BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20282_g1_i1 len=679 path=[2191:0-678]

Length=679
                                                                      Score     E

ref|XP_009615680.1|  PREDICTED: serine incorporator 3 isoform X2        339   6e-112   
ref|XP_009759114.1|  PREDICTED: probable serine incorporator isof...    338   8e-112   
ref|XP_009759116.1|  PREDICTED: probable serine incorporator isof...    338   9e-112   
ref|XP_009615679.1|  PREDICTED: probable serine incorporator isof...    337   3e-111   
ref|XP_009615681.1|  PREDICTED: probable serine incorporator isof...    337   3e-111   
ref|XP_010318692.1|  PREDICTED: probable serine incorporator            336   8e-111   
ref|XP_006341429.1|  PREDICTED: probable serine incorporator-like...    334   3e-110   
ref|XP_006341430.1|  PREDICTED: probable serine incorporator-like...    334   4e-110   
ref|XP_010063622.1|  PREDICTED: probable serine incorporator isof...    333   1e-109   
ref|XP_010063623.1|  PREDICTED: probable serine incorporator isof...    333   1e-109   
ref|XP_011073234.1|  PREDICTED: probable serine incorporator            332   4e-109   
ref|NP_173069.1|  Serinc-domain containing serine and sphingolipi...    328   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003532291.1|  PREDICTED: probable serine incorporator-like       327   2e-107   
ref|XP_002304839.2|  hypothetical protein POPTR_0003s18530g             325   3e-107   Populus trichocarpa [western balsam poplar]
ref|XP_009365247.1|  PREDICTED: probable serine incorporator            327   3e-107   
ref|XP_011082649.1|  PREDICTED: probable serine incorporator            327   4e-107   
ref|XP_007024820.1|  Serinc-domain containing serine and sphingol...    327   4e-107   
ref|XP_008342757.1|  PREDICTED: probable serine incorporator            326   6e-107   
ref|XP_009354238.1|  PREDICTED: probable serine incorporator            326   6e-107   
gb|EYU21792.1|  hypothetical protein MIMGU_mgv1a007183mg                326   6e-107   
ref|XP_003552131.1|  PREDICTED: probable serine incorporator-like       326   7e-107   
gb|EYU21795.1|  hypothetical protein MIMGU_mgv1a007183mg                326   7e-107   
ref|XP_010687311.1|  PREDICTED: probable serine incorporator            325   1e-106   
ref|XP_008381162.1|  PREDICTED: probable serine incorporator            325   1e-106   
ref|XP_007215456.1|  hypothetical protein PRUPE_ppa006404mg             325   1e-106   
gb|KDP41926.1|  hypothetical protein JCGZ_26944                         325   1e-106   
ref|XP_011020548.1|  PREDICTED: probable serine incorporator            325   2e-106   
ref|XP_007215457.1|  hypothetical protein PRUPE_ppa006404mg             325   2e-106   
gb|KHG09631.1|  Serine incorporator 3                                   324   4e-106   
ref|XP_006307669.1|  hypothetical protein CARUB_v10009295mg             324   5e-106   
ref|XP_002270610.1|  PREDICTED: probable serine incorporator            323   5e-106   Vitis vinifera
ref|XP_006493450.1|  PREDICTED: probable serine incorporator-like       323   6e-106   
ref|XP_008228861.1|  PREDICTED: probable serine incorporator            322   2e-105   
emb|CDO98258.1|  unnamed protein product                                321   4e-105   
ref|XP_007140603.1|  hypothetical protein PHAVU_008G126100g             321   5e-105   
ref|XP_006427689.1|  hypothetical protein CICLE_v10025720mg             321   5e-105   
ref|XP_004492298.1|  PREDICTED: probable serine incorporator-like       320   1e-104   
gb|ABK96018.1|  unknown                                                 320   1e-104   Populus trichocarpa [western balsam poplar]
ref|XP_002297693.2|  TMS membrane family protein                        320   1e-104   Populus trichocarpa [western balsam poplar]
ref|XP_002512768.1|  Membrane protein PB1A10.07c, putative              319   3e-104   Ricinus communis
gb|AFK46909.1|  unknown                                                 317   3e-104   
ref|XP_004158797.1|  PREDICTED: probable serine incorporator-like       319   3e-104   
ref|XP_010914044.1|  PREDICTED: probable serine incorporator            319   4e-104   
ref|XP_010107188.1|  putative serine incorporator                       318   1e-103   
ref|XP_010268463.1|  PREDICTED: serine incorporator 3-like              315   2e-102   
ref|XP_010532058.1|  PREDICTED: serine incorporator 3                   313   7e-102   
emb|CAN80335.1|  hypothetical protein VITISV_009414                     312   8e-102   Vitis vinifera
gb|KCW70853.1|  hypothetical protein EUGRSUZ_F03990                     309   2e-101   
ref|XP_002890152.1|  TMS membrane family protein                        311   2e-101   
gb|KEH22798.1|  serinc-domain serine and sphingolipid biosynthesi...    310   7e-101   
gb|KEH22799.1|  serinc-domain serine and sphingolipid biosynthesi...    310   1e-100   
ref|XP_009117776.1|  PREDICTED: serine incorporator 3 isoform X2        309   3e-100   
ref|XP_008794380.1|  PREDICTED: probable serine incorporator            309   3e-100   
emb|CDX81752.1|  BnaC08g38490D                                          308   5e-100   
ref|XP_006416842.1|  hypothetical protein EUTSA_v10007762mg             308   5e-100   
ref|XP_009383181.1|  PREDICTED: probable serine incorporator            308   6e-100   
ref|XP_009110458.1|  PREDICTED: serine incorporator 3-like              308   6e-100   
ref|XP_008790112.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    307   2e-99    
ref|XP_010929191.1|  PREDICTED: probable serine incorporator isof...    306   3e-99    
ref|XP_010929190.1|  PREDICTED: probable serine incorporator isof...    306   4e-99    
ref|XP_010497691.1|  PREDICTED: probable serine incorporator            306   5e-99    
ref|XP_010459155.1|  PREDICTED: probable serine incorporator            306   6e-99    
ref|XP_010476724.1|  PREDICTED: serine incorporator 3                   306   6e-99    
emb|CDY70974.1|  BnaAnng35710D                                          305   7e-99    
ref|XP_009399576.1|  PREDICTED: probable serine incorporator            305   9e-99    
ref|XP_011034606.1|  PREDICTED: probable serine incorporator            305   1e-98    
ref|XP_004954190.1|  PREDICTED: probable serine incorporator-like       301   5e-97    
ref|XP_004303218.1|  PREDICTED: probable serine incorporator-like       300   1e-96    
ref|XP_006649122.1|  PREDICTED: probable serine incorporator-like       298   3e-96    
gb|EAZ24909.1|  hypothetical protein OsJ_08689                          299   3e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008461193.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    299   3e-96    
ref|XP_006845424.1|  hypothetical protein AMTR_s00019p00091080          298   4e-96    
ref|NP_001048364.1|  Os02g0792900                                       298   5e-96    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001130490.1|  hypothetical protein precursor                     298   5e-96    Zea mays [maize]
ref|XP_002454688.1|  hypothetical protein SORBIDRAFT_04g035670          298   9e-96    Sorghum bicolor [broomcorn]
gb|EMT13726.1|  Putative serine incorporator                            297   1e-95    
gb|ACL54492.1|  unknown                                                 297   2e-95    Zea mays [maize]
emb|CDX83957.1|  BnaC08g16880D                                          307   3e-95    
ref|XP_010246591.1|  PREDICTED: serine incorporator 3-like              293   4e-94    
ref|XP_003570284.1|  PREDICTED: probable serine incorporator            292   1e-93    
ref|XP_004302121.1|  PREDICTED: serine incorporator 3-like              284   1e-92    
gb|ABR16232.1|  unknown                                                 286   2e-91    Picea sitchensis
ref|XP_006850791.1|  hypothetical protein AMTR_s00025p00104130          280   6e-90    
ref|XP_004135884.1|  PREDICTED: probable serine incorporator-like       283   6e-90    
gb|ABR17762.1|  unknown                                                 281   2e-89    Picea sitchensis
ref|XP_009391591.1|  PREDICTED: serine incorporator 3                   277   9e-88    
gb|EMS53525.1|  putative serine incorporator                            273   2e-87    
emb|CDY52849.1|  BnaA09g56410D                                          275   2e-87    
ref|XP_009799680.1|  PREDICTED: probable serine incorporator            270   3e-85    
ref|XP_009623079.1|  PREDICTED: probable serine incorporator            270   5e-85    
ref|XP_010255869.1|  PREDICTED: probable serine incorporator            270   6e-85    
ref|XP_010546829.1|  PREDICTED: serine incorporator 3 isoform X1        269   8e-85    
ref|XP_010322266.1|  PREDICTED: serine incorporator 3                   269   8e-85    
ref|XP_010546830.1|  PREDICTED: serine incorporator 3 isoform X2        269   9e-85    
ref|XP_006356686.1|  PREDICTED: serine incorporator 3-like              269   1e-84    
ref|XP_009129653.1|  PREDICTED: probable serine incorporator            268   2e-84    
emb|CDY24707.1|  BnaA05g31060D                                          268   3e-84    
ref|XP_010938752.1|  PREDICTED: probable serine incorporator            266   2e-83    
gb|KDP40096.1|  hypothetical protein JCGZ_02094                         265   4e-83    
ref|XP_010237604.1|  PREDICTED: probable serine incorporator            265   4e-83    
ref|XP_008799134.1|  PREDICTED: probable serine incorporator            265   4e-83    
ref|XP_006419802.1|  hypothetical protein CICLE_v10005070mg             265   5e-83    
emb|CDY05246.1|  BnaC05g45570D                                          265   5e-83    
ref|XP_008673654.1|  PREDICTED: uncharacterized protein LOC100191...    262   6e-83    
ref|XP_002280143.1|  PREDICTED: serine incorporator 3                   265   6e-83    Vitis vinifera
ref|XP_010486107.1|  PREDICTED: probable serine incorporator            264   7e-83    
ref|XP_006297798.1|  hypothetical protein CARUB_v10013833mg             264   9e-83    
tpg|DAA49274.1|  TPA: hypothetical protein ZEAMMB73_017777              261   2e-82    
ref|XP_010464184.1|  PREDICTED: probable serine incorporator            263   2e-82    
ref|XP_010436570.1|  PREDICTED: probable serine incorporator            263   3e-82    
ref|XP_004982576.1|  PREDICTED: probable serine incorporator-like       263   3e-82    
ref|XP_002466928.1|  hypothetical protein SORBIDRAFT_01g016840          263   3e-82    Sorghum bicolor [broomcorn]
ref|XP_010693925.1|  PREDICTED: serine incorporator 3                   263   4e-82    
ref|XP_011090806.1|  PREDICTED: probable serine incorporator            262   4e-82    
ref|XP_006650244.1|  PREDICTED: probable serine incorporator-like       262   7e-82    
ref|XP_010103434.1|  putative serine incorporator                       261   8e-82    
ref|NP_187268.2|  Serinc-domain containing serine and sphingolipi...    261   1e-81    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130812.1|  uncharacterized protein LOC100191916               261   1e-81    Zea mays [maize]
ref|XP_002882452.1|  TMS membrane family protein                        261   2e-81    
ref|XP_006407970.1|  hypothetical protein EUTSA_v10020853mg             261   2e-81    
ref|XP_007034589.1|  Serinc-domain containing serine and sphingol...    260   3e-81    
ref|XP_008458551.1|  PREDICTED: serine incorporator 3                   260   4e-81    
emb|CDO98987.1|  unnamed protein product                                259   6e-81    
ref|XP_002988580.1|  hypothetical protein SELMODRAFT_128126             257   2e-80    
ref|XP_002979274.1|  hypothetical protein SELMODRAFT_110336             257   2e-80    
ref|XP_004150322.1|  PREDICTED: serine incorporator 3-like              257   4e-80    
ref|XP_002516786.1|  Membrane protein PB1A10.07c, putative              257   4e-80    Ricinus communis
ref|XP_008340909.1|  PREDICTED: probable serine incorporator            256   7e-80    
ref|XP_004169518.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...    255   2e-79    
ref|XP_008223013.1|  PREDICTED: probable serine incorporator            255   2e-79    
gb|EYU43840.1|  hypothetical protein MIMGU_mgv1a006662mg                256   2e-79    
ref|XP_007222705.1|  hypothetical protein PRUPE_ppa006444mg             253   2e-78    
gb|ABF97020.1|  TMS membrane family protein, putative, expressed        251   2e-78    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050476.1|  Os03g0454100                                       251   1e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001765634.1|  predicted protein                                  251   1e-77    
gb|EPS57849.1|  hypothetical protein M569_16968                         244   4e-77    
ref|XP_002312742.1|  TMS membrane family protein                        249   6e-77    Populus trichocarpa [western balsam poplar]
ref|XP_004486156.1|  PREDICTED: probable serine incorporator-like       248   9e-77    
ref|XP_011010290.1|  PREDICTED: probable serine incorporator            248   3e-76    
emb|CAN71158.1|  hypothetical protein VITISV_036762                     244   3e-76    Vitis vinifera
gb|AAF30310.1|AC018907_10  hypothetical protein                         243   1e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407969.1|  hypothetical protein EUTSA_v10020853mg             243   1e-75    
dbj|BAJ86142.1|  predicted protein                                      244   4e-75    
gb|ACJ84561.1|  unknown                                                 243   2e-74    Medicago truncatula
gb|EPS68630.1|  hypothetical protein M569_06136                         242   2e-74    
ref|XP_009365800.1|  PREDICTED: probable serine incorporator isof...    241   1e-73    
ref|XP_009342179.1|  PREDICTED: probable serine incorporator            241   1e-73    
ref|XP_009365799.1|  PREDICTED: probable serine incorporator isof...    241   1e-73    
ref|XP_008390818.1|  PREDICTED: probable serine incorporator            239   4e-73    
ref|XP_004296950.1|  PREDICTED: probable serine incorporator-like       237   3e-72    
gb|KCW60869.1|  hypothetical protein EUGRSUZ_H03603                     236   4e-72    
ref|XP_010024424.1|  PREDICTED: serine incorporator 3                   236   5e-72    
ref|XP_007147778.1|  hypothetical protein PHAVU_006G154400g             236   6e-72    
gb|KDO74827.1|  hypothetical protein CISIN_1g039061mg                   234   3e-71    
gb|KHN37564.1|  Putative serine incorporator                            232   3e-70    
gb|KFM24734.1|  putative serine incorporator                            170   2e-46    
ref|XP_005651318.1|  TMS membrane protein/tumor differentially hy...    165   1e-44    
ref|XP_005850950.1|  hypothetical protein CHLNCDRAFT_48549              161   1e-43    
ref|XP_002506090.1|  predicted protein                                  157   8e-42    Micromonas commoda
ref|XP_006595390.1|  PREDICTED: probable serine incorporator-like       155   2e-41    
gb|ABR25551.1|  serine incorporator 3                                   150   1e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_003062471.1|  predicted protein                                  142   3e-36    
ref|XP_002956760.1|  hypothetical protein VOLCADRAFT_83749              134   5e-33    
ref|XP_002965853.1|  hypothetical protein SELMODRAFT_83891              122   5e-29    
gb|AFK47365.1|  unknown                                                 119   5e-29    
gb|KDO46126.1|  hypothetical protein CISIN_1g032312mg                   113   1e-27    
ref|XP_001770496.1|  predicted protein                                  117   2e-27    
ref|XP_002982341.1|  hypothetical protein SELMODRAFT_179397             117   3e-27    
emb|CEG01070.1|  TMS membrane protein/tumour differentially expre...    114   6e-26    
ref|XP_003075128.1|  OJ1249_F12.26 gene product (ISS)                   114   6e-26    
ref|XP_001416509.1|  predicted protein                                  112   2e-25    Ostreococcus lucimarinus CCE9901
gb|AFK34472.1|  unknown                                                 107   3e-24    
ref|XP_002966499.1|  hypothetical protein SELMODRAFT_85365              107   9e-24    
gb|AFK43836.1|  unknown                                                 102   4e-23    
ref|XP_534427.3|  PREDICTED: serine incorporator 3                      104   1e-22    Canis lupus familiaris [dogs]
gb|KDP32305.1|  hypothetical protein JCGZ_13230                         103   3e-22    
ref|XP_006734548.1|  PREDICTED: serine incorporator 3                   103   3e-22    
ref|XP_008058013.1|  PREDICTED: serine incorporator 3                   102   9e-22    
ref|XP_004746435.1|  PREDICTED: serine incorporator 3 isoform X1        102   1e-21    
ref|XP_004414156.1|  PREDICTED: serine incorporator 3                   102   1e-21    
ref|XP_001753882.1|  predicted protein                                  100   2e-21    
ref|XP_009336915.1|  PREDICTED: probable serine incorporator            100   3e-21    
ref|XP_006147626.1|  PREDICTED: serine incorporator 3                   100   3e-21    
ref|XP_003199457.1|  PREDICTED: serine incorporator 1-like              100   5e-21    
emb|CEG74956.1|  hypothetical protein RMATCC62417_10078               99.4    5e-21    
emb|CEG74955.1|  hypothetical protein RMATCC62417_10078               99.4    5e-21    
ref|XP_003620496.1|  Serine incorporator                              99.0    7e-21    
emb|CEJ00743.1|  hypothetical protein RMCBS344292_14792               99.8    8e-21    
ref|XP_008362934.1|  PREDICTED: probable serine incorporator          99.0    8e-21    
emb|CEG74953.1|  hypothetical protein RMATCC62417_10078               99.4    1e-20    
emb|CEG74954.1|  hypothetical protein RMATCC62417_10078               99.4    1e-20    
emb|CEG67770.1|  hypothetical protein RMATCC62417_04149               97.4    1e-20    
ref|XP_007202140.1|  hypothetical protein PRUPE_ppa006940mg           97.4    2e-20    
emb|CEG67769.1|  hypothetical protein RMATCC62417_04149               97.4    2e-20    
ref|XP_009214345.1|  PREDICTED: serine incorporator 3 isoform X2      97.8    3e-20    
ref|XP_008242601.1|  PREDICTED: probable serine incorporator          97.1    3e-20    
ref|XP_004346817.1|  predicted protein                                97.4    4e-20    
ref|XP_002515588.1|  conserved hypothetical protein                   96.7    5e-20    Ricinus communis
gb|EHH65321.1|  Tumor differentially expressed protein 1              97.4    6e-20    
ref|NP_001247901.1|  serine incorporator 3 precursor                  97.4    6e-20    
ref|XP_005569140.1|  PREDICTED: serine incorporator 3 isoform X1      97.4    6e-20    
ref|XP_009352478.1|  PREDICTED: probable serine incorporator          96.3    7e-20    
ref|XP_010382576.1|  PREDICTED: serine incorporator 3                 97.4    7e-20    
ref|NP_001128733.1|  serine incorporator 3 precursor                  97.1    7e-20    Pongo abelii [orang utan]
ref|XP_008337449.1|  PREDICTED: probable serine incorporator          96.3    7e-20    
ref|XP_008696301.1|  PREDICTED: serine incorporator 3                 97.1    8e-20    
ref|XP_003253654.1|  PREDICTED: serine incorporator 3 isoform 2       96.3    8e-20    
gb|EFB21149.1|  hypothetical protein PANDA_005628                     96.7    8e-20    Ailuropoda melanoleuca
ref|XP_002917413.1|  PREDICTED: serine incorporator 3-like            97.1    9e-20    
ref|XP_009887441.1|  PREDICTED: serine incorporator 3                 96.3    9e-20    
gb|EEH05886.1|  DNA mismatch repair protein pms1                      99.0    1e-19    Histoplasma capsulatum G186AR
gb|EGC49614.1|  DNA mismatch repair protein                           99.0    1e-19    
gb|EER41787.1|  DNA mismatch repair protein                           99.0    1e-19    Histoplasma capsulatum H143
ref|XP_002426175.1|  serine incorporator, putative                    95.9    1e-19    Pediculus humanus corporis [human body lice]
gb|KGL85892.1|  Serine incorporator 3                                 95.9    2e-19    
ref|XP_008210211.1|  PREDICTED: probable serine incorporator isof...  95.9    2e-19    
ref|XP_008210203.1|  PREDICTED: probable serine incorporator isof...  95.9    2e-19    
ref|XP_010249828.1|  PREDICTED: probable serine incorporator          95.1    2e-19    
ref|XP_008210231.1|  PREDICTED: serine incorporator 1 isoform X5      95.5    2e-19    
ref|XP_003253653.1|  PREDICTED: serine incorporator 3 isoform 1       95.5    2e-19    
ref|XP_001603720.2|  PREDICTED: probable serine incorporator isof...  95.5    2e-19    Nasonia vitripennis
ref|XP_008210234.1|  PREDICTED: serine incorporator 1 isoform X6      95.5    2e-19    
ref|XP_008210220.1|  PREDICTED: serine incorporator 1 isoform X4      95.5    2e-19    
ref|XP_002747623.2|  PREDICTED: serine incorporator 3                 95.5    3e-19    Callithrix jacchus [common marmoset]
ref|XP_009565857.1|  PREDICTED: serine incorporator 3                 94.7    3e-19    
ref|XP_003936453.1|  PREDICTED: serine incorporator 3                 95.1    4e-19    
ref|XP_001190705.2|  PREDICTED: probable serine incorporator-like     95.1    4e-19    Strongylocentrotus purpuratus [purple urchin]
ref|XP_003071312.1|  TMS membrane protein, putative                   95.1    4e-19    
ref|XP_010191635.1|  PREDICTED: serine incorporator 3                 94.4    5e-19    
ref|XP_004890198.1|  PREDICTED: serine incorporator 3                 94.7    5e-19    
gb|KFO81079.1|  Serine incorporator 3                                 94.7    5e-19    
ref|XP_002994401.1|  hypothetical protein SELMODRAFT_449363           93.6    5e-19    
ref|XP_007077812.1|  PREDICTED: serine incorporator 3                 94.4    7e-19    
ref|XP_001245605.1|  hypothetical protein CIMG_05046                  94.4    7e-19    Coccidioides immitis RS
ref|XP_004687460.1|  PREDICTED: serine incorporator 3                 94.4    8e-19    
gb|KFQ26316.1|  Serine incorporator 3                                 94.0    8e-19    
emb|CEG70157.1|  hypothetical protein RMATCC62417_06104               94.4    8e-19    
ref|XP_003303516.1|  hypothetical protein PTT_15753                   94.7    8e-19    
ref|XP_007530938.1|  PREDICTED: serine incorporator 3                 94.0    9e-19    
gb|EIE81637.1|  hypothetical protein RO3G_06342                       94.4    9e-19    
ref|XP_009507905.1|  PREDICTED: serine incorporator 3-like            93.2    9e-19    
gb|KFW97042.1|  Serine incorporator 3                                 93.6    1e-18    
ref|XP_006921897.1|  PREDICTED: serine incorporator 3                 94.0    1e-18    
ref|XP_001538371.1|  conserved hypothetical protein                   94.7    1e-18    Histoplasma capsulatum NAm1
ref|XP_009806828.1|  PREDICTED: serine incorporator 3                 93.2    1e-18    
gb|EPB88143.1|  hypothetical protein HMPREF1544_05087                 94.0    1e-18    
ref|NP_001076881.1|  serine incorporator 3 precursor                  93.6    1e-18    Bos taurus [bovine]
gb|ELR50968.1|  Serine incorporator 3                                 93.6    1e-18    
ref|XP_007248380.1|  PREDICTED: serine incorporator 3-like            93.6    1e-18    
gb|EOB03622.1|  Serine incorporator 3                                 92.8    1e-18    
gb|EEQ92459.1|  membrane protein TMS1                                 93.6    1e-18    Blastomyces dermatitidis ER-3
ref|XP_002626102.1|  serine incorporator                              93.6    2e-18    Blastomyces gilchristii SLH14081
ref|XP_001803629.1|  hypothetical protein SNOG_13417                  93.6    2e-18    Parastagonospora nodorum SN15
ref|XP_005016470.1|  PREDICTED: serine incorporator 3                 92.8    2e-18    
ref|XP_010925321.1|  PREDICTED: probable serine incorporator          92.4    2e-18    
ref|XP_007970374.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...  93.2    2e-18    
ref|XP_006132306.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...  92.4    2e-18    
dbj|BAM19260.1|  membrane protein tms1d                               92.8    2e-18    
gb|KFV41444.1|  Serine incorporator 3                                 92.8    2e-18    
ref|NP_001279601.1|  serine incorporator 3 precursor                  92.8    2e-18    
gb|EXX52304.1|  Tms1p                                                 92.4    2e-18    
ref|XP_009161557.1|  hypothetical protein HMPREF1120_09034            92.4    3e-18    
dbj|BAG62311.1|  unnamed protein product                              91.7    3e-18    Homo sapiens [man]
ref|XP_005146793.1|  PREDICTED: serine incorporator 3                 91.7    4e-18    
ref|XP_006202573.1|  PREDICTED: serine incorporator 3                 92.4    4e-18    
ref|XP_008942974.1|  PREDICTED: serine incorporator 3-like            91.3    4e-18    
ref|XP_009980407.1|  PREDICTED: serine incorporator 3                 91.7    4e-18    
dbj|BAG58147.1|  unnamed protein product                              91.7    4e-18    Homo sapiens [man]
ref|XP_004062246.1|  PREDICTED: serine incorporator 3 isoform 1       92.0    5e-18    
ref|XP_003825976.1|  PREDICTED: serine incorporator 3                 92.0    5e-18    
ref|XP_003787861.1|  PREDICTED: serine incorporator 3                 90.5    5e-18    
ref|XP_002583546.1|  conserved hypothetical protein                   92.0    5e-18    Uncinocarpus reesii 1704
ref|XP_001917465.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...  92.0    5e-18    Equus caballus [domestic horse]
gb|KEQ97837.1|  hypothetical protein AUEXF2481DRAFT_95498             92.0    6e-18    
ref|XP_005327165.1|  PREDICTED: serine incorporator 3                 91.7    6e-18    
ref|XP_009865640.1|  PREDICTED: serine incorporator 3                 91.3    6e-18    
dbj|BAD96643.1|  tumor differentially expressed protein 1 variant     91.7    6e-18    Homo sapiens [man]
gb|KEQ63452.1|  TMS membrane protein/tumor differentially express...  91.7    6e-18    
gb|EAW75915.1|  serine incorporator 3, isoform CRA_a                  91.7    6e-18    
ref|XP_004559867.1|  PREDICTED: serine incorporator 1-like            91.7    6e-18    
gb|KFU98418.1|  Serine incorporator 3                                 91.7    6e-18    
ref|NP_006802.1|  serine incorporator 3 precursor                     91.7    7e-18    
ref|XP_009435498.1|  PREDICTED: serine incorporator 3 isoform X1      91.7    7e-18    
ref|XP_005871298.1|  PREDICTED: serine incorporator 3 isoform X1      91.7    7e-18    
gb|KFQ33847.1|  Serine incorporator 3                                 91.3    8e-18    
ref|XP_006059288.1|  PREDICTED: serine incorporator 3                 91.3    8e-18    
ref|XP_010073800.1|  PREDICTED: serine incorporator 3-like            90.9    8e-18    
ref|XP_006668148.1|  membrane protein TMS1, putative                  91.3    8e-18    
ref|XP_005726804.1|  PREDICTED: serine incorporator 1-like            91.3    8e-18    
ref|XP_005688637.1|  PREDICTED: serine incorporator 3                 91.3    9e-18    
ref|XP_005954769.1|  PREDICTED: serine incorporator 3                 91.3    9e-18    
ref|XP_009635627.1|  PREDICTED: serine incorporator 3                 90.5    9e-18    
ref|NP_001267317.1|  serine incorporator 3 precursor                  91.3    9e-18    
ref|XP_008579000.1|  PREDICTED: serine incorporator 3                 91.3    1e-17    
ref|XP_005085060.1|  PREDICTED: serine incorporator 3                 91.3    1e-17    
ref|XP_004014636.1|  PREDICTED: serine incorporator 3                 91.3    1e-17    
ref|XP_010879048.1|  PREDICTED: serine incorporator 3-like            91.3    1e-17    
ref|XP_007067355.1|  PREDICTED: serine incorporator 3                 90.5    1e-17    
gb|AAD34641.1|AF153979_1  transmembrane protein SBBI99                91.3    1e-17    
ref|XP_009928061.1|  PREDICTED: serine incorporator 3 isoform X2      90.5    1e-17    
ref|XP_010144980.1|  PREDICTED: serine incorporator 3-like            89.4    1e-17    
gb|KEQ81147.1|  TMS membrane protein/tumor differentially express...  91.3    1e-17    
gb|KFP75273.1|  Serine incorporator 3                                 90.9    1e-17    
ref|XP_007152808.1|  hypothetical protein PHAVU_004G161400g           90.1    1e-17    
gb|KFU98253.1|  Serine incorporator 3                                 90.9    1e-17    
gb|ABK22983.1|  unknown                                               89.4    1e-17    
ref|XP_009408948.1|  PREDICTED: probable serine incorporator          90.1    1e-17    
ref|XP_008731904.1|  hypothetical protein G647_09379                  90.9    1e-17    
ref|XP_006639525.1|  PREDICTED: serine incorporator 1-like            90.1    1e-17    
emb|CDQ72446.1|  unnamed protein product                              90.5    2e-17    
gb|KFP14726.1|  Serine incorporator 3                                 90.5    2e-17    
ref|XP_008272698.1|  PREDICTED: serine incorporator 3 isoform X3      90.1    2e-17    
ref|XP_009477945.1|  PREDICTED: serine incorporator 3                 90.1    2e-17    
ref|XP_010021943.1|  PREDICTED: serine incorporator 3                 89.7    2e-17    
ref|XP_007761600.1|  hypothetical protein A1O7_09422                  90.5    2e-17    
gb|EZF71972.1|  hypothetical protein H105_05899                       89.7    2e-17    
gb|KFP93104.1|  Serine incorporator 3                                 90.1    2e-17    
ref|XP_009932093.1|  PREDICTED: serine incorporator 3                 89.7    2e-17    
gb|KFQ50088.1|  Serine incorporator 3                                 90.1    2e-17    
gb|KFV89836.1|  Serine incorporator 3                                 88.6    2e-17    
ref|XP_011043440.1|  PREDICTED: probable serine incorporator          89.4    2e-17    
gb|EZF28474.1|  hypothetical protein H101_07842                       89.7    2e-17    
ref|XP_010171348.1|  PREDICTED: serine incorporator 3                 90.1    2e-17    
gb|KFZ63206.1|  Serine incorporator 3                                 90.1    2e-17    
ref|XP_009141296.1|  PREDICTED: probable serine incorporator isof...  89.4    2e-17    
gb|KFZ64738.1|  Serine incorporator 3                                 90.1    2e-17    
ref|XP_010568004.1|  PREDICTED: serine incorporator 3                 90.1    2e-17    
gb|AGG38115.1|  maternal effect embryo arrest 55-2 protein            88.2    2e-17    
ref|NP_001008313.1|  serine incorporator 3 precursor                  90.1    2e-17    
gb|AET05293.2|  serinc-domain serine and sphingolipid biosynthesi...  89.4    3e-17    
ref|XP_009928060.1|  PREDICTED: serine incorporator 3 isoform X1      90.1    3e-17    
ref|XP_010629763.1|  PREDICTED: serine incorporator 3 isoform X2      89.4    3e-17    
ref|XP_002394743.1|  hypothetical protein MPER_05316                  87.8    3e-17    
ref|XP_009706336.1|  PREDICTED: serine incorporator 3                 89.4    3e-17    
ref|NP_001053258.1|  Os04g0506300                                     89.0    3e-17    
gb|EMD93772.1|  hypothetical protein COCHEDRAFT_1132482               89.7    3e-17    
ref|XP_010296076.1|  PREDICTED: serine incorporator 3                 89.0    3e-17    
gb|KFQ45096.1|  Serine incorporator 3                                 89.7    3e-17    
ref|XP_009141295.1|  PREDICTED: probable serine incorporator isof...  89.4    3e-17    
ref|XP_004430427.1|  PREDICTED: serine incorporator 3                 89.7    3e-17    
gb|KFR10077.1|  Serine incorporator 3                                 89.7    3e-17    
ref|XP_004336528.1|  serine incorporator 3, putative                  89.4    3e-17    
gb|KDO54165.1|  hypothetical protein CISIN_1g0159802mg                87.8    4e-17    
ref|XP_004134388.1|  PREDICTED: serine incorporator 3-like            89.4    4e-17    
ref|XP_005304724.1|  PREDICTED: serine incorporator 3                 89.4    4e-17    
ref|XP_007687418.1|  hypothetical protein COCMIDRAFT_93798            89.7    4e-17    
ref|XP_008024685.1|  hypothetical protein SETTUDRAFT_168930           89.7    4e-17    
ref|XP_008438416.1|  PREDICTED: probable serine incorporator isof...  89.0    4e-17    
gb|EUN26863.1|  hypothetical protein COCVIDRAFT_99736                 89.7    4e-17    
ref|XP_002455066.1|  hypothetical protein SORBIDRAFT_03g003750        89.0    4e-17    
ref|XP_007338591.1|  TMS membrane protein/tumor differentially ex...  89.7    4e-17    
gb|KGN56781.1|  hypothetical protein Csa_3G133320                     89.4    4e-17    
ref|XP_010139603.1|  PREDICTED: serine incorporator 3                 89.0    4e-17    
ref|XP_007701878.1|  hypothetical protein COCSADRAFT_121304           89.4    4e-17    
ref|XP_002721118.1|  PREDICTED: serine incorporator 3 isoform X2      89.4    4e-17    
ref|XP_005452254.1|  PREDICTED: serine incorporator 3-like            89.4    4e-17    
gb|KFO30238.1|  Serine incorporator 3                                 89.4    4e-17    
ref|XP_008438413.1|  PREDICTED: probable serine incorporator isof...  89.4    4e-17    
ref|XP_010629762.1|  PREDICTED: serine incorporator 3 isoform X1      89.4    4e-17    
ref|XP_010957009.1|  PREDICTED: serine incorporator 3 isoform X2      88.6    4e-17    
ref|XP_008438414.1|  PREDICTED: probable serine incorporator isof...  89.0    4e-17    
gb|KFO04100.1|  Serine incorporator 3                                 89.0    4e-17    
ref|XP_008272697.1|  PREDICTED: serine incorporator 3 isoform X1      89.4    4e-17    
ref|XP_009585513.1|  PREDICTED: serine incorporator 3                 88.6    5e-17    
ref|XP_007709253.1|  hypothetical protein COCCADRAFT_88158            89.4    5e-17    
ref|XP_009280465.1|  PREDICTED: serine incorporator 3                 88.6    5e-17    
ref|XP_007160349.1|  hypothetical protein PHAVU_002G314300g           88.2    5e-17    
gb|EZF16039.1|  hypothetical protein H100_05889                       89.0    5e-17    
ref|XP_002739996.1|  PREDICTED: serine incorporator 1-like            89.0    5e-17    
ref|XP_010290348.1|  PREDICTED: serine incorporator 3                 88.6    5e-17    
gb|KFP60282.1|  Serine incorporator 3                                 89.0    5e-17    
ref|XP_009324988.1|  PREDICTED: serine incorporator 3                 88.6    5e-17    
ref|XP_004512855.1|  PREDICTED: probable serine incorporator-like     88.2    5e-17    
ref|XP_008438411.1|  PREDICTED: probable serine incorporator isof...  89.0    5e-17    
ref|XP_007292046.1|  serine incorporator                              89.0    6e-17    
gb|KFQ78329.1|  Serine incorporator 3                                 89.0    6e-17    
gb|AGG19193.1|  maternal effect embryo arrest 55-1                    88.2    6e-17    
ref|XP_010542976.1|  PREDICTED: probable serine incorporator          88.2    6e-17    
gb|EST08485.1|  endosomal membrane protein, EMP70                     89.0    6e-17    
gb|KFO83903.1|  Serine incorporator 3                                 88.6    6e-17    
emb|CDY37743.1|  BnaA04g19250D                                        89.4    6e-17    
ref|XP_005235956.1|  PREDICTED: serine incorporator 3                 88.2    6e-17    
ref|XP_003382412.1|  PREDICTED: serine incorporator 1-like isoform 2  89.0    7e-17    
gb|KFV98619.1|  Serine incorporator 3                                 88.6    7e-17    
gb|KFQ68227.1|  Serine incorporator 3                                 88.6    7e-17    
emb|CDS07507.1|  hypothetical protein LRAMOSA01456                    89.0    7e-17    
gb|KFM09471.1|  Serine incorporator 3                                 88.6    7e-17    
gb|KFW68990.1|  Serine incorporator 3                                 88.6    7e-17    
gb|KFH68448.1|  hypothetical protein MVEG_05263                       88.6    7e-17    
ref|XP_005057115.1|  PREDICTED: serine incorporator 3                 88.6    7e-17    
gb|KDO43051.1|  hypothetical protein CISIN_1g037485mg                 87.4    8e-17    
ref|XP_009390129.1|  PREDICTED: probable serine incorporator          88.2    8e-17    
ref|XP_011020713.1|  PREDICTED: serine incorporator 3 isoform X4      87.0    8e-17    
gb|KGQ04935.1|  Membrane protein TMS1                                 88.6    8e-17    
ref|XP_010527190.1|  PREDICTED: probable serine incorporator          87.8    8e-17    
ref|XP_003382411.1|  PREDICTED: serine incorporator 1-like isoform 1  88.6    8e-17    
ref|XP_006451100.1|  hypothetical protein CICLE_v10008536mg           87.4    9e-17    
ref|XP_003842629.1|  similar to membrane protein TMS1                 88.6    9e-17    
ref|XP_008039450.1|  hypothetical protein TRAVEDRAFT_168740           88.6    9e-17    
gb|ACN36229.1|  unknown                                               87.8    9e-17    
gb|EYE97808.1|  TMS membrane protein/tumor differentially express...  88.6    9e-17    
gb|EIE82818.1|  hypothetical protein RO3G_07523                       87.4    9e-17    
ref|XP_006971084.1|  PREDICTED: serine incorporator 3                 88.2    1e-16    
ref|XP_008342071.1|  PREDICTED: probable serine incorporator          87.8    1e-16    
emb|CDY39551.1|  BnaC07g07190D                                        87.4    1e-16    
ref|XP_009619984.1|  PREDICTED: probable serine incorporator          87.4    1e-16    
ref|XP_011020711.1|  PREDICTED: serine incorporator 3 isoform X3      87.0    1e-16    
ref|XP_006193570.1|  PREDICTED: serine incorporator 3                 88.2    1e-16    
emb|CDM81834.1|  unnamed protein product                              87.4    1e-16    
ref|XP_008918268.1|  PREDICTED: serine incorporator 3                 87.4    1e-16    
ref|XP_005515348.1|  PREDICTED: serine incorporator 3                 87.4    1e-16    
ref|XP_008632015.1|  PREDICTED: serine incorporator 3                 87.4    1e-16    
ref|XP_010532841.1|  PREDICTED: probable serine incorporator          87.0    1e-16    
ref|XP_004968422.1|  PREDICTED: probable serine incorporator-like...  87.4    1e-16    
ref|XP_009669399.1|  PREDICTED: serine incorporator 3                 87.4    1e-16    
gb|EMT13739.1|  Putative serine incorporator                          87.8    1e-16    
ref|XP_006492163.1|  PREDICTED: probable serine incorporator-like     87.0    1e-16    
gb|AAS66282.1|  LRRGT00191                                            89.4    1e-16    
ref|NP_001042203.1|  Os01g0179800                                     87.4    1e-16    
ref|NP_001240143.1|  uncharacterized protein LOC100788574             87.0    1e-16    
ref|XP_009071136.1|  PREDICTED: serine incorporator 3                 87.4    1e-16    
ref|XP_007893061.1|  PREDICTED: serine incorporator 1-like            87.8    1e-16    
ref|XP_009381145.1|  PREDICTED: probable serine incorporator          87.0    1e-16    
ref|XP_003019590.1|  hypothetical protein TRV_06386                   87.4    2e-16    
ref|NP_001131274.1|  uncharacterized protein LOC100192587             86.3    2e-16    
gb|EMC88869.1|  Serine incorporator 3                                 87.4    2e-16    
gb|EEC70050.1|  hypothetical protein OsI_00646                        87.4    2e-16    
ref|XP_003016496.1|  hypothetical protein ARB_04785                   87.0    2e-16    
gb|EEE53986.1|  hypothetical protein OsJ_00615                        87.4    2e-16    
ref|XP_009471575.1|  PREDICTED: serine incorporator 3                 87.0    2e-16    
ref|XP_009107689.1|  PREDICTED: probable serine incorporator          86.7    2e-16    
gb|EMF14941.1|  TMS membrane protein/tumor differentially express...  87.4    2e-16    
ref|XP_001275614.1|  membrane protein TMS1, putative                  87.4    2e-16    
gb|EZA50206.1|  putative serine incorporator                          87.0    2e-16    
gb|KFO53165.1|  Serine incorporator 3                                 87.4    2e-16    
gb|EFN89882.1|  Serine incorporator 1                                 87.0    2e-16    
ref|XP_005422288.1|  PREDICTED: serine incorporator 3                 86.7    2e-16    
gb|KFV79352.1|  Serine incorporator 3                                 87.4    2e-16    
emb|CDH53974.1|  related to tms1 protein                              87.4    2e-16    
ref|NP_850202.4|  Serinc-domain containing serine and sphingolipi...  86.7    2e-16    
ref|XP_007597507.1|  serine incorporator                              87.0    2e-16    
ref|XP_007013229.1|  Serinc-domain containing serine and sphingol...  86.3    2e-16    
ref|XP_006420513.1|  hypothetical protein CICLE_v10006912mg           86.3    2e-16    
ref|XP_008187951.1|  PREDICTED: probable serine incorporator isof...  87.0    2e-16    
ref|XP_001947564.2|  PREDICTED: probable serine incorporator isof...  87.0    2e-16    
gb|KFW77793.1|  Serine incorporator 3                                 87.0    2e-16    
gb|KFP70119.1|  Serine incorporator 3                                 87.0    3e-16    
ref|XP_004586116.1|  PREDICTED: serine incorporator 3                 87.0    3e-16    
ref|XP_004287083.1|  PREDICTED: serine incorporator 3-like            86.3    3e-16    
ref|XP_011020710.1|  PREDICTED: probable serine incorporator isof...  86.7    3e-16    
ref|XP_011091387.1|  PREDICTED: probable serine incorporator          86.7    3e-16    
ref|XP_002885648.1|  TMS membrane family protein                      86.3    3e-16    
ref|XP_011020709.1|  PREDICTED: probable serine incorporator isof...  86.7    3e-16    
ref|XP_007420896.1|  PREDICTED: serine incorporator 3                 86.7    3e-16    
ref|XP_006297795.1|  hypothetical protein CARUB_v10013830mg           86.3    3e-16    
ref|XP_007002499.1|  hypothetical protein TREMEDRAFT_37929            87.0    3e-16    
ref|XP_002324973.1|  TMS membrane family protein                      86.3    3e-16    
ref|XP_007145428.1|  hypothetical protein PHAVU_007G238300g           86.3    3e-16    
ref|NP_001146222.1|  uncharacterized protein LOC100279792             86.3    3e-16    
gb|ESA19644.1|  hypothetical protein GLOINDRAFT_19362                 87.0    3e-16    
ref|XP_009972361.1|  PREDICTED: serine incorporator 3                 86.3    3e-16    
gb|ESA09597.1|  hypothetical protein GLOINDRAFT_80906                 86.3    3e-16    
gb|KFV41188.1|  Serine incorporator 3                                 86.7    3e-16    
gb|EFQ27559.1|  serine incorporator                                   86.7    3e-16    
gb|KFR06691.1|  Serine incorporator 3                                 86.7    3e-16    
ref|XP_006618653.1|  PREDICTED: probable serine incorporator-like...  86.7    3e-16    
ref|XP_006618651.1|  PREDICTED: probable serine incorporator-like...  86.7    3e-16    
ref|XP_003653050.1|  hypothetical protein THITE_2115040               86.7    4e-16    
ref|XP_006618652.1|  PREDICTED: probable serine incorporator-like...  86.7    4e-16    
ref|XP_008600130.1|  serine incorporator                              86.7    4e-16    
ref|XP_006618654.1|  PREDICTED: probable serine incorporator-like...  86.3    4e-16    
ref|XP_006275280.1|  PREDICTED: serine incorporator 3                 86.7    4e-16    
gb|EKG14098.1|  TMS membrane protein/tumor differentially express...  86.7    4e-16    
dbj|GAC71301.1|  endosomal membrane proteins, EMP70                   87.8    4e-16    
dbj|BAK01836.1|  predicted protein                                    86.3    4e-16    
ref|XP_009091225.1|  PREDICTED: serine incorporator 3                 86.3    4e-16    
ref|NP_189089.3|  Serinc-domain containing serine and sphingolipi...  85.9    4e-16    
ref|XP_002863245.1|  hypothetical protein ARALYDRAFT_497050           85.5    4e-16    
ref|XP_007643293.1|  PREDICTED: serine incorporator 3 isoform X2      85.9    4e-16    
ref|XP_010513493.1|  PREDICTED: probable serine incorporator          85.9    4e-16    
emb|CDP03356.1|  unnamed protein product                              85.5    5e-16    
gb|EJU04752.1|  TMS membrane protein                                  86.3    5e-16    
ref|XP_005491357.1|  PREDICTED: serine incorporator 3                 85.5    5e-16    
gb|EXX55775.1|  Tms1p                                                 86.3    5e-16    
ref|XP_008224089.1|  PREDICTED: probable serine incorporator          85.9    5e-16    
ref|NP_001085879.1|  serine incorporator 3 precursor                  86.3    5e-16    
ref|XP_002798067.1|  membrane protein TMS1                            86.3    5e-16    
gb|EJT47328.1|  vacuolar transmembrane protein, Tms1p                 86.3    5e-16    
ref|NP_001038647.1|  serine incorporator 2 precursor                  85.9    6e-16    
ref|XP_006016787.1|  PREDICTED: serine incorporator 3                 86.3    6e-16    
ref|XP_005524734.1|  PREDICTED: serine incorporator 3                 85.9    6e-16    
gb|EPY74192.1|  serine incorporator 3 precursor                       85.1    6e-16    
gb|KHJ32730.1|  putative serine incorporator                          85.9    7e-16    
ref|XP_003630817.1|  Serine incorporator                              85.5    7e-16    
dbj|GAC92975.1|  hypothetical protein PHSY_000535                     85.9    7e-16    
ref|XP_001399368.2|  membrane protein TMS1                            85.5    7e-16    
ref|XP_003660386.1|  hypothetical protein MYCTH_2298645               85.9    7e-16    
ref|XP_008471585.1|  PREDICTED: serine incorporator 1                 86.7    7e-16    
gb|AAA74236.1|  overexpressed in testicular tumors                    85.1    7e-16    
emb|CCF39398.1|  serine incorporator                                  85.9    8e-16    



