIPLIVNDFRVAARNAVEAGFDGVEIHGAHGYLIDQFLKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVV+ V DEIG ++VGIRLSPF+ Y E  DSNP ALG++M
Sbjct  197  VNDRTDKYGGSLENRCRFALEVVQAVVDEIGADKVGIRLSPFASYSEAPDSNPEALGLYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNK+G+LYCH++EPRM KL EK + P SL PMR AF G
Sbjct  257  ANALNKFGILYCHVVEPRMVKLGEKFETPYSLRPMRDAFKG  297



>ref|NP_001105909.1| 12-oxo-phytodienoic acid reductase5 [Zea mays]
 gb|AAY26525.1| 12-oxo-phytodienoic acid reductase [Zea mays]
Length=371

 Score =   340 bits (871),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 182/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT EQ+EAWKPIVD VH KGGIFFCQI HVGRVSN+ FQPNGQAPISSTDKPL PQ 
Sbjct  77   PGIWTHEQVEAWKPIVDGVHQKGGIFFCQIWHVGRVSNSTFQPNGQAPISSTDKPLKPQV  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F  PRRL  DEIP V+NDFR+AARNAI+AGFDGVEIHGAHG+LIDQFLKDG
Sbjct  137  RANGIDVATFAVPRRLETDEIPLVVNDFRVAARNAIEAGFDGVEIHGAHGYLIDQFLKDG  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEV + V DEIG ++VGIRLSPF+ Y E  DS+P ALG++M
Sbjct  197  VNDRTDKYGGSLENRCRFALEVTQAVVDEIGADKVGIRLSPFASYSEAPDSDPEALGLYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LN++G+LYCHM+EPRM KL EK + P SL P+R AF G
Sbjct  257  ANALNEFGILYCHMVEPRMVKLGEKFETPYSLRPIRDAFRG  297



>ref|XP_006376140.1| hypothetical protein POPTR_0013s10160g [Populus trichocarpa]
 gb|ERP53937.1| hypothetical protein POPTR_0013s10160g [Populus trichocarpa]
Length=365

 Score =   339 bits (870),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            P IWT+EQ+EAWKPIVDAVHAKGGIFFCQI H GRVSN+ FQP+GQAP+SSTDKP++ Q 
Sbjct  76   PSIWTREQVEAWKPIVDAVHAKGGIFFCQIWHAGRVSNSGFQPDGQAPVSSTDKPISSQV  135

Query  182  QA-QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            +  +FTPPRRLR DEIPQ++NDFR+AARNAI+AGFDGVEIHGAHGFLIDQF+KD VN+RT
Sbjct  136  EGMEFTPPRRLRTDEIPQIVNDFRIAARNAIEAGFDGVEIHGAHGFLIDQFMKDQVNNRT  195

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D+YGG L NRCRF LE+VE +A+EIG +++GIRLSP  +Y+E GDS+P ALG++M +SLN
Sbjct  196  DQYGGSLENRCRFPLEIVEAIANEIGSDKLGIRLSPHVNYMESGDSDPEALGLYMVKSLN  255

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFN  643
            KYG+ YCHM+EPRMK         +SLLPMRKAFN
Sbjct  256  KYGIAYCHMVEPRMKIGAGNPKFSESLLPMRKAFN  290



>ref|XP_008786405.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform 
X2 [Phoenix dactylifera]
Length=362

 Score =   339 bits (869),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 183/220 (83%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGG+FFCQI HVGRVS++ FQPNGQAP+SST+K   P  
Sbjct  72   PGIWTKEQVEAWKPIVDAVHAKGGVFFCQIWHVGRVSSSGFQPNGQAPVSSTNKGFGPVT  131

Query  182  Q-----AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
                   ++ PPRRLR DEIP ++ DFRLAARNAI+AGFDGVEIHGAHG+L+DQFLKD V
Sbjct  132  HLDGSVQEYFPPRRLRTDEIPCIVKDFRLAARNAIEAGFDGVEIHGAHGYLVDQFLKDQV  191

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTD+YGG L NRCRFALE+V+ V DEIG + VGIRLSP++DY+E  DS+P ALG++M 
Sbjct  192  NDRTDQYGGSLENRCRFALEIVQAVVDEIGADSVGIRLSPYADYMESRDSDPAALGLYMV  251

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             SLNK+G+ YCHMIEPRM K+ EK + P SLLPMRKAF G
Sbjct  252  NSLNKFGISYCHMIEPRMVKVGEKVETPHSLLPMRKAFKG  291



>ref|XP_004975715.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like [Setaria 
italica]
Length=365

 Score =   338 bits (868),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 181/215 (84%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+E+WKPIVD VHAKGGIFFCQI HVGRVSN+ FQPNGQAP+SSTDKP+    
Sbjct  77   PGIWTKEQVESWKPIVDGVHAKGGIFFCQIWHVGRVSNSTFQPNGQAPVSSTDKPVNSVR  136

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
              +FTPPRRL  DEIP VINDFR+AARNAI+AGFDGVEIHGAHG+LIDQFLKD VNDRTD
Sbjct  137  VDKFTPPRRLETDEIPLVINDFRVAARNAIEAGFDGVEIHGAHGYLIDQFLKDQVNDRTD  196

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG L NRCRFALE+VE + DEIG ++VGIRLSPF++Y    DSNP ALG++MA +LNK
Sbjct  197  KYGGSLENRCRFALEIVEALVDEIGADKVGIRLSPFANYSGAADSNPEALGMYMAHALNK  256

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            +GVLYCH++EPRM K   K + P SL P+R AF G
Sbjct  257  FGVLYCHVVEPRMVKHGGKFETPYSLGPVRDAFKG  291



>emb|CDP10746.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 189/222 (85%), Gaps = 10/222 (5%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHA+GGIFFCQI HVGRVSN DFQPNGQAPISSTDK L  Q 
Sbjct  90   PGIWTKEQVEAWKPIVDAVHARGGIFFCQIWHVGRVSNYDFQPNGQAPISSTDKLLPTQI  149

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            QA      + +PPRRL+ +EIPQ+++DFRLAA NAI+AGFDGVEIHGAHG++IDQFLKD 
Sbjct  150  QADGVSVHECSPPRRLKIEEIPQIVDDFRLAAINAIEAGFDGVEIHGAHGYIIDQFLKDQ  209

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            +NDRTDEYGG L NRCRFALE+VE V+  IG +RVGI+LSPF DY E GDSNP ALG++M
Sbjct  210  INDRTDEYGGKLENRCRFALEIVEAVSTAIGPDRVGIKLSPFDDYNESGDSNPQALGLYM  269

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGP-QSLLPMRKAFNG  646
            AE+LNKYG+LYCHM++PR    WEK+D P +SLLPMRKAF G
Sbjct  270  AEALNKYGILYCHMVKPR---FWEKADYPDESLLPMRKAFKG  308



>ref|XP_006858592.1| hypothetical protein AMTR_s00071p00195650 [Amborella trichopoda]
 gb|ERN20059.1| hypothetical protein AMTR_s00071p00195650 [Amborella trichopoda]
Length=379

 Score =   339 bits (869),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 181/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVH KGG+FFCQI HVGRVSN  +QPNGQAPIS T K L+PQ 
Sbjct  87   PGIWTKEQVEAWKPIVDAVHEKGGVFFCQIWHVGRVSNYGYQPNGQAPISCTSKQLSPQV  146

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 N+ +F+PPR L  +EIP V+NDFRLAARNAI AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  147  DANQINKLEFSPPRALVTEEIPLVVNDFRLAARNAIDAGFDGVEIHGAHGYLLDQFMKDS  206

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD YGG L NRCRFALE+VE V  EIG ++VGIRLSPF+ Y E GDSNP ALG++M
Sbjct  207  VNDRTDHYGGSLENRCRFALEIVEAVVKEIGADKVGIRLSPFASYCEAGDSNPEALGLYM  266

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNKY ++Y H +EPRM  + EK++ P SLLPMRKAF G
Sbjct  267  AEALNKYNIVYAHFVEPRMVTVGEKAETPHSLLPMRKAFKG  307



>ref|XP_006478213.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Citrus sinensis]
Length=355

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 189/222 (85%), Gaps = 7/222 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV  V AKGGIFFCQ+ H GR+SN DFQPNG+APIS +DKPL  + 
Sbjct  61   PGIWTKEQVEAWKPIVAEVQAKGGIFFCQLLHAGRISNRDFQPNGKAPISCSDKPLKNKP  120

Query  179  ----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
                N A+FTPPRRLR  EIPQ++NDFR+AARNAI+AGFDGVEIHGA+G+LIDQFLKD V
Sbjct  121  NGGFNAAEFTPPRRLRTGEIPQIVNDFRIAARNAIEAGFDGVEIHGANGYLIDQFLKDQV  180

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTD+YGG L NRCRFALE+VE V +EIG +++G+RLSPF+DYL+CGDSNP ALG++MA
Sbjct  181  NDRTDQYGGSLENRCRFALELVEAVTNEIGADKIGLRLSPFADYLDCGDSNPEALGLYMA  240

Query  527  ESLNKYGVLYCHMIEPRM-KKLWEKSDGPQ-SLLPMRKAFNG  646
             +LNKY +LYCH+IEPRM K   EK DGP  ++LPMRKAF+G
Sbjct  241  RALNKYNILYCHVIEPRMIKAQQEKCDGPDGTVLPMRKAFSG  282



>gb|ACF83071.1| unknown [Zea mays]
 tpg|DAA37650.1| TPA: 12-oxo-phytodienoic acid reductase [Zea mays]
Length=391

 Score =   339 bits (869),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 182/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT EQ+EAWKPIVD VH KGGIFFCQI HVGRVSN+ FQPNGQAPISSTDKPL PQ 
Sbjct  77   PGIWTHEQVEAWKPIVDGVHQKGGIFFCQIWHVGRVSNSTFQPNGQAPISSTDKPLKPQV  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F  PRRL  DEIP V+NDFR+AARNAI+AGFDGVEIHGAHG+LIDQFLKDG
Sbjct  137  RANGIDVATFAVPRRLETDEIPLVVNDFRVAARNAIEAGFDGVEIHGAHGYLIDQFLKDG  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEV + V DEIG ++VGIRLSPF+ Y E  DS+P ALG++M
Sbjct  197  VNDRTDKYGGSLENRCRFALEVTQAVVDEIGADKVGIRLSPFASYSEAPDSDPEALGMYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LN++G+LYCHM+EPRM KL EK + P SL P+R AF G
Sbjct  257  ANALNEFGILYCHMVEPRMVKLGEKFETPYSLRPIRDAFRG  297



>ref|XP_010912703.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Elaeis 
guineensis]
Length=365

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/219 (71%), Positives = 184/219 (84%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTD---KPLT  172
            PGIWTKEQ+EAWKPIVDAVHAKGG+FFCQI HVGR SN  +QPNGQAPISSTD   KP+T
Sbjct  72   PGIWTKEQVEAWKPIVDAVHAKGGMFFCQIWHVGRTSNYGYQPNGQAPISSTDRGIKPVT  131

Query  173  PQNQA--QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
              +    +++PPRRL+ +EIP V+NDFRLAARNAI+AGFDGVEIHGAHG+LI+QF+KD V
Sbjct  132  LHDGTIEEYSPPRRLKTEEIPHVVNDFRLAARNAIEAGFDGVEIHGAHGYLIEQFMKDSV  191

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTDEYGG L NRCRFALE+VE +  EIG +RVG+RLSPF+DY+EC DSNP ALG++M 
Sbjct  192  NDRTDEYGGSLENRCRFALEIVEAIVKEIGADRVGMRLSPFADYMECWDSNPEALGLYMV  251

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFN  643
            E+LNKYG++YCHM+EPRM  +  +   P  LLPMRKAF 
Sbjct  252  EALNKYGIVYCHMVEPRMSIVDGRRQIPHRLLPMRKAFK  290



>emb|CAN65589.1| hypothetical protein VITISV_036518 [Vitis vinifera]
Length=358

 Score =   337 bits (865),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 183/221 (83%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG IF CQ+ HVGRVS  +FQPNGQAP+SSTDK LTPQ 
Sbjct  64   PGIWTKEQVEAWKPIVDAVHAKGSIFICQLWHVGRVSKREFQPNGQAPLSSTDKALTPQV  123

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FT PRRL  DE+P+V+NDFRLAARNA++ GFDGVEIHGAHG+L+DQF+KD 
Sbjct  124  RSNGFDVAEFTAPRRLTTDEVPRVVNDFRLAARNAMEXGFDGVEIHGAHGYLLDQFMKDQ  183

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG   NRCRF LEVVE V +EIG ++VGIRLSPF  + + GDSNP ALG +M
Sbjct  184  VNDRTDKYGGSQENRCRFPLEVVEAVVNEIGADKVGIRLSPFGHHAQAGDSNPTALGRYM  243

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKYGVLYCHM+EPR++   E  +GP SL+P+RKAFNG
Sbjct  244  VESLNKYGVLYCHMVEPRIRAAGEMYEGPHSLVPLRKAFNG  284



>ref|XP_008352810.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica]
Length=368

 Score =   337 bits (865),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 186/218 (85%), Gaps = 3/218 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKP--LTP  175
            PGIWTKEQ+EAWKPIVDAVHA GG+FFCQI HVGR SN+  QPNGQAPISSTDKP  L  
Sbjct  77   PGIWTKEQVEAWKPIVDAVHAXGGVFFCQIWHVGRXSNSGXQPNGQAPISSTDKPIRLNG  136

