BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20315_g1_i1 len=600 path=[578:0-186 765:187-189 768:190-320
899:321-362 941:363-599]

Length=600
                                                                      Score     E

ref|XP_009758991.1|  PREDICTED: defensin-like protein 1               51.2    1e-05   
ref|XP_004242851.1|  PREDICTED: defensin-like protein 1               50.4    2e-05   
ref|XP_009773772.1|  PREDICTED: defensin-like protein 1               49.3    6e-05   
ref|XP_009598086.1|  PREDICTED: defensin Lc-def {ECO:0000303|PubM...  48.5    1e-04   
ref|XP_006359062.1|  PREDICTED: defensin-like protein 19-like         48.1    1e-04   



>ref|XP_009758991.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=76

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = +1

Query  91   IIVPLLFCFLLMAAFEMESAEA-TCWVASKTWNGNC-NGNSCKNWCDSQINGRYYWKCEK  264
            +I+ +LFCFLL+A+ EM+  EA  C   SKTW+G C N  +C   C +Q +GR +  C +
Sbjct  5    VILAILFCFLLIASNEMQGGEAKVCQRRSKTWSGPCINTGNCSRQCKNQEDGR-FGACHR  63

Query  265  SCGKSYYSCGCYKDC  309
            S     ++C CY +C
Sbjct  64   S--GIGFACFCYFNC  76



>ref|XP_004242851.1| PREDICTED: defensin-like protein 1 [Solanum lycopersicum]
Length=76

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 5/77 (6%)
 Frame = +1

Query  85   TNIIVPLLFCFLLMAAFEMESAEA-TCWVASKTWNGNC-NGNSCKNWCDSQINGRYYWKC  258
            T +I+ LLFCFLL+A+ EM+  EA  C   SKTW+G C N  +C   C  Q + R +  C
Sbjct  3    TKVILALLFCFLLVASNEMQVGEAKVCQRRSKTWSGPCINTGNCSRQCKQQEDAR-FGAC  61

Query  259  EKSCGKSYYSCGCYKDC  309
             +S     ++C CY  C
Sbjct  62   HRS--GFGFACFCYFKC  76



>ref|XP_009773772.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=76

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +1

Query  61   MATSQLTKTNIIVPLLFCFLLMAAFEMESAEAT-CWVASKTWNGNCNGNSCKNWCDSQIN  237
            MA  +++K +I V +LFCFLLM A E++  EA  C   SK+WNG C    C +WC +  +
Sbjct  1    MAQPKVSKISICV-VLFCFLLMFASEVQITEAKHCGKPSKSWNGKCFPRKCNHWCKNNED  59

Query  238  GRY  246
              Y
Sbjct  60   ADY  62



>ref|XP_009598086.1| PREDICTED: defensin Lc-def {ECO:0000303|PubMed:18468512, ECO:0000312|EMBL:ABP04037.1}-like 
[Nicotiana tomentosiformis]
Length=76

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +1

Query  61   MATSQLTKTNIIVPLLFCFLLMAAFEMESAEAT-CWVASKTWNGNCNGNSCKNWCDSQIN  237
            MA  +++K +I   +LFCFLLM A E++  EA  C   SK+WNG C    C +WC ++ +
Sbjct  1    MAQPKVSKISICA-VLFCFLLMFASEVQITEAKHCGKPSKSWNGKCFPKKCNHWCKNKED  59

Query  238  GRY  246
              Y
Sbjct  60   ADY  62



>ref|XP_006359062.1| PREDICTED: defensin-like protein 19-like [Solanum tuberosum]
Length=77

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 5/77 (6%)
 Frame = +1

Query  85   TNIIVPLLFCFLLMAAFEMESAEA-TCWVASKTWNGNC-NGNSCKNWCDSQINGRYYWKC  258
            T +I+ LLFCFLL+A+ EM+  EA  C   S+TW+G C N  +C   C  Q + R+    
Sbjct  3    TKLILALLFCFLLIASNEMQVGEAKVCQRRSQTWSGMCINTGNCSRQCKQQEDARFGACH  62

Query  259  EKSCGKSYYSCGCYKDC  309
            +   G   ++C CY  C
Sbjct  63   QNGIG---FACFCYFTC  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 742397556606