>ref|XP_009615680.1| PREDICTED: serine incorporator 3 isoform X2 [Nicotiana tomentosiformis]
Length=413

 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 206/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVKNQKDPRDS+HHGGWMMKI CW L+VIFMFFLPN I+S 
Sbjct  81   LRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVH WNDKWVGY+EQFWY+AL VV+L+CYVA FAFNGL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVAAFAFNGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSGH+CGLNTFFIVMTLI +F FAVVTLHPSV+GSI PASVLSLYCTYLCYS L
Sbjct  201  LFHFFTPSGHDCGLNTFFIVMTLIVIFVFAVVTLHPSVRGSILPASVLSLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVSSG+L LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSAVRAGSST  306



>ref|XP_009759114.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009759115.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   338 bits (868),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 193/226 (85%), Positives = 206/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVKNQKDPRDS+HHGGWMMKI CW L+VIFMFFLPN I+S 
Sbjct  81   LRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVH WNDKWVGY+EQFWY+AL VV+L+CYVATFAFNGL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVATFAFNGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSGH+CGLNTFFIVMTLI +F FAVVTLHPSV GSI PASVLSLYCTYLCYS L
Sbjct  201  LFHFFTPSGHDCGLNTFFIVMTLIVIFIFAVVTLHPSVGGSILPASVLSLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVSSG+L LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSAVRAGSST  306



>ref|XP_009759116.1| PREDICTED: probable serine incorporator isoform X2 [Nicotiana 
sylvestris]
Length=411

 Score =   338 bits (868),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 193/226 (85%), Positives = 206/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVKNQKDPRDS+HHGGWMMKI CW L+VIFMFFLPN I+S 
Sbjct  81   LRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVH WNDKWVGY+EQFWY+AL VV+L+CYVATFAFNGL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVATFAFNGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSGH+CGLNTFFIVMTLI +F FAVVTLHPSV GSI PASVLSLYCTYLCYS L
Sbjct  201  LFHFFTPSGHDCGLNTFFIVMTLIVIFIFAVVTLHPSVGGSILPASVLSLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVSSG+L LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSAVRAGSST  306



>ref|XP_009615679.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVKNQKDPRDS+HHGGWMMKI CW L+VIFMFFLPN I+S 
Sbjct  81   LRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVH WNDKWVGY+EQFWY+AL VV+L+CYVA FAFNGL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVAAFAFNGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSGH+CGLNTFFIVMTLI +F FAVVTLHPSV GSI PASVLSLYCTYLCYS L
Sbjct  201  LFHFFTPSGHDCGLNTFFIVMTLIVIFVFAVVTLHPSVGGSILPASVLSLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVSSG+L LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSAVRAGSST  306



>ref|XP_009615681.1| PREDICTED: probable serine incorporator isoform X3 [Nicotiana 
tomentosiformis]
Length=411

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVKNQKDPRDS+HHGGWMMKI CW L+VIFMFFLPN I+S 
Sbjct  81   LRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVH WNDKWVGY+EQFWY+AL VV+L+CYVA FAFNGL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVAAFAFNGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSGH+CGLNTFFIVMTLI +F FAVVTLHPSV GSI PASVLSLYCTYLCYS L
Sbjct  201  LFHFFTPSGHDCGLNTFFIVMTLIVIFVFAVVTLHPSVGGSILPASVLSLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVSSG+L LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSAVRAGSST  306



>ref|XP_010318692.1| PREDICTED: probable serine incorporator [Solanum lycopersicum]
Length=413

 Score =   336 bits (861),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 193/226 (85%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVKNQKDPRDS+HHGGWMMKI CW L+VIFMFFLPN I+S 
Sbjct  81   LRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVH WNDKWVGY+EQFWY+AL VV+L+CYVATFAFNGL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVATFAFNGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSG +CGLNTFFIVMTLI +F FAVVTLHPSV GSI PASVLSLYCTYLCYS L
Sbjct  201  LFHFFTPSGQDCGLNTFFIVMTLILIFGFAVVTLHPSVGGSILPASVLSLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVSSGTL LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSSGTLALGLLTTVLSVVYSAVRAGSST  306



>ref|XP_006341429.1| PREDICTED: probable serine incorporator-like isoform X1 [Solanum 
tuberosum]
Length=413

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVKNQKDPRDS+HHGGWMMKI CW L+VIFMFFLPN I+S 
Sbjct  81   LRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVH WNDKWVGY+EQFWY+AL  V+L+CYVATFAFNGL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLAVSLVCYVATFAFNGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSG +CGLNTFFIVMTLI +F FAVVTLHPSV GSI PASVLSLYCTYLCYS L
Sbjct  201  LFHFFTPSGQDCGLNTFFIVMTLILIFGFAVVTLHPSVGGSILPASVLSLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVSSGTL LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSSGTLALGLLTTVLSVVYSAVRAGSST  306



>ref|XP_006341430.1| PREDICTED: probable serine incorporator-like isoform X2 [Solanum 
tuberosum]
Length=411

 Score =   334 bits (857),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVKNQKDPRDS+HHGGWMMKI CW L+VIFMFFLPN I+S 
Sbjct  81   LRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVH WNDKWVGY+EQFWY+AL  V+L+CYVATFAFNGL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLAVSLVCYVATFAFNGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSG +CGLNTFFIVMTLI +F FAVVTLHPSV GSI PASVLSLYCTYLCYS L
Sbjct  201  LFHFFTPSGQDCGLNTFFIVMTLILIFGFAVVTLHPSVGGSILPASVLSLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVSSGTL LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSSGTLALGLLTTVLSVVYSAVRAGSST  306



>ref|XP_010063622.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
Length=414

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/226 (83%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ MMIGVKNQ+DPRD +HHGGWMMKI CW L+VIFMFFLPNEI+S 
Sbjct  81   LRVSLGNFLFFTILAIMMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSG FLL+QVVLLLDFVHGWNDKW GY+EQFWYIALFVV+L+CYVA FAF+G+
Sbjct  141  YESISKFGSGFFLLIQVVLLLDFVHGWNDKWAGYDEQFWYIALFVVSLVCYVAAFAFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSGH+CGLNTFFIV+TLIF F FAVV LHP+V GSI PA+V+SLYC YLCYSGL
Sbjct  201  LFHFFTPSGHDCGLNTFFIVVTLIFAFLFAVVALHPAVNGSILPAAVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTLTLGLVTTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHAHSKAVSTGTLTLGLVTTVLSVVYSAVRAGSST  306



>ref|XP_010063623.1| PREDICTED: probable serine incorporator isoform X2 [Eucalyptus 
grandis]
 gb|KCW70852.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=412

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/226 (83%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ MMIGVKNQ+DPRD +HHGGWMMKI CW L+VIFMFFLPNEI+S 
Sbjct  81   LRVSLGNFLFFTILAIMMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSG FLL+QVVLLLDFVHGWNDKW GY+EQFWYIALFVV+L+CYVA FAF+G+
Sbjct  141  YESISKFGSGFFLLIQVVLLLDFVHGWNDKWAGYDEQFWYIALFVVSLVCYVAAFAFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSGH+CGLNTFFIV+TLIF F FAVV LHP+V GSI PA+V+SLYC YLCYSGL
Sbjct  201  LFHFFTPSGHDCGLNTFFIVVTLIFAFLFAVVALHPAVNGSILPAAVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTLTLGLVTTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHAHSKAVSTGTLTLGLVTTVLSVVYSAVRAGSST  306



>ref|XP_011073234.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073235.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073236.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   332 bits (851),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 186/226 (82%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+  MIGVKNQKDPRDS+HHGGWMMKI CW ++VI MFF+PN I+S 
Sbjct  81   LRVSLGNFLFFTILAIFMIGVKNQKDPRDSIHHGGWMMKIICWCILVILMFFVPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE TSKFGSGLFLLVQVVLLLDFVHGWNDKWVGY+EQFWY+AL VV+L+CYVATF+F+GL
Sbjct  141  YEATSKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYMALLVVSLVCYVATFSFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF+ F PSGH+CGLNTFFIVMTLIFVF FAVVTLHPSV GSI PASV+SLYC YLCYSGL
Sbjct  201  LFYLFTPSGHDCGLNTFFIVMTLIFVFVFAVVTLHPSVSGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+ +L LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTSSLALGLLTTVLSVVYSAVRAGSST  306



>ref|NP_173069.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 ref|NP_001185008.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAF18512.1|AC010924_25 Contains similarity to gb|AF181686 membrane protein TMS1d from 
Drosophila melanogaster. ESTs gb|R64994, gb|AI994832, gb|Z47674 
come from this gene [Arabidopsis thaliana]
 gb|AEE29416.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEE29417.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=412

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/226 (81%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF+ LS MMIGVKNQKDPRD +HHGGWMMKI CW ++VIFMFFLPNEI+S 
Sbjct  81   LRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIICWCILVIFMFFLPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+G 
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSGF  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFI+MTLIFVF FA+V LHP+V GSI PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIIMTLIFVFVFAIVVLHPTVGGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHNHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_003532291.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN07179.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M+GVK Q+DPRDS+HHGGWMMKI CW L+VIFMFF+PNEI+S 
Sbjct  81   LRVSLGNFLFFTILAVLMVGVKTQRDPRDSMHHGGWMMKIICWCLLVIFMFFVPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG+FLLVQV+LLLDFVHGWNDKWVGY+EQFWYIALFVV+L+CYVATFAF+G+
Sbjct  141  YETISKFGSGMFLLVQVMLLLDFVHGWNDKWVGYDEQFWYIALFVVSLVCYVATFAFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSG +CGLN FFI MT+I  F FA+V LHP+V GS+ PASV+SLYCTYLCYS L
Sbjct  201  LFHFFTPSGQDCGLNVFFITMTMILAFVFAIVALHPAVNGSVLPASVISLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTLTLGL TTVLSVVYSAVRAGSS 
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTLTLGLATTVLSVVYSAVRAGSSA  306



>ref|XP_002304839.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
 gb|EEE79818.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
Length=364

 Score =   325 bits (834),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FFT L+ MM+GVKNQKDPRDS+HHGGWM K+ CW ++VI MFFLPNEIVS 
Sbjct  81   LRVSLGNFMFFTILATMMVGVKNQKDPRDSLHHGGWMAKVVCWCILVILMFFLPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWNDKWVGY+E+FWY+ALFVV+L+CYV TFAF+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEKFWYVALFVVSLVCYVGTFAFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFIVMTLIF F FA+V LHP+V GS+ PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGQDCGLNTFFIVMTLIFAFVFAIVALHPAVNGSVLPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   HSKAVS+GTL++GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPREYECNGLHRHSKAVSTGTLSIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_009365247.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009365248.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 184/226 (81%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT LS MM+GVKNQKDPRDS+HHGGWMMK+ CW L+VIFMFF+PNEIVS 
Sbjct  81   LRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG FLLVQVVLLLDFVHGWNDKWVGY+E+FWY+ALFVV+L+CY+ATF F+GL
Sbjct  141  YETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEKFWYVALFVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFIVMTL+ VF F +V LHPSV GSI PASV+S+YCTYLCYS L
Sbjct  201  LFHWFTPSGQDCGLNTFFIVMTLMCVFGFLIVALHPSVSGSILPASVISMYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTLT GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYSAVRAGSST  306



>ref|XP_011082649.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 182/226 (81%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+  MIGVKNQKD RDS+HHGGWMMKI CW ++VI MFFLPN I+S 
Sbjct  81   LRVSLGNFLFFTILAIFMIGVKNQKDSRDSLHHGGWMMKIICWCILVILMFFLPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE TSKFGSGLFLLVQVVLLLDF+HGWN+KWVGY+EQFWYIAL VV+LICYVATF+F+GL
Sbjct  141  YEATSKFGSGLFLLVQVVLLLDFIHGWNEKWVGYDEQFWYIALLVVSLICYVATFSFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF+ FAPSGH+CGLNTFFIVMTLI VF FA++TLHPSV GSI P+SV+SLYC YLCYSGL
Sbjct  201  LFYLFAPSGHDCGLNTFFIVMTLILVFVFAIITLHPSVSGSILPSSVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+ +L +GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHRHSKAVSTSSLAIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_007024820.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 ref|XP_007024821.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27442.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27443.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
Length=413

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT LSF+MIGVKNQ+DPRD +HHGGWMMK+ CWF++VI MFF+PNEI+S 
Sbjct  81   LRVSLGNFLFFTILSFLMIGVKNQRDPRDGLHHGGWMMKVICWFILVILMFFVPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVHGWNDKWVGY+EQFWY+ALFVV+L+CY+ T  F+GL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALFVVSLVCYLGTLGFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFIVMTLI V  FA+V LHP+V GSI PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGQDCGLNTFFIVMTLIVVLLFAIVALHPAVGGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKA+S+GTLT GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAISTGTLTFGLLTTVLSVVYSAVRAGSST  306



>ref|XP_008342757.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   326 bits (836),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 183/226 (81%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT LS MM+GVKNQKDPRDS+HHGGWMMK+ CW L+VIFMFF+PNEIVS 
Sbjct  81   LRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG FLLVQVVLLLDFVHGWNDKWVGY+E+FWY+ALFVV+L+CY+ATF F+GL
Sbjct  141  YETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEKFWYVALFVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFIVMTL+ VF F +V LHP+V GSI PASV+S+YCTYLCYS L
Sbjct  201  LFHWFTPSGQDCGLNTFFIVMTLMCVFVFLIVALHPAVSGSILPASVISMYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTLT GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYSAVRAGSST  306



>ref|XP_009354238.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009354239.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370970.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370971.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   326 bits (836),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 184/226 (81%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT LS MM+GVKNQKDPRDS+HHGGWMMK+ CW L+VIFMFF+PNEIVS 
Sbjct  81   LRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG FLLVQVVLLLDFVHGWNDKWVGY+E+FWY+ALFVV+L+CY+ATF F+GL
Sbjct  141  YETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEKFWYVALFVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFIVMTL+ VF F VV LHP+V GSI PASV+S+YCTYLCYS L
Sbjct  201  LFHWFTPSGQDCGLNTFFIVMTLMCVFMFLVVALHPAVNGSILPASVISMYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTLT GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYSAVRAGSST  306



>gb|EYU21792.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21793.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21794.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=416

 Score =   326 bits (836),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 183/226 (81%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+  MIGVKNQKDPRDSVHHGGWMMKI CW ++VI MFF+PN I+S 
Sbjct  81   LRVSLGNFLFFTILAIFMIGVKNQKDPRDSVHHGGWMMKIICWCVLVILMFFVPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE TSKFGSGLFLLVQVVLLLDFVHGWNDKWVGY+EQFWY+AL VV+L+CYVATF+F+GL
Sbjct  141  YEATSKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYMALLVVSLVCYVATFSFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF+ F PSGH+CGLNTFFI M LIFVF FAV+TLHPSV GS+ PASV+SLYC YLCYSGL
Sbjct  201  LFYLFTPSGHDCGLNTFFITMVLIFVFVFAVITLHPSVSGSLLPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+ +L LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTSSLGLGLLTTVLSVVYSAVRAGSST  306



>ref|XP_003552131.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN15373.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   326 bits (835),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M+GVK Q+DPRDS+HHGGWMMKI CW L+VI MFF+PNEI+S 
Sbjct  81   LRVSLGNFLFFTILAILMVGVKTQRDPRDSMHHGGWMMKIICWCLLVISMFFIPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG+FLLVQV+LLLDFVHGWNDKWVG++EQFWYIALFVV+L+CYVATFAF+G+
Sbjct  141  YETISKFGSGMFLLVQVMLLLDFVHGWNDKWVGFDEQFWYIALFVVSLVCYVATFAFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSGH+CGLN FFI MTLI  F FA+V LHP+V GS+ PASV+SLYCTYLCYS L
Sbjct  201  LFHFFTPSGHDCGLNVFFITMTLILAFIFAIVALHPAVNGSVLPASVISLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+TLGL TTVLSVVYSAVRAGSS 
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTITLGLATTVLSVVYSAVRAGSSA  306



>gb|EYU21795.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=414

 Score =   326 bits (835),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 183/226 (81%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+  MIGVKNQKDPRDSVHHGGWMMKI CW ++VI MFF+PN I+S 
Sbjct  81   LRVSLGNFLFFTILAIFMIGVKNQKDPRDSVHHGGWMMKIICWCVLVILMFFVPNGIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE TSKFGSGLFLLVQVVLLLDFVHGWNDKWVGY+EQFWY+AL VV+L+CYVATF+F+GL
Sbjct  141  YEATSKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYMALLVVSLVCYVATFSFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF+ F PSGH+CGLNTFFI M LIFVF FAV+TLHPSV GS+ PASV+SLYC YLCYSGL
Sbjct  201  LFYLFTPSGHDCGLNTFFITMVLIFVFVFAVITLHPSVSGSLLPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+ +L LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTSSLGLGLLTTVLSVVYSAVRAGSST  306



>ref|XP_010687311.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687312.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVKNQKDPRD++HHGGWMMKI CW L+VI MFFLPNE++SL
Sbjct  81   LRVSLGNFLFFTILAVLMIGVKNQKDPRDNLHHGGWMMKIICWCLLVILMFFLPNEMISL  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE TSKFG+GLFL VQVVLLLDFVHGWNDKWVGYNEQFWY+ALFVV+LICYVAT +F+ L
Sbjct  141  YEATSKFGAGLFLFVQVVLLLDFVHGWNDKWVGYNEQFWYVALFVVSLICYVATLSFSAL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLN+FFIVMTLIF   FA+V LHP+V GSI PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGQDCGLNSFFIVMTLIFALVFAIVALHPAVNGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY+CNG   HS+AVS+ +LTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYQCNGLHKHSQAVSTTSLTLGLLTTVLSVVYSAVRAGSST  306



>ref|XP_008381162.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 184/226 (81%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT LS MM+GVKNQKDPRDS+HHGGWMMK+ CW L+VIFMFF+PNEIVS 
Sbjct  81   LRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG FLLVQVVLLLDFVHGWNDKWVGY+E+FWY ALFVV+L+CY+ATF F+GL
Sbjct  141  YETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEKFWYXALFVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFIVMTL+ VF F +V LHPSV GSI PASV+S+YCTYLCYS L
Sbjct  201  LFHWFTPSGQDCGLNTFFIVMTLMCVFGFLIVALHPSVSGSILPASVISMYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTLT GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYSAVRAGSST  306



>ref|XP_007215456.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16655.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=397

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 185/226 (82%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ MM+GVK+QKDPRDS+HHGGWMMKI  W L+VIFMFF+PNEIVS 
Sbjct  65   LRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIPNEIVSF  124

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG FLLVQVVLLLDFVHGWNDKWVGY+EQFWYIALFVV+L+CY+ATF F+GL
Sbjct  125  YETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEQFWYIALFVVSLVCYLATFVFSGL  184

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLI VF F +V LHP+V GSI PASV+S+YCTYLCYS L
Sbjct  185  LFHWFTPSGHDCGLNTFFIVMTLICVFLFLIVALHPAVNGSILPASVISMYCTYLCYSAL  244

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   HSKAVS+GTLTLGL+TTVLSVVYSAVRAGSST
Sbjct  245  ASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSST  290