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             + ++FTPPRRLR DEIPQ++NDFRLAARN+I+AGFDGVEIHGAHG+L+DQFLKD VNDR
Sbjct  137  IDASEFTPPRRLRTDEIPQIVNDFRLAARNSIEAGFDGVEIHGAHGYLLDQFLKDHVNDR  196

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L NRCR  LEVVE V +EIG + VGIRL PF+D+++ GDSNP  LG++MA +L
Sbjct  197  TDQYGGSLENRCRLPLEVVEAVVNEIGADXVGIRLGPFADFMDAGDSNPKELGLYMANAL  256

Query  536  NKYGVLYCH-MIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NKYG++YCH M+EPRMK + E ++  QSLLPMRKAF+G
Sbjct  257  NKYGIVYCHMMVEPRMKAVGEIAETHQSLLPMRKAFHG  294



>dbj|BAJ96259.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AGG17917.1| 12-oxophytodienoic acid reductase 2 [Hordeum vulgare subsp. vulgare]
Length=366

 Score =   337 bits (864),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 182/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+ VHAKGGIFFCQI HVGRVSN  FQPNGQAPISSTDKPL P  
Sbjct  72   PGIWTKEQVEAWKPIVNGVHAKGGIFFCQIWHVGRVSNHTFQPNGQAPISSTDKPLKPVV  131

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A  + PRRL+ +EIP VINDFR+AARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  132  RANGIDVATISTPRRLQTNEIPLVINDFRVAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  191

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVV+ V DE+G ++VGIRLSPF+ Y E  DSNP ALG++M
Sbjct  192  VNDRTDKYGGSLENRCRFALEVVQAVVDEVGADKVGIRLSPFASYSEASDSNPEALGLYM  251

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNK+G+LYCHM+EPRM  + EK + P SL P+R AF G
Sbjct  252  AHALNKFGILYCHMVEPRMVNIGEKFETPHSLRPIRDAFKG  292



>gb|KFK43236.1| hypothetical protein AALP_AA1G097600 [Arabis alpina]
Length=369

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW KEQIEAWKPI D VH++GG+FFCQ+ H GRVS+ D QPNG+APISSTDKPL   +
Sbjct  81   PGIWRKEQIEAWKPITDGVHSRGGVFFCQLWHAGRVSHRDCQPNGEAPISSTDKPLAEDS  140

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
              ++TPPRRLR +EIP V+NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD VNDRTD
Sbjct  141  SNEYTPPRRLRIEEIPNVVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDMVNDRTD  200

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
             YGG L NRCRFALEVVE VA+EIG +RVGIRLSPF+ Y+E GDSNP  LG++MA+SLN+
Sbjct  201  SYGGSLENRCRFALEVVEAVANEIGSDRVGIRLSPFASYMESGDSNPEKLGLYMAKSLNR  260

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            + +LYCHM+E RMK   E  +  +SL PMRKAF G
Sbjct  261  FEILYCHMVELRMKTASEIFECSESLTPMRKAFQG  295



>ref|NP_172411.1| putative 12-oxophytodienoate reductase-like protein 1 [Arabidopsis 
thaliana]
 sp|Q8GYA3.2|OPRL1_ARATH RecName: Full=Putative 12-oxophytodienoate reductase-like protein 
1 [Arabidopsis thaliana]
 gb|AAC33200.1| Similar to 12-oxophytodienoate reductase, gi|2765083 and old-yellow-enzyme 
homolog, gi|2232254 [Arabidopsis thaliana]
 gb|AEE28437.1| putative 12-oxophytodienoate reductase-like protein 1 [Arabidopsis 
thaliana]
Length=324

 Score =   335 bits (858),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW KEQIEAWKPIVDAVH+ GGIFFCQ+ H GRVS+ D QPNG++P+SSTDKP     
Sbjct  61   PGIWRKEQIEAWKPIVDAVHSHGGIFFCQLWHAGRVSHQDCQPNGESPVSSTDKPFADDP  120

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
              +FTPPRRLR DEIP +INDFRLAARNA +AGFDGVEIHGAHG+LIDQF+KD VNDRTD
Sbjct  121  SNEFTPPRRLRTDEIPTIINDFRLAARNATEAGFDGVEIHGAHGYLIDQFMKDSVNDRTD  180

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
             YGG L NRCRFAL+V+E V+ EIG +RVGIRLSPF+DY+E GD++P  LG++MA+SLN+
Sbjct  181  SYGGSLENRCRFALQVIEAVSKEIGPDRVGIRLSPFADYMESGDTDPKRLGLYMAKSLNR  240

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            + +LYCHMIEPRMK + E  +  +SL PMR AFNG
Sbjct  241  FEILYCHMIEPRMKTVSEIFECRESLTPMRNAFNG  275



>ref|XP_003610878.1| 12-oxophytodienoate reductase [Medicago truncatula]
 gb|AES93836.1| 12-oxophytodienoate reductase-like protein [Medicago truncatula]
Length=371

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 183/221 (83%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW K+Q+E WKPI+DAVHAK GIFFCQI H GR SN+ +QPNGQAPISST+  L PQ 
Sbjct  80   PGIWRKDQVETWKPIIDAVHAKEGIFFCQIWHGGRASNSGYQPNGQAPISSTNMSLKPQT  139

Query  182  Q------AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +      A+FTPPRRLR  EIP+++NDFRLAARNAI AGFDGVEIHGAHG+L++QF+KD 
Sbjct  140  RSNGIDIAKFTPPRRLRTCEIPRIVNDFRLAARNAIAAGFDGVEIHGAHGYLLEQFMKDK  199

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+VE V +EIG ERVGIRLSPF++Y ECGDSNP  LG++M
Sbjct  200  VNDRTDKYGGTLENRCRFALEIVEAVVNEIGAERVGIRLSPFAEYGECGDSNPEELGLYM  259

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              +L+KY +LYCHM+EPRMK + EK +   SL+PMRKAFNG
Sbjct  260  VNALSKYNILYCHMVEPRMKTITEKVECLHSLVPMRKAFNG  300



>ref|XP_010685532.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Beta vulgaris 
subsp. vulgaris]
Length=375

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 181/217 (83%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTP--  175
            PGIWTK+Q+EAWKPIVDAVHAKGGIFFCQ+ HVGRVSN  FQPNGQAPIS TDKP+    
Sbjct  81   PGIWTKQQVEAWKPIVDAVHAKGGIFFCQLWHVGRVSNNAFQPNGQAPISCTDKPVPEVW  140

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             +   ++ PR LR DEIP V+N+FRLAARNAI+AGFDGVEIHGAHG++IDQF+KD VNDR
Sbjct  141  SSGESYSIPRPLRTDEIPFVVNEFRLAARNAIEAGFDGVEIHGAHGYIIDQFMKDQVNDR  200

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TDEYGG L NRCRFALEVVE VA EIG  RVG R+SPF++Y+E  DSNP AL ++MAESL
Sbjct  201  TDEYGGSLENRCRFALEVVEAVAKEIGAGRVGFRISPFANYMESADSNPEALSLYMAESL  260

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            +K+G+LYCH IEPRM    EK + P SLLPMRKAFNG
Sbjct  261  SKHGILYCHAIEPRMITATEKFESPHSLLPMRKAFNG  297



>gb|ABK28390.1| unknown [Arabidopsis thaliana]
Length=325

 Score =   335 bits (858),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW KEQIEAWKPIVDAVH+ GGIFFCQ+ H GRVS+ D QPNG++P+SSTDKP     
Sbjct  61   PGIWRKEQIEAWKPIVDAVHSHGGIFFCQLWHAGRVSHQDCQPNGESPVSSTDKPFADDP  120

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
              +FTPPRRLR DEIP +INDFRLAARNA +AGFDGVEIHGAHG+LIDQF+KD VNDRTD
Sbjct  121  SNEFTPPRRLRTDEIPTIINDFRLAARNATEAGFDGVEIHGAHGYLIDQFMKDSVNDRTD  180

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
             YGG L NRCRFAL+V+E V+ EIG +RVGIRLSPF+DY+E GD++P  LG++MA+SLN+
Sbjct  181  SYGGSLENRCRFALQVIEAVSKEIGPDRVGIRLSPFADYMESGDTDPKRLGLYMAKSLNR  240

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            + +LYCHMIEPRMK + E  +  +SL PMR AFNG
Sbjct  241  FEILYCHMIEPRMKTVSEIFECRESLTPMRNAFNG  275



>emb|CDP10751.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 185/221 (84%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN  +QPNGQAPISSTDK LTPQ 
Sbjct  87   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNYSYQPNGQAPISSTDKLLTPQL  146

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+F PPRRLR +EIP+++NDF+LAA NAI+AGFDGVEIHGAHG+LI+QFLKD 
Sbjct  147  RANGVDVAEFAPPRRLRTEEIPEIVNDFKLAAINAIEAGFDGVEIHGAHGYLIEQFLKDQ  206

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRFALE+VE V++ IG +RVGIRLSPF+ Y + GDSNPN LG++M
Sbjct  207  VNDRTDEYGGSLENRCRFALEIVEAVSNAIGADRVGIRLSPFASYSQAGDSNPNVLGLYM  266

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+ YCHM+EPRMK + EKS+ P + LP R   N 
Sbjct  267  AAALNKYGLAYCHMVEPRMKTVGEKSETPDN-LPKRFELNA  306


 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 6/100 (6%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+E WKPIVDAVHAKG IFFCQI H GR+SN  +QPNGQ+PISSTDK LT + 
Sbjct  358  PGIWTKEQVETWKPIVDAVHAKGCIFFCQIWHAGRISNYSYQPNGQSPISSTDKQLTFKV  417

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGF  283
            Q       ++ PPRRLR +EIP ++N+FR+AA NAI+AG 
Sbjct  418  QKNGVDDYKYPPPRRLRTEEIPAIVNEFRVAAINAIEAGM  457



>ref|XP_010535041.1| PREDICTED: 12-oxophytodienoate reductase 2-like isoform X1 [Tarenaya 
hassleriana]
Length=363

 Score =   335 bits (860),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 186/217 (86%), Gaps = 5/217 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT+EQ+EAWKPIVDAVHAKGG FFCQI H GRVSN  FQPNGQ PISSTDKPLTP  
Sbjct  79   PGIWTREQVEAWKPIVDAVHAKGGFFFCQIWHCGRVSNRGFQPNGQDPISSTDKPLTPGI  138

Query  179  NQAQFTPPRRLRADEIPQVINDFRLAARNAIQA-GFDGVEIHGAHGFLIDQFLKDGVNDR  355
            ++A+FTPPRRLR +EIP +++DFRLAARNAI+A GFDGVEIHGAHG+LIDQF+KD VNDR
Sbjct  139  DEARFTPPRRLRTEEIPAIVDDFRLAARNAIEAAGFDGVEIHGAHGYLIDQFMKDEVNDR  198

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L  RCRFALE+VE VA+EIG +RVGIRLSPF+DY+E GDSNP ALG+ MAESL
Sbjct  199  TDKYGGSLEKRCRFALEIVEAVANEIGPDRVGIRLSPFADYMESGDSNPEALGLHMAESL  258

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            N+YG+LYCHM+EPRM  + E    P++L   RKAF G
Sbjct  259  NQYGILYCHMVEPRMTAVGEMEQCPRTL---RKAFKG  292



>ref|XP_002892503.1| hypothetical protein ARALYDRAFT_888182 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68762.1| hypothetical protein ARALYDRAFT_888182 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   335 bits (859),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 181/215 (84%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW KEQI+AWKPIVDAVH+ GG+FFCQ+ H GRVS+ D QPNG+AP+SSTDKP     
Sbjct  61   PGIWRKEQIQAWKPIVDAVHSHGGVFFCQLWHAGRVSHRDCQPNGEAPVSSTDKPFVEDP  120

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
              +FTPPRRLR DEIP ++NDFRLAARNAI+AGFDGVE+HGAHG+L+DQF+KD VNDRTD
Sbjct  121  SNEFTPPRRLRTDEIPTIVNDFRLAARNAIEAGFDGVELHGAHGYLLDQFMKDSVNDRTD  180

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
             YGG L NRCRFAL+V+E V++EIG +RVGIRLSPF++Y+E GDS+P  LG++MA SLN+
Sbjct  181  RYGGSLENRCRFALQVIEAVSNEIGPDRVGIRLSPFANYMESGDSDPKRLGLYMANSLNR  240

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            + +LYCHM+EPRMK   E  +  +SL PMRKAFNG
Sbjct  241  FEILYCHMVEPRMKTASEIFECTESLTPMRKAFNG  275



>ref|XP_008786403.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Phoenix dactylifera]
Length=382

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT EQ+EAWKPIV+AVH KGGIFF QIGH+GR+SN  FQPNGQAPISSTDKPLTPQ 
Sbjct  93   PGIWTGEQVEAWKPIVNAVHEKGGIFFLQIGHMGRISNYGFQPNGQAPISSTDKPLTPQT  152

Query  182  -QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
             +  F+PPRRLR DEIP ++NDFR+AARNAI+AGFDGVEIH A G L++QF+KDG+NDRT
Sbjct  153  PEDDFSPPRRLRTDEIPLIVNDFRVAARNAIEAGFDGVEIHAAFGHLLEQFMKDGINDRT  212

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            DEYGG L+NRCRFALEVVE V DEIG  RVG+RLSPF D++E GDS+P  L ++MAESLN
Sbjct  213  DEYGGSLQNRCRFALEVVEAVVDEIGASRVGMRLSPFGDFMESGDSDPEGLALYMAESLN  272