>gb|KDP41926.1| hypothetical protein JCGZ_26944 [Jatropha curcas]
Length=413

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 182/226 (81%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M+GVKNQKDPRDS+HHGGWMMK+ CW ++VIFMFFLPNEIVS 
Sbjct  81   LRVSLGNFLFFTVLAILMVGVKNQKDPRDSLHHGGWMMKVICWCILVIFMFFLPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWNDKWVGY+EQFWY+AL VV+L+CYVATF F+G 
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCYVATFVFSGF  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFI+MTLI VF FA+V LHP+V GSI PASV+S+YC YLCYSGL
Sbjct  201  LFHWFTPSGQDCGLNTFFIIMTLISVFVFAIVALHPAVNGSILPASVISVYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTLT+GL TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTLTVGLFTTVLSVVYSAVRAGSST  306



>ref|XP_011020548.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=415

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FFT L+ MM+GVKNQKDPRDS+HHGGWM K+ CW ++VI MFFLPNEIVS 
Sbjct  81   LRVSLGNFMFFTILATMMVGVKNQKDPRDSLHHGGWMAKVVCWCILVILMFFLPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWNDKWVGY+E+FWY+ALFVV+L+CYV TFAF+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEKFWYVALFVVSLVCYVGTFAFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFIVMTLIF F FA+V LHP+V GS+ PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGQDCGLNTFFIVMTLIFAFVFAIVALHPAVNGSVLPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   HSKAVS+GTL++GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPREYECNGLHRHSKAVSTGTLSIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_007215457.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 ref|XP_007215458.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16656.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16657.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=413

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 185/226 (82%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ MM+GVK+QKDPRDS+HHGGWMMKI  W L+VIFMFF+PNEIVS 
Sbjct  81   LRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG FLLVQVVLLLDFVHGWNDKWVGY+EQFWYIALFVV+L+CY+ATF F+GL
Sbjct  141  YETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEQFWYIALFVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLI VF F +V LHP+V GSI PASV+S+YCTYLCYS L
Sbjct  201  LFHWFTPSGHDCGLNTFFIVMTLICVFLFLIVALHPAVNGSILPASVISMYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   HSKAVS+GTLTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSST  306



>gb|KHG09631.1| Serine incorporator 3 [Gossypium arboreum]
Length=413

 Score =   324 bits (830),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+F M+GVKNQ+DPRD+VHHGGWMMKI CWF++VI MFF+PNEI+S 
Sbjct  81   LRVSLGNFLFFTILAFSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+GLFLLVQVVLLLDFVHGWNDKWVGY+EQFWY+AL VV+L+CY+ATF F+GL
Sbjct  141  YESASKFGAGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCYLATFGFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH F PSG +CGLNTFFIVMTL  V  FA+V LHP+V GSI PASV+SLYC YLCYSGL
Sbjct  201  LFHLFTPSGQDCGLNTFFIVMTLTLVLLFAIVALHPAVGGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKA+S+GTLTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAISTGTLTLGLLTTVLSVVYSAVRAGSST  306



>ref|XP_006307669.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
 gb|EOA40567.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
Length=412

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF+ LS MMIGVKNQKDPRD +HHGGWMMKI  W ++VI MFFLPNEI+S 
Sbjct  81   LRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+GL
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLIFVF FA+V LHP+V GSI PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVMTLIFVFVFAIVVLHPTVGGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_002270610.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 ref|XP_010655133.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 emb|CBI25248.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   323 bits (829),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 184/226 (81%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFFT L+ +MIGVKNQKDPRD +HHGGWMMKI CW ++VIF FFLPNE++S 
Sbjct  81   LRVSFGNFLFFTILAILMIGVKNQKDPRDGMHHGGWMMKIICWCILVIFTFFLPNELISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YETTSKFGSGLFLLVQVVLLLDFVH WND WVGY EQFWYIALFVV+L+CYVATF+F+GL
Sbjct  141  YETTSKFGSGLFLLVQVVLLLDFVHRWNDTWVGYGEQFWYIALFVVSLVCYVATFSFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSGH+CGLNTFFIVMTLI  F FA+V LHP+V GSI PASV+SLYC YLCYSGL
Sbjct  201  LFHFFTPSGHDCGLNTFFIVMTLILAFVFAIVALHPAVGGSILPASVVSLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTLTLGL+TT+LSV+YSAVRAGSST
Sbjct  261  SSEPRDYECNGLHKHSKAVSTGTLTLGLLTTILSVIYSAVRAGSST  306



>ref|XP_006493450.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
Length=413

 Score =   323 bits (829),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 185/226 (82%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT LS +M+GVKNQKDPRDS+HHGGWMMKI CW L+VIFMFFLPNEIVS 
Sbjct  81   LRVSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVH WND WVGY+EQFWY+AL VV+L+CYV TF F+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHRWNDTWVGYDEQFWYVALLVVSLVCYVLTFGFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFIVMTLI  F FAVV LHP+V GSI PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGQDCGLNTFFIVMTLILAFIFAVVALHPAVGGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+G+LTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  SSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAVRAGSST  306



>ref|XP_008228861.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228862.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228863.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228864.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=413

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 184/226 (81%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ MM+GVK+QKDPRDS+HHGGWMMKI  W L+VIFMFF+PNEIVS 
Sbjct  81   LRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG FLLVQVVLLLDFVHGWNDKWVGY+EQFWYIALFVV+L+CY+ATF F+GL
Sbjct  141  YETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEQFWYIALFVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIV TLI VF F +V LHP+V GSI PASV+S+YCTYLCYS L
Sbjct  201  LFHWFTPSGHDCGLNTFFIVTTLICVFLFLIVALHPAVNGSILPASVISMYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   HSKAVS+GTLTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSST  306



>emb|CDO98258.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   321 bits (823),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+  M+G+KNQKDPRDSVHHGGWM+KI CW L+VI MFF+PNEI+S 
Sbjct  81   LRVSLGNFLFFTILAVFMMGIKNQKDPRDSVHHGGWMIKIICWCLLVILMFFVPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YETTSKFG+G FLLVQVVLLLDFVHGWNDKWVGY+E+FWY+AL V++L+CYVATFAF+GL
Sbjct  141  YETTSKFGAGFFLLVQVVLLLDFVHGWNDKWVGYDEKFWYMALLVISLVCYVATFAFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF+ F  SGH+CGLNTFFIVMTLI VF FAVVTLHPSV GSI PASV+SLYC YLCYSGL
Sbjct  201  LFYLFTASGHDCGLNTFFIVMTLISVFAFAVVTLHPSVGGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAG  670
             SEPRDYECNG   HSKAVS+ TLT+GL+TTVLSVVYSAVRAG
Sbjct  261  ASEPRDYECNGLHKHSKAVSTSTLTIGLLTTVLSVVYSAVRAG  303



>ref|XP_007140603.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
 gb|ESW12597.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
Length=410

 Score =   321 bits (823),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 201/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M GVK Q+DPRD +HHGGWMMKI CWFL+VIFMFF+PNEI+  
Sbjct  81   LRVSLGNFLFFTILAVLMTGVKTQRDPRDGMHHGGWMMKIICWFLLVIFMFFVPNEIIGF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG+FLLVQV+LLLDFVHGWNDKWVG++EQFWY+ALFVV+L+CY+ATFAF+G+
Sbjct  141  YETISKFGSGMFLLVQVMLLLDFVHGWNDKWVGFDEQFWYVALFVVSLVCYLATFAFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            L+HFF PSG +CG+N FFI MTLI  F FA+V LHP+V GS+ PASV+SLYCTYLCYS L
Sbjct  201  LYHFFTPSGQDCGINVFFITMTLILAFVFAIVALHPAVNGSVLPASVISLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GLVTTVLSVVYSAVRAGSS 
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTVTMGLVTTVLSVVYSAVRAGSSA  306



>ref|XP_006427689.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
 gb|ESR40929.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
Length=413

 Score =   321 bits (823),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 183/226 (81%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT LS +M+GVKNQKDPRDS+HHGGWMMKI CW L+VIFMFFLPNEIVS 
Sbjct  81   LRVSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVH WN+ WVGY+EQFWY+AL VV+L+CYV TF F+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHRWNETWVGYDEQFWYVALLVVSLVCYVLTFGFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFIVMTLI  F FAVV LHP+V GS+ PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGQDCGLNTFFIVMTLILAFIFAVVALHPAVGGSVLPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+G+LTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  SSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAVRAGSST  306



>ref|XP_004492298.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=410

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 201/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVK QKDPRD +HHGGWMMKI CW L+VIFMFFLPNEI+S 
Sbjct  81   LRVSLGNFLFFTILATLMIGVKTQKDPRDGLHHGGWMMKIICWCLMVIFMFFLPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG+FLLVQVVLLLDFVHGWNDKWVG++EQFWY+ALFVV+L+CYVATF F+G+
Sbjct  141  YETISKFGSGMFLLVQVVLLLDFVHGWNDKWVGFDEQFWYVALFVVSLVCYVATFVFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSG +CG+N FFI MTL+  F FA+V LHPSV GS+ PASV+SLYCTYLCYS L
Sbjct  201  LFHFFTPSGQDCGINIFFISMTLMLAFIFAIVALHPSVNGSVLPASVISLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTLTLGLVTTVLSVVYSAVRAGSS 
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTLTLGLVTTVLSVVYSAVRAGSSA  306



>gb|ABK96018.1| unknown [Populus trichocarpa]
Length=414

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ MM+GVKNQKDPRDS+HHGGWM K+ CW L+VIFMFFLPNEIVS 
Sbjct  81   LRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWNDKWVGY+EQFWY ALF V+ +CYV TFAF+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYAALFAVSFVCYVGTFAFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F  SG +CGLNTFFIVMTLIF F FA+  LHP+V GS+ PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTASGQDCGLNTFFIVMTLIFAFVFAIAALHPAVNGSVLPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   HSKAVS+ TLT+GL+TTVLSVVYSAVRAGSST
Sbjct  261  SSEPREYECNGLHRHSKAVSTSTLTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_002297693.2| TMS membrane family protein [Populus trichocarpa]
 gb|EEE82498.2| TMS membrane family protein [Populus trichocarpa]
Length=414

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ MM+GVKNQKDPRDS+HHGGWM K+ CW L+VIFMFFLPNEIVS 
Sbjct  81   LRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWNDKWVGY+EQFWY ALF V+ +CYV TFAF+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYAALFAVSFVCYVGTFAFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F  SG +CGLNTFFIVMTLIF F FA+  LHP+V GS+ PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTASGQDCGLNTFFIVMTLIFAFVFAIAALHPAVNGSVLPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   HSKAVS+ TLT+GL+TTVLSVVYSAVRAGSST
Sbjct  261  SSEPREYECNGLHRHSKAVSTSTLTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_002512768.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF49271.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=413

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M+GVK+QKDPRD +HHGGWMMKI CW ++VIFMFFLPNEIVS 
Sbjct  81   LRVSLGNFLFFTILATLMVGVKSQKDPRDGLHHGGWMMKIICWCVLVIFMFFLPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWNDKWVGYNEQFWYIALFVV+L+CY+ATF F+G 
Sbjct  141  YESMSKFGSGLFLLVQVVLLLDFVHGWNDKWVGYNEQFWYIALFVVSLVCYLATFVFSGF  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFI MTLI V  FA+V LHP+V GSI PASV+S YC YLCYSGL
Sbjct  201  LFHWFTPSGQDCGLNTFFITMTLILVIVFAIVALHPAVSGSILPASVISAYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   HSKAVS+GTL++GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPREYECNGLHKHSKAVSTGTLSIGLLTTVLSVVYSAVRAGSST  306



>gb|AFK46909.1| unknown [Lotus japonicus]
Length=353

 Score =   317 bits (812),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 197/226 (87%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M+GVKNQKDPRD +HHGGWMMKI CWFL+VIFMFFLPNEI+S 
Sbjct  25   LRVSLGNFLFFTILAVLMVGVKNQKDPRDGLHHGGWMMKIICWFLLVIFMFFLPNEIISF  84

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG+FLLVQVVLL    HGWNDKWVG++EQFWY+ALFVV+L+CY+ATF F+G+
Sbjct  85   YETISKFGSGMFLLVQVVLLDFV-HGWNDKWVGFDEQFWYVALFVVSLVCYLATFVFSGV  143

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH F PSG +CG+N FFI MTLI  F FA+V LHP+V GSI P+SV+SLYCTYLCYS L
Sbjct  144  LFHLFTPSGQDCGINVFFITMTLILAFVFAIVALHPAVNGSILPSSVISLYCTYLCYSAL  203

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTLTLGL+TT LSVVYSAVRAGSS 
Sbjct  204  ASEPRDYECNGLHKHSKAVSTGTLTLGLLTTTLSVVYSAVRAGSSA  249



>ref|XP_004158797.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
 gb|KGN45209.1| hypothetical protein Csa_7G431410 [Cucumis sativus]
Length=411

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT LS MM+GVK+Q+DPRD++HHGGWM+K+ CWFL+V+ MFF+PNEI++ 
Sbjct  81   LRVSLGNFLFFTILSVMMVGVKSQRDPRDNIHHGGWMVKVICWFLLVVLMFFVPNEIITF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVH WND WVGY+EQFWYIALFVV+L CYVATF  +GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHRWNDTWVGYDEQFWYIALFVVSLFCYVATFVSSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F P+GH+CGLNTFFIVMTLIF F F VV LHP+V GS+ PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPAGHDCGLNTFFIVMTLIFAFIFTVVALHPAVGGSVLPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTL+LGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTLSLGLLTTVLSVVYSAVRAGSST  306



>ref|XP_010914044.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=415

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ MM+G+K+QKDPRD +HHGGWM KI CWF++VI MFF+PN +VS 
Sbjct  81   LRVSLGNFLFFTILALMMVGIKDQKDPRDRLHHGGWMAKIVCWFVLVILMFFVPNGLVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVHGWND WV  +EQFWY+ALF+V+L+CYVATF+F GL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHGWNDSWVSKDEQFWYVALFIVSLVCYVATFSFTGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIV+TLI VF FAVV LHP V GS+ PASVLSLYC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVLTLILVFVFAVVALHPKVNGSLLPASVLSLYCAYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHS+AVS+G+LTLGL+TTVLSV+YSAVRAGSST
Sbjct  261  SSEPRDYECNGLHNHSEAVSTGSLTLGLLTTVLSVIYSAVRAGSST  306



>ref|XP_010107188.1| putative serine incorporator [Morus notabilis]
 gb|EXC14084.1| putative serine incorporator [Morus notabilis]
Length=413

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/226 (81%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M+GVKNQ+DPRD +HHGGWMMKI CW L+VIFMFFLPNEI++ 
Sbjct  81   LRVSLGNFLFFTILAILMVGVKNQRDPRDGLHHGGWMMKIICWCLLVIFMFFLPNEIINF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET+SKFGSGLFLLVQVVLLLDFVH WND WVGY+EQFWYIALFVV+L CY ATF F+GL
Sbjct  141  YETSSKFGSGLFLLVQVVLLLDFVHRWNDTWVGYDEQFWYIALFVVSLFCYGATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLI VF  AVV LHP+V GSI PAS++SLYCTYLCYS L
Sbjct  201  LFHWFTPSGHDCGLNTFFIVMTLISVFVSAVVALHPTVSGSILPASIISLYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   HSKAVS+GTLTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSST  306



>ref|XP_010268463.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=414

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVK+QKDPRD +HHGGWM KI CW ++V  MFFLPN IVS 
Sbjct  81   LRVSLGNFLFFTILAILMIGVKDQKDPRDRLHHGGWMTKIVCWCILVFIMFFLPNAIVSS  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVH WNDKWV  +EQFWYIALFVV+L+CY+ TF+F+GL
Sbjct  141  YETVSKFGSGLFLLVQVVLLLDFVHEWNDKWVRKDEQFWYIALFVVSLVCYLLTFSFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F P+GH+CG+NTFFIVMTLIFVF FA+V LHP+V GSI PASV+SLYCTYLC+SGL
Sbjct  201  LFHWFTPAGHDCGINTFFIVMTLIFVFVFAIVALHPAVGGSILPASVISLYCTYLCFSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNGF  H+KAVS+GTLTLGL TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGFHRHTKAVSTGTLTLGLFTTVLSVVYSAVRAGSST  306



>ref|XP_010532058.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
 ref|XP_010532059.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
Length=414

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 206/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FFT LS MM+GVKNQKDPRD +HHGGWMMK+ CW ++VIFMFFLPNEI+S 
Sbjct  81   LRVSLGNFIFFTVLSVMMVGVKNQKDPRDGIHHGGWMMKVICWCILVIFMFFLPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+GLFLLVQVVLLLDFVHGWND WVGY+EQFWY+AL VV+L+CY+ATF F+GL
Sbjct  141  YESISKFGAGLFLLVQVVLLLDFVHGWNDTWVGYDEQFWYVALLVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLIFVF FAVV LHP+V GSI PASV+S+YC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVMTLIFVFVFAVVVLHPTVGGSILPASVISMYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   H+KAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHAKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>emb|CAN80335.1| hypothetical protein VITISV_009414 [Vitis vinifera]
Length=382

 Score =   312 bits (799),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 203/244 (83%), Gaps = 18/244 (7%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFFT L+ +MIGVKNQKDPRD +HHGGWMMKI CW ++VIF FFLPNE++S 
Sbjct  127  LRVSFGNFLFFTILAILMIGVKNQKDPRDGMHHGGWMMKIICWCILVIFTFFLPNELISF  186

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YETTSKFGSGLFLLVQVVLLLDFVH WND WVGY EQFWYIALFVV+L+CYVATF+F+GL
Sbjct  187  YETTSKFGSGLFLLVQVVLLLDFVHRWNDTWVGYGEQFWYIALFVVSLVCYVATFSFSGL  246

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPS------------------VKGSI  487
            LFHFF PSGH+CGLNTFFIVMTLI  F FA+V LHP+                  V GSI
Sbjct  247  LFHFFTPSGHDCGLNTFFIVMTLILAFVFAIVALHPAAFLARLAPNFYLKTFVLYVGGSI  306

Query  488  FPASVLSLYCTYLCYSGLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRA  667
             PASV+SLYC YLCYSGL SEPRDYECNG   HSKAVS+GTLTLGL+TTVLSV+YSAVRA
Sbjct  307  LPASVVSLYCMYLCYSGLSSEPRDYECNGLHKHSKAVSTGTLTLGLLTTVLSVIYSAVRA  366

Query  668  GSST  679
            GSST
Sbjct  367  GSST  370



>gb|KCW70853.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=316

 Score =   309 bits (791),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = +2

Query  50   MMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLYETTSKFGSGlfllvq  229
            MMIGVKNQ+DPRD +HHGGWMMKI CW L+VIFMFFLPNEI+S YE+ SKFGSG FLL+Q
Sbjct  1    MMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLPNEIISFYESISKFGSGFFLLIQ  60

Query  230  vvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGLLFHFFAPSGHECGLNT  409
            VVLLLDFVHGWNDKW GY+EQFWYIALFVV+L+CYVA FAF+G+LFHFF PSGH+CGLNT
Sbjct  61   VVLLLDFVHGWNDKWAGYDEQFWYIALFVVSLVCYVAAFAFSGVLFHFFTPSGHDCGLNT  120

Query  410  FFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGLVSEPRDYECNGFLNHS  589
            FFIV+TLIF F FAVV LHP+V GSI PA+V+SLYC YLCYSGL SEPRDYECNG   HS
Sbjct  121  FFIVVTLIFAFLFAVVALHPAVNGSILPAAVISLYCMYLCYSGLASEPRDYECNGLHAHS  180

Query  590  KAvssgtltlglvttvlsvvYSAVRAGSST  679
            KAVS+GTLTLGLVTTVLSVVYSAVRAGSST
Sbjct  181  KAVSTGTLTLGLVTTVLSVVYSAVRAGSST  210



>ref|XP_002890152.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66411.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 182/226 (81%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF+ LS MMIGVKNQKDPRD +HHGGWMMKI CW ++VI MFFLPNEI+S 
Sbjct  81   LRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIICWCILVILMFFLPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+GL
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFI+MTLIFVF FAVV LHP+V GSI PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIIMTLIFVFVFAVVVLHPAVGGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>gb|KEH22798.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=410

 Score =   310 bits (795),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFFT L+ MM+GVK QKDPRD +HHGGWMMKI CW L+VIFMFFLPNEI+S 
Sbjct  81   LRVSFGNFLFFTILAAMMVGVKTQKDPRDGLHHGGWMMKIICWCLLVIFMFFLPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG+FLLVQVVLLLDFVH WND WVGY+EQFWYIALFVV+L+CYVATF F+G+
Sbjct  141  YETISKFGSGMFLLVQVVLLLDFVHRWNDTWVGYDEQFWYIALFVVSLVCYVATFVFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSG +CG N FFI MTL+  F FA+V LHP+V GS+ PASV+S YC YLCYS L
Sbjct  201  LFHFFTPSGQDCGTNIFFISMTLMLAFVFAIVALHPAVNGSVLPASVISFYCMYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+G+LTLGLVTTVLSVVYSAVRAGSS 
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGSLTLGLVTTVLSVVYSAVRAGSSA  306



>gb|KEH22799.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=427

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFFT L+ MM+GVK QKDPRD +HHGGWMMKI CW L+VIFMFFLPNEI+S 
Sbjct  98   LRVSFGNFLFFTILAAMMVGVKTQKDPRDGLHHGGWMMKIICWCLLVIFMFFLPNEIISF  157

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG+FLLVQVVLLLDFVH WND WVGY+EQFWYIALFVV+L+CYVATF F+G+
Sbjct  158  YETISKFGSGMFLLVQVVLLLDFVHRWNDTWVGYDEQFWYIALFVVSLVCYVATFVFSGV  217

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFHFF PSG +CG N FFI MTL+  F FA+V LHP+V GS+ PASV+S YC YLCYS L
Sbjct  218  LFHFFTPSGQDCGTNIFFISMTLMLAFVFAIVALHPAVNGSVLPASVISFYCMYLCYSAL  277

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+G+LTLGLVTTVLSVVYSAVRAGSS 
Sbjct  278  ASEPRDYECNGLHKHSKAVSTGSLTLGLVTTVLSVVYSAVRAGSSA  323



>ref|XP_009117776.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
 ref|XP_009117777.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
Length=413

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FF+ LS MMIGVK QKDPRD +HHGGWMMK+ CWF++VI MFF+PNE++S 
Sbjct  81   LRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+GL
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLIFVF FAVV LHP+V GSI PASV+S+YC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVMTLIFVFVFAVVVLHPAVGGSILPASVISVYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_008794380.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=415

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M G+K+QKDPRD +HHGGWM K+ CW ++VI MFF+PN +VS 
Sbjct  81   LRVSLGNFLFFTILALLMAGIKDQKDPRDRLHHGGWMAKVVCWCVLVILMFFVPNGLVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVHGWND WV  +EQFWY+ALF+V+L+CYVA F+F GL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHGWNDSWVSNDEQFWYMALFIVSLVCYVAAFSFTGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIV+TLI VF FAVV LHP V GS+ PASV+SLYCTYLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVLTLILVFVFAVVALHPKVNGSLLPASVISLYCTYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+G+LTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  SSEPRDYECNGLHGHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSST  306



>emb|CDX81752.1| BnaC08g38490D [Brassica napus]
Length=412

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FF+ LS MMIGVK QKDPRD +HHGGWMMK+ CWF++VI MFF+PNE++S 
Sbjct  81   LRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+GL
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLIFVF FAVV LHP+V GSI PASV+S YC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVMTLIFVFVFAVVVLHPAVGGSILPASVISFYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_006416842.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 ref|XP_006416843.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35195.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35196.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
Length=412

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF+ LS MMIGVKNQKDPRD +HHGGWMMK+ CW ++VI MFF+PNEI+S 
Sbjct  81   LRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKVICWCILVILMFFVPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+GL
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLIFVF FAVV LHP+V GSI PASV+S YC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVMTLIFVFVFAVVVLHPAVGGSILPASVISFYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_009383181.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   308 bits (790),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF FFT L+ +MIG+K+QKDPRD +HHGGWM KI CW ++V  MFF+PN IVS 
Sbjct  81   LRVSLGNFFFFTLLAVLMIGIKDQKDPRDRLHHGGWMAKIVCWCIVVFLMFFVPNGIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVH WN+ WV  +EQFWY+AL +V+L+CYVATF+F GL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHAWNENWVSKDEQFWYMALLIVSLVCYVATFSFTGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIV+TLIFVF FAVV LHP V GS+ PASV+SLYCTYLCYSG+
Sbjct  201  LFHWFTPSGHDCGLNTFFIVLTLIFVFVFAVVALHPKVNGSLLPASVISLYCTYLCYSGI  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSKAVS+G+LTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  SSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSST  306



>ref|XP_009110458.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
 ref|XP_009110459.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
Length=412

 Score =   308 bits (789),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FF+ LS MMIGVK QKDPRD +HHGGWMMK+ CWF++VI MFF+PNE++S 
Sbjct  81   LRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+GL
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLIFVF FAVV LHP+V GSI PASV+S YC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVMTLIFVFVFAVVVLHPAVGGSILPASVISFYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_008790112.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
 ref|XP_008778863.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
Length=415

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M+G+K+QKDPRD +HHGGWM KI  WF++VI MFF+PN +VS 
Sbjct  81   LRVSLGNFLFFTILALVMVGIKDQKDPRDRLHHGGWMAKIVGWFVLVILMFFVPNGLVSS  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVHGWND WV  +EQFWY+ALF+V+L+CYV TF+F GL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHGWNDSWVSKDEQFWYMALFLVSLLCYVVTFSFTGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLNTFFIV+TL+ VF FAV+ LHP V GS+ PASVLSLYC YLCYSGL
Sbjct  201  LFHWFTPSGRDCGLNTFFIVLTLVLVFVFAVIALHPKVNGSLLPASVLSLYCAYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSKAVS+G+LTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  SSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSST  306



>ref|XP_010929191.1| PREDICTED: probable serine incorporator isoform X2 [Elaeis guineensis]
Length=415

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M+G+K+QKDPRD +HHGGWM KI CW ++VI MFF+PN +VS 
Sbjct  81   LRVSLGNFLFFTILAVLMVGIKDQKDPRDRLHHGGWMAKIVCWCVLVILMFFVPNGLVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVHGWND WV  +EQFWY+ALF+V+L+CYV TF+F GL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHGWNDSWVSKDEQFWYMALFIVSLVCYVTTFSFTGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIV+TLI V  FAVV LHP V GS+ PASV+SLYCTYLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVLTLILVLVFAVVALHPKVNGSLLPASVISLYCTYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAG  670
             SEPRDYECNG  NHSKAVS+G+LTLGL+TTVLSVVYSAVRAG
Sbjct  261  SSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAG  303



>ref|XP_010929190.1| PREDICTED: probable serine incorporator isoform X1 [Elaeis guineensis]
Length=423

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M+G+K+QKDPRD +HHGGWM KI CW ++VI MFF+PN +VS 
Sbjct  81   LRVSLGNFLFFTILAVLMVGIKDQKDPRDRLHHGGWMAKIVCWCVLVILMFFVPNGLVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVHGWND WV  +EQFWY+ALF+V+L+CYV TF+F GL
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHGWNDSWVSKDEQFWYMALFIVSLVCYVTTFSFTGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIV+TLI V  FAVV LHP V GS+ PASV+SLYCTYLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVLTLILVLVFAVVALHPKVNGSLLPASVISLYCTYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAG  670
             SEPRDYECNG  NHSKAVS+G+LTLGL+TTVLSVVYSAVRAG
Sbjct  261  SSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAG  303



>ref|XP_010497691.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497697.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497701.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497705.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   306 bits (783),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  LS MMIGVK QKDPRD +HHGGWMMKI  W ++VI MFFLPNEI+S 
Sbjct  81   LRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+GL
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFI+MTLIFVF FAVV LHP+V GSI PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFILMTLIFVFVFAVVVLHPAVGGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_010459155.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  LS MMIGVK QKDPRD +HHGGWMMKI  W ++VI MFFLPNEI+S 
Sbjct  81   LRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+GL
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFI+MTLIFVF FAVV LHP+V GSI PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFILMTLIFVFVFAVVVLHPAVGGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_010476724.1| PREDICTED: serine incorporator 3 [Camelina sativa]
Length=412

 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  LS MMIGVK QKDPRD +HHGGWMMKI  W ++VI MFFLPNEI+S 
Sbjct  81   LRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+GL
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFI+MTLIFVF FAVV LHP+V GSI PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFILMTLIFVFVFAVVVLHPAVGGSILPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>emb|CDY70974.1| BnaAnng35710D [Brassica napus]
Length=412

 Score =   305 bits (782),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 177/226 (78%), Positives = 201/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FF+ LS MMIGVK QKDPRD +HHGGWMMK+ CWF++VI MFF+PNE++S 
Sbjct  81   LRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL  V+L+CY+ATF F+GL
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLGVSLVCYLATFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLIFVF FAVV LHP+V GSI PASV+S YC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVMTLIFVFVFAVVVLHPAVGGSILPASVISFYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_009399576.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   305 bits (782),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FFT L+ +MIG+K+QKDPRD +HHGGWM KI CWF++V  MFF+PN IVS 
Sbjct  81   LRVSLGNFVFFTILAVVMIGIKDQKDPRDQLHHGGWMAKIVCWFIVVFLMFFVPNGIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVVLLLDFVH WN+ WV  +EQFWY+AL +V+L+CY+ATF+F G+
Sbjct  141  YETISKFGSGLFLLVQVVLLLDFVHAWNENWVSKDEQFWYMALLIVSLVCYLATFSFTGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIV+TLI VF FA V LHP V GS+ PAS++SLYCTYLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVLTLILVFVFATVALHPKVNGSLLPASIISLYCTYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSK VS+G+LTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  SSEPRDYECNGLHNHSKVVSTGSLTLGLLTTVLSVVYSAVRAGSST  306



>ref|XP_011034606.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034607.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034608.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=414

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ MM+GVKNQKDPRDS+HHGGWM K+ CW L+VIFMFFLPNEIVS 
Sbjct  81   LRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLPNEIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVV LLDFVHGWNDKWVGY+EQFWY ALF V+ +CYV TFAF+GL
Sbjct  141  YESISKFGSGLFLLVQVVFLLDFVHGWNDKWVGYDEQFWYAALFAVSFVCYVGTFAFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F  SG +CGLNTFFIVMTLIF F FA++ LHP+V GS+ PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTASGQDCGLNTFFIVMTLIFAFAFAIIALHPAVNGSVLPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
             SEPR+YECNG   HSKAVS+ TLT+GL+TTVLSVVYSAVRAGSS
Sbjct  261  SSEPREYECNGLHRHSKAVSTSTLTIGLLTTVLSVVYSAVRAGSS  305



>ref|XP_004954190.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=413

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M G+K+QKDPRD +HHGGWM KI CW +IV  MFF+PN +VS 
Sbjct  81   LRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWAIIVFLMFFVPNGVVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWN+ WV  +EQFWY+AL VV+++CY+ATF+F+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIATFSFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLN FFIV TLI VF FA+V LHP V GS+ PASV+ LYCTYLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNLFFIVFTLILVFAFAIVALHPKVNGSLLPASVIGLYCTYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSKAVS+G+LTLGL+TT+LSVVYSAVRAGSS 
Sbjct  261  SSEPRDYECNGLHNHSKAVSTGSLTLGLLTTILSVVYSAVRAGSSA  306



>ref|XP_004303218.1| PREDICTED: probable serine incorporator-like [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 201/227 (89%), Gaps = 1/227 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFL-PNEIVS  178
            LRVSLGNFLFFT LS +MIGVK+QKDPRDS+HHGGWMMK+ CWFL+V+F  F  PN ++S
Sbjct  81   LRVSLGNFLFFTILSVVMIGVKSQKDPRDSIHHGGWMMKVICWFLLVLFSLFFVPNGVIS  140

Query  179  LYETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNG  358
             YET +KFGSG FLLVQVVLLLDFVHGWNDKWV Y+EQFWY+ALFVV+L+CY+ATF F+G
Sbjct  141  FYETIAKFGSGFFLLVQVVLLLDFVHGWNDKWVSYDEQFWYVALFVVSLVCYLATFVFSG  200

Query  359  LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSG  538
            LLFH F PSGH+CGLNTFFIVMTLIFVF F +V LHP+V GSI PASV+S+YCTYLCYS 
Sbjct  201  LLFHLFTPSGHDCGLNTFFIVMTLIFVFVFLIVALHPTVGGSILPASVISVYCTYLCYSA  260

Query  539  LVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
            L SEPRDYECN    HSKAVS+GTLTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  LASEPRDYECNSLHKHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSST  307



>ref|XP_006649122.1| PREDICTED: probable serine incorporator-like, partial [Oryza 
brachyantha]
Length=384

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FFT L+ +M G+K+QKDPRD +HHGGWM KI CW +IV  MFF+PN +VS 
Sbjct  51   LRVSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVPNGVVSF  110

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWN+ WV  +EQFWY+AL VV+++CY+  F+F+GL
Sbjct  111  YESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIGAFSFSGL  170

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLN FFIV TLI VF FA+V LHP + GS+ PASV++LYCTYLCYSGL
Sbjct  171  LFHWFTPSGHDCGLNMFFIVFTLILVFVFAIVALHPKINGSLLPASVIALYCTYLCYSGL  230

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSKAVS+G+L+LGL+TT+LSVVYSAVRAGSS 
Sbjct  231  SSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVYSAVRAGSSA  276



>gb|EAZ24909.1| hypothetical protein OsJ_08689 [Oryza sativa Japonica Group]
Length=414

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FFT L+ +M G+K+QKDPRD +HHGGWM KI CW +IV  MFF+PN +VS 
Sbjct  81   LRVSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVPNGVVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWN+ WV  +EQFWY+AL VV+++CY+ TF+F+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIVTFSFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CG+N FFIV TLI VF FA+V LHP + GS+ PASV++LYCTYLCYSGL
Sbjct  201  LFHWFTPSGHDCGINLFFIVFTLILVFVFAIVALHPKINGSLLPASVIALYCTYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSKAVS+G+L+LGL+TT+LSVVYSAVRAGSS 
Sbjct  261  SSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVYSAVRAGSSA  306



>ref|XP_008461193.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Cucumis melo]
Length=416

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT LS MM+GVK Q+DPRD++HHGGWM+K+ CWFL+V+ MFF+PNEI++ 
Sbjct  81   LRVSLGNFLFFTILSVMMVGVKTQRDPRDNIHHGGWMVKVICWFLLVVLMFFIPNEIITF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVH WND WVGY+EQFWYIALFVV+L CYV TF  +GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHRWNDTWVGYDEQFWYIALFVVSLFCYVTTFVSSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F P+GH+CGLNTFFIVMTLIF F F VV LHP++ GS+ PASV+SLYC YLCYSGL
Sbjct  201  LFHWFTPAGHDCGLNTFFIVMTLIFAFVFTVVALHPAIGGSVLPASVISLYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHS  589
             SEPRDYECNG   HS
Sbjct  261  ASEPRDYECNGLHKHS  276



>ref|XP_006845424.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
 gb|ERN07099.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
Length=415

 Score =   298 bits (764),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +MIGVKNQKDPRDS+HHGGWM+KI  W ++VI MFFL N IV  
Sbjct  81   LRVSLGNFLFFTLLAVIMIGVKNQKDPRDSLHHGGWMVKIVTWCIVVILMFFLSNGIVEF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE  SKFGSGLFLLVQVVLLLDFVH WN+ WV  +EQFWYIALFVV+L+CY+ TF+F GL
Sbjct  141  YEAISKFGSGLFLLVQVVLLLDFVHAWNENWVEKDEQFWYIALFVVSLVCYIGTFSFGGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFF+V TLI VF FA + LHP V GS+ PASV+S+YCTYLCYS L
Sbjct  201  LFHWFTPSGHDCGLNTFFLVTTLILVFVFAAIALHPKVNGSLLPASVISVYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  +HSKAVS+GTLTLGL+TTVLSVVYSAVRAGSST
Sbjct  261  SSEPRDYECNGLHHHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSST  306



>ref|NP_001048364.1| Os02g0792900 [Oryza sativa Japonica Group]
 dbj|BAD19186.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAD19654.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAF10278.1| Os02g0792900 [Oryza sativa Japonica Group]
 gb|EAY87831.1| hypothetical protein OsI_09251 [Oryza sativa Indica Group]
 dbj|BAG96913.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97616.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99574.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   298 bits (763),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FFT L+ +M G+K+QKDPRD +HHGGWM KI CW +IV  MFF+PN +VS 
Sbjct  81   LRVSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVPNGVVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWN+ WV  +EQFWY+AL VV+++CY+ TF+F+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIVTFSFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CG+N FFIV TLI VF FA+V LHP + GS+ PASV++LYCTYLCYSGL
Sbjct  201  LFHWFTPSGHDCGINLFFIVFTLILVFVFAIVALHPKINGSLLPASVIALYCTYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSKAVS+G+L+LGL+TT+LSVVYSAVRAGSS 
Sbjct  261  SSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVYSAVRAGSSA  306



>ref|NP_001130490.1| hypothetical protein precursor [Zea mays]
 gb|ACF78724.1| unknown [Zea mays]
 gb|ACN28943.1| unknown [Zea mays]
 gb|AFW73836.1| hypothetical protein ZEAMMB73_916907 [Zea mays]
Length=413

 Score =   298 bits (763),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M G+K+QKDPRD +HHGGWM KI CW +IV  MFF+PN +VS 
Sbjct  81   LRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWVIIVFLMFFVPNGVVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWN+ WV  +EQFWY+AL VV+++CY+ATF F+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIATFCFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLN FFIV TLI VF FA+V LHP + GS+ PASV+ +YCTYLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNLFFIVFTLILVFAFAIVALHPKINGSLLPASVIGMYCTYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSKAVS+G+LTLGL+TTVLSVVYSAVRAGSS 
Sbjct  261  SSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSSA  306



>ref|XP_002454688.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
 gb|EES07664.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
Length=413

 Score =   298 bits (762),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M G+K+QKDPRD +HHGGWM KI CW +IV  MFF+PN +VS 
Sbjct  81   LRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWAVIVFLMFFVPNGVVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWN+ WV  +EQFWY+AL VV+++CY+AT +F+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIATASFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLN FFIV TLI VF FA+V LHP + GS+ PASV+ LYCTYLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNMFFIVFTLILVFAFAIVALHPKINGSLLPASVIGLYCTYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSKAVS+G+LTLGL+TTVLSVVYSAVRAGSS 
Sbjct  261  SSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSSA  306



>gb|EMT13726.1| Putative serine incorporator [Aegilops tauschii]
Length=414

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 193/226 (85%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M G+K+QKDPRD VHHGGWM KI CW +IV  MFF+PN +VS 
Sbjct  82   LRVSLGNFLFFTILAAIMAGIKDQKDPRDKVHHGGWMAKIFCWVVIVFLMFFVPNGVVSF  141

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWN+ WV  +EQFWY+AL VV+++CY+ +FAF+GL
Sbjct  142  YESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIGSFAFSGL  201

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLN FFIV TLI VF FA+V LHP V GS+ PASV+ LYCTYLCYSGL
Sbjct  202  LFHWFTPSGQDCGLNMFFIVSTLILVFVFAIVALHPKVNGSLLPASVIGLYCTYLCYSGL  261

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSKA+S+G+LTLGL TT+LSVVYSAVRAGSS 
Sbjct  262  SSEPRDYECNGLHNHSKAMSTGSLTLGLCTTILSVVYSAVRAGSSA  307



>gb|ACL54492.1| unknown [Zea mays]
Length=413

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M G+K+QKDPRD +HHGGWM KI CW +I   MFF+PN +VS 
Sbjct  81   LRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWVIIAFLMFFVPNGVVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWN+ WV  +EQFWY+AL VV+++CY+ATF F+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIATFCFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLN FFIV TLI VF FA+V LHP + GS+ PASV+ +YCTYLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNLFFIVFTLILVFAFAIVALHPKINGSLLPASVIGMYCTYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  NHSKAVS+G+LTLGL+TTVLSVVYSAVRAGSS 
Sbjct  261  SSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSSA  306



>emb|CDX83957.1| BnaC08g16880D [Brassica napus]
Length=821

 Score =   307 bits (786),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FF+ LS MMIGVK QKDPRD +HHGGWMMK+ CWF++VI MFF+PNE++S 
Sbjct  81   LRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVISF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFG+G FLLVQVVLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+GL
Sbjct  141  YESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFLFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLIFVF FAVV LHP+V GSI PASV+S YC YLCYSGL
Sbjct  201  LFHWFTPSGHDCGLNTFFIVMTLIFVFVFAVVVLHPAVGGSILPASVISFYCMYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  261  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  306



>ref|XP_010246591.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=409

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 195/226 (86%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRV+LGNFLFFT L+ +MIG+K++ D RD +HHGG M KI  W L+VIFMFFLPN I S 
Sbjct  77   LRVNLGNFLFFTILAVLMIGIKDE-DSRDRLHHGGXMTKIVSWCLVVIFMFFLPNGIASF  135

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQVV+LLDFVHGWND+WV  +EQFWYIAL VV+L  YVATF+F+GL
Sbjct  136  YETVSKFGSGLFLLVQVVMLLDFVHGWNDRWVRKDEQFWYIALSVVSLAGYVATFSFSGL  195

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIV+TLIFVF FA+V LHP+V GSIFPAS +SL+CTYLCYSGL
Sbjct  196  LFHWFTPSGHDCGLNTFFIVITLIFVFVFAIVALHPAVGGSIFPASAISLFCTYLCYSGL  255

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSK V +GT+ LGL+TTV+SVVYSAVRAGSST
Sbjct  256  ASEPRDYECNGLHQHSKTVPTGTIILGLLTTVVSVVYSAVRAGSST  301



>ref|XP_003570284.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=414

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M G+K+QKDPRD +HHGGWM KI CW +IV  MF +PN +VS 
Sbjct  81   LRVSLGNFLFFTILAGIMAGIKDQKDPRDKIHHGGWMAKIFCWAVIVFLMFLVPNGVVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDFVHGWN+ WV  +EQFWY+AL VV+++CY+ATF+F+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIATFSFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +CGLN FFIV TL+ VF FA+V LHP + GS+ PASV++LYCTYLCYS L
Sbjct  201  LFHWFTPSGQDCGLNLFFIVFTLMLVFLFAIVALHPKINGSLLPASVIALYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY+CNG  NHSKA+S+G+LTLGL+TT+LSVVYSAVRAGSS 
Sbjct  261  SSEPRDYKCNGLHNHSKAMSTGSLTLGLITTILSVVYSAVRAGSSA  306



>ref|XP_004302121.1| PREDICTED: serine incorporator 3-like [Fragaria vesca subsp. 
vesca]
Length=246

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 186/210 (89%), Gaps = 1/210 (0%)
 Frame = +2

Query  53   MIGVKNQKDPRDSVHHGGWMMKICCWFLIVIF-MFFLPNEIVSLYETTSKFGSGlfllvq  229
            MIGVK QKDPRDS+HHGGWMMK+ CWFL+V+F ++F+PN  +S YET +KFGSG FLLVQ
Sbjct  1    MIGVKRQKDPRDSIHHGGWMMKVTCWFLLVLFSLYFVPNGFISFYETIAKFGSGFFLLVQ  60

Query  230  vvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGLLFHFFAPSGHECGLNT  409
            VVLLLDFVHGWN+KWV Y+EQFWY+ALFVV+L+CY+ATF F GLLFH F PSGH+C LNT
Sbjct  61   VVLLLDFVHGWNNKWVSYDEQFWYVALFVVSLVCYLATFVFCGLLFHLFTPSGHDCRLNT  120

Query  410  FFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGLVSEPRDYECNGFLNHS  589
            FFIVMTLIFVF F +V LHP+V GSI PASV+S+YCTYLCYS L SEPRDYECNG   HS
Sbjct  121  FFIVMTLIFVFVFLIVALHPTVGGSILPASVISVYCTYLCYSALASEPRDYECNGLHKHS  180

Query  590  KAvssgtltlglvttvlsvvYSAVRAGSST  679
            KAVS+GTLTLGL+TTVLSVVYSAVRAGSST
Sbjct  181  KAVSTGTLTLGLLTTVLSVVYSAVRAGSST  210



>gb|ABR16232.1| unknown [Picea sitchensis]
Length=407

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT  +  MIG+K QKD RD  HHGGW++KI CW L+V+ MFFLPN ++S+
Sbjct  72   LRVSLGNFLFFTIFAVTMIGIKTQKDIRDGWHHGGWIVKIICWALLVVLMFFLPNSVISV  131

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQV++LLDF H WND WV  +EQFWYIAL VV+++CY+ TFAF+GL
Sbjct  132  YETLSKFGSGLFLLVQVIILLDFTHTWNDAWVAKDEQFWYIALLVVSIVCYLVTFAFSGL  191

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF++F PSGH+C LN FFIVMT+I  F FAV+ LHP V GS+ PASV+S+YC YLCY GL
Sbjct  192  LFYWFNPSGHDCSLNVFFIVMTMILAFAFAVIALHPQVSGSLLPASVISVYCAYLCYCGL  251

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG  NH+ AVS+GTL LG++TTVLSV+YSAVRAGSST
Sbjct  252  SSEPRDYGCNGLHNHTAAVSTGTLILGMLTTVLSVIYSAVRAGSST  297



>ref|XP_006850791.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
 gb|ERN12372.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
Length=339

 Score =   280 bits (716),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT  + +MIGVK+Q D RDS HHGGW+ KI  W L+VI MFFLPN + ++
Sbjct  5    LRVSLGNFLFFTIFALIMIGVKDQNDRRDSWHHGGWITKIIVWSLLVILMFFLPNAVFNM  64

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFGSGLFLLVQV++LLDF H WND WV  +EQ WYIAL  V+++CY+ATFAF+GL
Sbjct  65   YAMLSKFGSGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLSVSVVCYLATFAFSGL  124

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG++CGLN FFIVMT+I  F FA+V LHP V GS+FPASV+S+YC YLCY+GL
Sbjct  125  LFFWFNPSGNDCGLNVFFIVMTMILAFGFAIVALHPKVNGSLFPASVISMYCAYLCYTGL  184

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GTL +G++TTVLSVVYSAVRAGSST
Sbjct  185  SSEPRDYECNGLHKHSKAVSTGTLIMGMITTVLSVVYSAVRAGSST  230



>ref|XP_004135884.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
Length=422

 Score =   283 bits (723),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 168/237 (71%), Positives = 194/237 (82%), Gaps = 11/237 (5%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT LS MM+GVK+Q+DPRD++HHGGWM+K+ CWFL+V+ MFF+PNEI++ 
Sbjct  81   LRVSLGNFLFFTILSVMMVGVKSQRDPRDNIHHGGWMVKVICWFLLVVLMFFVPNEIITF  140

Query  182  YE-----TTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATF  346
            Y      + SKFGSGLFLLVQVVLLLDFVH WND  +  +   WYIALFVV+L CYVATF
Sbjct  141  YVWLRIVSISKFGSGLFLLVQVVLLLDFVHRWNDTRILSSSLLWYIALFVVSLFCYVATF  200

Query  347  AFNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYL  526
              +GLLFH+F P+GH+CGLNTFFIVMTLIF F F VV LHP+V GS+ PASV+SLYC YL
Sbjct  201  VSSGLLFHWFTPAGHDCGLNTFFIVMTLIFAFIFTVVALHPAVGGSVLPASVISLYCMYL  260

Query  527  CYSGLVSEPRDYECNGFLNHSKAvssgtltl------glvttvlsvvYSAVRAGSST  679
            CYSGL SEPRDYECNG   HSKAVS+GTL+L        +TTVLSVVYSAVRAGSST
Sbjct  261  CYSGLASEPRDYECNGLHKHSKAVSTGTLSLGLLTTVLSLTTVLSVVYSAVRAGSST  317



>gb|ABR17762.1| unknown [Picea sitchensis]
 gb|ABR17907.1| unknown [Picea sitchensis]
Length=417

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/226 (70%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLG+FLFF   + +MIGVK+Q+D RDS HHGGWM KI  W  +V+ MFF+PN ++ +
Sbjct  81   LRVSLGSFLFFAVFALIMIGVKDQRDARDSWHHGGWMAKIMTWCTLVVLMFFVPNGLIGI  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLL+QVVLLLDF H WN+ WV  +EQFWYIAL VV+L+CY+ TFAF+GL
Sbjct  141  YETLSKFGSGLFLLIQVVLLLDFTHTWNNAWVSKDEQFWYIALLVVSLVCYIGTFAFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG++C LNTFFIV+TL   F FAVV LHP V GS+ PASV+S+YCTYLCYSGL
Sbjct  201  LFHWFNPSGYDCNLNTFFIVVTLSLAFVFAVVALHPKVNGSLLPASVISVYCTYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   H KAVS+ TL LG++TTVLSVVYSAVRAGSST
Sbjct  261  SSEPRDYECNGLHGHVKAVSTSTLLLGMITTVLSVVYSAVRAGSST  306



>ref|XP_009391591.1| PREDICTED: serine incorporator 3 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   277 bits (709),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + +MIGVK+Q D RDS HHGGW++KI  W L+++ MFFLPN ++++
Sbjct  81   LRVSLGNFLFFAIFALLMIGVKDQNDKRDSWHHGGWIVKIIIWALLIVLMFFLPNIVITI  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG FLLVQVV+LLDF H WND WV  +EQ WY+AL  +T++CY+AT+AF+G+
Sbjct  141  YETLSKFGSGFFLLVQVVILLDFTHTWNDAWVEKDEQKWYVALLSITVVCYLATYAFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FA+V LHP V GS+ P+SV+S+YC YLCYSGL
Sbjct  201  LFMWFNPSGHDCGLNVFFIVMTMILAFVFAIVALHPQVNGSLLPSSVISIYCAYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG  NH K VS+GTL LG++TTVLSVVYSAVRAGSST
Sbjct  261  SSEPRDYACNGLHNHVKQVSTGTLVLGMLTTVLSVVYSAVRAGSST  306



>gb|EMS53525.1| putative serine incorporator [Triticum urartu]
Length=316

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = +2

Query  53   MIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLYETTSKFGSGlfllvqv  232
            M G+K+QKDPRD VHHGGWM KI CW +IV  MFF+PN +VS YE+ SKFGSGLFLLVQV
Sbjct  1    MAGIKDQKDPRDKVHHGGWMAKIFCWVVIVFLMFFVPNGVVSFYESISKFGSGLFLLVQV  60

Query  233  vllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGLLFHFFAPSGHECGLNTF  412
            VLLLDFVHGWN+ WV  +EQFWY+AL VV+++CY+ +FAF+GLLFH+F PSG +CGLN F
Sbjct  61   VLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIGSFAFSGLLFHWFTPSGQDCGLNMF  120

Query  413  FIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGLVSEPRDYECNGFLNHSK  592
            FIV TLI VF FA+V LHP V GS+ PASV+ LYCTYLCYSGL SEPRDYECNG  NHSK
Sbjct  121  FIVSTLILVFVFAIVALHPKVNGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSK  180

Query  593  AvssgtltlglvttvlsvvYSAVRAGSST  679
            A+S+G+LTLGL TT+LSVVYSAVRAGSS 
Sbjct  181  AMSTGSLTLGLCTTILSVVYSAVRAGSSA  209



>emb|CDY52849.1| BnaA09g56410D [Brassica napus]
Length=400

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 187/226 (83%), Gaps = 13/226 (6%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNF+FF+ LS MMIGVK QKDPRD +HHGGWMMK+ CWF++VI MF  P +    
Sbjct  81   LRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFSFPMK----  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
               +S F S      + VLLLDFVHGWND WVGY+EQFWY AL VV+L+CY+ATF F+GL
Sbjct  137  ---SSAFMS------RFVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSGL  187

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSGH+CGLNTFFIVMTLIFVF FAVV LHP+V GSI PASV+S+YC YLCYSGL
Sbjct  188  LFHWFTPSGHDCGLNTFFIVMTLIFVFVFAVVVLHPAVGGSILPASVISVYCMYLCYSGL  247

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG   HSKAVS+GT+T+GL+TTVLSVVYSAVRAGSST
Sbjct  248  ASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSST  293



>ref|XP_009799680.1| PREDICTED: probable serine incorporator [Nicotiana sylvestris]
Length=408

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 184/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS HHGGW+ K+  W L+V  MFFLPN ++++
Sbjct  77   LRVSLGNFLFFGLLALIMIGVKDQNDKRDSWHHGGWVAKLVIWVLLVALMFFLPNGVITV  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLL+QV++LLD  H WND WV  +EQ WYIAL V+++ CY+ATFAF+G+
Sbjct  137  YSFISKFGAGLFLLIQVIILLDATHSWNDSWVAKDEQKWYIALLVISVGCYIATFAFSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FAV+ LHP V GS+ PASV+S+YC Y+CY+GL
Sbjct  197  LFMWFNPSGHDCGLNVFFIVMTMILAFAFAVIALHPKVNGSLLPASVISVYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG LN SKAV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  257  SSEPRDYVCNG-LNKSKAVTTSTLVLGMLTTVLSVLYSALRAGSST  301



>ref|XP_009623079.1| PREDICTED: probable serine incorporator [Nicotiana tomentosiformis]
Length=408

 Score =   270 bits (690),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 183/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS HHGGW+ K+  W L+V  MFFLPN ++++
Sbjct  77   LRVSLGNFLFFGLLALIMIGVKDQNDKRDSWHHGGWVAKLVIWMLLVALMFFLPNGVITV  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLL+QV++LLD  H WND WV  +EQ WYIAL V++  CY+ATFAF+G+
Sbjct  137  YSFISKFGAGLFLLIQVIILLDATHSWNDSWVAKDEQKWYIALLVISAGCYIATFAFSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FAV+ LHP V GS+ PASV+S+YC Y+CY+GL
Sbjct  197  LFMWFNPSGHDCGLNVFFIVMTMILAFAFAVIALHPKVNGSLLPASVISVYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG LN SKAV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  257  SSEPRDYVCNG-LNKSKAVTTSTLVLGMLTTVLSVLYSALRAGSST  301



>ref|XP_010255869.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=416

 Score =   270 bits (690),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 184/226 (81%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + +MIGVK+Q D RDS HHGGW++KI  W L++I MFF+PN I+++
Sbjct  78   LRVSLGNFLFFVVFALVMIGVKDQNDKRDSWHHGGWILKIVVWVLLIILMFFVPNAIITI  137

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSGLFLLVQV++LLDF H WND WV  +EQ WYIAL  V++ CY+A F F+G+
Sbjct  138  YETLSKFGSGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSIGCYLAAFTFSGI  197

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+C LN FF+VMT+I  F FAV+ LHP V GS+ PASV+S+YC YLCY+GL
Sbjct  198  LFIWFNPSGHDCSLNVFFLVMTIILAFSFAVIALHPKVNGSLLPASVISVYCAYLCYTGL  257

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG   +SKAVS+GTL LG++TTVLSV+YSAVRAGSST
Sbjct  258  SSEPRDYICNGLHKNSKAVSTGTLILGMLTTVLSVLYSAVRAGSST  303



>ref|XP_010546829.1| PREDICTED: serine incorporator 3 isoform X1 [Tarenaya hassleriana]
Length=410

 Score =   269 bits (688),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 182/226 (81%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +MIGVK+Q D RDS HHGGW++K+  WFL+V  MFF+PN IVS+
Sbjct  77   LRVSFGNFLFFALFALIMIGVKDQNDRRDSWHHGGWVVKMIVWFLLVTLMFFVPNVIVSI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y T SKFG+G FLLVQV+LLLD  H WND WV  +E+ WYIAL V+++ CY+AT+ F+ +
Sbjct  137  YGTLSKFGAGAFLLVQVILLLDATHNWNDAWVEKDERKWYIALLVISIACYLATYGFSAI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVM +I  F FAV+ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  197  LFIWFNPSGHDCGLNVFFIVMAMILSFAFAVIALHPAVNGSLLPASVISVYCVYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  N SKAV++ TL LG++TTVLSV+YSAVRAGSST
Sbjct  257  SSEPRDYECNGLHNKSKAVTTSTLILGMLTTVLSVIYSAVRAGSST  302



>ref|XP_010322266.1| PREDICTED: serine incorporator 3 [Solanum lycopersicum]
Length=411

 Score =   269 bits (688),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIG+K+Q D RD +HHGGW+ K+  W L+V  MFFLPN ++++
Sbjct  77   LRVSLGNFLFFGVLALIMIGIKDQNDRRDCLHHGGWVAKLVIWVLLVALMFFLPNGVITI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+G FLL+QV++LLD  H WND WV  +EQ WY+AL VV++ CY+ATF F+G+
Sbjct  137  YGFLSKFGAGFFLLIQVIILLDATHSWNDSWVAKDEQKWYVALLVVSVACYIATFVFSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FAV+ LHP V GS+ PASV+S+YC Y+CYSGL
Sbjct  197  LFMWFNPSGHDCGLNVFFIVMTMILAFAFAVIALHPKVNGSLLPASVISVYCAYVCYSGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG  N SKAV++ TL LG++TTVLSV+YSA+RAGS+T
Sbjct  257  SSEPRDYVCNGLHNKSKAVTTSTLVLGMLTTVLSVLYSALRAGSAT  302



>ref|XP_010546830.1| PREDICTED: serine incorporator 3 isoform X2 [Tarenaya hassleriana]
Length=409

 Score =   269 bits (688),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 182/226 (81%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +MIGVK+Q D RDS HHGGW++K+  WFL+V  MFF+PN IVS+
Sbjct  77   LRVSFGNFLFFALFALIMIGVKDQNDRRDSWHHGGWVVKMIVWFLLVTLMFFVPNVIVSI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y T SKFG+G FLLVQV+LLLD  H WND WV  +E+ WYIAL V+++ CY+AT+ F+ +
Sbjct  137  YGTLSKFGAGAFLLVQVILLLDATHNWNDAWVEKDERKWYIALLVISIACYLATYGFSAI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVM +I  F FAV+ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  197  LFIWFNPSGHDCGLNVFFIVMAMILSFAFAVIALHPAVNGSLLPASVISVYCVYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDYECNG  N SKAV++ TL LG++TTVLSV+YSAVRAGSST
Sbjct  257  SSEPRDYECNGLHNKSKAVTTSTLILGMLTTVLSVIYSAVRAGSST  302



>ref|XP_006356686.1| PREDICTED: serine incorporator 3-like [Solanum tuberosum]
Length=409

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIG+K+Q D RDS HHGGW+ K+  W L+V  MFFLPN ++++
Sbjct  77   LRVSLGNFLFFGVLALIMIGIKDQNDRRDSWHHGGWVAKLVIWVLLVALMFFLPNGVITI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+G FLL+QV++LLD  H WND WV  +EQ WY+AL VV++ CY+ATF F+G+
Sbjct  137  YGFLSKFGAGFFLLIQVIILLDATHSWNDSWVAKDEQKWYVALLVVSVACYIATFVFSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FAV+ LHP V GS+ PASV+S+YC Y+CYSGL
Sbjct  197  LFMWFNPSGHDCGLNVFFIVMTMILAFAFAVIALHPKVNGSLLPASVISVYCAYVCYSGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG  N SKAV++ TL LG++TTVLSV+YSA+RAGS+T
Sbjct  257  SSEPRDYVCNGLHNKSKAVTTSTLVLGMLTTVLSVLYSALRAGSAT  302



>ref|XP_009129653.1| PREDICTED: probable serine incorporator [Brassica rapa]
Length=408

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 186/226 (82%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +MIGVK+Q D RDS HHGGW +K+  WFL+V+ MFF+PNEI+S+
Sbjct  77   LRVSFGNFLFFAIYALVMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNEIISI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+G FLLVQVVLLLD  H WND WV  +E+ WY+AL V++++CY+AT+AF+G+
Sbjct  137  YGILSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDERKWYVALLVISIVCYIATYAFSGV  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FA+V LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  197  LFMWFNPSGHDCGLNVFFIVMTMILAFVFAIVALHPAVNGSLLPASVISVYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG LN SKAV++ TLTLG++TTVLSV+YSA+RAGSST
Sbjct  257  SSEPHDYVCNG-LNRSKAVTASTLTLGMLTTVLSVLYSALRAGSST  301



>emb|CDY24707.1| BnaA05g31060D [Brassica napus]
Length=408

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 185/226 (82%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +MIGVK+Q D RDS HHGGW +K+  WFL+V+ MFF+PNEI+S+
Sbjct  77   LRVSFGNFLFFAIYALVMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNEIISI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+G FLLVQVVLLLD  H WND WV  +E+ WY+AL V++++CY+AT+AF+G+
Sbjct  137  YGILSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDERKWYVALLVISIVCYIATYAFSGV  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FA+V LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  197  LFMWFNPSGHDCGLNVFFIVMTMILAFVFAIVALHPAVNGSLLPASVISVYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG LN SKAV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  257  SSEPHDYVCNG-LNRSKAVTASTLILGMLTTVLSVLYSALRAGSST  301



>ref|XP_010938752.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=416

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 178/223 (80%), Gaps = 0/223 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLG+FLFF   + MMIGVK+Q D RDS HHGGW+ KI  W ++++ MFFLPN ++++
Sbjct  81   LRVSLGSFLFFAIFALMMIGVKDQNDKRDSWHHGGWIAKIVIWVVLIVLMFFLPNIVITI  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG FL  QV+LLLDF + WND WV  +EQ WYIAL  V+ +CY+AT++F+G+
Sbjct  141  YETLSKFGSGFFLFAQVILLLDFTYTWNDAWVEKDEQKWYIALLSVSAVCYLATYSFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FAVV LHP V GS+ PASV+S+YC YLCYSGL
Sbjct  201  LFMWFNPSGHDCGLNVFFIVMTMILAFAFAVVALHPQVNGSLLPASVISVYCAYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAG  670
             SEPRDY CNG   HSK VS+GTL LGL+TTV+SVVYSAVR G
Sbjct  261  SSEPRDYACNGLHKHSKQVSTGTLVLGLLTTVISVVYSAVRTG  303



>gb|KDP40096.1| hypothetical protein JCGZ_02094 [Jatropha curcas]
Length=401

 Score =   265 bits (676),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + +MIGVK+Q D RDS HHGGW+ K+  W L+V+ MFF+PN I+S+
Sbjct  67   LRVSLGNFLFFAIFALIMIGVKDQNDKRDSWHHGGWIAKMVIWLLLVVLMFFMPNVIISI  126

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLL QV++LLDF H WND WV  +EQ WYIAL  V+++CY+A F F+G+
Sbjct  127  YGIASKFGAGLFLLFQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSIVCYLAAFTFSGI  186

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FA++ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  187  LFLWFNPSGHDCGLNIFFIVMTMILAFVFAIIALHPTVNGSLLPASVISVYCAYVCYTGL  246

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG    +KAVS+ TL LG++TTVLSV+YSAVRAGSST
Sbjct  247  SSEPLDYACNGLHKSTKAVSTSTLVLGVLTTVLSVLYSAVRAGSST  292



>ref|XP_010237604.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
 ref|XP_010237605.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=418

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + MMIGVK+Q D RD+ HHGGW+ KI  W ++++ MFF+PN ++++
Sbjct  81   LRVSLGNFLFFGIFALMMIGVKDQNDRRDAWHHGGWIAKIAVWVVLIVLMFFVPNIVITV  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE  SKFGSGLFLLVQVV+LLDF + WND WV  +EQ W IAL VVT++CY++TFAF+G+
Sbjct  141  YEMLSKFGSGLFLLVQVVMLLDFTNNWNDSWVEKDEQKWEIALLVVTVVCYLSTFAFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF  F PSGH+CGLN FFIVMT+I  F FA++ LHP V GS+ PASV+S+YC YLCYS L
Sbjct  201  LFMLFNPSGHDCGLNVFFIVMTIILAFAFAIIALHPQVNGSVMPASVISVYCAYLCYSSL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG   HSK VS G L LG++TTVLSVVYSAVRAGSST
Sbjct  261  SSEPDDYACNGLHMHSKQVSVGALILGMLTTVLSVVYSAVRAGSST  306



>ref|XP_008799134.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=416

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 180/223 (81%), Gaps = 0/223 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + MMIGVK+Q D R S HHGGW+ KI  W +++I MFFLPN ++++
Sbjct  81   LRVSLGNFLFFAIFALMMIGVKDQNDKRYSWHHGGWIAKIVVWAVLIILMFFLPNIVITI  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFGSG FLLVQV+LLLDF + WND WV  +EQ WYIAL  V+++CY+AT++F+G+
Sbjct  141  YETLSKFGSGFFLLVQVILLLDFTYTWNDAWVEKDEQKWYIALLSVSVVCYLATYSFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FAVV LHP V GS+ PASV+S+YC YLCYSGL
Sbjct  201  LFMWFNPSGHDCGLNVFFIVMTMILAFVFAVVALHPQVNGSLLPASVISVYCAYLCYSGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAG  670
             SEPRDY CNG   HSK VS+GTL LGL+TTV+SVVYSAVR G
Sbjct  261  SSEPRDYACNGLHKHSKQVSTGTLVLGLLTTVISVVYSAVRTG  303



>ref|XP_006419802.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
 ref|XP_006489289.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
 gb|ESR33042.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
Length=414

 Score =   265 bits (677),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  LS +MIG+K+Q D RDS HHGGW  KI  W L+V+ MFFLPN ++S+
Sbjct  79   LRVSLGNFLFFGILSLIMIGIKDQNDKRDSWHHGGWCAKIIIWALLVVLMFFLPNVVISI  138

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFG+GLFLLVQV++LLD VH WND WV  +EQ WY+AL  +++ CY+A F F+G+
Sbjct  139  YETISKFGAGLFLLVQVIILLDGVHTWNDAWVAKDEQKWYVALLAISVGCYLAAFTFSGI  198

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FAV+ L+PSV GS+ PASV+S+YC Y+CY+ L
Sbjct  199  LFIWFNPSGHDCGLNVFFIVMTMILAFVFAVIALNPSVNGSLLPASVISVYCAYVCYTAL  258

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG  N SKAV+  TL LG++TTVLSV+YSA+RAGSST
Sbjct  259  SSEPHDYVCNGLHNKSKAVTISTLVLGMLTTVLSVLYSALRAGSST  304