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            K+G+LYCH+IEP M+ +  K   P   LPMRKAFNG
Sbjct  273  KFGILYCHVIEPNMEVVDGKQQIPHLHLPMRKAFNG  308



>ref|XP_009362373.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Pyrus x 
bretschneideri]
Length=376

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 189/225 (84%), Gaps = 10/225 (4%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKP--LTP  175
            PGIWTKEQ+EAWKPIVDAVHAKGG+FFCQI HVGRVSN+ +QPNGQAPISSTDKP  L  
Sbjct  78   PGIWTKEQVEAWKPIVDAVHAKGGVFFCQIWHVGRVSNSGYQPNGQAPISSTDKPIRLNG  137

Query  176  QNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
             + ++FTPPRRLR DEIPQ++NDFRLAARNAI+AGFDGVEIHGAHG+L+DQFLKD VNDR
Sbjct  138  IDASEFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGVEIHGAHGYLLDQFLKDHVNDR  197

Query  356  TDEYGGCL-------RNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALG  514
            TD+YGG L       R  CR  LEVVE VA+EIG ++VGIRL PF+DY++ GDSNP  LG
Sbjct  198  TDQYGGSLGADKVGIRLCCRLPLEVVEAVANEIGADKVGIRLCPFADYMDSGDSNPKELG  257

Query  515  VFMAESLNKYGVLYCH-MIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            ++MA +LNKYG++YCH M+EPRM  + E ++  QSLLPMRKAF+G
Sbjct  258  LYMANALNKYGIMYCHLMVEPRMSTVGEIAETRQSLLPMRKAFHG  302



>gb|AFK46523.1| unknown [Lotus japonicus]
Length=368

 Score =   335 bits (859),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 181/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG  FFCQI HVGR S++ +QPNGQAP+SSTDKPLTP  
Sbjct  77   PGIWTKEQVEAWKPIVDAVHAKGATFFCQIWHVGRASSSVYQPNGQAPVSSTDKPLTPTI  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A FT PRRLR DEIPQ++NDF+LAARNAI+AGFDG+EIHGAHG+L++QF+KD 
Sbjct  137  RANGVDVADFTQPRRLRTDEIPQIVNDFKLAARNAIEAGFDGIEIHGAHGYLLEQFMKDK  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L NRCRF L +VE VA+EIG ERVGIRLSPF ++ EC DSNP  L ++M
Sbjct  197  VNDRTDEYGGSLENRCRFLLGIVEAVANEIGAERVGIRLSPFGEHGECVDSNPKELALYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              +LNKY VLYCHM+EPR+K   E+ +   SL+PMRKAF G
Sbjct  257  VNALNKYSVLYCHMVEPRIKNNVEQVESSHSLVPMRKAFKG  297



>ref|XP_006376139.1| hypothetical protein POPTR_0013s10150g [Populus trichocarpa]
 gb|ERP53936.1| hypothetical protein POPTR_0013s10150g [Populus trichocarpa]
Length=358

 Score =   335 bits (858),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 184/215 (86%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIVDAVHAKGGIFFCQI HVGRVS + FQP+GQAP+SSTDKPL+ Q 
Sbjct  69   PGIWTREQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSKSVFQPDGQAPVSSTDKPLSSQR  128

Query  182  Q-AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            +  +FTPPRRLR DEIPQ++NDFR+AARNAI+AGFDGVEIHGAHG+L DQF+KD VN+RT
Sbjct  129  EGTEFTPPRRLRTDEIPQIVNDFRIAARNAIEAGFDGVEIHGAHGYLSDQFMKDQVNNRT  188

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D+YGG L NRCRF LE+VE +A+EIG ++VGIRLSP  +++E  DS+P ALG+ M +SLN
Sbjct  189  DQYGGSLENRCRFPLEIVEAIANEIGSDKVGIRLSPHVNFMESEDSDPEALGLHMVKSLN  248

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFN  643
            KYG+ YCHM+EPRMK     +   +SLLPMRKAFN
Sbjct  249  KYGIAYCHMVEPRMKIGAGNTKFSESLLPMRKAFN  283



>ref|XP_003579839.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Brachypodium 
distachyon]
 ref|XP_010239955.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Brachypodium 
distachyon]
Length=369

 Score =   335 bits (859),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 182/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVD VHAKGGIFFCQI HVGRVSN +FQPNGQAPISST+KPL P  
Sbjct  75   PGIWTKEQVEAWKPIVDGVHAKGGIFFCQIWHVGRVSNHNFQPNGQAPISSTNKPLKPVV  134

Query  182  QAQ------FTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A        + PRRL  DEIP VI+DFR+AARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  135  RANGIVVATISTPRRLETDEIPLVIDDFRIAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  194

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVV+ V DEIG ++VGIRLSPF+ Y +  DSNP ALG++M
Sbjct  195  VNDRTDKYGGSLENRCRFALEVVQAVVDEIGADKVGIRLSPFASYSDASDSNPEALGLYM  254

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LN++G+LYCHM+EPRM  + EK + P SL P+R AF G
Sbjct  255  AHALNEFGILYCHMVEPRMVNIGEKFETPHSLRPIRNAFKG  295



>gb|AGG17918.1| 12-oxophytodienoic acid reductase 2 [Hordeum vulgare subsp. vulgare]
Length=366

 Score =   334 bits (857),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 181/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+ VHAKGGIFFCQI HVGRV N  FQPNGQAPISSTDKPL P  
Sbjct  72   PGIWTKEQVEAWKPIVNGVHAKGGIFFCQIWHVGRVFNHTFQPNGQAPISSTDKPLKPVV  131

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A  + PRRL+ +EIP VINDFR+AARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  132  RANGIDVATISTPRRLQTNEIPLVINDFRVAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  191

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVV+ V DE+G ++VGIRLSPF+ Y E  DSNP ALG++M
Sbjct  192  VNDRTDKYGGSLENRCRFALEVVQAVVDEVGADKVGIRLSPFASYSEASDSNPEALGLYM  251

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNK+G+LYCHM+EPRM  + EK + P SL P+R AF G
Sbjct  252  AHALNKFGILYCHMVEPRMVNIGEKFETPHSLRPIRDAFKG  292



>gb|EMS65404.1| 12-oxophytodienoate reductase 1 [Triticum urartu]
Length=366

 Score =   334 bits (857),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 181/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIV+ VH KGGIFFCQI HVGRVSN  FQPNGQAPISSTDKPL P  
Sbjct  72   PGIWTKEQVEAWKPIVNGVHTKGGIFFCQIWHVGRVSNHTFQPNGQAPISSTDKPLKPVV  131

Query  182  QAQ------FTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A        + PRRL+ +EIP VINDFR AARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  132  RANGIDVPTISTPRRLQTNEIPLVINDFRAAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  191

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVV+ V DE+G ++VGIRLSPF++Y E  DSNP ALG++M
Sbjct  192  VNDRTDKYGGSLENRCRFALEVVQAVVDEVGADKVGIRLSPFANYSEASDSNPEALGLYM  251

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNK+G+LYCHM+EPRM  + EK + P SL P+R AF G
Sbjct  252  AHALNKFGILYCHMVEPRMVNIGEKFETPHSLRPIRDAFKG  292



>emb|CAN74407.1| hypothetical protein VITISV_033305 [Vitis vinifera]
Length=371

 Score =   334 bits (857),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 182/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG IF CQ+ HVGRVS  +FQPNGQAP+SSTDK LTPQ 
Sbjct  77   PGIWTKEQVEAWKPIVDAVHAKGSIFXCQLWHVGRVSXXEFQPNGQAPLSSTDKALTPQV  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FT PRRL  DE+P+V+NDFRLAARNA++ GFDGVEIHGAHG+L+DQF+KD 
Sbjct  137  RSNGFDVAEFTAPRRLTTDEVPRVVNDFRLAARNAMEXGFDGVEIHGAHGYLLDQFMKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG   NRCRF LEVVE V +EIG ++VGIRLSPF  + + GDSNP ALG +M
Sbjct  197  VNDRTDKYGGSQENRCRFPLEVVEAVVNEIGADKVGIRLSPFGHHAQAGDSNPTALGRYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKYGVLYCHM+EPR++   E  +GP SL+P+RK FNG
Sbjct  257  VESLNKYGVLYCHMVEPRIRAAGEMYEGPHSLVPLRKDFNG  297



>gb|EYU22758.1| hypothetical protein MIMGU_mgv1a008135mg [Erythranthe guttata]
Length=383

 Score =   335 bits (858),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 184/224 (82%), Gaps = 9/224 (4%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNT FQPNGQAP+S TDK + PQ 
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTGFQPNGQAPLSCTDKGIAPQV  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + AQF+PPRRL  D+IP ++NDF+LAARNAI+AGFDGVEIHGAHG+LIDQF KD 
Sbjct  142  RANGVDVAQFSPPRRLETDKIPLIVNDFKLAARNAIEAGFDGVEIHGAHGYLIDQFFKDQ  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALE+ E V +EIG  RVGIRLSPF+++ EC DSNP ALG++M
Sbjct  202  VNDRTDQYGGSLENRCRFALEITEAVTNEIGAYRVGIRLSPFANFAECADSNPKALGLYM  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQ---SLLPMRKAFNG  646
            AE+LNKY +LYCHM+EPRM    + +   +   SL+PMRKAF G
Sbjct  262  AEALNKYELLYCHMVEPRMTTATKITTKTECLHSLVPMRKAFKG  305



>gb|EMT02700.1| 12-oxophytodienoate reductase 2 [Aegilops tauschii]
Length=399

 Score =   335 bits (859),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 182/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIV+ VHA+GGIFFCQI HVGRVSN  FQPNGQAPISSTDKPL P  
Sbjct  105  PGIWTKEQVEAWKPIVNGVHAEGGIFFCQIWHVGRVSNHTFQPNGQAPISSTDKPLKPVV  164

Query  182  QAQ------FTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A        + PRRL+ +EIP VINDFR AARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  165  RANGIDVPTISTPRRLQTNEIPLVINDFRAAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  224

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVV+ V DE+G ++VGIRLSPF++Y E  DSNP ALG++M
Sbjct  225  VNDRTDKYGGSLENRCRFALEVVQAVVDEVGADKVGIRLSPFANYSEASDSNPEALGLYM  284

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNK+G+LYCHM+EPRM  + EK + P SL P+R AF G
Sbjct  285  AHALNKFGILYCHMVEPRMVNIGEKFETPHSLRPIRDAFKG  325



>ref|XP_009110833.1| PREDICTED: putative 12-oxophytodienoate reductase-like protein 
1 [Brassica rapa]
Length=375

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 181/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPL--TP  175
            PGIW KEQIEAWKPI+DAVH+ G +FFCQ+ H GRVS+ D QPNG+APISSTDKPL  T 
Sbjct  81   PGIWKKEQIEAWKPIIDAVHSNGAVFFCQLWHAGRVSHRDSQPNGEAPISSTDKPLAETS  140

Query  176  QNQ----AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
             N+     +FTPPRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  141  SNEFTTSDEFTPPRRLRTDEIPNIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDT  200

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD YGG L NRCRFALEVVE V +EIG +RVG+RLSPF++Y++ GD+ P  LGV+M
Sbjct  201  VNDRTDAYGGSLENRCRFALEVVEAVTNEIGSDRVGVRLSPFANYMQSGDTEPQKLGVYM  260

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A+SLN++  LYCHM+EPRMK   E  +  +SL PMRKAF G
Sbjct  261  AKSLNRFRTLYCHMVEPRMKTATEAFECTESLTPMRKAFEG  301



>ref|XP_003610762.1| 12-oxophytodienoate reductase [Medicago truncatula]
 gb|AES93720.1| 12-oxophytodienoate reductase-like protein [Medicago truncatula]
Length=365

 Score =   333 bits (854),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 181/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKG  FFCQI HVGRVSN+  QPNGQAPISST+K LTPQ 
Sbjct  74   PGIWTKEHVEAWKPIVDAVHAKGATFFCQIWHVGRVSNSICQPNGQAPISSTNKLLTPQI  133

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                    QFT PRRLR +EIP ++NDFRLAARNAI+AGFDGVEIHGAHG+L++QF+KD 
Sbjct  134  GGDGFQMPQFTQPRRLRTEEIPNIVNDFRLAARNAIEAGFDGVEIHGAHGYLVEQFMKDK  193

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
             NDRTDEYGG L NRCRF LE+VE VA+EIG ERVGI+LSPF  + +CGDSNP  LG++M
Sbjct  194  ANDRTDEYGGTLENRCRFVLEIVEAVANEIGAERVGIKLSPFEKFGDCGDSNPQELGLYM  253

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              +LNKYG+LYCHM+EPRM+ L EK++   SL+ +RK FNG
Sbjct  254  VNALNKYGILYCHMVEPRMEILDEKTECHYSLVSIRKVFNG  294



>ref|XP_006652323.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like [Oryza 
brachyantha]
Length=371

 Score =   333 bits (855),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 178/221 (81%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVD VHAKGGIFFCQI HVGRVSN  FQPNGQAPISST+K + P  
Sbjct  77   PGIWTKEQVEAWKPIVDGVHAKGGIFFCQIWHVGRVSNNTFQPNGQAPISSTNKSMKPAV  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A F+ PR+L  DEIP ++NDFR+AARNAI AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  137  RANGIDVATFSTPRQLETDEIPSIVNDFRVAARNAIDAGFDGVEIHGAHGYLIDQFLKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDR D+YGG L NRCRFALEV + V DEIG ++VGIRLSPF+ Y E  DSNP ALG++M
Sbjct  197  VNDRIDKYGGSLENRCRFALEVAQAVVDEIGADKVGIRLSPFASYSEASDSNPEALGLYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNK G+LYCHM+EPRM KL EK + P SL P+R AF G
Sbjct  257  ANALNKLGILYCHMVEPRMAKLGEKFETPYSLGPIRNAFKG  297