>emb|CDY05246.1| BnaC05g45570D [Brassica napus]
Length=408

 Score =   265 bits (676),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 185/226 (82%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +MIGVK+Q D RDS HHGGW +K+  WFL+V+ MFF+PN I+S+
Sbjct  77   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNVIISV  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+G FLLVQVVLLLD  H WND WV  +E+ WYIAL V++++CY+AT+AF+G+
Sbjct  137  YGILSKFGAGAFLLVQVVLLLDATHSWNDSWVEKDERKWYIALLVISIVCYLATYAFSGV  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FA+V LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  197  LFMWFNPSGHDCGLNVFFIVMTMILAFVFAIVALHPAVNGSLLPASVISVYCAYICYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG LN SKAV++ TLTLG++TTVLSV+YSA+RAGSST
Sbjct  257  SSEPHDYVCNG-LNRSKAVTASTLTLGMLTTVLSVLYSALRAGSST  301



>ref|XP_008673654.1| PREDICTED: uncharacterized protein LOC100191916 isoform X1 [Zea 
mays]
Length=339

 Score =   262 bits (670),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 177/226 (78%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   S +MIGVK+Q D RD+ HHGGW+ KI  W ++++ MF +PN ++++
Sbjct  5    LRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGWIAKIAVWAVLIVLMFCVPNIVITI  64

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE  SKFGSG FLLVQVV+LLDF + WND WV   E+ W IAL VVT++CY++T AF+G+
Sbjct  65   YEVLSKFGSGFFLLVQVVMLLDFTNNWNDSWVEKEERKWEIALLVVTVVCYLSTLAFSGV  124

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMTLI  F FA+V LHP V GS+ PASV+S+YC YLCY+ L
Sbjct  125  LFMWFNPSGHDCGLNVFFIVMTLILAFAFAIVALHPQVHGSVMPASVISVYCAYLCYTSL  184

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DYECNG   HSK VS   L LG++TTVLSVVYSAVRAGSST
Sbjct  185  SSEPDDYECNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSST  230



>ref|XP_002280143.1| PREDICTED: serine incorporator 3 [Vitis vinifera]
 emb|CBI26177.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + +MIGVK+Q D RDS HHGGW+ K+  W L++I MFF+PN ++S+
Sbjct  77   LRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWVAKMVIWVLLIILMFFVPNVVISI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y T SKFG+GLFLLVQV++LLDF H WND WV  +EQ WYIAL  V++ CY+  F F+G+
Sbjct  137  YGTLSKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSIGCYLLAFTFSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG++CGLN FFIVMT+I  F FAV+ LHP V GS+ PASV+SLYC Y+CY+GL
Sbjct  197  LFIWFNPSGNDCGLNIFFIVMTMILAFSFAVIALHPRVNGSLLPASVISLYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG  N SKAVS+ TL LG++TTVLSV+YSAVRAGSST
Sbjct  257  SSEPRDYACNGLHNKSKAVSTSTLILGMLTTVLSVLYSAVRAGSST  302



>ref|XP_010486107.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   264 bits (675),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 184/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +MIGVK+Q D RDS HHGGW +K+  WFL+V+ MFF+PN IVS+
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSI  137

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y T SKFG+G FLLVQVVLLLD  H WND WV  +E+ WYIAL V++++CY+AT+AF+G+
Sbjct  138  YGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYAFSGI  197

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVM +I  F FA++ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  198  LFIWFNPSGHDCGLNVFFIVMPMILAFVFAIIALHPAVNGSLLPASVISVYCAYVCYTGL  257

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG LN SKAV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  258  SSEPHDYVCNG-LNKSKAVNASTLILGMLTTVLSVLYSALRAGSST  302



>ref|XP_006297798.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
 gb|EOA30696.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
Length=410

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 184/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +MIGVK+Q D RDS HHGGW +K+  WFL+V+ MFF+PN IVS+
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSI  137

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y T SKFG+G FLLVQVVLLLD  H WND WV  +E+ WYIAL V++++CY+AT+AF+G+
Sbjct  138  YGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYAFSGI  197

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVM +I  F FA++ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  198  LFIWFNPSGHDCGLNVFFIVMPMILAFVFAIIALHPAVNGSLLPASVISVYCAYVCYTGL  257

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG LN SKAV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  258  SSEPHDYVCNG-LNKSKAVNASTLILGMLTTVLSVLYSALRAGSST  302



>tpg|DAA49274.1| TPA: hypothetical protein ZEAMMB73_017777 [Zea mays]
Length=359

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 177/226 (78%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   S +MIGVK+Q D RD+ HHGGW+ KI  W ++++ MF +PN ++++
Sbjct  25   LRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGWIAKIAVWAVLIVLMFCVPNIVITI  84

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE  SKFGSG FLLVQVV+LLDF + WND WV   E+ W IAL VVT++CY++T AF+G+
Sbjct  85   YEVLSKFGSGFFLLVQVVMLLDFTNNWNDSWVEKEERKWEIALLVVTVVCYLSTLAFSGV  144

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMTLI  F FA+V LHP V GS+ PASV+S+YC YLCY+ L
Sbjct  145  LFMWFNPSGHDCGLNVFFIVMTLILAFAFAIVALHPQVHGSVMPASVISVYCAYLCYTSL  204

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DYECNG   HSK VS   L LG++TTVLSVVYSAVRAGSST
Sbjct  205  SSEPDDYECNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSST  250



>ref|XP_010464184.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=409

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 183/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +MIGVK+Q D RDS HHGGW +K+  WFL+V  MFF+PN IVS+
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVALMFFVPNVIVSI  137

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y T SKFG+G FLLVQVVLLLD  H WND WV  +E+ WYIAL V++++CY+AT+AF+G+
Sbjct  138  YGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYAFSGI  197

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVM +I  F FA++ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  198  LFIWFNPSGHDCGLNVFFIVMPMILAFVFAIIALHPAVNGSLLPASVISVYCAYVCYTGL  257

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG LN SKAV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  258  SSEPHDYVCNG-LNKSKAVNASTLILGMLTTVLSVLYSALRAGSST  302



>ref|XP_010436570.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 183/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +MIGVK+Q D RDS HHGGW +K+  WFL+V  MFF+PN IVS+
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVALMFFVPNVIVSI  137

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y T SKFG+G FLLVQVVLLLD  H WND WV  +E+ WYIAL V++++CY+AT+AF+G+
Sbjct  138  YGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYAFSGI  197

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVM +I  F FA++ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  198  LFIWFNPSGHDCGLNVFFIVMPMILAFVFAIIALHPAVNGSLLPASVISVYCAYVCYTGL  257

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG LN SKAV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  258  SSEPHDYVCNG-LNKSKAVNASTLILGMLTTVLSVLYSALRAGSST  302



>ref|XP_004982576.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=415

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + MMIG+K+Q D RD+ HHGGW+ KI  W ++++ MF +PN + ++
Sbjct  81   LRVSLGNFLFFAIFAIMMIGIKDQNDRRDAWHHGGWVAKIAVWAVLIVLMFCVPNIVTTI  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE  SKFGSGLFLLVQVV+LLDF + WND WV  +EQ W IAL VVT++CY++TFAF+G+
Sbjct  141  YEVLSKFGSGLFLLVQVVMLLDFTNNWNDSWVEKDEQKWEIALLVVTVVCYLSTFAFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMTLI  F FA+V LHP V GSI PASV+S+YC YLCYS L
Sbjct  201  LFMWFNPSGHDCGLNVFFIVMTLILAFAFAIVALHPQVNGSIMPASVISVYCAYLCYSSL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP  YECNG   HSK VS   L LG++TTVLSVVYSAVRAGSST
Sbjct  261  SSEPDGYECNGLHMHSKQVSMSALILGMLTTVLSVVYSAVRAGSST  306



>ref|XP_002466928.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
 gb|EER93926.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
Length=415

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF T + MMIGVK+Q D RD+ HHGGW+ K+  W ++++ MF +PN ++++
Sbjct  81   LRVSLGNFLFFATFALMMIGVKDQNDRRDAWHHGGWIAKVAVWAVLIVLMFCVPNIVITI  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE  SKFGSG FLLVQVV+LLDF + WND W+   E+ W IAL VVT++CY++TFAF+G+
Sbjct  141  YEVLSKFGSGFFLLVQVVMLLDFTNNWNDSWIEKEERKWEIALLVVTVVCYLSTFAFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT I  F FA+V LHP V GS+ PASV+S+YC YLCY+ L
Sbjct  201  LFMWFNPSGHDCGLNVFFIVMTFILAFAFAIVALHPQVNGSVMPASVISVYCAYLCYTSL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DYECNG   HSK VS G L LG++TTVLSVVYSAVRAGSST
Sbjct  261  SSEPDDYECNGLHRHSKQVSLGALILGMLTTVLSVVYSAVRAGSST  306



>ref|XP_010693925.1| PREDICTED: serine incorporator 3 [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS HHGGWM+K+  W L+++ MFF+PN +V +
Sbjct  76   LRVSLGNFLFFAVLALIMIGVKDQNDKRDSWHHGGWMVKMIIWILLIVLMFFMPNVVVDI  135

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQVVLLLDF + WND WV  +EQ WY+AL  V++ CY+A FAF+G+
Sbjct  136  YGILSKFGAGLFLLVQVVLLLDFTYTWNDAWVEKDEQKWYVALLAVSVGCYIAAFAFSGI  195

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG +CGLN FFIVMT+I  F FAV+ LHP V GS+ PASV+S+YC Y+CY+GL
Sbjct  196  LFIWFNPSGQDCGLNVFFIVMTMILAFAFAVIALHPKVNGSLLPASVISVYCAYVCYTGL  255

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
             SEPRDY CNG  N SKAV++ TL LG++TTVLSV+YSA+RAGSS
Sbjct  256  SSEPRDYVCNGLHNKSKAVTTSTLVLGMITTVLSVLYSALRAGSS  300



>ref|XP_011090806.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=411

 Score =   262 bits (670),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS HH GW+ K+  W L++I MFFLPN I+++
Sbjct  77   LRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHDGWIAKMLIWALLIILMFFLPNVIITV  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLD  H WND WV  +EQ WY+AL  V++ CY+  F  +GL
Sbjct  137  YGVLSKFGAGLFLLVQVIILLDATHSWNDSWVAKDEQKWYLALLAVSVACYLGAFTISGL  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FF+VMT+I  F FAV+ LHP V GS+ PASV+S+YC YLCY+GL
Sbjct  197  LFIWFNPSGHDCGLNVFFLVMTIILAFVFAVIALHPKVNGSLLPASVISVYCAYLCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG  N SKAVS+ TL LG++TTVLSV+YSA+RAGSST
Sbjct  257  SSEPRDYVCNGLHNKSKAVSTSTLVLGMLTTVLSVLYSALRAGSST  302



>ref|XP_006650244.1| PREDICTED: probable serine incorporator-like [Oryza brachyantha]
Length=417

 Score =   262 bits (669),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 177/226 (78%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + MMIGVK+Q D RD+ HHGGW+ KI  W ++ + MF +PN ++++
Sbjct  81   LRVSLGNFLFFAIFALMMIGVKDQNDQRDAWHHGGWIAKIVVWAVLTVLMFCVPNIVITI  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE  SKFGSGLFLLVQVV+LLDF + WND WV  +EQ W IAL VVT++CY++TFAF+GL
Sbjct  141  YEILSKFGSGLFLLVQVVMLLDFTNNWNDSWVEKDEQKWEIALLVVTVVCYLSTFAFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFI MT+I  F FA++ LHP V GS+ PAS++S+YC YLCY+ L
Sbjct  201  LFMWFNPSGHDCGLNVFFITMTIILAFAFAIIALHPQVNGSVMPASIISVYCAYLCYTSL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG   HSK VS   L LG++TTVLSVVYSAVRAGSST
Sbjct  261  SSEPDDYACNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSST  306



>ref|XP_010103434.1| putative serine incorporator [Morus notabilis]
 gb|EXB95837.1| putative serine incorporator [Morus notabilis]
Length=409

 Score =   261 bits (668),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 182/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + +MIGVK+Q D RDS HHGGW+ K+  W ++V+ MFF+P+ ++S 
Sbjct  77   LRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLVLVVLMFFIPDAVISF  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y T SKFG+GLFLLVQV++LLDF H WND WV  +EQ WYIAL VV++ CY+A FAF+G+
Sbjct  137  YGTLSKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLVVSVGCYLAAFAFSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG +CGLN FFIVMT+I    FA++ LHP+V GS+ PASV+SLYC Y+CY+GL
Sbjct  197  LFIWFNPSGQDCGLNVFFIVMTMILALAFAIIALHPAVNGSLLPASVISLYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY+CNG LN SKAVS  TL LG++TTVLSV+YSA+RAGSST
Sbjct  257  SSEPHDYKCNG-LNKSKAVSLSTLILGMLTTVLSVLYSALRAGSST  301



>ref|NP_187268.2| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAZ23918.1| At3g06170 [Arabidopsis thaliana]
 gb|AEE74356.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 182/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +MIGVK+Q D RDS HHGGW +K+  WFL+V+ MFF+PN IVSL
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSL  137

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y T SKFG+G FLLVQVVLLLD  H WND WV  +E+ WYIAL V++++CY+AT+ F+G+
Sbjct  138  YGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYTFSGI  197

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG +CGLN FFIVM +I  F FA++ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  198  LFIWFNPSGQDCGLNVFFIVMPMILAFVFAIIALHPAVNGSLLPASVISVYCAYVCYTGL  257

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG LN SKAV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  258  SSEPHDYVCNG-LNKSKAVNASTLILGMLTTVLSVLYSALRAGSST  302



>ref|NP_001130812.1| uncharacterized protein LOC100191916 [Zea mays]
 gb|ACF79174.1| unknown [Zea mays]
 gb|ACF82535.1| unknown [Zea mays]
 gb|ACF85768.1| unknown [Zea mays]
 gb|ACG39558.1| serine incorporator 3 [Zea mays]
 tpg|DAA49275.1| TPA: Serine incorporator 3 isoform 1 [Zea mays]
 tpg|DAA49276.1| TPA: Serine incorporator 3 isoform 2 [Zea mays]
Length=415

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 177/226 (78%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   S +MIGVK+Q D RD+ HHGGW+ KI  W ++++ MF +PN ++++
Sbjct  81   LRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGWIAKIAVWAVLIVLMFCVPNIVITI  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE  SKFGSG FLLVQVV+LLDF + WND WV   E+ W IAL VVT++CY++T AF+G+
Sbjct  141  YEVLSKFGSGFFLLVQVVMLLDFTNNWNDSWVEKEERKWEIALLVVTVVCYLSTLAFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMTLI  F FA+V LHP V GS+ PASV+S+YC YLCY+ L
Sbjct  201  LFMWFNPSGHDCGLNVFFIVMTLILAFAFAIVALHPQVHGSVMPASVISVYCAYLCYTSL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DYECNG   HSK VS   L LG++TTVLSVVYSAVRAGSST
Sbjct  261  SSEPDDYECNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSST  306



>ref|XP_002882452.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58711.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 183/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +MIGVK+Q D RDS HHGGW +K+  WFL+V+ MFF+PN IVS+
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIAWFLLVVLMFFVPNVIVSI  137

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y T SKFG+G FLLVQVVLLLD  H WND WV  +E+ WYIAL V++++CY+AT+AF+G+
Sbjct  138  YGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYAFSGI  197

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG +CGLN FFIV+ +I  F FA++ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  198  LFIWFNPSGQDCGLNVFFIVVPMILAFVFAIIALHPAVNGSLLPASVISVYCAYVCYTGL  257

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG LN SKAV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  258  SSEPHDYVCNG-LNKSKAVNASTLILGMLTTVLSVLYSALRAGSST  302



>ref|XP_006407970.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49423.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=406

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 183/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS GNFLFF   + +M+GVK+Q D RDS HHGGW +K+  WFL+V+ MFF+PN +VS+
Sbjct  77   LRVSFGNFLFFAIYALIMVGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNVVVSI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+G FLLVQVVLLLD  H WND WV  +E+ W++AL V++++CYVAT+AF+G+
Sbjct  137  YGILSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDERKWFVALLVISVVCYVATYAFSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F P GH+CGLN FFIVMT+I  F FA+V LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  197  LFMWFNPPGHDCGLNVFFIVMTMILAFVFAIVALHPAVNGSLLPASVISVYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG LN SKAV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  257  SSEPHDYVCNG-LNRSKAVTASTLILGMLTTVLSVLYSALRAGSST  301



>ref|XP_007034589.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
 gb|EOY05515.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
Length=410

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGN LFF  L+ +MIGVK+Q D RDS HHGGW+ K+  W L+VI MFFLPN ++++
Sbjct  76   LRVSLGNCLFFAILALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVILMFFLPNVVITV  135

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y T SKFG+GLFLLVQV++LLDF H WND WV  +EQ WYIAL  V++ CY+A F F+G+
Sbjct  136  YGTLSKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSVGCYLAAFVFSGI  195

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT++  F F ++ LHP+V GS+ PASV+S+YC Y+C++GL
Sbjct  196  LFIWFNPSGHDCGLNIFFIVMTMVLAFAFGIIALHPAVNGSLLPASVISIYCAYVCFTGL  255

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG  N S AVS+ TL LG++TTVLSV+YSA+RAGSST
Sbjct  256  SSEPRDYVCNGLHNKSSAVSTSTLILGMLTTVLSVLYSALRAGSST  301



>ref|XP_008458551.1| PREDICTED: serine incorporator 3 [Cucumis melo]
Length=411

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RD+ HHGGWM K+  W L V+ MFFLPN I S+
Sbjct  76   LRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILFVVLMFFLPNVIFSI  135

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   S FG+GLFLLVQVVLLLDF H WND WV  +EQ WYIAL VV++ CY+ T+ F+GL
Sbjct  136  YGVLSIFGAGLFLLVQVVLLLDFTHSWNDSWVEKDEQKWYIALLVVSIGCYLGTYTFSGL  195

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FF+VMT+I  F FAV+ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  196  LFIWFNPSGHDCGLNVFFLVMTMILAFVFAVIALHPAVNGSLLPASVISVYCAYVCYTGL  255

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG    SKAVS GTL LG++TTVLSV+YSA+RAGSST
Sbjct  256  SSEPRDYVCNGLHTKSKAVSVGTLVLGMLTTVLSVIYSALRAGSST  301



>emb|CDO98987.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   259 bits (662),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS HHGGW +K+  W L+VI MFF+PN ++++
Sbjct  77   LRVSLGNFLFFGVLALLMIGVKDQNDRRDSWHHGGWTVKMVIWALLVILMFFIPNVVITI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLD  H WND WV  +EQ WYIAL V++++CY+  +A +G+
Sbjct  137  YGFISKFGAGLFLLVQVIILLDATHTWNDAWVAKDEQKWYIALLVISVVCYLGAYALSGV  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I    FAV+ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  197  LFIWFNPSGHDCGLNIFFIVMTMILALAFAVIALHPAVNGSLLPASVISVYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+Y CNG    S+AVS+ TL LGL+TT++SV+YSA+RAGSST
Sbjct  257  SSEPRNYVCNGLHKASRAVSTSTLILGLLTTIISVLYSALRAGSST  302



>ref|XP_002988580.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
 gb|EFJ10376.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
Length=371

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 176/226 (78%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + +MIGVKNQ D RDS HHGGWM K+  W  +++ MFFLPN +V  
Sbjct  81   LRVSLGNFLFFLAFAIVMIGVKNQSDQRDSWHHGGWMAKLILWLTVMVLMFFLPNGLVDA  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   S+FGSG+FLLVQV++LLDF H WN  WV  +EQFWYIAL ++++ CY  +F F+GL
Sbjct  141  YGAISRFGSGVFLLVQVIILLDFTHNWNAAWVAKDEQFWYIALLLISIFCYTISFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+C LNTFFIV T+I    FAV++LHP V GS+ PASV+++YCTY+CYS L
Sbjct  201  LFRWFNPSGHDCQLNTFFIVTTIILAIAFAVISLHPQVNGSLLPASVIAVYCTYICYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   H   VS+GTL LG++TT+LSVVYSAVRAGSST
Sbjct  261  SSEPRNYECNGLHKHENVVSTGTLVLGMLTTLLSVVYSAVRAGSST  306



>ref|XP_002979274.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
 gb|EFJ19682.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
Length=376

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 176/226 (78%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + +MIGVKNQ D RDS HHGGWM K+  W  +++ MFFLPN +V  
Sbjct  81   LRVSLGNFLFFLAFAIVMIGVKNQSDQRDSWHHGGWMAKLILWLTVMVLMFFLPNGLVDA  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   S+FGSG+FLLVQV++LLDF H WN  WV  +EQFWYIAL ++++ CY  +F F+GL
Sbjct  141  YGAISRFGSGVFLLVQVIILLDFTHNWNAAWVAKDEQFWYIALLLISIFCYTISFVFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+C LNTFFIV T+I    FAV++LHP V GS+ PASV+++YCTY+CYS L
Sbjct  201  LFRWFNPSGHDCQLNTFFIVTTIILAIAFAVISLHPQVNGSLLPASVIAVYCTYICYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   H   VS+GTL LG++TT+LSVVYSAVRAGSST
Sbjct  261  SSEPRNYECNGLHKHENVVSTGTLVLGMLTTLLSVVYSAVRAGSST  306



>ref|XP_004150322.1| PREDICTED: serine incorporator 3-like [Cucumis sativus]
 gb|KGN47263.1| hypothetical protein Csa_6G238640 [Cucumis sativus]
Length=411

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RD+ HHGGWM K+  W L+V+ MFFLPN I S+
Sbjct  76   LRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILLVVLMFFLPNVIFSI  135

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   S FG+GLFLLVQVVLLLDF H WND WV  +EQ WY+AL VV++ CY+ T+ F+GL
Sbjct  136  YGVLSIFGAGLFLLVQVVLLLDFTHSWNDSWVEKDEQKWYVALLVVSIGCYLGTYIFSGL  195

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FF+VMT+I  F FAV+ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  196  LFIWFNPSGHDCGLNVFFLVMTMILAFVFAVIALHPAVNGSLLPASVISVYCAYVCYTGL  255

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CN     SKAVS GTL LG++TTVLSV+YSA+RAGSST
Sbjct  256  SSEPRDYVCNDLHTKSKAVSVGTLVLGMLTTVLSVIYSALRAGSST  301



>ref|XP_002516786.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF45400.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=414

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 183/226 (81%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + +MIGVK+Q D RDS HHGGW+ K+  W L+++ MFF+PN ++++
Sbjct  80   LRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLLVLMFFMPNVVIAI  139

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLDF H WND WV  +EQ WYIAL VV+++CY+A FAF+G+
Sbjct  140  YGIISKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLVVSVVCYLAAFAFSGV  199

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG +CGLN FFIVMT+I  F FA++ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  200  LFIWFNPSGQDCGLNIFFIVMTMILAFVFAIIALHPTVNGSLLPASVISIYCAYVCYTGL  259

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG  N +KAVS+ TL LG++TT+LSV+YSAVRAGSST
Sbjct  260  SSEPHDYVCNGLHNKTKAVSTSTLILGMLTTILSVLYSAVRAGSST  305



>ref|XP_008340909.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=409

 Score =   256 bits (655),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 181/226 (80%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS+GNFLFFT  + +MIGVK+Q D RDS HHGGW+ K+  W L+VI MFF+P+ ++++
Sbjct  77   LRVSMGNFLFFTAFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVILMFFMPDIVITI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLDF H WND WV  +EQ WYIAL VV+++CY+A FA +G+
Sbjct  137  YGFLSKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFALSGV  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG +CGLN FFIVMT+I  F FAV+ LHP V GS+ PASV+S+Y  Y+C++ L
Sbjct  197  LFIWFNPSGEDCGLNIFFIVMTMILAFGFAVIALHPKVNGSLLPASVISVYSAYVCFTAL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG L+HSKAVS  TL LG+ TTVLSV+YSA+RAGSST
Sbjct  257  SSEPRDYACNG-LHHSKAVSVSTLLLGMATTVLSVLYSALRAGSST  301



>ref|XP_004169518.1| PREDICTED: LOW QUALITY PROTEIN: serine incorporator 3-like [Cucumis 
sativus]
Length=411

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RD+ HHGGWM K+  W L+V+ MFF PN I S+
Sbjct  76   LRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILLVVLMFFXPNVIFSI  135

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   S FG+GLFLLVQVVLLLDF H WND WV  +EQ WY+AL VV++ CY+ T+ F+GL
Sbjct  136  YGVLSIFGAGLFLLVQVVLLLDFTHSWNDSWVEKDEQKWYVALLVVSIGCYLGTYIFSGL  195

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FF+VMT+I  F FAV+ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  196  LFIWFNPSGHDCGLNVFFLVMTMILAFVFAVIALHPAVNGSLLPASVISVYCAYVCYTGL  255

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CN     SKAVS GTL LG++TTVLSV+YSA+RAGSST
Sbjct  256  SSEPRDYVCNDLHTKSKAVSVGTLVLGMLTTVLSVIYSALRAGSST  301



>ref|XP_008223013.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=411

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 180/226 (80%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF T + +MIGVK+Q D RDS HHGGW+ K+  W L+VI MFFLP+ ++++
Sbjct  77   LRVSLGNFLFFVTFALLMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVILMFFLPDIVITI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLDF H WND WV  +EQ WYIAL VV+++CY+A F  +G+
Sbjct  137  YGVLSKFGAGLFLLVQVLILLDFTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFTISGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            +F +F PSG +CGLN FFIVMT++  F FAV+ LHP V GS+ PASV+S+Y  Y+ Y+ L
Sbjct  197  MFIWFNPSGEDCGLNIFFIVMTMVLAFSFAVIALHPKVNGSLLPASVISVYSAYVLYTAL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG L+HSKAVS  TL LG+VTTVLSV+YSA+RAGSST
Sbjct  257  SSEPRDYACNG-LHHSKAVSVSTLLLGMVTTVLSVLYSALRAGSST  301



>gb|EYU43840.1| hypothetical protein MIMGU_mgv1a006662mg [Erythranthe guttata]
Length=436

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 175/226 (77%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIG+K Q D RD  HH GW++KI  W  ++I MFFLPN ++S+
Sbjct  102  LRVSLGNFLFFAILAVIMIGIKYQNDKRDFFHHEGWIVKIVIWTTLIILMFFLPNAVISV  161

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLD  H WND WV  ++Q WYIAL VV++ CY+  F F+GL
Sbjct  162  YGVVSKFGAGLFLLVQVLMLLDATHSWNDSWVAKDDQKWYIALLVVSISCYIGAFTFSGL  221

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG +CGLN FF+VMT+I  F F ++ LHP V GS+ PASV+S+YC Y+CY+GL
Sbjct  222  LFIWFNPSGQDCGLNVFFLVMTIILAFSFGIIALHPKVNGSLLPASVISMYCAYVCYTGL  281

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG  N SK VS+ TL LG++TTVLSV+YSA+RAGSST
Sbjct  282  SSEPRDYVCNGLHNKSKVVSTSTLILGMLTTVLSVLYSALRAGSST  327



>ref|XP_007222705.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
 gb|EMJ23904.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
Length=411

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 178/226 (79%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF T + +MIGVK+Q D RDS HHGGW+ K+  W L+VI MFFLP+ ++++
Sbjct  77   LRVSLGNFLFFVTFALIMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVILMFFLPDIVITI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLDF H WND WV  +EQ WYIAL VV+++CY+A F  +G+
Sbjct  137  YGVLSKFGAGLFLLVQVLILLDFTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFTISGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            +F +F PSG +CGLN FFIVMT++  F FAV+ LHP V GS+ PASV+S+Y  Y+ Y+ L
Sbjct  197  MFIWFNPSGEDCGLNIFFIVMTMVLAFSFAVIALHPQVNGSLLPASVISVYSAYVLYTAL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR Y CNG L+HSKAVS  TL LG+ TTVLSV+YSA+RAGSST
Sbjct  257  SSEPRGYACNG-LHHSKAVSVSTLLLGMATTVLSVLYSALRAGSST  301



>gb|ABF97020.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=372

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + MMIGVK+Q D RD+ HHGGW+ KI  W ++++ MF +PN ++++
Sbjct  81   LRVSLGNFLFFAIFALMMIGVKDQNDRRDAWHHGGWIAKIVVWVVLIVLMFCVPNVVITI  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE  SKFGSGLFLLVQVV+LLDF + WND W+  +EQ W IAL VVT++CY++TFAF+GL
Sbjct  141  YEVLSKFGSGLFLLVQVVMLLDFTNNWNDSWIEKDEQKWEIALLVVTVVCYLSTFAFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFI MT+I  F FA++ LHP V GS+ PASV+S+YC YLCY+ L
Sbjct  201  LFTWFNPSGHDCGLNVFFITMTIILAFAFAIIALHPQVNGSVMPASVISVYCAYLCYTSL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG   HSK VS   L LG++TTVLSVVYSAVRAGSST
Sbjct  261  SSEPDDYACNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSST  306



>ref|NP_001050476.1| Os03g0454100 [Oryza sativa Japonica Group]
 gb|AAO73245.1| putative membrane protein [Oryza sativa Japonica Group]
 gb|ABF97019.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12390.1| Os03g0454100 [Oryza sativa Japonica Group]
 dbj|BAG90227.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75563.1| hypothetical protein OsI_12232 [Oryza sativa Indica Group]
 gb|EEE59340.1| hypothetical protein OsJ_11423 [Oryza sativa Japonica Group]
Length=417

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + MMIGVK+Q D RD+ HHGGW+ KI  W ++++ MF +PN ++++
Sbjct  81   LRVSLGNFLFFAIFALMMIGVKDQNDRRDAWHHGGWIAKIVVWVVLIVLMFCVPNVVITI  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE  SKFGSGLFLLVQVV+LLDF + WND W+  +EQ W IAL VVT++CY++TFAF+GL
Sbjct  141  YEVLSKFGSGLFLLVQVVMLLDFTNNWNDSWIEKDEQKWEIALLVVTVVCYLSTFAFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFI MT+I  F FA++ LHP V GS+ PASV+S+YC YLCY+ L
Sbjct  201  LFTWFNPSGHDCGLNVFFITMTIILAFAFAIIALHPQVNGSVMPASVISVYCAYLCYTSL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG   HSK VS   L LG++TTVLSVVYSAVRAGSST
Sbjct  261  SSEPDDYACNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSST  306



>ref|XP_001765634.1| predicted protein [Physcomitrella patens]
 gb|EDQ69473.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 176/226 (78%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF   + +MIGVK+Q++ RDS HHGGWM+K+  W + +I MFFLPN +VS 
Sbjct  81   LRVSLGNFLFFLAFAILMIGVKDQREQRDSWHHGGWMVKLILWCITIILMFFLPNGLVSA  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y + S+FGSGLFLL+QVV+LLDF H WN  WV  +EQFWYIAL  V++ CY+A+F F+G 
Sbjct  141  YGSVSRFGSGLFLLIQVVILLDFTHNWNAAWVAKDEQFWYIALLAVSIGCYLASFVFSGF  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LFH+F PSG +C LNTF I  TLI    FA+V+LHP V GS+ PA V++ YCTYLCYS L
Sbjct  201  LFHWFTPSGVDCELNTFVIAFTLILGVSFAIVSLHPQVNGSLLPAGVIAAYCTYLCYSAL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR+YECNG   H  AVS GTL LG++TT+LSVVYSAVRAGSST
Sbjct  261  SSEPRNYECNGLHKHVNAVSKGTLGLGMLTTLLSVVYSAVRAGSST  306



>gb|EPS57849.1| hypothetical protein M569_16968, partial [Genlisea aurea]
Length=239

 Score =   244 bits (622),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT L+ +M+G+KNQ+DPRD+VHHGGWMMKI CWF++VI MFF+PN IVS 
Sbjct  81   LRVSLGNFLFFTILAILMVGIKNQRDPRDTVHHGGWMMKIFCWFVLVILMFFIPNGIVSF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE+ SKFGSGLFLLVQVVLLLDF+HGWNDKWVGY+EQFWY+AL VV+L+CYVATF F+GL
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFIHGWNDKWVGYDEQFWYVALLVVSLVCYVATFCFSGL  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVK  478
            LFH FAPSGH+CGLNTFFI  TLI VF FA+VTLHPSV 
Sbjct  201  LFHLFAPSGHDCGLNTFFITTTLILVFVFAIVTLHPSVS  239



>ref|XP_002312742.1| TMS membrane family protein [Populus trichocarpa]
 gb|EEE90109.1| TMS membrane family protein [Populus trichocarpa]
Length=417

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 182/226 (81%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS+GNFLFF  L+ +MIGVK+Q D RDS HHGGW+ K+  W L+V+ MFFLP+ ++S+
Sbjct  81   LRVSMGNFLFFAVLALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVVLMFFLPDSVISV  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLDF H WND WV  +EQ WYIAL  V++ CY+A F F+G+
Sbjct  141  YGILSKFGAGLFLLVQVIILLDFTHTWNDAWVEKDEQKWYIALLSVSVGCYLAAFTFSGI  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FAV+ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  201  LFMWFNPSGHDCGLNVFFIVMTMILAFAFAVIALHPAVNGSLLPASVISIYCAYVCYTGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG  N SKAVS+ TL LG++TT+LSV+YSAVRAGSST
Sbjct  261  SSEPHDYACNGLHNKSKAVSTSTLVLGMLTTILSVLYSAVRAGSST  306