>ref|XP_006416647.1| hypothetical protein EUTSA_v10009775mg, partial [Eutrema salsugineum]
 gb|ESQ35000.1| hypothetical protein EUTSA_v10009775mg, partial [Eutrema salsugineum]
Length=352

 Score =   332 bits (851),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 184/217 (85%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIVDAVH KGGIFFCQI H GRV + D QPNG+APISSTDKPLT  N
Sbjct  60   PGIWTREQVEAWKPIVDAVHLKGGIFFCQIWHGGRVFHLD-QPNGEAPISSTDKPLTCNN  118

Query  182  --QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
                +FTPPRRLR+DEIP ++NDFR+AARNA++AGFDGVE+HGAHG+LIDQFLKD VNDR
Sbjct  119  IYGGKFTPPRRLRSDEIPAIVNDFRVAARNAMEAGFDGVEVHGAHGYLIDQFLKDKVNDR  178

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            +DEYGG L NRCRFA+EV+E V  EIG +RVGIRLSPF+DY+E GDSNP ALG++M +++
Sbjct  179  SDEYGGSLENRCRFAVEVIEAVVKEIGSDRVGIRLSPFADYMESGDSNPEALGLYMVQAM  238

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NK+G+LYCH++EPRMK L    +  +SL PMR AF G
Sbjct  239  NKHGILYCHLVEPRMKTLEGILECTESLTPMRNAFKG  275



>ref|XP_004511462.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Cicer arietinum]
Length=368

 Score =   333 bits (853),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 181/220 (82%), Gaps = 6/220 (3%)
 Frame = +2

Query  5    GIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ--  178
            GIW K+QIE WKPIVDAVHAK GIFF QI H GRVSN+ +QP GQAPISST++ LTPQ  
Sbjct  78   GIWRKDQIETWKPIVDAVHAKHGIFFSQIWHAGRVSNSGYQPFGQAPISSTNRRLTPQIR  137

Query  179  ----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
                + AQF  PRRLR DEIP +INDFRLAARNAI AGFDGVEIHGAHG+LI+QF+KD V
Sbjct  138  SNGIDIAQFASPRRLRTDEIPLIINDFRLAARNAILAGFDGVEIHGAHGYLIEQFIKDKV  197

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTD+YGG L NRCRFALE+VE V +EIG ERVGIRLSPF++Y ECGDSNP  LG++M 
Sbjct  198  NDRTDKYGGNLENRCRFALEIVEAVVNEIGAERVGIRLSPFAEYGECGDSNPEELGLYMV  257

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             +LNKYG+LYCH++EPRMK + EK +  Q L+PMRKAF G
Sbjct  258  NALNKYGILYCHVVEPRMKTISEKVESFQCLMPMRKAFKG  297



>dbj|BAJ34294.1| unnamed protein product [Thellungiella halophila]
Length=367

 Score =   332 bits (852),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 184/217 (85%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIVDAVH KGGIFFCQI H GRV + D QPNG+APISSTDKPLT  N
Sbjct  75   PGIWTREQVEAWKPIVDAVHLKGGIFFCQIWHGGRVFHLD-QPNGEAPISSTDKPLTCNN  133

Query  182  --QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
                +FTPPRRLR+DEIP ++NDFR+AARNA++AGFDGVE+HGAHG+LIDQFLKD VNDR
Sbjct  134  IYGGKFTPPRRLRSDEIPAIVNDFRVAARNAMEAGFDGVEVHGAHGYLIDQFLKDKVNDR  193

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            +DEYGG L NRCRFA+EV+E V  EIG +RVGIRLSPF+DY+E GDSNP ALG++M +++
Sbjct  194  SDEYGGSLENRCRFAVEVIEAVVKEIGSDRVGIRLSPFADYMESGDSNPEALGLYMVQAM  253

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NK+G+LYCH++EPRMK L    +  +SL PMR AF G
Sbjct  254  NKHGILYCHLVEPRMKTLEGILECTESLTPMRNAFKG  290



>emb|CDY31095.1| BnaA08g26450D [Brassica napus]
Length=375

 Score =   333 bits (853),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 181/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPL--TP  175
            PGIW KEQIEAWKPI+DAVH+ G +FFCQ+ H GRVS+ D QPNG+APISSTDKPL  T 
Sbjct  81   PGIWKKEQIEAWKPIIDAVHSNGAVFFCQLWHAGRVSHRDSQPNGEAPISSTDKPLAETS  140

Query  176  QNQ----AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
             N+     +FTPPRRLR DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  141  SNEFTTSDEFTPPRRLRTDEIPNIVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDT  200

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD YGG L NRCRFALEVVE V +EIG +RVG+RLSPF++Y++ GD+ P  LGV+M
Sbjct  201  VNDRTDFYGGSLENRCRFALEVVEAVTNEIGSDRVGVRLSPFANYMQSGDTEPQKLGVYM  260

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A+SLN++  LYCHM+EPRMK   E  +  +SL PMRKAF G
Sbjct  261  AKSLNRFRTLYCHMVEPRMKTATEAFECTESLTPMRKAFEG  301



>ref|XP_010930415.1| PREDICTED: putative 12-oxophytodienoate reductase 5 [Elaeis guineensis]
Length=365

 Score =   332 bits (851),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 182/218 (83%), Gaps = 5/218 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGG+FFCQ+ HVGRVSN  FQPNGQAP+SST+K + P  
Sbjct  72   PGIWTKEQVEAWKPIVDAVHAKGGLFFCQLWHVGRVSNYGFQPNGQAPVSSTNKGIAPIT  131

Query  182  Q-----AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
                   +++PPRRLR DEIP +INDFRLAARNAI+AGFDGVEIHGA+G++I+QF+KD V
Sbjct  132  HHDGSVEEYSPPRRLRIDEIPHIINDFRLAARNAIEAGFDGVEIHGANGYIIEQFMKDSV  191

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDR DEYGG L NRCRFALE+VE + +EIG ++VG+RLSPF+DY+EC DSNP ALG++M 
Sbjct  192  NDRIDEYGGSLENRCRFALEIVEAIVNEIGADKVGMRLSPFADYMECWDSNPEALGLYMM  251

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAF  640
            E+LNKYG+LYCH+IEPRM  +  +   P  LL MRKAF
Sbjct  252  EALNKYGILYCHVIEPRMSIVDGRRQIPHRLLLMRKAF  289



>ref|XP_010912704.1| PREDICTED: LOW QUALITY PROTEIN: 12-oxophytodienoate reductase 
1-like [Elaeis guineensis]
Length=365

 Score =   332 bits (850),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 183/219 (84%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTD---KPLT  172
            PGI T EQ+EAWKPIVDAVH KGG+FFCQ+ HVGRVSN  +QPNGQAPISSTD   KP+T
Sbjct  72   PGIXTMEQVEAWKPIVDAVHTKGGVFFCQVWHVGRVSNYGYQPNGQAPISSTDRVVKPVT  131

Query  173  PQNQA--QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
             Q  A  +++PPRRLR +EIP+++NDFRLAARNAI+AGFDGVEIHGAHG+LI+QF+KD V
Sbjct  132  IQEGALEEYSPPRRLRTEEIPRIVNDFRLAARNAIKAGFDGVEIHGAHGYLIEQFMKDSV  191

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            N+RTDEYGG L NRCRFALE+VE + +EIG +RVG+RLSPF+DY+EC DSNP  LG++M 
Sbjct  192  NNRTDEYGGSLENRCRFALEIVEAIVEEIGADRVGMRLSPFADYMECWDSNPETLGLYMV  251

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFN  643
            E+LNKYG+ YCHM+EPRM  +  +   P  LLPMRKAF 
Sbjct  252  EALNKYGIAYCHMVEPRMSIVDGRRQIPHRLLPMRKAFK  290



>ref|XP_010475773.1| PREDICTED: putative 12-oxophytodienoate reductase-like protein 
1 [Camelina sativa]
Length=369

 Score =   332 bits (850),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 182/215 (85%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW K+QI+AWKPIVDAVH+ GGIFFCQ+ H GRVS+ D QPN +AP+SSTDKP     
Sbjct  81   PGIWKKDQIDAWKPIVDAVHSHGGIFFCQLWHAGRVSHRDCQPNREAPVSSTDKPFADDP  140

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
             +++TPPRRL  DEIP ++N+FRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD VNDRTD
Sbjct  141  SSEYTPPRRLTTDEIPTIVNEFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDSVNDRTD  200

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG L NRCRFALEV+E V+DEIG +RVGIRLSPF++Y+E GDS+P  LG++MA+SLN+
Sbjct  201  DYGGSLENRCRFALEVIEAVSDEIGPDRVGIRLSPFANYMESGDSDPQRLGLYMAKSLNR  260

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            + +LYCHM+EPRMK   E  +  +SL PMRKAF+G
Sbjct  261  FEILYCHMVEPRMKTASEIFECTESLTPMRKAFDG  295



>emb|CDP18872.1| unnamed protein product [Coffea canephora]
Length=544

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 184/221 (83%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSN  +QPNGQAPISSTDKPLT Q 
Sbjct  63   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNYSYQPNGQAPISSTDKPLTHQL  122

Query  182  Q------AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            Q      A+F PPRRLR +EIP+++NDF+LAA NAI+AGFDGVEIHGAHG+LI+QFLKD 
Sbjct  123  QPNGVDVAEFAPPRRLRTEEIPRIVNDFKLAAINAIEAGFDGVEIHGAHGYLIEQFLKDQ  182

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD YGG L NRCRFALE+VE V++ IG +RVGIRLSPF+ Y + GDSNPNALG++M
Sbjct  183  VNDRTDAYGGSLENRCRFALEIVEAVSNAIGADRVGIRLSPFASYSQAGDSNPNALGLYM  242

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A +LNKYG+ YCH +EPRMK + EKS+ P + LP R   N 
Sbjct  243  AAALNKYGLAYCHTVEPRMKTVGEKSETPDN-LPKRFELNA  282


 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 86/117 (74%), Gaps = 6/117 (5%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            P IWTKEQ+EAWKPIVDAVHAKGG+FFCQI H G++SN  +QPNGQ+PISSTDK LT + 
Sbjct  428  PDIWTKEQVEAWKPIVDAVHAKGGVFFCQIWHAGQISNYSYQPNGQSPISSTDKQLTFKV  487

Query  182  Q------AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFL  334
            Q       ++ PPRRLRADEIP+++N+FR+ A NAI+AG    + +    F    FL
Sbjct  488  QKNGVDDCKYPPPRRLRADEIPEIVNEFRVVAINAIEAGMAIQKTNRTENFFHFSFL  544



>gb|EMS57216.1| 12-oxophytodienoate reductase 2 [Triticum urartu]
Length=361

 Score =   330 bits (846),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 181/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTK+Q+EAWKPIVD VH KGGIFFCQI HVGRVSN +FQPNGQAPISSTDKP+ P  
Sbjct  67   PGIWTKKQVEAWKPIVDGVHVKGGIFFCQIWHVGRVSNHNFQPNGQAPISSTDKPIKPAT  126

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A      + + PRRL+ DEI  VI DFR+AARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  127  RADGIGLAKISTPRRLQTDEIQLVIEDFRVAARNAIEAGFDGVEIHGAHGYLIDQFLKDQ  186

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVV+ VADEIG ++VGIRLSPF+ Y +  DSNP ALG+++
Sbjct  187  VNDRTDKYGGSLENRCRFALEVVQAVADEIGADKVGIRLSPFASYSDASDSNPEALGLYI  246

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            A++LNK G+LYCHM+EPRM  + EK + P SL  MR AF G
Sbjct  247  AQALNKLGILYCHMVEPRMVNIGEKLETPHSLRAMRDAFKG  287



>gb|KFK43972.1| hypothetical protein AALP_AA1G198200 [Arabis alpina]
Length=367

 Score =   330 bits (845),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 181/217 (83%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIVDAVH+KGGI FCQI H GRV N D QPNG  PISS+DKPL  +N
Sbjct  75   PGIWTREQVEAWKPIVDAVHSKGGIIFCQIWHGGRVFNQD-QPNGVVPISSSDKPLMCKN  133

Query  182  --QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
                QFTPPRRLR DEIP ++NDFR+AARNA++AGFDGVEIHGAHG+LIDQFLKD VNDR
Sbjct  134  IYGGQFTPPRRLRTDEIPAIVNDFRVAARNAMEAGFDGVEIHGAHGYLIDQFLKDKVNDR  193

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            +D+YGG L NRCRFAL++VE V DEIG +RVGIR SPF+DY+E GDSNP ALG+++ ++L
Sbjct  194  SDQYGGSLENRCRFALDIVEAVVDEIGSDRVGIRFSPFADYMESGDSNPEALGLYLVQAL  253

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            N +G+LYCHM+EPRMK L E  +  +SL PMR AF G
Sbjct  254  NTHGILYCHMVEPRMKTLGEIFECTESLTPMRNAFKG  290



>ref|XP_006858593.1| hypothetical protein AMTR_s00071p00196220 [Amborella trichopoda]
 gb|ERN20060.1| hypothetical protein AMTR_s00071p00196220 [Amborella trichopoda]
Length=353