>ref|XP_004486156.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=409

 Score =   248 bits (634),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 177/226 (78%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS HHGGW +K   W L+++  FF+P+ +   
Sbjct  77   LRVSLGNFLFFVVLALIMIGVKDQNDRRDSWHHGGWTVKTVIWLLLIVLAFFIPDAVTLA  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLL+QV++LLD  H WND WV  +EQ WYIAL VV++ CY+  FA +G+
Sbjct  137  YGFISKFGAGLFLLIQVLILLDCTHSWNDAWVEKDEQKWYIALLVVSIGCYIGAFAVSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F+P G++CGLN FF+V T+I  F FAVV LHP V GS+ PASV+SLYC Y+CY+GL
Sbjct  197  LFIWFSPGGYDCGLNVFFLVTTMILAFVFAVVALHPKVNGSLLPASVISLYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR YECNG LN S+AV++GTL LG++TTVLSV+YSA+RAGSST
Sbjct  257  SSEPRGYECNG-LNKSRAVNTGTLILGMLTTVLSVLYSALRAGSST  301



>ref|XP_011010290.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=417

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 182/226 (81%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS+GNFLFF  L+ +MIGVK++ D RDS HHGGW+ K+  W L+V+ MFFLP+ ++S+
Sbjct  81   LRVSMGNFLFFAILALIMIGVKDKNDRRDSWHHGGWIAKMVIWLLLVVLMFFLPDSVISV  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLDF H WND WV  +EQ WYIAL  V++ CY+A F F+G+
Sbjct  141  YGILSKFGAGLFLLVQVIILLDFTHTWNDAWVEKDEQKWYIALLSVSVGCYLAAFTFSGI  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FAV+ LHP+V GS+ PASV+S+YC Y+CY+GL
Sbjct  201  LFMWFNPSGHDCGLNVFFIVMTMILAFAFAVIALHPAVNGSLLPASVISIYCAYVCYTGL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG  N SKAVS+ TL LG++TTVLSV+YSAVRAGSST
Sbjct  261  SSEPHDYACNGLHNKSKAVSTSTLVLGMLTTVLSVLYSAVRAGSST  306



>emb|CAN71158.1| hypothetical protein VITISV_036762 [Vitis vinifera]
Length=309

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = +2

Query  53   MIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLYETTSKFGSGlfllvqv  232
            MIGVK+Q D RDS HHGGW+ K+  W L++I MFF+PN ++S+Y T SKFG+GLFLLVQV
Sbjct  1    MIGVKDQNDRRDSWHHGGWVAKMVIWVLLIILMFFVPNVVISIYGTLSKFGAGLFLLVQV  60

Query  233  vllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGLLFHFFAPSGHECGLNTF  412
            ++LLDF H WND WV  +EQ WYIAL  V++ CY+  F F+G+LF +F PSG++CGLN F
Sbjct  61   IILLDFTHSWNDAWVEKDEQKWYIALLAVSIGCYLLAFTFSGILFIWFNPSGNDCGLNIF  120

Query  413  FIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGLVSEPRDYECNGFLNHSK  592
            FIVMT+I  F FAV+ LHP V GS+ PASV+SLYC Y+CY+GL SEPRDY CNG  N SK
Sbjct  121  FIVMTMILAFSFAVIALHPRVNGSLLPASVISLYCAYVCYTGLSSEPRDYACNGLHNKSK  180

Query  593  AvssgtltlglvttvlsvvYSAVRAGSST  679
            AVS+ TL LG++TTVLSV+YSAVRAGSST
Sbjct  181  AVSTSTLILGMLTTVLSVLYSAVRAGSST  209



>gb|AAF30310.1|AC018907_10 hypothetical protein [Arabidopsis thaliana]
Length=315

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 170/209 (81%), Gaps = 1/209 (0%)
 Frame = +2

Query  53   MIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLYETTSKFGSGlfllvqv  232
            MIGVK+Q D RDS HHGGW +K+  WFL+V+ MFF+PN IVSLY T SKFG+G FLLVQV
Sbjct  1    MIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSLYGTLSKFGAGAFLLVQV  60

Query  233  vllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGLLFHFFAPSGHECGLNTF  412
            VLLLD  H WND WV  +E+ WYIAL V++++CY+AT+ F+G+LF +F PSG +CGLN F
Sbjct  61   VLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYTFSGILFIWFNPSGQDCGLNVF  120

Query  413  FIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGLVSEPRDYECNGFLNHSK  592
            FIVM +I  F FA++ LHP+V GS+ PASV+S+YC Y+CY+GL SEP DY CNG LN SK
Sbjct  121  FIVMPMILAFVFAIIALHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNG-LNKSK  179

Query  593  AvssgtltlglvttvlsvvYSAVRAGSST  679
            AV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  180  AVNASTLILGMLTTVLSVLYSALRAGSST  208



>ref|XP_006407969.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49422.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=313

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 171/209 (82%), Gaps = 1/209 (0%)
 Frame = +2

Query  53   MIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLYETTSKFGSGlfllvqv  232
            M+GVK+Q D RDS HHGGW +K+  WFL+V+ MFF+PN +VS+Y   SKFG+G FLLVQV
Sbjct  1    MVGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNVVVSIYGILSKFGAGAFLLVQV  60

Query  233  vllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGLLFHFFAPSGHECGLNTF  412
            VLLLD  H WND WV  +E+ W++AL V++++CYVAT+AF+G+LF +F P GH+CGLN F
Sbjct  61   VLLLDATHNWNDSWVEKDERKWFVALLVISVVCYVATYAFSGILFMWFNPPGHDCGLNVF  120

Query  413  FIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGLVSEPRDYECNGFLNHSK  592
            FIVMT+I  F FA+V LHP+V GS+ PASV+S+YC Y+CY+GL SEP DY CNG LN SK
Sbjct  121  FIVMTMILAFVFAIVALHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNG-LNRSK  179

Query  593  AvssgtltlglvttvlsvvYSAVRAGSST  679
            AV++ TL LG++TTVLSV+YSA+RAGSST
Sbjct  180  AVTASTLILGMLTTVLSVLYSALRAGSST  208



>dbj|BAJ86142.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 177/226 (78%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LR+SLGNFLFF   +  MIGVK+Q D RD+ HHGGW+ K   W ++V+ MFF+PN +VS+
Sbjct  81   LRLSLGNFLFFAIFALTMIGVKDQNDRRDAWHHGGWIAKFAIWVVLVVLMFFVPNIVVSV  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YE  SKFGSGLFLLVQVV+LLDF + WND WV  +EQ W IAL VVT+ICY++TFAF+G+
Sbjct  141  YEILSKFGSGLFLLVQVVMLLDFTNNWNDSWVEKDEQKWEIALLVVTVICYLSTFAFSGV  200

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PS H+CGLN FFIV+T+I  F FA++ LHP V GS+ PASV+S+YC YLCY+ L
Sbjct  201  LFMWFNPSDHDCGLNVFFIVLTMILAFAFAIIALHPQVNGSVMPASVISVYCAYLCYTSL  260

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG   HSK VS   L LG++TTVLSVVYSAVRAGSST
Sbjct  261  SSEPYDYACNGLHMHSKQVSMSALVLGMLTTVLSVVYSAVRAGSST  306



>gb|ACJ84561.1| unknown [Medicago truncatula]
 gb|AFK35204.1| unknown [Medicago truncatula]
 gb|KEH36756.1| TMS membrane protein/tumor differentially protein [Medicago truncatula]
Length=409

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 175/226 (77%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            L VSLGN LFF  L+ +MIGVK+Q D RDS HHGGW +KI  W L+++  FF+P+ I+  
Sbjct  77   LHVSLGNCLFFVVLALIMIGVKDQNDKRDSWHHGGWTVKIVIWLLLIVLAFFIPDSIMLA  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLL+QV++LLD  H WND WV  +EQ WYIAL VV++ CY+A F  +G+
Sbjct  137  YGFISKFGAGLFLLIQVIILLDCTHNWNDSWVEKDEQKWYIALLVVSIGCYIAAFTLSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F P G++CGLN FF+ M++I  F F VV LHP V GS+ PASV+SLYC Y+CY+GL
Sbjct  197  LFIWFNPGGYDCGLNVFFLSMSMILAFVFGVVALHPKVNGSLLPASVISLYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR YECNG LN S+AVS+GTL LG++TTVLSV+YSA+RAGSST
Sbjct  257  SSEPRGYECNG-LNKSRAVSTGTLVLGMLTTVLSVLYSALRAGSST  301



>gb|EPS68630.1| hypothetical protein M569_06136 [Genlisea aurea]
Length=410

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 177/226 (78%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+  MIGVK+Q D RDS+H GGW+ K   W L+++ MFF+PN + ++
Sbjct  77   LRVSLGNFLFFAVLALTMIGVKHQNDKRDSLHRGGWIAKFLIWALLIVLMFFVPNAVTNI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+G+FLLVQVVLLLD VH WND WV  +EQ WYIAL VVT+ CY+ T+AF+G+
Sbjct  137  YGILSKFGAGVFLLVQVVLLLDAVHTWNDSWVDKDEQKWYIALLVVTVACYIGTYAFSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F P GH+CGLN FF+VMT+I    FA++ LHP V GS+ PASV+S+YC Y+CY+GL
Sbjct  197  LFIWFNPPGHDCGLNIFFLVMTMILALAFALIALHPQVNGSLLPASVVSIYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG LN SKAV+  TL +G++TTV SV+YSA RAGSST
Sbjct  257  SSEPRDYVCNG-LNKSKAVTISTLVVGMLTTVFSVLYSAFRAGSST  301



>ref|XP_009365800.1| PREDICTED: probable serine incorporator isoform X2 [Pyrus x bretschneideri]
Length=409

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 179/226 (79%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS+GNFLFF   + +MIGVK+Q D RDS HHGGW+ K+  W L+V+ MFF+P+ ++++
Sbjct  77   LRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLD  H WND WV  +EQ WYIAL VV+++CY+A FAF+G+
Sbjct  137  YGVVSKFGAGLFLLVQVIILLDCTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFAFSGV  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG +CGLN FFIVMT+I  F FAV+ L+P V GS+ PASV+S+Y  Y+CY+ L
Sbjct  197  LFIWFNPSGEDCGLNIFFIVMTMILAFGFAVIALYPKVNGSLLPASVISVYSAYVCYTAL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR Y CNG L+HSKAVS  TL LG+ TTVLSV+YSA+RAGSST
Sbjct  257  SSEPRGYACNG-LHHSKAVSLSTLLLGMATTVLSVLYSALRAGSST  301



>ref|XP_009342179.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=411

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 179/226 (79%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS+GNFLFF   + +MIGVK+Q D RDS HHGGW+ K+  W L+V+ MFF+P+ ++++
Sbjct  77   LRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLD  H WND WV  +EQ WYIAL VV+++CY+A FAF+G+
Sbjct  137  YGVVSKFGAGLFLLVQVIILLDCTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFAFSGV  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG +CGLN FFIVMT+I  F FAV+ L+P V GS+ PASV+S+Y  Y+CY+ L
Sbjct  197  LFIWFNPSGEDCGLNIFFIVMTMILAFGFAVIALYPKVNGSLLPASVISVYSAYVCYTAL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR Y CNG L+HSKAVS  TL LG+ TTVLSV+YSA+RAGSST
Sbjct  257  SSEPRGYACNG-LHHSKAVSLSTLLLGMATTVLSVLYSALRAGSST  301



>ref|XP_009365799.1| PREDICTED: probable serine incorporator isoform X1 [Pyrus x bretschneideri]
Length=411

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 179/226 (79%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS+GNFLFF   + +MIGVK+Q D RDS HHGGW+ K+  W L+V+ MFF+P+ ++++
Sbjct  77   LRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLD  H WND WV  +EQ WYIAL VV+++CY+A FAF+G+
Sbjct  137  YGVVSKFGAGLFLLVQVIILLDCTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFAFSGV  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG +CGLN FFIVMT+I  F FAV+ L+P V GS+ PASV+S+Y  Y+CY+ L
Sbjct  197  LFIWFNPSGEDCGLNIFFIVMTMILAFGFAVIALYPKVNGSLLPASVISVYSAYVCYTAL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPR Y CNG L+HSKAVS  TL LG+ TTVLSV+YSA+RAGSST
Sbjct  257  SSEPRGYACNG-LHHSKAVSLSTLLLGMATTVLSVLYSALRAGSST  301



>ref|XP_008390818.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=411

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 177/226 (78%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS+GNFLFF   + +MIGVK+Q D RDS HHGGW+ K+  W L+V+ MFF+P+ ++++
Sbjct  77   LRVSMGNFLFFAAFALIMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLD  H WND WV  +EQ WYIAL +V+++CY+A FAF+G+
Sbjct  137  YGVVSKFGAGLFLLVQVIILLDCTHSWNDAWVEKDEQKWYIALLIVSIVCYLAAFAFSGV  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG +CGLN FFIVMT+I  F FAV+ LHP V GS+ PASV+S+Y  Y+CY+ L
Sbjct  197  LFIWFNPSGEDCGLNIFFIVMTMILAFGFAVIALHPKVNGSLLPASVISVYSAYVCYTAL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP  Y CNG L+HSKAVS  TL LG+  TVLSV+YSA+RAGSST
Sbjct  257  SSEPHGYACNG-LHHSKAVSLSTLLLGMAMTVLSVLYSALRAGSST  301



>ref|XP_004296950.1| PREDICTED: probable serine incorporator-like [Fragaria vesca 
subsp. vesca]
Length=409

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 181/226 (80%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS+GNFLFF  L+ +MIGVK++ D RD  HHGGW+ K+  W L++I MFFLP+ ++++
Sbjct  77   LRVSMGNFLFFAILALIMIGVKDRNDRRDGWHHGGWIAKMVIWLLLIILMFFLPDIVITI  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   SKFG+GLFLLVQV++LLDF H WND WV  +EQ WYIAL  V++ CY+A FAF+G+
Sbjct  137  YGDLSKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSIGCYIAAFAFSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG++CGLN FFIVMT++  F FAV+ LHP+V GS+ PASV+S+Y  Y+CY+ L
Sbjct  197  LFIWFNPSGNDCGLNVFFIVMTMVLAFAFAVIALHPTVNGSLLPASVISVYSAYVCYTAL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEPRDY CNG L+HS AVS GTL LG+ TT+LSV+YSA+RAGSST
Sbjct  257  SSEPRDYACNG-LHHSSAVSVGTLLLGMATTILSVLYSALRAGSST  301



>gb|KCW60869.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=383

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS+ HGGW+ K+  W L+V+ MFFLPNE++++
Sbjct  76   LRVSLGNFLFFGILALIMIGVKDQNDKRDSMQHGGWIAKMIIWLLLVVLMFFLPNEVITI  135

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFG+GLFLLVQV++LLD  H WND WV  +EQ WY+AL V+++ CY+A +  +G+
Sbjct  136  YETLSKFGAGLFLLVQVIILLDCTHSWNDAWVAKDEQKWYVALLVISVGCYIAAYTLSGI  195

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FF+VMT+I  F   +V LHP+V GS+ PASV+S+Y  Y+CY+ L
Sbjct  196  LFIWFNPSGHDCGLNVFFLVMTMILGFVNGIVALHPAVNGSLLPASVVSVYGAYVCYTAL  255

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
              EPR+Y CNG  N S AVS+ TL LG++TTVLSV+YSA RAGSST
Sbjct  256  SCEPRNYVCNGLHNKSHAVSTSTLILGMLTTVLSVLYSACRAGSST  301



>ref|XP_010024424.1| PREDICTED: serine incorporator 3 [Eucalyptus grandis]
 gb|KCW60868.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=416

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS+ HGGW+ K+  W L+V+ MFFLPNE++++
Sbjct  76   LRVSLGNFLFFGILALIMIGVKDQNDKRDSMQHGGWIAKMIIWLLLVVLMFFLPNEVITI  135

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFG+GLFLLVQV++LLD  H WND WV  +EQ WY+AL V+++ CY+A +  +G+
Sbjct  136  YETLSKFGAGLFLLVQVIILLDCTHSWNDAWVAKDEQKWYVALLVISVGCYIAAYTLSGI  195

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FF+VMT+I  F   +V LHP+V GS+ PASV+S+Y  Y+CY+ L
Sbjct  196  LFIWFNPSGHDCGLNVFFLVMTMILGFVNGIVALHPAVNGSLLPASVVSVYGAYVCYTAL  255

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
              EPR+Y CNG  N S AVS+ TL LG++TTVLSV+YSA RAGSST
Sbjct  256  SCEPRNYVCNGLHNKSHAVSTSTLILGMLTTVLSVLYSACRAGSST  301



>ref|XP_007147778.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
 gb|ESW19772.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
Length=409

 Score =   236 bits (602),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 179/225 (80%), Gaps = 1/225 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS HHGGW  K+  W L+++  FFLP+ I+ +
Sbjct  77   LRVSLGNFLFFGILALLMIGVKDQNDRRDSWHHGGWPAKLVVWLLLLVLAFFLPDAIILV  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   +KFG+GLFLL+QV++LLDF H WND WV  +EQ WYIAL  V++ CY+A F  +G+
Sbjct  137  YGFIAKFGAGLFLLIQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSVGCYIAAFTVSGI  196

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG++C +N FF+VMT+I  F FA++ LHP+V GS+ PASV+SLYC Y+CY+GL
Sbjct  197  LFIWFNPSGYDCSINIFFLVMTMILAFVFAIIALHPTVNGSLLPASVMSLYCAYVCYTGL  256

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
             SEPRDYECNG LN S+AVS+ TL LG++TTVLSV+YSA+RAGSS
Sbjct  257  SSEPRDYECNG-LNKSRAVSTSTLVLGMLTTVLSVLYSALRAGSS  300



>gb|KDO74827.1| hypothetical protein CISIN_1g039061mg [Citrus sinensis]
Length=399

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 168/226 (74%), Gaps = 15/226 (7%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  LS +MIG+K+Q D RDS HHGGW  KI  W L+V+ MFFLPN ++S+
Sbjct  79   LRVSLGNFLFFGILSLIMIGIKDQNDKRDSWHHGGWCAKIIIWALLVVLMFFLPNVVISI  138

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            YET SKFG+GLFLLVQV++LLD VH WND WV  +EQ                   F+G+
Sbjct  139  YETISKFGAGLFLLVQVIILLDGVHTWNDAWVAKDEQ---------------KCIYFSGI  183

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSGH+CGLN FFIVMT+I  F FAV+ L+PSV GS+ PASV+S+YC Y+CY+ L
Sbjct  184  LFIWFNPSGHDCGLNVFFIVMTMILAFVFAVIALNPSVNGSLLPASVISVYCAYVCYTAL  243

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DY CNG  N SKAV+  TL LG++TTVLSV+YSA+RAGSST
Sbjct  244  SSEPHDYVCNGLHNKSKAVTISTLVLGMLTTVLSVLYSALRAGSST  289



>gb|KHN37564.1| Putative serine incorporator [Glycine soja]
Length=407

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 179/226 (79%), Gaps = 4/226 (2%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS HHGGW  KI  W L+V+  FFLP+ I+ +
Sbjct  78   LRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGWTAKIVIWLLLVVLAFFLPDAIILV  137

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   +KFG+GLFLL+QV++LLDF H WND WV  +EQ WYIAL  V++ CY+A F  +G+
Sbjct  138  Y---AKFGAGLFLLIQVIILLDFTHTWNDAWVEKDEQKWYIALLAVSVGCYIAAFTVSGI  194

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            LF +F PSG++C LN FF+VMT+I  F FA++ LHP V GS+ PA+V+SLYC Y+CY+GL
Sbjct  195  LFIWFNPSGYDCSLNIFFLVMTMILAFVFAIIALHPQVNGSLLPAAVVSLYCAYVCYTGL  254

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DYECNG LN S+AVS+GTL LG++TTVLSV+YSA+RAGSST
Sbjct  255  SSEPHDYECNG-LNKSRAVSTGTLVLGMLTTVLSVLYSALRAGSST  299



>gb|KFM24734.1| putative serine incorporator [Auxenochlorella protothecoides]
Length=435

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 142/229 (62%), Gaps = 4/229 (2%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDS-VHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            R+SLGN L F +L+ +M+GVK   D RD+ +HHG W++K   W + ++  F LP  +++ 
Sbjct  89   RISLGNLLLFGSLALVMMGVKRTSDRRDTQLHHGSWLIKAALWTVCILLPFLLPPSVINA  148

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWV--GYNEQFWYIALFVVTLICYVATFAFN  355
            Y   ++FGS LFLL Q+V+++D    WND WV  G  ++ W   L   TL       A  
Sbjct  149  YSWVARFGSPLFLLTQMVIVVDVTQAWNDAWVEAGDEDETWLYGLLAATLGALGGCVALA  208

Query  356  GLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVK-GSIFPASVLSLYCTYLCY  532
             L FHFFAP+  +C LN   I +TL+ V   A+ + HP+V+ GS+FPA+ + LY +Y+ Y
Sbjct  209  ALCFHFFAPASQDCSLNLTLISLTLVLVVVMALTSFHPAVEAGSLFPAAAVGLYVSYMGY  268

Query  533  SGLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
            S L SEPRDY CNG      A S  TL  G++ T+LSVVYSA RAGS+T
Sbjct  269  SALQSEPRDYACNGLGARLGAASGATLAGGMLLTLLSVVYSAFRAGSNT  317



>ref|XP_005651318.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
 gb|EIE26774.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
Length=429

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 144/228 (63%), Gaps = 3/228 (1%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDS-VHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            RVS+GNF+FF  +S  M+GVK + D RD  + HGGW +K+  W L  I  FF P   V+ 
Sbjct  64   RVSMGNFIFFGLMSLAMVGVKYKSDKRDQYLQHGGWFLKVALWLLFNILPFFFPVSFVNG  123

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   ++ GS  FL VQ+++LLDFV  WND WV   ++ +  AL  VT + Y+ TF   G+
Sbjct  124  YGWVARVGSACFLCVQILMLLDFVTKWNDTWVDKEDERYLWALLTVTCVSYLGTFGLAGI  183

Query  362  LFHFFAPSG-HECGLNTFFIVMTLIFVFCFAVVTLHPSVK-GSIFPASVLSLYCTYLCYS  535
            LF+FF P G  EC  N   I  TLI     + V++    K GS+FP+++ + YCTYLCYS
Sbjct  184  LFYFFTPVGADECSFNVSMITFTLIIGIIISGVSMSSLAKNGSLFPSAIFTFYCTYLCYS  243

Query  536  GLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             LVSEP DY+CNG      A S+ TL  G++ T++SVVYSA+RAGS+T
Sbjct  244  ALVSEPHDYQCNGLGQRLNAASATTLATGMLLTLVSVVYSALRAGSNT  291



>ref|XP_005850950.1| hypothetical protein CHLNCDRAFT_48549 [Chlorella variabilis]
 gb|EFN58848.1| hypothetical protein CHLNCDRAFT_48549 [Chlorella variabilis]
Length=367

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 146/232 (63%), Gaps = 7/232 (3%)
 Frame = +2

Query  5    RVSLGNFL---FFTTLSFMMIGVKNQKDPRD-SVHHGGWMMKICCWFLIVIFMFFLPNEI  172
            R+SLGNF+    F  L+ +M GV+++ D RD S+HHG W++K   W L     FFLP  +
Sbjct  86   RISLGNFVSGVLFGALAVVMAGVQHKSDRRDRSLHHGHWLLKAGLWALCNALPFFLPVGV  145

Query  173  VSLYETTSKFGSGlfllvqvvllldfvHGWNDKWV--GYNEQFWYIALFVVTLICYVATF  346
            V  Y   ++FGS LFLL+Q+++LLD    WND WV  G  +  ++ AL  VT   Y    
Sbjct  146  VGAYSWLARFGSPLFLLIQMIILLDVTQSWNDAWVEAGEGDVRYFHALLAVTAAAYAGCA  205

Query  347  AFNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-KGSIFPASVLSLYCTY  523
            A  GLL+HFFAP+  +C LN   I + LI     + +TLHP+V +GS+FPA+ +SLY  Y
Sbjct  206  AIAGLLYHFFAPASADCSLNISLITLALILCIVLSTITLHPAVQRGSLFPAACISLYTMY  265

Query  524  LCYSGLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
            L YS L SEPRDYECN       A S+ TL  G++ T++SVVYSA RAGS+T
Sbjct  266  LQYSALQSEPRDYECNALGARLSAASATTLATGVLLTLVSVVYSAFRAGSNT  317



>ref|XP_002506090.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67348.1| predicted protein [Micromonas sp. RCC299]
Length=433

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 135/229 (59%), Gaps = 9/229 (4%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDS-VHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            RVSLGNF+FF  LS M++  K + DPRD  +HHG W +K+  W L VI  F LP+  +  
Sbjct  85   RVSLGNFMFFGGLSAMLVDCKTRSDPRDRHIHHGSWTLKLAAWALCVIVPFLLPDGFIDA  144

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   ++ GSG+FL+VQ+V+LLDF   WN+ WV      W + L V T+  Y  +      
Sbjct  145  YAWLARLGSGVFLVVQMVILLDFAFLWNETWVAREHVGWVVGLLVSTIALYAGSITLVVF  204

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVK-GSIFPASVLSLYCTYLCYSG  538
            ++ ++AP G +CG N + I  +L+    F+ ++ HP  K GS+ P++V++ YC YLCYS 
Sbjct  205  MYQWYAPKGLDCGRNAWLITTSLVPCVFFSALSTHPIAKEGSLLPSAVVTSYCVYLCYSA  264

Query  539  LVSEPRDYECN---GFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
            L SEP +Y CN    +    KA    +     V T+ SV YSAVRAGSS
Sbjct  265  LASEPTEYRCNPRGAYAGDGKA----SEVASTVLTLASVAYSAVRAGSS  309



>ref|XP_006595390.1| PREDICTED: probable serine incorporator-like [Glycine max]
Length=375

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 146/226 (65%), Gaps = 36/226 (16%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS HHGGW  KI  W L+V+  FFLP+ I+ +
Sbjct  78   LRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGWTAKIVIWLLLVVLAFFLPDAIILV  137

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   +K G+GLFLL+QV++LLDF H WND WV  +EQ WYIAL    L+  + +      
Sbjct  138  YGFIAKIGAGLFLLIQVIILLDFTHTWNDAWVEKDEQKWYIALTSSVLVRDITS------  191

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
                                          ++ +   V GS+ PA+V+SLYC Y+CY+GL
Sbjct  192  -----------------------------RIIGVQKQVNGSLLPAAVVSLYCAYVCYTGL  222

Query  542  VSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
             SEP DYECNG LN S+AVS+GTL LG++TTVLSV+YSA+RAGSST
Sbjct  223  SSEPHDYECNG-LNKSRAVSTGTLVLGMLTTVLSVLYSALRAGSST  267



>gb|ABR25551.1| serine incorporator 3 [Oryza sativa Indica Group]
Length=220

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  344  FAFNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTY  523
            F+F+GLLFH+F PSGH+CG+N FFIV TLI VF FA+V LHP + GS+ PASV++LYCTY
Sbjct  1    FSFSGLLFHWFTPSGHDCGINLFFIVFTLILVFVFAIVALHPKINGSLLPASVIALYCTY  60

Query  524  LCYSGLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
            LCYSGL SEPRDYECNG  NHSKAVS+G+L+LGL+TT+LSVVYSAVRAGSS 
Sbjct  61   LCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVYSAVRAGSSA  112



>ref|XP_003062471.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53290.1| predicted protein [Micromonas pusilla CCMP1545]
Length=442

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/238 (37%), Positives = 132/238 (55%), Gaps = 14/238 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRD-SVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            R+SLGNF+FF  ++  ++GVK + D RD  +HHG W++K   W L  +  FF  N +V  
Sbjct  74   RISLGNFIFFGAMACALVGVKRRSDARDVHLHHGSWVLKFTAWALCNVLPFFASNGVVGA  133

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   ++  SG+FL+VQ+++LLDF   WN+ WV      W + L V T++ Y  + A   +
Sbjct  134  YTWVARVASGVFLVVQMIILLDFAFFWNESWVARQHAGWLVGLLVSTIVLYAESVAVVVM  193

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVK---------GSIFPASVLSLY  514
             F +F+P G +CG N + I         F++  +HP VK         GS+ P++V++ Y
Sbjct  194  AFRWFSPRGVDCGSNDWMIGSACALCLAFSLACVHPGVKARSRVVTLDGSLLPSAVVTSY  253

Query  515  CTYLCYSGLVSEPRDYECNGFLNHSKAvssg----tltlglvttvlsvvYSAVRAGSS  676
            CTYL YS L SEP +YECN   + + A +              T+ SV Y A+RAGS+
Sbjct  254  CTYLLYSALASEPSEYECNPRGSETGAGAGSRGGVAEIASTALTLASVAYGALRAGSA  311



>ref|XP_002956760.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
 gb|EFJ42217.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
Length=415

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 149/230 (65%), Gaps = 5/230 (2%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDS-VHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            RVS+GNFLFF  +S   IGVK + D RD  +HH   ++K+  W L     F  PN +++ 
Sbjct  87   RVSMGNFLFFACMSLATIGVKFRGDKRDRYLHHAHPLLKLALWLLFTALPFLFPNGVLNA  146

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWV--GYNEQFWYIALFVVTLICYVATFAFN  355
            Y   ++ GSG+FL++Q+++LLDFV GWND WV  G ++  W   L  +T + Y +T    
Sbjct  147  YSWMARVGSGVFLVIQMIILLDFVQGWNDSWVANGEDDDRWLYGLMGLTCVGYGSTLTLA  206

Query  356  GLLFHFFAPSGH-ECGLNTFFIVMTLIFVFCFAVVTLHPSVKG-SIFPASVLSLYCTYLC  529
            G ++++F P+G   C LN   I +TL+ V  F+V++L P  +G SIFP+S+++LY  YLC
Sbjct  207  GFMYYWFKPAGAGSCSLNIALITLTLLLVVTFSVLSLAPLARGGSIFPSSMIALYAAYLC  266

Query  530  YSGLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
            +S L SEPR+Y CNG  +   A S GTL LG+V T+ SVVY+A RAGS+T
Sbjct  267  FSALQSEPREYACNGLGHRLTAASGGTLALGMVVTLASVVYAAFRAGSNT  316



>ref|XP_002965853.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
 ref|XP_002983103.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ15912.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ33273.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
Length=365

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 116/191 (61%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLG F+FF T+    +G     DPRD+ H G W +K   W ++++  FF+P+  + +
Sbjct  51   LRVSLGCFVFFFTMYLTTVGTSKPDDPRDAWHSGWWPIKSLFWIIVMVLPFFIPSAFIQM  110

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVG-YNEQFWYIALFVVTLICYVATFAFNG  358
            Y   ++FG+G+FL++Q++ +++F++ WN++W+  +N +   I L V+ +  Y+ +F    
Sbjct  111  YGEMARFGAGIFLVIQLLSVINFIYWWNEEWLSEHNVRRCQIPLVVIAVGSYILSFIGII  170

Query  359  LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSG  538
            L++ +F+P    CG+N FFI  T + +     ++LH  V   +  + ++SLY  +LC+S 
Sbjct  171  LMYVWFSPRA-SCGVNIFFITWTFVLILVVTAISLHSKVNAGLLTSGLISLYLVFLCWSA  229

Query  539  LVSEPRDYECN  571
            ++SEP    CN
Sbjct  230  IMSEPASELCN  240



>gb|AFK47365.1| unknown [Lotus japonicus]
Length=234

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +2

Query  356  GLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYS  535
            G+ F +F P+G++C +N FF+VMT+I  F  A++ LHP V GS+ PA+V+SLYC YLCY+
Sbjct  21   GIFFIWFNPAGYDCSINVFFLVMTMILGFLLAIIALHPRVNGSLLPAAVISLYCAYLCYT  80

Query  536  GLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSST  679
            GL SEPR+YECNG LN SKAV++ TL LG+VTTVLSV+YSA+RAGSST
Sbjct  81   GLSSEPRNYECNG-LNKSKAVTTSTLVLGMVTTVLSVLYSALRAGSST  127



>gb|KDO46126.1| hypothetical protein CISIN_1g032312mg [Citrus sinensis]
 gb|KDO46127.1| hypothetical protein CISIN_1g032312mg [Citrus sinensis]
Length=143

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFFT LS +M+GVKNQKDPRDS+HHGGWMMKI CW L+VIFMFFLPNEIVS 
Sbjct  81   LRVSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLPNEIVSF  140

Query  182  Y  184
            Y
Sbjct  141  Y  141



>ref|XP_001770496.1| predicted protein [Physcomitrella patens]
 gb|EDQ64665.1| predicted protein [Physcomitrella patens]
Length=387

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 113/191 (59%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LR+S G F+FF  +    +G   + DPRD  H G W +K   W    I  FFLP+ ++ L
Sbjct  72   LRLSFGCFMFFFVMFMTTVGTSRKDDPRDRWHSGWWPVKSILWITFTIVPFFLPSVVIQL  131