 Score =   329 bits (844),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 182/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVH KGG+FFCQI HVGRVSN  +QPNGQAPISST+K L PQ 
Sbjct  61   PGIWTKEQVEAWKPIVDAVHEKGGVFFCQIWHVGRVSNYGYQPNGQAPISSTNKQLKPQL  120

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A      +++PP+ L  +EIP V+NDFRLAARNAI AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  121  RANQIDVVEYSPPQALATEEIPNVVNDFRLAARNAIDAGFDGVEIHGAHGYLLDQFMKDS  180

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRF L++VE V  EIG +RVGIR+SPF+ Y + GDSNP ALG+++
Sbjct  181  VNDRTDQYGGSLENRCRFTLDIVEAVVKEIGADRVGIRVSPFASYGDAGDSNPEALGLYL  240

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNK+ +LY H +EPRM  + EK++ P SLLPMRKAF G
Sbjct  241  AEALNKHNILYGHFVEPRMITVGEKAETPHSLLPMRKAFKG  281



>ref|NP_974157.1| 12-oxophytodienoate reductase 1 [Arabidopsis thaliana]
 gb|AEE35874.1| 12-oxophytodienoate reductase 1 [Arabidopsis thaliana]
Length=397

 Score =   330 bits (847),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/246 (65%), Positives = 189/246 (77%), Gaps = 31/246 (13%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKE +EAWKPIVDAVHAKGGIFFCQI HVGRVSN+ FQPNG+APIS +DKPL PQ 
Sbjct  78   PGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQI  137

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAG---------------------  280
                 ++A FTPPRRL  +EIP ++NDFRLAARNA++AG                     
Sbjct  138  RSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGKHILDLEFKKLKPFKILICVL  197

Query  281  ----FDGVEIHGAHGFLIDQFLKDGVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERV  448
                FDGVEIHGA+G+LIDQF+KD VNDRTDEYGG L+NRC+F LE+V+ VA EIG +RV
Sbjct  198  VVAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRV  257

Query  449  GIRLSPFSDYLECGDSNPNALGVFMAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPM  628
            GIRLSPF+DY+E GD+NP ALG++MAESLNKYG+LYCH+IE RMK + E    P +L+PM
Sbjct  258  GIRLSPFADYMESGDTNPGALGLYMAESLNKYGILYCHVIEARMKTMGEVHACPHTLMPM  317

Query  629  RKAFNG  646
            RKAF G
Sbjct  318  RKAFKG  323



>emb|CDY21723.1| BnaA09g44740D [Brassica napus]
Length=363

 Score =   329 bits (843),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 180/217 (83%), Gaps = 9/217 (4%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIVDAVHAKGGIFFCQI H GR       PNG+AP+SSTDKPLT  N
Sbjct  75   PGIWTREQVEAWKPIVDAVHAKGGIFFCQIWHGGR-------PNGEAPVSSTDKPLTCNN  127

Query  182  --QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
                QFTPPRRLR +EIP ++NDFR+AARNA++AGFDGVE+HGAHG+LIDQFLKD VNDR
Sbjct  128  IYGGQFTPPRRLRTEEIPAIVNDFRVAARNAMEAGFDGVEVHGAHGYLIDQFLKDKVNDR  187

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L NRCRFA+EV+E V  EIG +RVGIRLSPF+DY+E GDSNP ALG++M + +
Sbjct  188  TDQYGGSLENRCRFAVEVIEAVVKEIGSDRVGIRLSPFADYMESGDSNPEALGLYMVQEM  247

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NK+G+LYCHM+EPRMK L E  +  +SL PMR AF G
Sbjct  248  NKHGILYCHMVEPRMKLLEEMFECTESLTPMRNAFKG  284



>ref|XP_006367688.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Solanum tuberosum]
Length=376

 Score =   329 bits (844),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 182/221 (82%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPI++ VHAKGGIFF QI H GRVS+ DFQPNGQ PIS TDK L PQ 
Sbjct  82   PGIWTKEQVEAWKPIINEVHAKGGIFFSQIWHAGRVSSKDFQPNGQDPISCTDKLLAPQI  141

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A FTPPRRL  DEIPQ++N+FRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD 
Sbjct  142  LSNGIDVAHFTPPRRLTTDEIPQIVNEFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDQ  201

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            +NDR D+YGG L NRCRFALE+VE VA+EIG  RVGIR+SPF++Y E GD+NP+ALG++M
Sbjct  202  INDRNDKYGGSLENRCRFALEIVEAVANEIGSNRVGIRISPFANYNESGDTNPSALGLYM  261

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             ESLNKY + YCH++EPRMK   EK +  +SL+ +RKA+ G
Sbjct  262  VESLNKYDIAYCHVVEPRMKTACEKIECGESLVHLRKAYKG  302



>ref|XP_010458225.1| PREDICTED: putative 12-oxophytodienoate reductase-like protein 
1 isoform X2 [Camelina sativa]
Length=295

 Score =   326 bits (836),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW KEQIEAWKPIVDAVH+ GG+FFCQ+ H GRVS+ D QPN +AP+SSTDKP     
Sbjct  7    PGIWRKEQIEAWKPIVDAVHSHGGVFFCQLWHAGRVSHRDCQPNREAPVSSTDKPFANDP  66

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
             +++TPPRRL  DEIP ++N+FRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD VNDR D
Sbjct  67   SSEYTPPRRLTTDEIPTIVNEFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDSVNDRVD  126

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG L NRCRFALEV+E V++EIG +RVGIRLSPF++Y+E GDS+P  LG++MA+SLN+
Sbjct  127  DYGGSLENRCRFALEVIEAVSNEIGPDRVGIRLSPFANYMESGDSDPQRLGLYMAKSLNR  186

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            + +LYCHM+EPRMK   E  +  +SL PMRK F+G
Sbjct  187  FEILYCHMVEPRMKTASEIFECTESLTPMRKVFDG  221



>ref|XP_006400225.1| hypothetical protein EUTSA_v10013817mg [Eutrema salsugineum]
 gb|ESQ41678.1| hypothetical protein EUTSA_v10013817mg [Eutrema salsugineum]
Length=381

 Score =   329 bits (843),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 186/228 (82%), Gaps = 15/228 (7%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSN------------TDFQPNGQAP  145
            PGIWTKE +EAWKPIVDAVHAKGGI FCQI HVGRVSN              FQPNGQAP
Sbjct  80   PGIWTKEHVEAWKPIVDAVHAKGGIIFCQIWHVGRVSNRGLSNSNLSIFSNGFQPNGQAP  139

Query  146  ISSTDKPLTPQNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLID  325
            IS TDKPL   ++A FTPPRRL  +EIP +++ FRLAARNA++AGFDGVEIHGA+G+LID
Sbjct  140  ISCTDKPLI--DEAMFTPPRRLSTEEIPTIVDHFRLAARNAMEAGFDGVEIHGANGYLID  197

Query  326  QFLKDGVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPN  505
            QF+KD VNDRTDEYGG L+NRC+FAL++VE V+ EIG +RVGIRLSPF+DY+E GD+NP 
Sbjct  198  QFMKDTVNDRTDEYGGSLQNRCKFALDIVEAVSKEIGPDRVGIRLSPFADYMESGDTNPQ  257

Query  506  ALGVFMAESLNKYGVLYCHMIEPRMKKLWEKSD-GPQSLLPMRKAFNG  646
            AL V MAESLNKYG+LYCH++E RMK + E S+  P +L+PMRKAF+G
Sbjct  258  ALAVHMAESLNKYGILYCHVVEARMKTMGEISECPPHTLMPMRKAFSG  305



>ref|XP_010930422.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Elaeis 
guineensis]
Length=359

 Score =   328 bits (840),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 182/221 (82%), Gaps = 10/221 (5%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAW+PIVDAVH KGGIFFCQI HVGRVSN  FQPNGQAPIS TDKP+  + 
Sbjct  72   PGIWTKEQVEAWRPIVDAVHKKGGIFFCQIWHVGRVSNYTFQPNGQAPISCTDKPIVSKV  131

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +A      +F+PPRRL  +EIP ++NDFR+AA+NAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  132  RANGVDVPRFSPPRRLATEEIPLIVNDFRIAAKNAIEAGFDGVEIHGAHGYLIDQFLKDQ  191

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            +NDRTD+YGG + NRCRFALE+V+ V DEIG +RVGIRLSP++     GDS+P+ALG++M
Sbjct  192  INDRTDQYGGSMENRCRFALEIVQAVVDEIGADRVGIRLSPYT----AGDSDPDALGLYM  247

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              SLNK+G+ YCHM+EP M K  EK + P SLLPMRKAF G
Sbjct  248  VNSLNKFGISYCHMVEPSMAKEGEKVETPHSLLPMRKAFKG  288



>ref|NP_001242398.1| uncharacterized protein LOC100816003 [Glycine max]
 gb|ACU19928.1| unknown [Glycine max]
Length=361

 Score =   328 bits (840),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 175/214 (82%), Gaps = 4/214 (2%)
 Frame = +2

Query  5    GIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQNQ  184
            GIW+KEQIEAWKPIVDAVHAKGGIFFCQI H GRVS+ DF+PN Q  ISST+KPLT    
Sbjct  78   GIWSKEQIEAWKPIVDAVHAKGGIFFCQILHTGRVSDPDFKPNRQTLISSTNKPLTHNG-  136

Query  185  AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTDE  364
                 PR LR DEIP ++NDFRLAARNAI+AGFDGVEIHGAHGFLIDQFLKD VNDRTD+
Sbjct  137  ---IEPRALRTDEIPHIVNDFRLAARNAIEAGFDGVEIHGAHGFLIDQFLKDQVNDRTDK  193

Query  365  YGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNKY  544
            YGG   NRCRFAL VVE V +EIG +RVGIRLSPFSDY EC DSNP ALG++MA+SLNK+
Sbjct  194  YGGSTENRCRFALGVVEAVVEEIGADRVGIRLSPFSDYNECNDSNPQALGLYMAKSLNKH  253

Query  545  GVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            GVLYCHM+EPR     E  + P +L PM+KAFNG
Sbjct  254  GVLYCHMVEPRWDISGENKETPHTLAPMKKAFNG  287



>ref|XP_010030202.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Eucalyptus 
grandis]
 gb|KCW57150.1| hypothetical protein EUGRSUZ_I02783 [Eucalyptus grandis]
Length=365

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTP-Q  178
            PGIWT+EQ+EAWKPIVDAVH KGG+FFCQI HVGRVS+  +QPNG+AP+SSTDK +TP  
Sbjct  76   PGIWTREQVEAWKPIVDAVHEKGGVFFCQIWHVGRVSSYSYQPNGEAPMSSTDKGVTPGL  135

Query  179  NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            +   ++PP RLR DEIP ++NDFRLAARNAI+AGFDGVE+HGAHG+LIDQF+KD VNDRT
Sbjct  136  DGGDWSPPHRLRVDEIPHIVNDFRLAARNAIEAGFDGVEVHGAHGYLIDQFMKDQVNDRT  195

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            DEYGG L  RC FALEVVE V +EIG +RVG+RLSPF+DY+E  DS+PNALG++MA +LN
Sbjct  196  DEYGGSLEKRCCFALEVVEAVVNEIGADRVGMRLSPFADYMETADSDPNALGLYMANALN  255

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
             YG++Y H+IEPRM ++ +K + P SL  MRKAF G
Sbjct  256  NYGLVYLHVIEPRMVRMGDKLESPHSLFTMRKAFKG  291



>ref|XP_008781981.1| PREDICTED: putative 12-oxophytodienoate reductase 4 [Phoenix 
dactylifera]
Length=365

 Score =   327 bits (839),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 182/220 (83%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVHAKGG+FFCQ+ HVGR S+  +QPNGQAPISSTD+ + P  
Sbjct  72   PGIWTKEQVEAWKPIVNAVHAKGGLFFCQLWHVGRTSSYAYQPNGQAPISSTDRGIAPVT  131

Query  179  ----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
                +  +F+PPRRLR +EIP+++NDFRLAA NAI+AGFDGVEIHGA+G++I+QF+KD V
Sbjct  132  LHDGSVEEFSPPRRLRTEEIPRIVNDFRLAAMNAIEAGFDGVEIHGANGYIIEQFMKDSV  191

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDR DEYGG L NRCRFALE+ E + +EIG +RVG+RLSPFSDY+EC DSNP ALG++M 
Sbjct  192  NDRNDEYGGSLENRCRFALEIAEAIVEEIGADRVGMRLSPFSDYMECWDSNPEALGLYMV  251

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            E+LNKYG+ YCH+IEPRM  +  +   P  LLPMRKAF G
Sbjct  252  EALNKYGIAYCHLIEPRMAIVDGRRQIPHRLLPMRKAFKG  291



>emb|CDP18869.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   328 bits (842),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/240 (66%), Positives = 187/240 (78%), Gaps = 25/240 (10%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTD--------------------  121
            PGIWTK+Q+EAWKPIV+AVHAKGGIFFCQI H GRVSN                      
Sbjct  86   PGIWTKQQVEAWKPIVEAVHAKGGIFFCQICHTGRVSNYGNFFSHYDFKLDGNKWSLLYC  145

Query  122  FQPNGQAPISSTDKPLTPQNQ-----AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFD  286
            FQPNGQAPISSTDK L  Q +     A+F+PPRRLR +EIP ++N+F+LAA NAI+AGFD
Sbjct  146  FQPNGQAPISSTDKKLAAQVRNGVVVAEFSPPRRLRTEEIPDIVNEFKLAALNAIEAGFD  205