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVG-YNEQFWYIALFVVTLICYVATFAFNG  358
            Y   ++FG+G+FLLVQ++ +++FV+ WN+ W+   +E+  YI L VV + CY+ TF    
Sbjct  132  YGEIARFGAGIFLLVQLLSIINFVYLWNESWMSPEHERQCYIPLVVVPMTCYILTFIGLV  191

Query  359  LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSG  538
            L++ +F P    C LN FFI  T+I V    +++LH  V   +  + V+SLY  +LC+S 
Sbjct  192  LMYVWFTPHV-TCRLNIFFITWTMILVIVMTIISLHAKVNAGLLTSGVMSLYLIFLCWSA  250

Query  539  LVSEPRDYECN  571
            ++SEP    CN
Sbjct  251  IMSEPLSASCN  261



>ref|XP_002982341.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
 gb|EFJ16586.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
Length=382

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 111/191 (58%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LR+S G F+FF  +    +G       RD  H G W +K   W L++I  FF+P  I+ +
Sbjct  65   LRLSFGCFVFFAIMFVTTVGTSRIGGLRDGWHCGWWPLKFLLWILLMILPFFVPPAIIKV  124

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVG-YNEQFWYIALFVVTLICYVATFAFNG  358
            Y   ++FG+G+FL++Q+  +++F + WN+KW+   N +  ++ + +VT + YV       
Sbjct  125  YGEIARFGAGVFLVIQLFSIVNFAYWWNEKWLAPENSRRCFLPMLIVTTLSYVFCLIGLV  184

Query  359  LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSG  538
            +++ +FAP    C LN FFI  TL+ +    +++LHP V   +  + ++SLY  +LC+S 
Sbjct  185  IMYVWFAPK-PSCSLNIFFISWTLVLLLAMTLISLHPKVSAGLMTSGLISLYIVFLCWSA  243

Query  539  LVSEPRDYECN  571
            ++SEPR   CN
Sbjct  244  IMSEPRSEVCN  254



>emb|CEG01070.1| TMS membrane protein/tumour differentially expressed protein 
[Ostreococcus tauri]
Length=422

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 125/229 (55%), Gaps = 6/229 (3%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDS-VHHGGWMMKICCWFLIVIFMFFLPNE-IVS  178
            R S   F+ F TLS  ++G +++ D RD  +H G W +K+  + ++    F L ++  + 
Sbjct  86   RASCATFVLFATLSASLVGTRDKGDARDRMIHRGSWGVKMLAYVILNALTFCLASDGFMD  145

Query  179  LYETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNG  358
            +Y   ++ GSGLFL++Q++++LDF   WN+ W       W   L   TL  + A+     
Sbjct  146  VYAGAARLGSGLFLVIQMIIVLDFSFAWNESWASGEHWGWIAGLIASTLAMFGASIGLFV  205

Query  359  LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHP-SVKGSIFPASVLSLYCTYLCYS  535
             ++  +APS  EC  N   I  T +      ++T HP S +G + P S ++LYC YLCYS
Sbjct  206  EMYRAYAPS-RECHRNVAMITSTAVLCAVLTLITFHPISREGCLLPTSAVTLYCAYLCYS  264

Query  536  GLVSEPRDYEC--NGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
             L SEP  Y C    F++ ++A+      +  V T++SVVY+A+RAG S
Sbjct  265  ALSSEPSTYACRPQSFIDANEALRKPATLVQTVFTLVSVVYAAMRAGES  313



>ref|XP_003075128.1| OJ1249_F12.26 gene product (ISS), partial [Ostreococcus tauri]
Length=423

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 125/229 (55%), Gaps = 6/229 (3%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDS-VHHGGWMMKICCWFLIVIFMFFLPNE-IVS  178
            R S   F+ F TLS  ++G +++ D RD  +H G W +K+  + ++    F L ++  + 
Sbjct  87   RASCATFVLFATLSASLVGTRDKGDARDRMIHRGSWGVKMLAYVILNALTFCLASDGFMD  146

Query  179  LYETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNG  358
            +Y   ++ GSGLFL++Q++++LDF   WN+ W       W   L   TL  + A+     
Sbjct  147  VYAGAARLGSGLFLVIQMIIVLDFSFAWNESWASGEHWGWIAGLIASTLAMFGASIGLFV  206

Query  359  LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHP-SVKGSIFPASVLSLYCTYLCYS  535
             ++  +APS  EC  N   I  T +      ++T HP S +G + P S ++LYC YLCYS
Sbjct  207  EMYRAYAPS-RECHRNVAMITSTAVLCAVLTLITFHPISREGCLLPTSAVTLYCAYLCYS  265

Query  536  GLVSEPRDYEC--NGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
             L SEP  Y C    F++ ++A+      +  V T++SVVY+A+RAG S
Sbjct  266  ALSSEPSTYACRPQSFIDANEALRKPATLVQTVFTLVSVVYAAMRAGES  314



>ref|XP_001416509.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94802.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=393

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 127/229 (55%), Gaps = 6/229 (3%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRD-SVHHGGWMMKICCWFLIVIFMF-FLPNEIVS  178
            R S     FF  +S  +IG K++ D RD ++H G WM+K+  +  +  F F +  +E + 
Sbjct  58   RASCATSTFFFAMSAALIGTKDRSDFRDKALHRGNWMLKVLAFVALHAFFFLWATDEGME  117

Query  179  LYETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNG  358
             Y   ++ GSGLFL++Q++++LDF   WN+ W       W   L V TL  Y  + A   
Sbjct  118  AYAAAARLGSGLFLVIQMIIVLDFAFAWNESWASGEHWGWVAGLLVSTLAMYATSVALFV  177

Query  359  LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVK-GSIFPASVLSLYCTYLCYS  535
             ++  +AP+  EC  N   I  T++      V+TLHP+ + G + P++ ++LYCTYLCYS
Sbjct  178  EMYESYAPN-RECHRNIAMITCTVVLCVVLTVITLHPAAREGCLLPSAAVTLYCTYLCYS  236

Query  536  GLVSEPRDYEC--NGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
             L SEP  Y C    F++ ++ +      +    T++SVVY+A+RAG S
Sbjct  237  ALTSEPSTYACRPRSFIDANEELKKPANLVTTAFTLVSVVYAAMRAGES  285



>gb|AFK34472.1| unknown [Lotus japonicus]
Length=256

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLGNFLFF  L+ +MIGVK+Q D RDS HHGGW +K+  W L+++  FFLP+ I+ +
Sbjct  77   LRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGWTVKLVIWLLLLVLSFFLPDVIILV  136

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNG  358
            Y   SKFG+GLFLLVQV++LLD  H WND WV  +EQ WY+AL  V++ CY+  +A +G
Sbjct  137  YGFISKFGAGLFLLVQVIILLDCTHAWNDAWVEKDEQKWYVALLAVSVGCYIGAYALSG  195



>ref|XP_002966499.1| hypothetical protein SELMODRAFT_85365 [Selaginella moellendorffii]
 gb|EFJ32526.1| hypothetical protein SELMODRAFT_85365 [Selaginella moellendorffii]
Length=414

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 111/191 (58%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LR+S G F+FF  +    +G       RD  H G W +K   W L++I  FF+P  I+ +
Sbjct  65   LRLSFGCFVFFAIMFVTTVGTSRIGGLRDGWHCGWWPLKFLLWILLMILPFFVPPAIIKV  124

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVG-YNEQFWYIALFVVTLICYVATFAFNG  358
            Y   ++FG+G+FL++Q+  +++F + WN+KW+   N +  ++ + +VT + YV       
Sbjct  125  YGEIARFGAGVFLVIQLFSIVNFAYWWNEKWLAPENSRRCFLPMLIVTTLSYVFCLIGLV  184

Query  359  LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSG  538
            +++ +FAP    C LN FFI  TL+ +    +V+LHP V   +  + ++SLY  +LC+S 
Sbjct  185  IMYVWFAPK-PSCSLNIFFISWTLVLLLTMTLVSLHPKVSAGLMTSGLISLYIVFLCWSA  243

Query  539  LVSEPRDYECN  571
            ++SEPR   CN
Sbjct  244  IMSEPRSEVCN  254



>gb|AFK43836.1| unknown [Medicago truncatula]
Length=190

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  422  MTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGLVSEPRDYECNGFLNHSKAvs  601
            MTL+  F FA+V LHP+V GS+ PASV+S YC YLCYS L SEPRDYECNG   HSKAVS
Sbjct  1    MTLMLAFVFAIVALHPAVNGSVLPASVISFYCMYLCYSALASEPRDYECNGLHKHSKAVS  60

Query  602  sgtltlglvttvlsvvYSAVRAGSS  676
            +G+LTLGLVTTVLSVVYSAVRAGSS
Sbjct  61   TGSLTLGLVTTVLSVVYSAVRAGSS  85



>ref|XP_534427.3| PREDICTED: serine incorporator 3 [Canis lupus familiaris]
Length=473

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 113/200 (57%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R++    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     + 
Sbjct  100  RINFALAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAAIVGIMVGSFYIPGGHFTTA  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL  VT ICY+ +  
Sbjct  160  WFIVGMVGAFLFILIQLVLLVDFAHSWNESWVSRMEEGNPRCWYAALLSVTSICYILSVV  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F GLL+ ++  P G  C  N FFI + LI  F  +++++HP +     +  +  +S+++L
Sbjct  220  FVGLLYTYYTKPDG--CTENKFFISINLILCFVVSIISIHPKIQEHQPRSGLLQSSLITL  277

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  278  YTMYLTWSAMSNEP-DRSCN  296



>gb|KDP32305.1| hypothetical protein JCGZ_13230 [Jatropha curcas]
Length=400

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 105/199 (53%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLG F+FF  +    +G     DPRD+ H G W  KI  W  + +  F +P+  + L
Sbjct  84   LRVSLGCFIFFIIMFVSTVGTSKFYDPRDAWHSGWWSAKIVMWIALTVLTFLIPSAFIQL  143

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVG--YNEQFWYIALFVVTLICYVATFAFN  355
            Y   + FG+G+FLL+Q++ ++ F+   ND  +   Y E+  ++ + ++  I YV      
Sbjct  144  YGEIAHFGAGVFLLIQLISIISFITWLNDCCLSDKYAERC-HMHVMLIATIAYVICIVGI  202

Query  356  GLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYS  535
             L++ ++AP    C LN FFI  TL+ V     ++LHP V G I    ++ LY  +LC+ 
Sbjct  203  ILMYIWYAPE-PSCLLNIFFITWTLVLVQLMTSISLHPKVNGGILTPGLMGLYVVFLCWC  261

Query  536  GLVSEPRDYECNGFLNHSK  592
             + SEP    CN     SK
Sbjct  262  AIRSEPAGESCNRKAEASK  280



>ref|XP_006734548.1| PREDICTED: serine incorporator 3 [Leptonychotes weddellii]
Length=473

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 113/200 (57%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R++    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     + 
Sbjct  100  RINFALAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAAIVGIMVGSFYIPGGHFTTA  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL  VT +CY+ +  
Sbjct  160  WFIVGMVGAFLFILIQLVLLVDFAHSWNESWVNRMEEGNPRCWYAALLSVTSVCYILSVV  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F GLL+ ++  P G  C  N FFI + L+  F  +++++HP +     +  +  +S+++L
Sbjct  220  FVGLLYTYYTKPDG--CTENKFFISINLVLCFVVSIISIHPKIQEHQPRSGLLQSSLITL  277

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  278  YTMYLTWSAMSNEP-DRSCN  296



>ref|XP_008058013.1| PREDICTED: serine incorporator 3 [Tarsius syrichta]
Length=473

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 113/206 (55%), Gaps = 20/206 (10%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R++    +FF   S +MI VK  KDPR +VH+G W  KI     I++  F++P      Y
Sbjct  100  RINFALAIFFFVFSLLMIKVKTSKDPRAAVHNGFWFFKIAALVGIMVGSFYIPGS----Y  155

Query  185  ETTSKF-----GSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYV  337
             TT+ F     G+ +F+L+Q++LL+D  H WN+ WV      N + WY AL   T + Y+
Sbjct  156  FTTAWFVVGMIGAFIFILIQLILLVDSAHSWNESWVNRMEEGNPRLWYAALLSFTSLFYI  215

Query  338  ATFAFNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVK-----GSIFPASV  502
             +    GLL+ ++  S H C  N FFI + LIF    +++++HP ++       +  +SV
Sbjct  216  LSIISVGLLYTYYTKS-HGCTENKFFISINLIFCVVVSMISIHPKIQEHQPHSGLLQSSV  274

Query  503  LSLYCTYLCYSGLVSEPRDYECNGFL  580
            ++LY  YL +S + +EP D  CN  L
Sbjct  275  ITLYTIYLTWSAMSNEP-DRSCNPSL  299



>ref|XP_004746435.1| PREDICTED: serine incorporator 3 isoform X1 [Mustela putorius 
furo]
 ref|XP_004746436.1| PREDICTED: serine incorporator 3 isoform X2 [Mustela putorius 
furo]
 ref|XP_004785596.1| PREDICTED: serine incorporator 3 isoform X1 [Mustela putorius 
furo]
 ref|XP_004785597.1| PREDICTED: serine incorporator 3 isoform X2 [Mustela putorius 
furo]
Length=473

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 112/200 (56%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R++    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     + 
Sbjct  100  RINFALAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAAIVGIMVGSFYIPGGHFTTA  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H  N+ WV      N + WY AL  VT ICY+ +  
Sbjct  160  WFIVGMAGAFLFILIQLVLLVDFAHSCNESWVNRMEEGNPRCWYAALLSVTSICYILSVV  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F GLL+ ++  P G  C  N FFI + LI  F  +++++HP +     +  +  +SV++L
Sbjct  220  FAGLLYTYYTRPDG--CAENKFFISINLILCFVVSIISIHPKIQEHRPQSGLLQSSVITL  277

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  278  YTMYLTWSAMTNEP-DRSCN  296



>ref|XP_004414156.1| PREDICTED: serine incorporator 3 [Odobenus rosmarus divergens]
Length=473

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 112/200 (56%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R++    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     + 
Sbjct  100  RINFAMAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAAIVGIMVGSFYIPGGHFTTA  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL  VT +CY+ +  
Sbjct  160  WFIVGMVGAFLFILIQLVLLVDFAHSWNESWVNRMEEGNPRCWYAALLSVTSVCYILSVV  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F  LL+ ++  P G  C  N FFI + L+  F  +++++HP +     +  +  +S+++L
Sbjct  220  FVSLLYTYYTRPDG--CTENKFFISINLVLCFVVSIISIHPKIQEHQPRSGLLQSSLITL  277

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  278  YTMYLTWSAMSNEP-DRSCN  296



>ref|XP_001753882.1| predicted protein [Physcomitrella patens]
 gb|EDQ81204.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 109/186 (59%), Gaps = 2/186 (1%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LR+S G F+FF+ +    +G  + KDPRDS H G W +K   W  +++  F +P   +++
Sbjct  51   LRLSFGCFMFFSFMFLTTVGTSSTKDPRDSWHSGWWPIKTLGWAALMVMPFLIPPHYIAI  110

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYN-EQFWYIALFVVTLICYVATFAFNG  358
            Y   ++FG+G+FL++Q+V  ++F++ WN++W+    E  W + + +V+ +C++A+    G
Sbjct  111  YGEIARFGAGIFLVIQLVSFINFIYFWNEEWLNEKYEHIWRVPMILVSAVCFMASLFTIG  170

Query  359  LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSG  538
            ++  +F  S  +C LN FFI  TL  V    +++++  V   +  + ++++Y  +LC   
Sbjct  171  VMIAWFVTS-KDCKLNVFFISSTLCLVLFTTLLSVNSKVNAGLLTSGLMAVYIVFLCCEP  229

Query  539  LVSEPR  556
            L S  R
Sbjct  230  LSSTCR  235



>ref|XP_009336915.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009336916.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 99/196 (51%), Gaps = 1/196 (1%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLG FLF+ T+     G     +PRDS   G W  KI  W   +I  F LP  I+ L
Sbjct  83   LRVSLGCFLFYITMFLSTAGTSKLNEPRDSWQSGWWSAKIVMWISFIIIPFLLPATIIQL  142

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   + FG+G+FLL+Q++ ++ F+   ND       +   I + ++    YV       L
Sbjct  143  YGEIAHFGAGVFLLIQLISIISFITWLNDSCQSTKSERCRIHVMLLATAAYVVCLVGIIL  202

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            ++ ++AP    C LN FFI  TL+ +     V+LHP+V   I    ++ LY  ++C+  +
Sbjct  203  MYIWYAPE-PTCLLNIFFITWTLVLLQLMTSVSLHPNVNAGILTPGLMGLYIVFICWFAI  261

Query  542  VSEPRDYECNGFLNHS  589
             SEP    CN   + S
Sbjct  262  RSEPAGTSCNKKADDS  277



>ref|XP_006147626.1| PREDICTED: serine incorporator 3 [Tupaia chinensis]
 gb|ELW66770.1| Serine incorporator 3 [Tupaia chinensis]
Length=472

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 112/203 (55%), Gaps = 14/203 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R++    +FF T   +M+ VK  KDPR +VH+G W  KI     I++  F++P     ++
Sbjct  100  RINFALAIFFFTFFVLMLKVKTSKDPRAAVHNGFWFFKIAAIVGIMVGSFYIPGGSFTTV  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+  F+L+Q+VLL+DF H WN+ WV      N + WY AL  VT + Y+ +  
Sbjct  160  WFAVGMGGAAFFILIQLVLLVDFAHSWNELWVNRMEEGNPRLWYAALLSVTSLLYILSII  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F GLLF ++  P G  C  N FFI + LI     +V+++HP +     +  +  +S+++L
Sbjct  220  FVGLLFTYYTKPDG--CTENKFFISINLILCVVVSVISIHPKIQEHQPRSGLLQSSIITL  277

Query  512  YCTYLCYSGLVSEPRDYECNGFL  580
            Y  YL +S + +EP D  CN  L
Sbjct  278  YTMYLTWSAMSNEP-DRSCNPSL  299



>ref|XP_003199457.1| PREDICTED: serine incorporator 1-like [Danio rerio]
Length=479

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/203 (36%), Positives = 112/203 (55%), Gaps = 14/203 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNE-IVSL  181
            RV  G  LFF T S  MI VKN +DPR +VH+G W  KI     +    F++P+E    +
Sbjct  98   RVCCGMSLFFLTFSLFMIRVKNSRDPRAAVHNGFWCFKIAVMISVTAGAFYIPDEPFTRM  157

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+  F+L+Q+VLL+DF H WN+ WV      NE+ WYIAL +VT + Y+ +F+
Sbjct  158  WFIVGSGGAFCFILIQLVLLIDFAHSWNESWVDKMEKENEKRWYIALVLVTGLNYILSFS  217

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
               L F  +  P G  C LN FFI   ++     + +++ P++     +  +  +S+++L
Sbjct  218  AALLCFSIYTQPEG--CVLNKFFICFNMLLCVTASALSVLPTIQEYQPRSGLLQSSIMTL  275

Query  512  YCTYLCYSGLVSEPRDYECNGFL  580
            Y  YL +S + +EP D  CN  L
Sbjct  276  YTMYLTWSAMTNEP-DRTCNPSL  297



>emb|CEG74956.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=396

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 128/233 (55%), Gaps = 13/233 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R+     LF   L  +++GV+N   PR S+ +G W  K+ CW L+++  FF+PNE   ++
Sbjct  35   RICFALVLFHALLGLLLLGVRNSGQPRSSIQNGWWGPKVLCWMLLLVASFFIPNEFFRVW  94

Query  185  ETT-SKFGSGlfllvqvvllldfvHGWNDKWV---GYNEQFWYIALFVVTLICYVATFAF  352
                S  G+ +F+L  +VLL+DF H W ++ +    Y++++ YI L   TL  Y A    
Sbjct  95   GNYFSLAGAAIFILFGLVLLVDFAHSWTERCLENMEYSDKWKYI-LIGGTLFLYAAAITL  153

Query  353  NGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLYC  517
             G+++ FF P+G  C LN FF+ + +I       + + PSV     +  +  +S++ +YC
Sbjct  154  TGIMYGFFTPNG--CSLNQFFVTLNMILSLLITFLCITPSVQEANHRSGLSQSSIVVIYC  211

Query  518  TYLCYSGLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
            TYL  S + +EP D ECN  L  S+   + ++ LG + T L++ YS  RA + 
Sbjct  212  TYLVLSAVANEPNDKECNP-LRKSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  263



>emb|CEG74955.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=393

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 128/233 (55%), Gaps = 13/233 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R+     LF   L  +++GV+N   PR S+ +G W  K+ CW L+++  FF+PNE   ++
Sbjct  35   RICFALVLFHALLGLLLLGVRNSGQPRSSIQNGWWGPKVLCWMLLLVASFFIPNEFFRVW  94

Query  185  ETT-SKFGSGlfllvqvvllldfvHGWNDKWV---GYNEQFWYIALFVVTLICYVATFAF  352
                S  G+ +F+L  +VLL+DF H W ++ +    Y++++ YI L   TL  Y A    
Sbjct  95   GNYFSLAGAAIFILFGLVLLVDFAHSWTERCLENMEYSDKWKYI-LIGGTLFLYAAAITL  153

Query  353  NGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLYC  517
             G+++ FF P+G  C LN FF+ + +I       + + PSV     +  +  +S++ +YC
Sbjct  154  TGIMYGFFTPNG--CSLNQFFVTLNMILSLLITFLCITPSVQEANHRSGLSQSSIVVIYC  211

Query  518  TYLCYSGLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
            TYL  S + +EP D ECN  L  S+   + ++ LG + T L++ YS  RA + 
Sbjct  212  TYLVLSAVANEPNDKECNP-LRKSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  263



>ref|XP_003620496.1| Serine incorporator [Medicago truncatula]
 gb|AES76714.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=402

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 102/194 (53%), Gaps = 10/194 (5%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVS+G FLFF  + +         +PRD  H G W  KI  W ++ IF F LP+E++ L
Sbjct  86   LRVSMGCFLFFMMMFWSTTRTSKLNEPRDRWHSGWWATKIVLWIILTIFTFLLPSELIDL  145

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVG--YNEQFWYIALFVVT---LICYVATF  346
            Y   + FG+G+FLL+Q+V ++ F+   ND +    Y E+     +   T    IC V   
Sbjct  146  YGEVAHFGAGVFLLIQLVSIISFITWLNDCFASEKYAERCQIHVMVFATGSYFICLVGII  205

Query  347  AFNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYL  526
                L++ ++AP    C LN FFI  TL+ +     V+LHP V G I    ++ LY  +L
Sbjct  206  ----LMYIWYAPI-PSCLLNIFFITWTLVLLQIMTSVSLHPKVNGGILSPGLMGLYVVFL  260

Query  527  CYSGLVSEPRDYEC  568
            C+  + SEP   +C
Sbjct  261  CWCAIRSEPEGDQC  274



>emb|CEJ00743.1| hypothetical protein RMCBS344292_14792 [Rhizopus microsporus]
Length=453

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 128/233 (55%), Gaps = 13/233 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R+     LF   L  +++GV+N + PR S+ +G W  K+ CW L+++  FF+PNE   ++
Sbjct  96   RICFALVLFHALLGLLLLGVRNSRQPRSSIQNGWWGPKVLCWMLLLVASFFIPNEFFRVW  155

Query  185  ETT-SKFGSGlfllvqvvllldfvHGWNDKWV---GYNEQFWYIALFVVTLICYVATFAF  352
                S  G+ +F+L  +VLL+DF H W ++ +    Y++++ YI L   TL  Y A    
Sbjct  156  GNYFSLTGAAIFILFGLVLLVDFAHSWTERCLENMEYSDKWKYI-LIGGTLFLYAAAITL  214

Query  353  NGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLYC  517
             G+++ FF P+G  C LN FF+   +I       + + PSV     +  +  +S++ +YC
Sbjct  215  TGIMYGFFTPNG--CSLNQFFVTFNVILSLLITFLCITPSVQEANHRSGLSQSSIVVIYC  272

Query  518  TYLCYSGLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
            TYL  S + +EP D ECN  L  S+   + ++ LG + T L++ YS  RA + 
Sbjct  273  TYLVLSAVANEPNDKECNP-LRRSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  324



>ref|XP_008362934.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=392

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 98/196 (50%), Gaps = 1/196 (1%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLG FLF+ T+     G     +PRDS   G W  KI  W   +I  F LP  I+ L
Sbjct  83   LRVSLGCFLFYITMFLSTAGTSKLNEPRDSWQSGWWSAKIVMWISFIIIPFLLPATIIQL  142

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   + FG+G+FLL+Q++ ++ F+   ND       +   I + ++    YV       L
Sbjct  143  YGEIAHFGAGVFLLIQLISIISFITWLNDCCQSTKSERCRIHVMLLATAAYVVCLVGIIL  202

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            ++ ++AP    C LN FFI  TL+ +     V+LHP V   I    ++ LY  ++C+  +
Sbjct  203  MYIWYAPE-PTCLLNIFFITWTLVLLQLMTSVSLHPKVNAGILTPGLMGLYIVFICWFAI  261

Query  542  VSEPRDYECNGFLNHS  589
             SEP    CN   + S
Sbjct  262  RSEPAGTSCNKKADDS  277



>emb|CEG74953.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=454

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 128/233 (55%), Gaps = 13/233 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R+     LF   L  +++GV+N   PR S+ +G W  K+ CW L+++  FF+PNE   ++
Sbjct  96   RICFALVLFHALLGLLLLGVRNSGQPRSSIQNGWWGPKVLCWMLLLVASFFIPNEFFRVW  155

Query  185  ETT-SKFGSGlfllvqvvllldfvHGWNDKWV---GYNEQFWYIALFVVTLICYVATFAF  352
                S  G+ +F+L  +VLL+DF H W ++ +    Y++++ YI L   TL  Y A    
Sbjct  156  GNYFSLAGAAIFILFGLVLLVDFAHSWTERCLENMEYSDKWKYI-LIGGTLFLYAAAITL  214

Query  353  NGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLYC  517
             G+++ FF P+G  C LN FF+ + +I       + + PSV     +  +  +S++ +YC
Sbjct  215  TGIMYGFFTPNG--CSLNQFFVTLNMILSLLITFLCITPSVQEANHRSGLSQSSIVVIYC  272

Query  518  TYLCYSGLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
            TYL  S + +EP D ECN  L  S+   + ++ LG + T L++ YS  RA + 
Sbjct  273  TYLVLSAVANEPNDKECNP-LRKSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  324



>emb|CEG74954.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=457

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 128/233 (55%), Gaps = 13/233 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R+     LF   L  +++GV+N   PR S+ +G W  K+ CW L+++  FF+PNE   ++
Sbjct  96   RICFALVLFHALLGLLLLGVRNSGQPRSSIQNGWWGPKVLCWMLLLVASFFIPNEFFRVW  155

Query  185  ETT-SKFGSGlfllvqvvllldfvHGWNDKWV---GYNEQFWYIALFVVTLICYVATFAF  352
                S  G+ +F+L  +VLL+DF H W ++ +    Y++++ YI L   TL  Y A    
Sbjct  156  GNYFSLAGAAIFILFGLVLLVDFAHSWTERCLENMEYSDKWKYI-LIGGTLFLYAAAITL  214

Query  353  NGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLYC  517
             G+++ FF P+G  C LN FF+ + +I       + + PSV     +  +  +S++ +YC
Sbjct  215  TGIMYGFFTPNG--CSLNQFFVTLNMILSLLITFLCITPSVQEANHRSGLSQSSIVVIYC  272

Query  518  TYLCYSGLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
            TYL  S + +EP D ECN  L  S+   + ++ LG + T L++ YS  RA + 
Sbjct  273  TYLVLSAVANEPNDKECNP-LRKSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  324



>emb|CEG67770.1| hypothetical protein RMATCC62417_04149 [Rhizopus microsporus]
Length=284

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 126/226 (56%), Gaps = 13/226 (6%)
 Frame = +2

Query  26   LFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLYETT-SKF  202
            LF   L  +++GV+N   PR S+ +G W  K+ CW L+++  FF+PNE   ++    S  
Sbjct  42   LFHALLGLLLLGVRNSGQPRSSIQNGWWGPKVLCWMLLLVASFFIPNEFFRVWGNYFSLT  101

Query  203  GSGlfllvqvvllldfvHGWNDKWV---GYNEQFWYIALFVVTLICYVATFAFNGLLFHF  373
            G+ +F+L  +VLL+DF H W ++ +    Y++++ YI L   TL  Y A     G+++ F
Sbjct  102  GAAIFILFGLVLLVDFAHSWTERCLENMEYSDKWKYI-LIGGTLFLYAAAITLTGIMYGF  160

Query  374  FAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLYCTYLCYSG  538
            F P+G  C LN FF+ + +I       + + PSV     +  +  +S++ +YCTYL  S 
Sbjct  161  FTPNG--CSLNQFFVTINVILSLLITFLCITPSVQEANHRSGLSQSSIVVIYCTYLVLSA  218

Query  539  LVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
            + +EP D ECN  L  S+   + ++ LG + T L++ YS  RA + 
Sbjct  219  VANEPNDKECNP-LRKSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  263



>ref|XP_007202140.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
 gb|EMJ03339.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
Length=389

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 96/190 (51%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSL  F+F+ T+     G    K+PRDS   G W  KI  W   +I  F LP  I+ L
Sbjct  74   LRVSLACFMFYFTMFLSTAGASKLKEPRDSWQSGWWSAKIVLWVTFIIIPFLLPAAIIQL  133

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   + FG+G+FLL+Q++ ++ F+   ND       +   I + ++    YV       L
Sbjct  134  YGEIAHFGAGVFLLIQLISIISFITWLNDCCQSSKSERCQIHIMLLATTAYVLCLTGIIL  193

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            ++ ++AP    C LN FFI  TL+ +     V+LHP V   I    ++ LY  ++C+  +
Sbjct  194  MYIWYAPE-PSCLLNIFFITWTLVLLQLMTSVSLHPKVNAGILTPGLMGLYIVFICWFAI  252

Query  542  VSEPRDYECN  571
             SEP    CN
Sbjct  253  RSEPSGESCN  262



>emb|CEG67769.1| hypothetical protein RMATCC62417_04149 [Rhizopus microsporus]
Length=393

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 127/233 (55%), Gaps = 13/233 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R      LF   L  +++GV+N   PR S+ +G W  K+ CW L+++  FF+PNE   ++
Sbjct  35   RTCFALVLFHALLGLLLLGVRNSGQPRSSIQNGWWGPKVLCWMLLLVASFFIPNEFFRVW  94

Query  185  ETT-SKFGSGlfllvqvvllldfvHGWNDKWV---GYNEQFWYIALFVVTLICYVATFAF  352
                S  G+ +F+L  +VLL+DF H W ++ +    Y++++ YI L   TL  Y A    
Sbjct  95   GNYFSLTGAAIFILFGLVLLVDFAHSWTERCLENMEYSDKWKYI-LIGGTLFLYAAAITL  153

Query  353  NGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLYC  517
             G+++ FF P+G  C LN FF+ + +I       + + PSV     +  +  +S++ +YC
Sbjct  154  TGIMYGFFTPNG--CSLNQFFVTINVILSLLITFLCITPSVQEANHRSGLSQSSIVVIYC  211

Query  518  TYLCYSGLVSEPRDYECNGFLNHSKAvssgtltlglvttvlsvvYSAVRAGSS  676
            TYL  S + +EP D ECN  L  S+   + ++ LG + T L++ YS  RA + 
Sbjct  212  TYLVLSAVANEPNDKECNP-LRKSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  263



>ref|XP_009214345.1| PREDICTED: serine incorporator 3 isoform X2 [Papio anubis]
Length=418

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 110/203 (54%), Gaps = 14/203 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNE-IVSL  181
            R+S    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     S+
Sbjct  45   RISFAMAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSSV  104

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL   T   Y+ +  
Sbjct  105  WFVAGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSII  164

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
              GLL+ ++  P G  C  N FFI + LI     +++++HP +     +  +  +S+++L
Sbjct  165  CVGLLYTYYTKPDG--CTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITL  222

Query  512  YCTYLCYSGLVSEPRDYECNGFL  580
            Y  YL +S + +EP D  CN  L
Sbjct  223  YTMYLTWSAMSNEP-DRSCNPSL  244



>ref|XP_008242601.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=389

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 96/190 (51%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSL  F+F+ T+     G    K+PRDS   G W  KI  W   +I  F LP  I+ L
Sbjct  74   LRVSLACFMFYFTMFLSTAGASKLKEPRDSWQSGWWSAKIVLWVTFIIIPFLLPAAIIQL  133

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   + FG+G+FLL+Q++ ++ F+   ND       +   I + ++    YV       L
Sbjct  134  YGEIAHFGAGVFLLIQLISIISFITWLNDCCQSSKSERCQIHIMLLATTAYVLCLTGIIL  193

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            ++ ++AP    C LN FFI  TL+ +     V+LHP V   I    ++ LY  ++C+  +
Sbjct  194  MYIWYAPE-PSCLLNIFFITWTLVLLQLMTSVSLHPKVNAGILTPGLMGLYIVFICWFAI  252