Query  287  GVEIHGAHGFLIDQFLKDGVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSP  466
            GVEIHGAHG+LIDQFLKD VNDRTDEYGG L NRCRFALE++E V++ IG +R+GIRLSP
Sbjct  206  GVEIHGAHGYLIDQFLKDSVNDRTDEYGGSLENRCRFALEIIEAVSNAIGPQRLGIRLSP  265

Query  467  FSDYLECGDSNPNALGVFMAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            F++YL   DSNP ALG++MAE+LNKYG+LYCH++EPRMK + EK +   SLLPMRKAF G
Sbjct  266  FANYLGSADSNPEALGLYMAEALNKYGILYCHVVEPRMKLIGEKFECSDSLLPMRKAFKG  325



>dbj|BAD06520.1| hypothetical protein [Pisum sativum]
 dbj|BAD12188.1| 12-oxophytodienoic acid 10, 11-reductase [Pisum sativum]
Length=368

 Score =   327 bits (839),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 183/216 (85%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGG+  CQI HVGRVSN+ +QPNGQ PISS+DK LT  +
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGVIICQIWHVGRVSNSCYQPNGQTPISSSDKSLTSSH  141

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
              QFTPPRRL  DEIP ++NDFRLAARNAI+AGFDG+EIHGAHG+LI+QF+KD VNDRTD
Sbjct  142  AQQFTPPRRLSTDEIPDIVNDFRLAARNAIEAGFDGIEIHGAHGYLIEQFMKDEVNDRTD  201

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            EYGG + NRCRFALEVVE   +EIG ++VGIRLSPF+++ ECGDS+P  LG++M  +LNK
Sbjct  202  EYGGSIENRCRFALEVVEAAVNEIGADKVGIRLSPFAEHSECGDSSPKELGLYMVNALNK  261

Query  542  YGVLYCHMIEPRMKKLWEKSD-GPQSLLPMRKAFNG  646
            Y +LYCHM+EPR+K  +E  D  P SL+PMRKAFNG
Sbjct  262  YNLLYCHMVEPRIKSAFEVVDNSPHSLVPMRKAFNG  297



>emb|CBI39234.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   325 bits (833),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 174/204 (85%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG IF CQ+ HVGRVSNT+FQPNGQAP+SSTDK LTPQ 
Sbjct  77   PGIWTKEQVEAWKPIVDAVHAKGSIFICQLWHVGRVSNTEFQPNGQAPLSSTDKALTPQV  136

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FT PRRL  DE+P+V+NDFRLAARNA++AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  137  RSNGFDVAEFTAPRRLTTDEVPRVVNDFRLAARNAMEAGFDGVEIHGAHGYLLDQFMKDQ  196

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRF LEVVE V +EIG ++VGIRLSPF  + E GDSNP ALG++M
Sbjct  197  VNDRTDKYGGSLENRCRFPLEVVEAVVNEIGADKVGIRLSPFGHHAEAGDSNPTALGLYM  256

Query  524  AESLNKYGVLYCHMIEPRMKKLWE  595
             ESLNKYGVLYCHM+EPR++   E
Sbjct  257  VESLNKYGVLYCHMVEPRIRAAGE  280



>ref|XP_010458224.1| PREDICTED: putative 12-oxophytodienoate reductase-like protein 
1 isoform X1 [Camelina sativa]
Length=413

 Score =   328 bits (841),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW KEQIEAWKPIVDAVH+ GG+FFCQ+ H GRVS+ D QPN +AP+SSTDKP     
Sbjct  125  PGIWRKEQIEAWKPIVDAVHSHGGVFFCQLWHAGRVSHRDCQPNREAPVSSTDKPFANDP  184

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
             +++TPPRRL  DEIP ++N+FRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD VNDR D
Sbjct  185  SSEYTPPRRLTTDEIPTIVNEFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDSVNDRVD  244

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG L NRCRFALEV+E V++EIG +RVGIRLSPF++Y+E GDS+P  LG++MA+SLN+
Sbjct  245  DYGGSLENRCRFALEVIEAVSNEIGPDRVGIRLSPFANYMESGDSDPQRLGLYMAKSLNR  304

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            + +LYCHM+EPRMK   E  +  +SL PMRK F+G
Sbjct  305  FEILYCHMVEPRMKTASEIFECTESLTPMRKVFDG  339



>emb|CDP10744.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 180/222 (81%), Gaps = 7/222 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKGGI FCQ+ HVGRVSN   QP+GQAPISSTDK +TP  
Sbjct  82   PGIWTKEQVEAWKPIVDAVHAKGGIIFCQLWHVGRVSNYGAQPHGQAPISSTDKEITPHL  141

Query  179  ------NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKD  340
                     +F+PPRRLR +EIP ++N+FRLAA NAI+AGFDGVEIHGAHG+LI+QFLKD
Sbjct  142  PTSTTGYDIKFSPPRRLRKEEIPDIVNNFRLAALNAIEAGFDGVEIHGAHGYLIEQFLKD  201

Query  341  GVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVF  520
              NDRTDEYGG + NRCRFALE+VE V++ IG  RVGIRLSPF+D+++C DSNP ALG++
Sbjct  202  KANDRTDEYGGSIENRCRFALEIVEAVSNAIGPHRVGIRLSPFTDFMDCADSNPKALGLY  261

Query  521  MAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            MAE+LNKYG+LY HM+EPR++          SLLPMRKAF G
Sbjct  262  MAEALNKYGILYLHMVEPRIRVNENSKRHDDSLLPMRKAFKG  303



>emb|CDX81857.1| BnaC08g37440D [Brassica napus]
Length=371

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 179/217 (82%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            P IWT+E +EAWKPIVDAVHAKGGIFFCQI H GRV + D QPNG+AP+SSTDKPLT  N
Sbjct  77   PVIWTREHVEAWKPIVDAVHAKGGIFFCQIWHGGRVFHQD-QPNGEAPVSSTDKPLTCNN  135

Query  182  --QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
                QFTPPRRL   EIP ++NDFR+AARNA++AGFDGVE+HGAHG+LIDQFLKD VNDR
Sbjct  136  IYGGQFTPPRRLSTKEIPAIVNDFRIAARNAMEAGFDGVEVHGAHGYLIDQFLKDKVNDR  195

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD+YGG L NRCRFA+EV+E V  EIG +RVGIRLSPF+DY+E  DSNP ALG++M + +
Sbjct  196  TDQYGGSLENRCRFAVEVIEAVVKEIGSDRVGIRLSPFADYMESVDSNPEALGLYMVQEM  255

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NK+GVLYCHM+EPRMK L +  +  +SL PMR AF G
Sbjct  256  NKHGVLYCHMVEPRMKLLEDVFECSESLTPMRNAFKG  292



>ref|XP_006417576.1| hypothetical protein EUTSA_v10009352mg, partial [Eutrema salsugineum]
 gb|ESQ35929.1| hypothetical protein EUTSA_v10009352mg, partial [Eutrema salsugineum]
Length=310

 Score =   323 bits (827),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIW KEQ+EAWKPIV+AVH+KGG F CQ+ H GRVS+ D QPNG+APISSTDKPL   +
Sbjct  81   PGIWRKEQVEAWKPIVNAVHSKGGFFLCQLWHAGRVSHRDCQPNGEAPISSTDKPLAADS  140

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
              ++TPPRRLR DEI  V+NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD VNDRTD
Sbjct  141  SNEYTPPRRLRTDEISTVVNDFRLAARNAIEAGFDGVEIHGAHGYLIDQFMKDTVNDRTD  200

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            EYGG L NRCRF LEV+E V +EIG +RVGIRLSPF++Y+E GDS P  LG++MAESLN+
Sbjct  201  EYGGSLENRCRFTLEVIEAVTNEIGADRVGIRLSPFANYMESGDSEPQKLGIYMAESLNR  260

Query  542  YGVLYCHMIEPRMK  583
            + +LYCHM+EPRMK
Sbjct  261  FEILYCHMVEPRMK  274



>ref|XP_006494221.1| PREDICTED: putative 12-oxophytodienoate reductase 11-like [Citrus 
sinensis]
Length=372

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTP-Q  178
            PGIWTK+Q+EAWKPIVDAVH KGGIFFCQI HVGRVS   FQPNG+APIS T K +TP  
Sbjct  83   PGIWTKKQVEAWKPIVDAVHEKGGIFFCQIWHVGRVSTFGFQPNGEAPISCTSKGVTPGL  142

Query  179  NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            +   ++PPR LR +EIP V+NDFRLAARNAI+AGFDGVEIHGA+G+LIDQF+KD VNDRT
Sbjct  143  DGVDWSPPRPLRTEEIPLVVNDFRLAARNAIEAGFDGVEIHGANGYLIDQFMKDQVNDRT  202

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D+YGG L NRCRFALE+VE VA+EIG ERVG+RLSP++ Y+E GDSNP ALG++MA++LN
Sbjct  203  DQYGGSLENRCRFALEIVEAVANEIGAERVGMRLSPYASYMETGDSNPEALGLYMAKALN  262

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            K+ +LY H+IEPRM K+ +K +   SLLPMR AF G
Sbjct  263  KFKLLYLHVIEPRMIKINDKYETVHSLLPMRSAFEG  298



>ref|XP_006858594.1| hypothetical protein AMTR_s00071p00196480 [Amborella trichopoda]
 gb|ERN20061.1| hypothetical protein AMTR_s00071p00196480 [Amborella trichopoda]
Length=374

 Score =   324 bits (831),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 180/221 (81%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIV+AVH  GG+FFCQI HVGRVS+ D+QPNGQAPISS+DK LTPQ 
Sbjct  84   PGIWTKEQVEAWKPIVNAVHDNGGVFFCQIWHVGRVSHYDYQPNGQAPISSSDKGLTPQL  143

Query  179  --NQ---AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
              NQ   A+FTPPR L  DEIP ++NDFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  144  KSNQLDVAEFTPPRPLATDEIPLIVNDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDS  203

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRF LEVVE V  EIG ++VGIRLSPF  + E  DS+P ALG++M
Sbjct  204  VNDRTDQYGGTLENRCRFPLEVVEAVTKEIGPDKVGIRLSPFGAHAEAEDSDPEALGLYM  263

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            AE+LNKY VLY H +EPR+ K   +++   SLLPMR AF G
Sbjct  264  AEALNKYSVLYAHYVEPRIVKSGVQAETSHSLLPMRTAFKG  304



>emb|CBI39236.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   326 bits (835),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 173/200 (87%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWTKEQ+EAWKPIVDAVHAKG IF CQ+ HVGRVSNT+FQPNGQAP+SSTDK LTPQ 
Sbjct  53   PGIWTKEQVEAWKPIVDAVHAKGSIFICQLWHVGRVSNTEFQPNGQAPLSSTDKALTPQV  112

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                 + A+FT PRRL  DE+P+V+NDFRLAARNA++AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  113  RSNGFDVAEFTAPRRLTTDEVPRVVNDFRLAARNAMEAGFDGVEIHGAHGYLLDQFMKDQ  172

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRF LEVVE V +EIG ++VGIRLSPF  + E GDSNP ALG++M
Sbjct  173  VNDRTDKYGGSLENRCRFPLEVVEAVVNEIGADKVGIRLSPFGHHAEAGDSNPTALGLYM  232

Query  524  AESLNKYGVLYCHMIEPRMK  583
             ESLNKYGVLYCHM+EPR++
Sbjct  233  VESLNKYGVLYCHMVEPRIR  252



>ref|XP_009390090.1| PREDICTED: putative 12-oxophytodienoate reductase 5 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 181/220 (82%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PG+WT+EQ+EAWKPIVDAVHAKGG+FFCQ+ HVGRVSNT +QPNGQ PISSTDK +  Q 
Sbjct  72   PGVWTREQVEAWKPIVDAVHAKGGVFFCQLWHVGRVSNTGYQPNGQDPISSTDKQVPTQV  131

Query  179  ----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
                +  +++ PRRLR +EIP+++ DFRLAARNAI+AGFDGVEIHGA+G+LI+QF+KD  
Sbjct  132  LHDGSIEEYSRPRRLRTEEIPRIVEDFRLAARNAIEAGFDGVEIHGANGYLIEQFMKDSA  191

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTDEYGG L NRCRFALEVVE V  EIG +RVG+RLSPF DY++C DS+P AL ++M 
Sbjct  192  NDRTDEYGGSLENRCRFALEVVEAVVGEIGADRVGMRLSPFLDYMDCWDSDPEALALYMV  251

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            ++LNK+G+LYCHMIEPRM  +  +   P  LLPMRKAF G
Sbjct  252  QALNKHGILYCHMIEPRMAVVNGRYHIPHRLLPMRKAFKG  291



>ref|XP_011088113.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Sesamum 
indicum]
Length=378

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 184/218 (84%), Gaps = 5/218 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKE +EAWKPIVDAVH KGGIFF QI HVGRVS  DFQPNGQAPISSTDK +TP  
Sbjct  86   PGIWTKEHVEAWKPIVDAVHQKGGIFFLQIVHVGRVSTYDFQPNGQAPISSTDKGVTPGL  145

Query  182  QA-QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
            +  + +PPRRLR DE+P ++NDFRLAARNAI+AGFDGVEIHGA+GFLI+QFLKD VNDRT
Sbjct  146  EGLELSPPRRLRKDEVPGIVNDFRLAARNAIEAGFDGVEIHGANGFLIEQFLKDQVNDRT  205

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            DEYGG L NRCRFALE+VE VA+EIG  RVGIRLSP+SD++E  DS+P+ALG++MA +LN
Sbjct  206  DEYGGSLENRCRFALEIVEAVANEIGSHRVGIRLSPYSDFMEAIDSDPDALGLYMANALN  265

Query  539  KYGVLYCHMIEPRM--KKLWE--KSDGPQSLLPMRKAF  640
            K+ +LY HMIEPR+   ++++  + + P  LLPMRKAF
Sbjct  266  KFNILYLHMIEPRVVGSRVFQGPEDEIPHRLLPMRKAF  303



>emb|CBI39238.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 169/194 (87%), Gaps = 6/194 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFFCQI HVGRVSNTDFQPNGQAPIS TDKPLTPQ 
Sbjct  85   PGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTDFQPNGQAPISCTDKPLTPQI  144

Query  182  QA------QFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
            +       QF+PPRRL  DEIPQV+ DFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD 
Sbjct  145  RGNGIGVDQFSPPRRLTTDEIPQVVKDFRLAARNAIEAGFDGVEIHGAHGYLLDQFMKDQ  204

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L NRCRFALEVVE V DEIG ++VGI+LSP+  + E  DSNP ALG++M
Sbjct  205  VNDRTDKYGGSLENRCRFALEVVEAVVDEIGADKVGIKLSPYDAFGEAEDSNPKALGLYM  264

Query  524  AESLNKYGVLYCHM  565
            AESLNKYG+LYCHM
Sbjct  265  AESLNKYGLLYCHM  278



>ref|XP_006306255.1| hypothetical protein CARUB_v10012098mg [Capsella rubella]
 gb|EOA39153.1| hypothetical protein CARUB_v10012098mg [Capsella rubella]
Length=367

 Score =   323 bits (828),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 179/217 (82%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIVDAVH+KGGIFFCQI H GRV + D Q NG+AP+SSTDKPLT +N
Sbjct  75   PGIWTREQVEAWKPIVDAVHSKGGIFFCQIWHGGRVFHQD-QANGEAPVSSTDKPLTCKN  133

Query  182  Q--AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
                QF PPRRLR DEIP ++NDFR+AARNA++AGFDGVE+HGAHG+LIDQFLKD VNDR
Sbjct  134  MYGGQFIPPRRLRTDEIPAIVNDFRIAARNAMEAGFDGVEVHGAHGYLIDQFLKDKVNDR  193

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            +D+YGG + NRCRFALEV+E V  EIG   VG+RLSPF+DY++ GDSNP ALG+++ E++
Sbjct  194  SDKYGGSIENRCRFALEVIEAVVSEIGSNHVGVRLSPFADYMDSGDSNPEALGLYLVEAM  253

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            N +G+LYCHM+EPRMK L E  +  +SL  MR  F G
Sbjct  254  NTHGILYCHMVEPRMKTLEESFECTESLTLMRNTFKG  290



>ref|XP_009390087.1| PREDICTED: putative 12-oxophytodienoate reductase 5 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=365

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 179/220 (81%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PG+WT+EQ+EAWKPIVDAVHAKGG+FFCQ+ HVGRVS+T +QPNGQ PISSTDK +  Q 
Sbjct  72   PGVWTREQVEAWKPIVDAVHAKGGVFFCQLWHVGRVSDTSYQPNGQHPISSTDKQVLSQM  131

Query  179  ----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
                +  + + PRRL  +EIP+++ DFRLAARNAI+AGFDGVEIHGA+G+LIDQF+KD V
Sbjct  132  PDDASVEEHSRPRRLLTEEIPRIVEDFRLAARNAIEAGFDGVEIHGANGYLIDQFMKDSV  191

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTDEYGG L NRCRFALEVVE VADEIG +RVG+RLSPF D L+C DS+P AL ++M 
Sbjct  192  NDRTDEYGGSLENRCRFALEVVEAVADEIGADRVGMRLSPFMDCLDCWDSDPEALALYMV  251

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              LNK+G+LYCHMIEPRM  +  +   P  LLPMRKAF G
Sbjct  252  RELNKHGILYCHMIEPRMAMVSGRYHIPHRLLPMRKAFKG  291



>ref|XP_007157104.1| hypothetical protein PHAVU_002G043000g [Phaseolus vulgaris]
 gb|ESW29098.1| hypothetical protein PHAVU_002G043000g [Phaseolus vulgaris]
Length=429

 Score =   324 bits (831),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 175/215 (81%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+E +EAWKPIVDAVHAKGGIFFCQI HVGRVSNT +QPNGQ PISSTDK L    
Sbjct  135  PGIWTREHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTGYQPNGQQPISSTDKALK---  191

Query  182  QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRTD  361
              ++T PRRLR DEIP V+NDFR+AARNAI+AGFDGVEIHGAHGFL+DQF+KD VNDRTD
Sbjct  192  STEYTQPRRLRTDEIPNVVNDFRIAARNAIEAGFDGVEIHGAHGFLLDQFMKDQVNDRTD  251

Query  362  EYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLNK  541
            +YGG L NRCRF LEVVE + +EIG +RVGIRLSPF DY E GDSNP  LG++M  +LN+
Sbjct  252  QYGGSLENRCRFPLEVVEAIVNEIGADRVGIRLSPFIDYSESGDSNPLQLGLYMVNALNR  311

Query  542  YGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            Y + YCH++ PRM  +  K   P+S++ +R AFNG
Sbjct  312  YNIAYCHVVAPRMGSIGGKVQNPESMVILRNAFNG  346



>emb|CDP10745.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 185/225 (82%), Gaps = 12/225 (5%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKE +EAWKPIVDAVHAKGGI FCQ+ HVGRVSN D QPNGQAPISSTDK LTP+ 
Sbjct  83   PGIWTKEHVEAWKPIVDAVHAKGGIIFCQLWHVGRVSNYDAQPNGQAPISSTDKALTPRV  142

Query  182  QAQ--------FTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLK  337
            Q+         ++PPRRLR +EIP ++NDFRLAA NAI+AGFDGVEIHGAHG+LI+QF+K
Sbjct  143  QSNSTGFDLEYYSPPRRLRKEEIPNIVNDFRLAAINAIEAGFDGVEIHGAHGYLIEQFMK  202

Query  338  DGVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGV  517
            D  NDRTDEYGG + NRCRFALE+VE V++ IG  RVGIRLSPF+ + +  DSNPNALG+
Sbjct  203  DEANDRTDEYGGSMENRCRFALEIVEAVSNAIGPLRVGIRLSPFTYFNDSADSNPNALGL  262

Query  518  FMAESLNKYGVLYCHMIEPRMK--KLWEKSDGPQSLLPMRKAFNG  646
            +MAE+LNKYG+LY HM++P+++    +++ DG  SLLPMRKAF G
Sbjct  263  YMAEALNKYGILYLHMVDPKLRFNPNFKRHDG--SLLPMRKAFKG  305



>gb|ABK26573.1| unknown [Picea sitchensis]
Length=376

 Score =   322 bits (825),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 180/222 (81%), Gaps = 7/222 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT+EQ+EAWKPIV+ VH KGG+FFCQI H GR S+ D+QPNGQAP+SSTD+ ++ Q 
Sbjct  84   PGIWTEEQVEAWKPIVNGVHEKGGVFFCQIWHSGRASHVDYQPNGQAPLSSTDRKISGQI  143

Query  179  ------NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKD  340
                  + A ++PPR L+ +EIP ++NDFRLAARNAI+AGFDGVEIHGAHG+LIDQF+KD
Sbjct  144  VLPNGKDLADYSPPRALKIEEIPHIVNDFRLAARNAIKAGFDGVEIHGAHGYLIDQFMKD  203

Query  341  GVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVF  520
             +N+RTDEYGG L NRCRF LEVVE VA+EIGGERVGIRLSPF+ YLE  DS+P ALG++
Sbjct  204  SINNRTDEYGGTLANRCRFPLEVVEAVANEIGGERVGIRLSPFAQYLESSDSDPEALGLY  263

Query  521  MAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            MAE+LN+Y +LY H +EPR+   +E     +SL PMRKAF G
Sbjct  264  MAEALNRYNILYAHYVEPRLVTTFEPVATNKSLFPMRKAFKG  305



>gb|AEZ53109.1| 12-oxophytodienoate reductase [Epimedium acuminatum]
Length=384

 Score =   322 bits (826),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 181/222 (82%), Gaps = 7/222 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVDAVHAKGGIFF Q+ HVGRVS+T FQPNGQAPISSTD  LT + 
Sbjct  83   PGIWTKEQVEAWKPIVDAVHAKGGIFFIQLWHVGRVSDTSFQPNGQAPISSTDNALTLKI  142

Query  182  QAQ------FTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
              Q       TPPRRLR +EIPQV+NDF+LAARNA++AGFDGVEIH A+G+LIDQF KD 
Sbjct  143  NYQNAPTIYSTPPRRLRTNEIPQVVNDFKLAARNAMEAGFDGVEIHAANGYLIDQFNKDS  202

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            +NDRTDEYGG + NR RFA E+VE V++EIG +RVGIRLSPFSD++E  DSNP AL + M
Sbjct  203  INDRTDEYGGTIENRFRFASEIVEAVSNEIGADRVGIRLSPFSDFMESMDSNPEALALHM  262

Query  524  AESLNKYGVLYCHMIEPRMKKL-WEKSDGPQSLLPMRKAFNG  646
            A+SL+KYG+LYC ++EPRMK    EKS   + LLPMRKAF G
Sbjct  263  AQSLDKYGILYCDVMEPRMKTSPSEKSYTHEDLLPMRKAFKG  304



>ref|XP_010930414.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Elaeis guineensis]
Length=382

 Score =   322 bits (826),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 177/216 (82%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIV+AVH KGGIFF QIGH+GR+SN  FQPNGQAPISSTDKP+TPQ 
Sbjct  93   PGIWTREQVEAWKPIVNAVHEKGGIFFLQIGHMGRISNYGFQPNGQAPISSTDKPITPQT  152

Query  182  -QAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
             +  F+PPRRL  DEIP ++NDFR+AARNAI+AGFDGVEIH A G L++QF+KD +NDRT
Sbjct  153  PEDDFSPPRRLSTDEIPLIVNDFRVAARNAIEAGFDGVEIHAAFGHLLEQFMKDNINDRT  212

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            DEYGG L+N CRFALEVVE V DEIG  RVG+RLS F+D +E GDS+P  L ++MAESLN
Sbjct  213  DEYGGSLQNHCRFALEVVEAVVDEIGASRVGMRLSLFADIMESGDSDPEGLALYMAESLN  272

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            K+GVLYCH+IEP M+ +  K   P   L MRKAF G
Sbjct  273  KFGVLYCHVIEPNMEVVDGKQQIPHVHLSMRKAFKG  308



>gb|KEH36332.1| 12-oxophytodienoate reductase-like protein [Medicago truncatula]
Length=366

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 180/217 (83%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ+EAWKPIV AVH KGGIFFCQ+ H GRVSN  +QP+GQ PISST+K L  + 
Sbjct  76   PGIWTREQVEAWKPIVGAVHEKGGIFFCQLWHAGRVSNYGYQPDGQPPISSTNKALQKEG  135

Query  182  Q--AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
                ++ PPRRL  DEIP+++NDFRLAA+NAI AGFDGVEIHGA+G+L+DQFLKD VNDR
Sbjct  136  SGSTKYPPPRRLTTDEIPKIVNDFRLAAKNAIDAGFDGVEIHGANGYLLDQFLKDKVNDR  195

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
             DEYGG L NRCRF LEVV+ V DEIG ++VG+RLSP++DY  CGDSNP+ALG++MA+SL
Sbjct  196  DDEYGGSLENRCRFPLEVVKAVVDEIGADKVGVRLSPYADYCGCGDSNPHALGIYMAKSL  255

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            ++ G+LYCH+IEP M  ++EK D  +SL+PMRK FNG
Sbjct  256  SQLGILYCHVIEPGMCTMFEKYDTNESLMPMRKIFNG  292



>gb|ABK26588.1| unknown [Picea sitchensis]
Length=376

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 180/222 (81%), Gaps = 7/222 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT+EQ+EAWKPIV+ VH KGG+FFCQI H GR S+ D+QPNGQAP+SSTD+ ++ Q 
Sbjct  84   PGIWTEEQVEAWKPIVNGVHEKGGVFFCQIWHSGRASHVDYQPNGQAPLSSTDRKISGQI  143

Query  179  ------NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKD  340
                  + A ++PPR L+ +EIP ++NDFRLAARNA++AGFDGVEIHGAHG+LIDQF+KD
Sbjct  144  VLPNGKDLADYSPPRALKIEEIPHIVNDFRLAARNAMKAGFDGVEIHGAHGYLIDQFMKD  203

Query  341  GVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVF  520
             +N+RTDEYGG L NRCRF LEVVE VA+EIGGERVGIRLSPF+ YLE  DS+P ALG++
Sbjct  204  SINNRTDEYGGTLANRCRFPLEVVEAVANEIGGERVGIRLSPFAQYLESSDSDPEALGLY  263

Query  521  MAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            MAE+LN+Y +LY H +EPR+   +E     +SL PMRKAF G
Sbjct  264  MAEALNRYNILYAHYVEPRLVTTFEPVATNKSLFPMRKAFKG  305



>ref|XP_002447902.1| hypothetical protein SORBIDRAFT_06g017680 [Sorghum bicolor]
 gb|EES12230.1| hypothetical protein SORBIDRAFT_06g017680 [Sorghum bicolor]
Length=351

 Score =   319 bits (818),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 176/217 (81%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWTKEQ+EAWKPIVD VHAKGG FFCQI HVGRVSN+ FQPNGQAPISSTDKP+  ++
Sbjct  61   PGIWTKEQVEAWKPIVDGVHAKGGTFFCQIWHVGRVSNSTFQPNGQAPISSTDKPVQSKH  120

Query  182  QAQFTP--PRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
              +FTP  PRRL  DEIP ++NDFR+AARNAI+AGFDGVEIHGAHG+LIDQFLKD VNDR
Sbjct  121  VDKFTPLPPRRLETDEIPFIVNDFRVAARNAIEAGFDGVEIHGAHGYLIDQFLKDHVNDR  180

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            TD YG  L NRCRFA+E+++ V DEIG ++VGIRLSPF++Y    DSNP ALG++MA +L
Sbjct  181  TDIYGASLENRCRFAVEIIQAVVDEIGADKVGIRLSPFANYSGAVDSNPEALGLYMANAL  240

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            N +GVLYCH++ PRM K  E  + P  +  MR AF G
Sbjct  241  NNFGVLYCHVVVPRMVKNGENFETPSHIGLMRSAFKG  277



>ref|XP_009404832.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   319 bits (817),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 174/221 (79%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKP-----  166
            PGIWTKE +EAWKPIVDAVHAKGGIFFCQ+ H GRVSNT +QPNGQAPIS TDKP     
Sbjct  74   PGIWTKEHVEAWKPIVDAVHAKGGIFFCQLWHTGRVSNTGYQPNGQAPISCTDKPVNSGL  133

Query  167  -LTPQNQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
             L  +   +FT PRRLR DEIP+V++DFR AARNAI+AGFDGVEIHGAHG+LIDQFLKD 
Sbjct  134  LLEDEPDEKFTVPRRLRTDEIPRVVDDFRNAARNAIEAGFDGVEIHGAHGYLIDQFLKDS  193

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTDEYGG L  RCRFALEVVE V DEIG ERVG+RLSPF+DY  C DS+P   G+++
Sbjct  194  VNDRTDEYGGSLEKRCRFALEVVEAVVDEIGAERVGLRLSPFADYHGCWDSDPEVSGLYL  253

Query  524  AESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
               +NK+ +LY HM+EPRM  +  +   P  LLPMR+AF G
Sbjct  254  VHQINKHDLLYLHMVEPRMSIVEGRRQIPHRLLPMRRAFKG  294



>ref|XP_006389493.1| hypothetical protein POPTR_0022s00360g [Populus trichocarpa]
 gb|ERP48407.1| hypothetical protein POPTR_0022s00360g [Populus trichocarpa]
Length=365

 Score =   319 bits (817),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 180/216 (83%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PGIWT+EQ++AWKPIVDAVH KGGI FCQI HVGRVS   FQPNG+APIS TDK +TP  
Sbjct  76   PGIWTEEQVKAWKPIVDAVHEKGGILFCQIWHVGRVSTYGFQPNGEAPISCTDKGVTPGL  135

Query  182  QAQ-FTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
              + ++PPRRLRADE+P+++NDFRLAARNAI+AGFDGVEIHGA+G+LIDQFLKD VNDRT
Sbjct  136  DGEDWSPPRRLRADELPRIVNDFRLAARNAIEAGFDGVEIHGANGYLIDQFLKDQVNDRT  195

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D YGG L NRCRF LE++E V DE+G ++VG+RLSP+++Y+E  DSNP  LG++MA +LN
Sbjct  196  DNYGGSLENRCRFPLEILEAVVDEVGADKVGMRLSPYANYMEAVDSNPEELGLYMANALN  255

Query  539  KYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            K+G+LY H+IEPRM K  +  + P SLLPM+ AF G
Sbjct  256  KFGILYLHVIEPRMVKANDIYETPHSLLPMKNAFEG  291



>gb|ABK23778.1| unknown [Picea sitchensis]
Length=376

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 180/222 (81%), Gaps = 7/222 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT+EQ+EAWKPIV+ VH KGG+FFCQI H GR S+ D+QPNGQAP+SSTD+ ++ Q 
Sbjct  84   PGIWTEEQVEAWKPIVNGVHEKGGVFFCQIWHTGRASHVDYQPNGQAPVSSTDRKISGQV  143

Query  179  ------NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKD  340
                  + A ++PPR L+ +EIPQ+INDFRLAARNAI+AGFDGVEIHGAHG+L+DQF+KD
Sbjct  144  VLPNGKDLADYSPPRALKIEEIPQIINDFRLAARNAIKAGFDGVEIHGAHGYLLDQFMKD  203

Query  341  GVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVF  520
             +N+R D+YGG L NRCRF LEVVE VA+EIG ERVGIRLSPF+ +LE  DS+P ALG++
Sbjct  204  SINNRIDQYGGTLENRCRFPLEVVEAVANEIGAERVGIRLSPFAQFLESSDSDPEALGLY  263

Query  521  MAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            MAE+LN+Y +LY H +EPR+   +E     +SLLPMRKAF G
Sbjct  264  MAETLNRYNILYAHYVEPRLVTTFEPVATNKSLLPMRKAFKG  305



>gb|EPS65369.1| hypothetical protein M569_09408, partial [Genlisea aurea]
Length=341

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/222 (68%), Positives = 179/222 (81%), Gaps = 8/222 (4%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PGIWT EQ+EAWKPIVDAVHAKG  FFCQI H GRVSNT FQPNGQ PISSTD+ LTP+ 
Sbjct  69   PGIWTTEQVEAWKPIVDAVHAKGAFFFCQIWHTGRVSNTGFQPNGQLPISSTDRGLTPKL  128

Query  179  -----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDG  343
                  +  F+PPRRL  +EIP++++DFR+AARNAI+AGFDGVEIHGAHG+LI+QFLKDG
Sbjct  129  GSNGSGEPLFSPPRRLTTEEIPRIVDDFRVAARNAIEAGFDGVEIHGAHGYLIEQFLKDG  188

Query  344  VNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFM  523
            VNDRTD+YGG L+NRCRF LE+ + V  EIG +RVGIRLSPF+DY E  DSNP  LG+ +
Sbjct  189  VNDRTDQYGGSLQNRCRFLLEITDAVTQEIGADRVGIRLSPFADYAEAEDSNPEKLGIHL  248

Query  524  AESLNKYGVLYCHMIEPRMKK-LWEKSDGPQSLLPMRKAFNG  646
            A +LN YG+ Y H++EPRMK  + E SDG  SLLPMR+AF G
Sbjct  249  AGALNVYGLAYIHVVEPRMKDGVVEPSDG-ASLLPMRRAFEG  289



>gb|AAF97278.1|AC034106_21 Strong similarity to 12-oxophytodienoate reductase OPR2 from 
Arabidopsis thaliana gb|U92460 and is a member of the NADH:flavin 
oxidoreductase / NADH oxidase PF|00724 family. EST gb|AI993602 
comes from this gene [Arabidopsis thaliana]
 gb|AAF97820.1|AC034107_3 Strong similarity to 12-oxophytodienoate reductase from Lycopersicon 
esculentum gb|AJ242551 and is a member of the NADH:flavin 
oxidoreductase / NADH oxidase PF|00724 family. ESTs gb|N96381, 
gb|AI993602 come from this gene [Arabidopsis thaliana]
Length=367

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 183/217 (84%), Gaps = 4/217 (2%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQN  181
            PG+W ++Q+EAWKPIVDAVH+KGGIFFCQI H GRV + D QPNG+AP+SSTDKPL  +N
Sbjct  75   PGLWNRDQVEAWKPIVDAVHSKGGIFFCQIWHGGRVFHQD-QPNGEAPVSSTDKPLMCKN  133

Query  182  Q--AQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDR  355
                QF PPRRLR+DE+P ++NDFR+AARNAI+AGFDGVE+HGAHG+LIDQFLKD VNDR
Sbjct  134  MYGGQFKPPRRLRSDELPAIVNDFRIAARNAIEAGFDGVEVHGAHGYLIDQFLKDKVNDR  193

Query  356  TDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESL  535
            +D+YGG L NRCRFALEV+E V +EIG +RVGIRLSPF+DY+E GDSNP ALG+++ +++
Sbjct  194  SDQYGGSLENRCRFALEVIEAVVNEIGSDRVGIRLSPFADYMESGDSNPEALGLYLVQAM  253

Query  536  NKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            NK+ V+Y HM+EPRMK L    +  +SL PMRKAF G
Sbjct  254  NKH-VVYGHMVEPRMKTLEGIFECTESLTPMRKAFKG  289



>ref|XP_006494222.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Citrus sinensis]
Length=372

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 180/217 (83%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTP-Q  178
            PGIWT+EQ+EAWKPIVDAVH KGGIFFCQI H GRVS   FQPNG+APIS T K +TP  
Sbjct  82   PGIWTQEQVEAWKPIVDAVHEKGGIFFCQIWHCGRVSTYGFQPNGEAPISCTSKGVTPGL  141

Query  179  NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGVNDRT  358
                ++PPR LR +EIPQ++NDFRLAARNAI+AGFDGVEIHGA+G+LIDQF+KD VNDRT
Sbjct  142  GGGDWSPPRPLRTEEIPQIVNDFRLAARNAIKAGFDGVEIHGANGYLIDQFMKDQVNDRT  201

Query  359  DEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMAESLN  538
            D+YGG L NRCRFALE+VE V +EIG ERVG+RLSP ++Y+E  DSNP ALG++MA++LN
Sbjct  202  DQYGGSLENRCRFALEIVEAVVNEIGAERVGLRLSPHANYMEAQDSNPEALGLYMAKALN  261

Query  539  KYGVLYCHMIEPRMKKLWEKSDG-PQSLLPMRKAFNG  646
            KY +LY H++EPR+    +K D  P SLLPMRKAF+G
Sbjct  262  KYQILYLHILEPRLFNAQDKPDAPPYSLLPMRKAFDG  298



>ref|XP_009390089.1| PREDICTED: putative 12-oxophytodienoate reductase 5 isoform X3 
[Musa acuminata subsp. malaccensis]
Length=345

 Score =   317 bits (811),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 178/220 (81%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLTPQ-  178
            PG+WT+EQ+EAWKPIVDAVHAKGG+FFCQ+ HVGRVS+T  QPNGQ PISSTDK +  Q 
Sbjct  53   PGVWTREQVEAWKPIVDAVHAKGGVFFCQLWHVGRVSDTS-QPNGQHPISSTDKQVLSQM  111

Query  179  ----NQAQFTPPRRLRADEIPQVINDFRLAARNAIQAGFDGVEIHGAHGFLIDQFLKDGV  346
                +  + + PRRL  +EIP+++ DFRLAARNAI+AGFDGVEIHGA+G+LIDQF+KD V
Sbjct  112  PDDASVEEHSRPRRLLTEEIPRIVEDFRLAARNAIEAGFDGVEIHGANGYLIDQFMKDSV  171

Query  347  NDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGDSNPNALGVFMA  526
            NDRTDEYGG L NRCRFALEVVE VADEIG +RVG+RLSPF D L+C DS+P AL ++M 
Sbjct  172  NDRTDEYGGSLENRCRFALEVVEAVADEIGADRVGMRLSPFMDCLDCWDSDPEALALYMV  231

Query  527  ESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
              LNK+G+LYCHMIEPRM  +  +   P  LLPMRKAF G
Sbjct  232  RELNKHGILYCHMIEPRMAMVSGRYHIPHRLLPMRKAFKG  271



>gb|KFK43238.1| hypothetical protein AALP_AA1G097900 [Arabis alpina]
Length=389

 Score =   318 bits (814),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 180/231 (78%), Gaps = 16/231 (7%)
 Frame = +2

Query  2    PGIWTKEQIEAWKPIVDAVHAKGGIFFCQIGHVGRVSNTDFQPNGQAPISSTDKPLT--P  175
            PGIW KEQIEAWKPI+DAVH+KGG+FFCQ+ H GRVS+ D QPNG+AP+SSTDKP+   P
Sbjct  81   PGIWKKEQIEAWKPIIDAVHSKGGVFFCQLWHAGRVSHRDCQPNGEAPVSSTDKPIAADP  140

Query  176  QNQ-AQFTPPRRLRADEIPQVINDFRLAARNA-------------IQAGFDGVEIHGAHG  313
             N+   FTPPRRL  +EIP VINDFRLAAR+               +  FDGVEIHGAHG
Sbjct  141  SNEFINFTPPRRLTIEEIPNVINDFRLAARSQETQLKLVMRPRVIYKKRFDGVEIHGAHG  200

Query  314  FLIDQFLKDGVNDRTDEYGGCLRNRCRFALEVVEGVADEIGGERVGIRLSPFSDYLECGD  493
            FLIDQF+KD VNDRTD YGG L NRCRFALE++E V +EIG +RVGIRLSPF++Y+E GD
Sbjct  201  FLIDQFIKDTVNDRTDSYGGSLENRCRFALEIIEAVTNEIGSDRVGIRLSPFANYMESGD  260

Query  494  SNPNALGVFMAESLNKYGVLYCHMIEPRMKKLWEKSDGPQSLLPMRKAFNG  646
            SNP  LG++MA+SLN++ +LYCHM+EPRMK + E  +  +SL PMRKAF G
Sbjct  261  SNPEQLGIYMAKSLNRFEILYCHMVEPRMKTVSELFECSESLTPMRKAFQG  311



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 910113435382