Query  542  VSEPRDYECN  571
             SEP    CN
Sbjct  253  RSEPTGESCN  262



>ref|XP_004346817.1| predicted protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW47188.1| hypothetical protein CAOG_05132 [Capsaspora owczarzaki ATCC 30864]
Length=438

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 106/201 (53%), Gaps = 10/201 (5%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            RV LG  LF T ++ +M GV +  DPR S+ +  W +K+  W   +I  FF+P   +  +
Sbjct  87   RVCLGLVLFHTFMALIMYGVSSSSDPRASIQNSWWPLKLALWLGSIIGCFFIPGSNIEQF  146

Query  185  ETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFAF  352
            +  S  G+ +F+L+Q+VLL+DF H  NDK V        + W++ L  +T +     FA 
Sbjct  147  QYPSMAGAIVFILIQLVLLVDFAHSLNDKLVAKFQDTQARIWFVLLIGLTFLFNGTAFAL  206

Query  353  NGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLYC  517
              +++ +F P    C +NTFF+    +      +V++   V     K  +  +SV++LY 
Sbjct  207  TVIMWTYFLPGDSSCRINTFFVTFNFLVCIVLTLVSISGKVQEHNPKSGLLQSSVVTLYS  266

Query  518  TYLCYSGLVSEPR-DYECNGF  577
            TYL +S + SEP  DY CN  
Sbjct  267  TYLVWSAVSSEPESDYPCNSL  287



>ref|XP_002515588.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47037.1| conserved hypothetical protein [Ricinus communis]
Length=398

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 101/199 (51%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLG F+FF  +    +G     DPRDS H G W  KI  W  + I  F +P+  + L
Sbjct  82   LRVSLGCFVFFMIMFLSTVGTSKFHDPRDSWHSGWWGPKIVLWIALTIMTFLVPSAFIRL  141

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVG--YNEQFWYIALFVVTLICYVATFAFN  355
            Y   + FG+G+FLL+Q++ ++ F+   ND  +   Y E+  +I   ++  + YV      
Sbjct  142  YGEIAHFGAGVFLLIQLISIISFITWLNDCCLSEKYAERC-HIHAMLIATVAYVVCIVGI  200

Query  356  GLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYS  535
             +++ ++ P    C LN FFI  TL+ +     V+LHP V        ++ LY  +LC+ 
Sbjct  201  IMMYIWYTPET-SCLLNIFFITWTLVLLQVITSVSLHPKVNAGFLTPGLMGLYVVFLCWC  259

Query  536  GLVSEPRDYECNGFLNHSK  592
             + SEP    CN     SK
Sbjct  260  AIRSEPAGESCNRKAEASK  278



>gb|EHH65321.1| Tumor differentially expressed protein 1 [Macaca fascicularis]
Length=473

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 110/203 (54%), Gaps = 14/203 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNE-IVSL  181
            R+S    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     S+
Sbjct  100  RISFAMAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSSV  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL   T   Y+ +  
Sbjct  160  WFVAGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSII  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
              GLL+ ++  P G  C  N FFI + LI     +++++HP +     +  +  +S+++L
Sbjct  220  CVGLLYTYYTKPDG--CTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITL  277

Query  512  YCTYLCYSGLVSEPRDYECNGFL  580
            Y  YL +S + +EP D  CN  L
Sbjct  278  YTMYLTWSAMSNEP-DRSCNPSL  299



>ref|NP_001247901.1| serine incorporator 3 precursor [Macaca mulatta]
 ref|XP_003904756.1| PREDICTED: serine incorporator 3 isoform X1 [Papio anubis]
 gb|EHH19676.1| Tumor differentially expressed protein 1 [Macaca mulatta]
Length=473

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 110/203 (54%), Gaps = 14/203 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNE-IVSL  181
            R+S    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     S+
Sbjct  100  RISFAMAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSSV  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL   T   Y+ +  
Sbjct  160  WFVAGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSII  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
              GLL+ ++  P G  C  N FFI + LI     +++++HP +     +  +  +S+++L
Sbjct  220  CVGLLYTYYTKPDG--CTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITL  277

Query  512  YCTYLCYSGLVSEPRDYECNGFL  580
            Y  YL +S + +EP D  CN  L
Sbjct  278  YTMYLTWSAMSNEP-DRSCNPSL  299



>ref|XP_005569140.1| PREDICTED: serine incorporator 3 isoform X1 [Macaca fascicularis]
Length=473

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 110/203 (54%), Gaps = 14/203 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNE-IVSL  181
            R+S    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     S+
Sbjct  100  RISFAMAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSSV  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL   T   Y+ +  
Sbjct  160  WFVAGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSII  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
              GLL+ ++  P G  C  N FFI + LI     +++++HP +     +  +  +S+++L
Sbjct  220  CVGLLYTYYTKPDG--CTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITL  277

Query  512  YCTYLCYSGLVSEPRDYECNGFL  580
            Y  YL +S + +EP D  CN  L
Sbjct  278  YTMYLTWSAMSNEP-DRSCNPSL  299



>ref|XP_009352478.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 99/190 (52%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLG FLF+ T+    IG     +PRD    G W  KI  W   +I  F LP +I+ L
Sbjct  83   LRVSLGCFLFYFTMFLSTIGTSKLNEPRDLWQSGWWSAKIVMWVSFIIIPFVLPAKIIQL  142

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   + FG+G+FLL+Q++ ++ F+   ND       +   I + ++ +  +V       L
Sbjct  143  YGEIAHFGAGVFLLIQLISIISFIKWLNDWCQSTKSERCRIYVTLLAITAHVVCLVGIVL  202

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            ++ ++AP    C LN FFI  TL+ +     V+LHP+V   I    ++ LY  ++C+  +
Sbjct  203  MYIWYAPE-PTCLLNIFFITWTLVLLQLMTSVSLHPNVNAGILTPGLMGLYIVFICWFAI  261

Query  542  VSEPRDYECN  571
             SEP    CN
Sbjct  262  RSEPAGTSCN  271



>ref|XP_010382576.1| PREDICTED: serine incorporator 3 [Rhinopithecus roxellana]
 ref|XP_010382577.1| PREDICTED: serine incorporator 3 [Rhinopithecus roxellana]
Length=473

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 110/203 (54%), Gaps = 14/203 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNE-IVSL  181
            R+S    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     S+
Sbjct  100  RISFAMAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSSV  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL   T   Y+ +  
Sbjct  160  WFVAGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSII  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
              GLL+ ++  P G  C  N FFI + LI     +++++HP +     +  +  +S+++L
Sbjct  220  CVGLLYTYYTKPDG--CTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITL  277

Query  512  YCTYLCYSGLVSEPRDYECNGFL  580
            Y  YL +S + +EP D  CN  L
Sbjct  278  YTMYLTWSAMSNEP-DRSCNPSL  299



>ref|NP_001128733.1| serine incorporator 3 precursor [Pongo abelii]
 sp|Q5R533.1|SERC3_PONAB RecName: Full=Serine incorporator 3 [Pongo abelii]
 emb|CAH93133.1| hypothetical protein [Pongo abelii]
Length=473

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 108/200 (54%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNE-IVSL  181
            R+S    +FF   S +M  VK  KDPR +VH+G W  KI     I++  F++P     S+
Sbjct  100  RISFAMAIFFFVFSLLMFKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSSV  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL   T   Y+ +  
Sbjct  160  WFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSII  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
              GLL+ ++  P G  C  N FFI + LI     +++++HP +     +  +  +SV++L
Sbjct  220  CVGLLYTYYTKPDG--CTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSVITL  277

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  278  YTMYLTWSAMSNEP-DRSCN  296



>ref|XP_008337449.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=398

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 99/190 (52%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLG FLF+ T+    +G     +PRDS   G W  KI  W   +I  F LP +I+ L
Sbjct  83   LRVSLGCFLFYFTMFLSTVGTSKLNEPRDSWQSGWWSAKIVMWVSFIIIPFVLPAKIIQL  142

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   + FG+G+FLL+Q++ ++ F+   N+       +   I + ++    +V       L
Sbjct  143  YGEIAHFGAGVFLLIQLISIICFIKWLNEWCQSTKSERCRIYVMLLATTAHVVCLVGIXL  202

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            ++ ++AP    C LN FFI  TL+ +     V+LHP+V   I    ++ LY  ++C+  +
Sbjct  203  MYIWYAPE-PTCLLNIFFITWTLVLLQLMTSVSLHPNVNAGILTPGLMGLYIVFICWFAI  261

Query  542  VSEPRDYECN  571
             SEP    CN
Sbjct  262  RSEPAGTSCN  271



>ref|XP_008696301.1| PREDICTED: serine incorporator 3 [Ursus maritimus]
Length=473

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 112/200 (56%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R++    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     + 
Sbjct  100  RINFALAIFFFAFSLLMLKVKTSKDPRAAVHNGFWFFKIAAIVGIMVGSFYIPGGHFTTA  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL  VT +CY+ +  
Sbjct  160  WFIVGMVGAFLFILIQLVLLVDFAHSWNESWVNRMEEGNPRCWYAALLSVTSVCYILSVV  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F GLL+ ++  P G  C  N FFI + LI  F  +++++ P +     +  +  +S+++L
Sbjct  220  FVGLLYAYYTKPDG--CAENKFFISINLILCFVVSIISILPKIQEHQPRSGLLQSSLITL  277

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  278  YTMYLTWSAMSNEP-DRSCN  296



>ref|XP_003253654.1| PREDICTED: serine incorporator 3 isoform 2 [Nomascus leucogenys]
Length=418

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 108/200 (54%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNE-IVSL  181
            R+S    +FF   S +M  VK  KDPR +VH+G W  KI     I++  F++P     S+
Sbjct  45   RISFAMAIFFFVFSLLMFKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSSV  104

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL   T   Y+ +  
Sbjct  105  WFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSII  164

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
              GLL+ ++  P G  C  N FFI + LI     +++++HP +     +  +  +S+++L
Sbjct  165  CVGLLYTYYTKPDG--CTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITL  222

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  223  YTMYLTWSAMSNEP-DRSCN  241



>gb|EFB21149.1| hypothetical protein PANDA_005628 [Ailuropoda melanoleuca]
Length=460

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 112/200 (56%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R++    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     + 
Sbjct  87   RINFALAIFFFAFSLLMLKVKTSKDPRAAVHNGFWFFKIAAIVGIMVGSFYIPGGHFTTA  146

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL  VT +CYV +  
Sbjct  147  WFIVGMVGAFLFILIQLVLLVDFAHSWNESWVNRMEEGNPRCWYAALLSVTSVCYVLSVV  206

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F GLL+ ++  P G  C  N FFI + LI  F  +++++ P +     +  +  +S+++L
Sbjct  207  FVGLLYAYYTKPDG--CTENKFFISINLILCFVVSIISILPKIQEHQPRSGLLQSSLITL  264

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  265  YTMYLTWSAMSNEP-DRSCN  283



>ref|XP_002917413.1| PREDICTED: serine incorporator 3-like [Ailuropoda melanoleuca]
Length=473

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 112/200 (56%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R++    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     + 
Sbjct  100  RINFALAIFFFAFSLLMLKVKTSKDPRAAVHNGFWFFKIAAIVGIMVGSFYIPGGHFTTA  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL  VT +CYV +  
Sbjct  160  WFIVGMVGAFLFILIQLVLLVDFAHSWNESWVNRMEEGNPRCWYAALLSVTSVCYVLSVV  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F GLL+ ++  P G  C  N FFI + LI  F  +++++ P +     +  +  +S+++L
Sbjct  220  FVGLLYAYYTKPDG--CTENKFFISINLILCFVVSIISILPKIQEHQPRSGLLQSSLITL  277

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  278  YTMYLTWSAMSNEP-DRSCN  296



>ref|XP_009887441.1| PREDICTED: serine incorporator 3 [Charadrius vociferus]
Length=417

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 108/202 (53%), Gaps = 12/202 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSL  181
            R+S    +FF  LS +MI VK   DPR SVH+G W  KI     I++  F++P     + 
Sbjct  45   RISFAMAVFFFLLSLLMIQVKTSNDPRASVHNGFWFFKIAAIVAIMVGAFYIPEGPFTTA  104

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +     FG+ +F+L+Q+VLL+DF H WN+ WV      N + WY AL   T + Y  +  
Sbjct  105  WFVIGIFGAAIFILIQLVLLVDFAHSWNESWVQKMEEGNSKCWYAALLSCTSLFYALSLI  164

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
            F  +LF+ F     +C  N FFI + +I     ++V++ P V     +  +  +SV++LY
Sbjct  165  F-VVLFYVFYTKPDDCTENKFFITINMILCIAVSIVSVLPKVQERHPRSGLLQSSVITLY  223

Query  515  CTYLCYSGLVSEPRDYECNGFL  580
              YL +S + +EP +  CN  L
Sbjct  224  TMYLTWSAMSNEP-ERSCNPSL  244



>gb|EEH05886.1| DNA mismatch repair protein pms1 [Histoplasma capsulatum G186AR]
Length=1515

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 66/199 (33%), Positives = 109/199 (55%), Gaps = 12/199 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R++    LF   L+ +++GV++ KD R  + +G W  KI  W L+V+  FF+P     ++
Sbjct  99   RINFALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIPEGFFFVW  158

Query  185  ETTSKF-GSGlfllvqvvllldfvHGWND----KWVGYNEQFWYIALFVVTLICYVATFA  349
             +   F G+ LFLL+ ++LL+D  H W +    K    + Q W + L   TL  Y+A+ A
Sbjct  159  GSYISFIGAILFLLLGLILLVDLAHTWAEICLQKIEELDSQMWRVLLIGSTLGMYLASIA  218

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGS-----IFPASVLSLY  514
               +++ FFA SG  C +N   I   LI     +VV++ P+V+ S     +  A+++++Y
Sbjct  219  MTVIMYIFFANSG--CTMNQAAITTNLIIFLIISVVSVQPAVQASNPRAGLAQAAMVTVY  276

Query  515  CTYLCYSGLVSEPRDYECN  571
            CTYL  S +  EP D +CN
Sbjct  277  CTYLMLSAVSMEPDDRQCN  295



>gb|EGC49614.1| DNA mismatch repair protein [Histoplasma capsulatum H88]
Length=1515

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 66/199 (33%), Positives = 109/199 (55%), Gaps = 12/199 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R++    LF   L+ +++GV++ KD R  + +G W  KI  W L+V+  FF+P     ++
Sbjct  99   RINFALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIPEGFFFVW  158

Query  185  ETTSKF-GSGlfllvqvvllldfvHGWND----KWVGYNEQFWYIALFVVTLICYVATFA  349
             +   F G+ LFLL+ ++LL+D  H W +    K    + Q W + L   TL  Y+A+ A
Sbjct  159  GSYISFIGAILFLLLGLILLVDLAHTWAEICLQKIEELDSQMWRVLLIGSTLGMYLASIA  218

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGS-----IFPASVLSLY  514
               +++ FFA SG  C +N   I   LI     +VV++ P+V+ S     +  A+++++Y
Sbjct  219  MTVIMYIFFAHSG--CTMNQAAITTNLIIFLIISVVSVQPAVQASNPRAGLAQAAMVTVY  276

Query  515  CTYLCYSGLVSEPRDYECN  571
            CTYL  S +  EP D +CN
Sbjct  277  CTYLMLSAVSMEPDDRQCN  295



>gb|EER41787.1| DNA mismatch repair protein [Histoplasma capsulatum H143]
Length=1515

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 66/199 (33%), Positives = 109/199 (55%), Gaps = 12/199 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R++    LF   L+ +++GV++ KD R  + +G W  KI  W L+V+  FF+P     ++
Sbjct  99   RINFALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIPEGFFFVW  158

Query  185  ETTSKF-GSGlfllvqvvllldfvHGWND----KWVGYNEQFWYIALFVVTLICYVATFA  349
             +   F G+ LFLL+ ++LL+D  H W +    K    + Q W + L   TL  Y+A+ A
Sbjct  159  GSYISFIGAILFLLLGLILLVDLAHTWAEICLQKIEELDSQMWRVLLIGSTLGMYLASIA  218

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGS-----IFPASVLSLY  514
               +++ FFA SG  C +N   I   LI     +VV++ P+V+ S     +  A+++++Y
Sbjct  219  MTVIMYIFFAHSG--CTMNQAAITTNLIIFLIISVVSVQPAVQASNPRAGLAQAAMVTVY  276

Query  515  CTYLCYSGLVSEPRDYECN  571
            CTYL  S +  EP D +CN
Sbjct  277  CTYLMLSAVSMEPDDRQCN  295



>ref|XP_002426175.1| serine incorporator, putative [Pediculus humanus corporis]
 gb|EEB13437.1| serine incorporator, putative [Pediculus humanus corporis]
Length=439

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 106/191 (55%), Gaps = 12/191 (6%)
 Frame = +2

Query  29   FFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSLYETTSKFG  205
            FFT +  +MIGVK+ KDPR ++ +G W MK      I +  FF+P  E  S++      G
Sbjct  106  FFTLMCIIMIGVKSSKDPRAAIQNGFWGMKYLVLIGICVGAFFIPEGEFASVWMVFGMIG  165

Query  206  SGlfllvqvvllldfvHGWNDKWVGYNEQ----FWYIALFVVTLICYVATFAFNGLLFHF  373
              LF+L+Q++L++DF H W ++WVG  E+    FWYIAL  VT + +  +     LLF +
Sbjct  166  GFLFILIQLILIVDFAHSWAERWVGKYEETESKFWYIALLTVTFLLFTISIIGVVLLFIY  225

Query  374  FAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLYCTYLCYSG  538
            F  S  +C LN FFI   L+  F  ++V+  P V     K  +  +S++S Y  YL +SG
Sbjct  226  FTKS-DDCMLNKFFISFNLLLCFFSSIVSTLPKVQEYQPKSGLLQSSIVSAYVIYLTWSG  284

Query  539  LVSEPRDYECN  571
            + + P    CN
Sbjct  285  ISNSPVK-NCN  294



>gb|KGL85892.1| Serine incorporator 3, partial [Charadrius vociferus]
Length=458

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 108/202 (53%), Gaps = 12/202 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSL  181
            R+S    +FF  LS +MI VK   DPR SVH+G W  KI     I++  F++P     + 
Sbjct  87   RISFAMAVFFFLLSLLMIQVKTSNDPRASVHNGFWFFKIAAIVAIMVGAFYIPEGPFTTA  146

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +     FG+ +F+L+Q+VLL+DF H WN+ WV      N + WY AL   T + Y  +  
Sbjct  147  WFVIGIFGAAIFILIQLVLLVDFAHSWNESWVQKMEEGNSKCWYAALLSCTSLFYALSLI  206

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
            F  +LF+ F     +C  N FFI + +I     ++V++ P V     +  +  +SV++LY
Sbjct  207  F-VVLFYVFYTKPDDCTENKFFITINMILCIAVSIVSVLPKVQERHPRSGLLQSSVITLY  265

Query  515  CTYLCYSGLVSEPRDYECNGFL  580
              YL +S + +EP +  CN  L
Sbjct  266  TMYLTWSAMSNEP-ERSCNPSL  286



>ref|XP_008210211.1| PREDICTED: probable serine incorporator isoform X3 [Nasonia vitripennis]
Length=460

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 111/206 (54%), Gaps = 19/206 (9%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN---EIV  175
            R+SL   LFF  +S MMIGVK+ KDPR  + +G W +K       +I  FF+P     I 
Sbjct  94   RISLIMTLFFILMSVMMIGVKSTKDPRAGIQNGFWAIKYLLLIGGMIGAFFIPEGSFGIT  153

Query  176  SLYETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQF----WYIALFVVTLICYVAT  343
             +Y      G  LF+L+Q++L++DF H W D WVG  E+     WY AL   T++ Y   
Sbjct  154  WMY--FGMIGGFLFILIQLILIIDFAHTWADAWVGNYEETESKGWYAALLGATILNYC--  209

Query  344  FAFNG-LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVL  505
             A  G +L H +     +C LN FFI + +I     + V++ P +     +  +  +SV+
Sbjct  210  LALTGVVLLHVYFTKSDDCSLNKFFISINVILCVIVSAVSILPKIQEHQPRSGLLQSSVM  269

Query  506  SLYCTYLCYSGLVSEPRDYECN-GFL  580
            SLY  YL +SG+ + P D ECN GFL
Sbjct  270  SLYVVYLTWSGVSNSP-DRECNPGFL  294



>ref|XP_008210203.1| PREDICTED: probable serine incorporator isoform X2 [Nasonia vitripennis]
Length=461

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 111/206 (54%), Gaps = 19/206 (9%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN---EIV  175
            R+SL   LFF  +S MMIGVK+ KDPR  + +G W +K       +I  FF+P     I 
Sbjct  94   RISLIMTLFFILMSVMMIGVKSTKDPRAGIQNGFWAIKYLLLIGGMIGAFFIPEGSFGIT  153

Query  176  SLYETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQF----WYIALFVVTLICYVAT  343
             +Y      G  LF+L+Q++L++DF H W D WVG  E+     WY AL   T++ Y   
Sbjct  154  WMY--FGMIGGFLFILIQLILIIDFAHTWADAWVGNYEETESKGWYAALLGATILNYC--  209

Query  344  FAFNG-LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVL  505
             A  G +L H +     +C LN FFI + +I     + V++ P +     +  +  +SV+
Sbjct  210  LALTGVVLLHVYFTKSDDCSLNKFFISINVILCVIVSAVSILPKIQEHQPRSGLLQSSVM  269

Query  506  SLYCTYLCYSGLVSEPRDYECN-GFL  580
            SLY  YL +SG+ + P D ECN GFL
Sbjct  270  SLYVVYLTWSGVSNSP-DRECNPGFL  294



>ref|XP_010249828.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=397

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 103/195 (53%), Gaps = 10/195 (5%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LRVSLG F+F+ T+     G +   +  DS H G W  KI  W  +++  FF+PN ++  
Sbjct  81   LRVSLGCFIFYFTMFLSTAGTRKLNERSDSWHSGWWSAKILVWIALLVLPFFVPNALIQF  140

Query  182  YETTSKFGSGlfllvqvvllldfvHGWN-----DKWVGYNEQFWYIALFVVTLICYVATF  346
            Y   + FG+G+FLLVQ++ ++ F+   N     DK+ G       I + ++++  Y+A  
Sbjct  141  YGEIAHFGAGVFLLVQLISVISFITWLNDCCQSDKYEGRCR----IQVILLSVAAYIACM  196

Query  347  AFNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYL  526
                L++ ++AP    C LN FFI  TL+ +   A V+LHP V        ++ LY  ++
Sbjct  197  VGVVLMYIWYAPM-PSCLLNIFFITWTLVLLQLMACVSLHPKVNAGFLTPGLMGLYVVFI  255

Query  527  CYSGLVSEPRDYECN  571
            C+  + SEP    CN
Sbjct  256  CWCAIRSEPPTETCN  270



>ref|XP_008210231.1| PREDICTED: serine incorporator 1 isoform X5 [Nasonia vitripennis]
Length=448

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 111/206 (54%), Gaps = 19/206 (9%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN---EIV  175
            R+SL   LFF  +S MMIGVK+ KDPR  + +G W +K       +I  FF+P     I 
Sbjct  94   RISLIMTLFFILMSVMMIGVKSTKDPRAGIQNGFWAIKYLLLIGGMIGAFFIPEGSFGIT  153

Query  176  SLYETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQF----WYIALFVVTLICYVAT  343
             +Y      G  LF+L+Q++L++DF H W D WVG  E+     WY AL   T++ Y   
Sbjct  154  WMY--FGMIGGFLFILIQLILIIDFAHTWADAWVGNYEETESKGWYAALLGATILNYC--  209

Query  344  FAFNG-LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVL  505
             A  G +L H +     +C LN FFI + +I     + V++ P +     +  +  +SV+
Sbjct  210  LALTGVVLLHVYFTKSDDCSLNKFFISINVILCVIVSAVSILPKIQEHQPRSGLLQSSVM  269

Query  506  SLYCTYLCYSGLVSEPRDYECN-GFL  580
            SLY  YL +SG+ + P D ECN GFL
Sbjct  270  SLYVVYLTWSGVSNSP-DRECNPGFL  294



>ref|XP_003253653.1| PREDICTED: serine incorporator 3 isoform 1 [Nomascus leucogenys]
 ref|XP_003253655.1| PREDICTED: serine incorporator 3 isoform 3 [Nomascus leucogenys]
Length=466

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 108/200 (54%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNE-IVSL  181
            R+S    +FF   S +M  VK  KDPR +VH+G W  KI     I++  F++P     S+
Sbjct  93   RISFAMAIFFFVFSLLMFKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSSV  152

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H WN+ WV      N + WY AL   T   Y+ +  
Sbjct  153  WFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSII  212

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
              GLL+ ++  P G  C  N FFI + LI     +++++HP +     +  +  +S+++L
Sbjct  213  CVGLLYTYYTKPDG--CTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITL  270

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  271  YTMYLTWSAMSNEP-DRSCN  289



>ref|XP_001603720.2| PREDICTED: probable serine incorporator isoform X1 [Nasonia vitripennis]
Length=465

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 111/206 (54%), Gaps = 19/206 (9%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN---EIV  175
            R+SL   LFF  +S MMIGVK+ KDPR  + +G W +K       +I  FF+P     I 
Sbjct  94   RISLIMTLFFILMSVMMIGVKSTKDPRAGIQNGFWAIKYLLLIGGMIGAFFIPEGSFGIT  153

Query  176  SLYETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQF----WYIALFVVTLICYVAT  343
             +Y      G  LF+L+Q++L++DF H W D WVG  E+     WY AL   T++ Y   
Sbjct  154  WMY--FGMIGGFLFILIQLILIIDFAHTWADAWVGNYEETESKGWYAALLGATILNYC--  209

Query  344  FAFNG-LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVL  505
             A  G +L H +     +C LN FFI + +I     + V++ P +     +  +  +SV+
Sbjct  210  LALTGVVLLHVYFTKSDDCSLNKFFISINVILCVIVSAVSILPKIQEHQPRSGLLQSSVM  269

Query  506  SLYCTYLCYSGLVSEPRDYECN-GFL  580
            SLY  YL +SG+ + P D ECN GFL
Sbjct  270  SLYVVYLTWSGVSNSP-DRECNPGFL  294



>ref|XP_008210234.1| PREDICTED: serine incorporator 1 isoform X6 [Nasonia vitripennis]
Length=447

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 111/206 (54%), Gaps = 19/206 (9%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN---EIV  175
            R+SL   LFF  +S MMIGVK+ KDPR  + +G W +K       +I  FF+P     I 
Sbjct  94   RISLIMTLFFILMSVMMIGVKSTKDPRAGIQNGFWAIKYLLLIGGMIGAFFIPEGSFGIT  153

Query  176  SLYETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQF----WYIALFVVTLICYVAT  343
             +Y      G  LF+L+Q++L++DF H W D WVG  E+     WY AL   T++ Y   
Sbjct  154  WMY--FGMIGGFLFILIQLILIIDFAHTWADAWVGNYEETESKGWYAALLGATILNYC--  209

Query  344  FAFNG-LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVL  505
             A  G +L H +     +C LN FFI + +I     + V++ P +     +  +  +SV+
Sbjct  210  LALTGVVLLHVYFTKSDDCSLNKFFISINVILCVIVSAVSILPKIQEHQPRSGLLQSSVM  269

Query  506  SLYCTYLCYSGLVSEPRDYECN-GFL  580
            SLY  YL +SG+ + P D ECN GFL
Sbjct  270  SLYVVYLTWSGVSNSP-DRECNPGFL  294



>ref|XP_008210220.1| PREDICTED: serine incorporator 1 isoform X4 [Nasonia vitripennis]
Length=452

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 111/206 (54%), Gaps = 19/206 (9%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN---EIV  175
            R+SL   LFF  +S MMIGVK+ KDPR  + +G W +K       +I  FF+P     I 
Sbjct  94   RISLIMTLFFILMSVMMIGVKSTKDPRAGIQNGFWAIKYLLLIGGMIGAFFIPEGSFGIT  153

Query  176  SLYETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQF----WYIALFVVTLICYVAT  343
             +Y      G  LF+L+Q++L++DF H W D WVG  E+     WY AL   T++ Y   
Sbjct  154  WMY--FGMIGGFLFILIQLILIIDFAHTWADAWVGNYEETESKGWYAALLGATILNYC--  209

Query  344  FAFNG-LLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVL  505
             A  G +L H +     +C LN FFI + +I     + V++ P +     +  +  +SV+
Sbjct  210  LALTGVVLLHVYFTKSDDCSLNKFFISINVILCVIVSAVSILPKIQEHQPRSGLLQSSVM  269

Query  506  SLYCTYLCYSGLVSEPRDYECN-GFL  580
            SLY  YL +SG+ + P D ECN GFL
Sbjct  270  SLYVVYLTWSGVSNSP-DRECNPGFL  294



>ref|XP_002747623.2| PREDICTED: serine incorporator 3 [Callithrix jacchus]
Length=473

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 107/203 (53%), Gaps = 14/203 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNE-IVSL  181
            R+     +FF   S +MI VK  KDPR +VH+G W  KI     I++  F++P     S 
Sbjct  100  RIGFAMAIFFFVFSLLMIKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSSA  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+  F+L+Q+VLL+DF H WN+ WV      N + WY AL   T   Y+ +  
Sbjct  160  WFFVGMIGAAAFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSII  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
              GLL+ ++  P G  C  N FFI + LI     +++++HP +     +  +  +S+++L
Sbjct  220  CVGLLYTYYTKPDG--CTENKFFISINLILCVVVSIISIHPKIQEHQPRSGLLQSSIITL  277

Query  512  YCTYLCYSGLVSEPRDYECNGFL  580
            Y  YL +S + +EP D  CN  L
Sbjct  278  YTMYLTWSAMSNEP-DRSCNPSL  299



>ref|XP_009565857.1| PREDICTED: serine incorporator 3 [Cuculus canorus]
Length=416

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 105/202 (52%), Gaps = 12/202 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSL  181
            RVS    +FF  LS +MI VK   DPR S+H+G W  KI     I++  F++P       
Sbjct  45   RVSFAMAVFFFLLSVLMIQVKTSNDPRASIHNGFWFFKIAAIVAIMVGAFYIPEGPFTRA  104

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +     FG+  F+L+Q+VLL+DF H WN+ WV      N + WY AL   T + Y  +  
Sbjct  105  WFAIGIFGASCFILIQLVLLMDFAHSWNESWVNRMDEGNTKCWYAALLFCTSLFYALSLV  164

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
            F  +LF  F     +C  N FFI + LI     +VV++ P V     +  +  +SV++LY
Sbjct  165  F-VVLFSIFYTKPDDCTENKFFISINLILCVAVSVVSVLPKVQEHHPRSGLLQSSVITLY  223

Query  515  CTYLCYSGLVSEPRDYECNGFL  580
              YL +S + +EP +  CN  L
Sbjct  224  TMYLTWSAMSNEP-ERNCNPSL  244



>ref|XP_003936453.1| PREDICTED: serine incorporator 3 [Saimiri boliviensis boliviensis]
Length=473

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 111/207 (54%), Gaps = 22/207 (11%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R++    +FF   S +MI VK  KDPR +VH+G W  KI     I++  F++P      Y
Sbjct  100  RINFAMAIFFLVFSLLMIKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGG----Y  155

Query  185  ETTSKF-----GSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYV  337
             +++ F     G+  F+L+Q+VLL+DF H WN+ WV      N + WY AL   T   Y+
Sbjct  156  FSSAWFFVGMGGAAFFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYI  215

Query  338  ATFAFNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPAS  499
             +    GLL+ ++  P G  C  N FFI + LI     +++++HP +     +  +  +S
Sbjct  216  LSIICVGLLYTYYTKPDG--CTENKFFISINLILCVVVSIISIHPKIQEHQPRSGLLQSS  273

Query  500  VLSLYCTYLCYSGLVSEPRDYECNGFL  580
            +++LY  YL +S + +EP D  CN  L
Sbjct  274  IITLYTMYLTWSAMSNEP-DRSCNPSL  299



>ref|XP_001190705.2| PREDICTED: probable serine incorporator-like [Strongylocentrotus 
purpuratus]
Length=465

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 107/201 (53%), Gaps = 15/201 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN---EIV  175
            RVS G   FF  LS +MI VK+ KDPR  + +G W  K      + +  FF+PN   E V
Sbjct  90   RVSFGVAAFFFLLSLIMINVKSSKDPRSPIQNGFWFFKFLVMCGLCVAAFFIPNGSFENV  149

Query  176  SLYETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQF----WYIALFVVTLICYVAT  343
             +Y      G+  F+++Q+VLL+DF H WN+ WVG  E+     WY AL   T++ Y+  
Sbjct  150  FMY--FGMVGAFAFIIIQLVLLVDFAHSWNESWVGRMEETEHKGWYCALMSSTVVMYLIA  207

Query  344  FAFNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLS  508
                 L F F+  +G EC L+ FFI   L+     +V+++ P V     +  +  ++V+S
Sbjct  208  LTGFILFFIFYIGTGKECSLHKFFISFNLVLCVVMSVISILPKVQEAMPRSGLLQSAVIS  267

Query  509  LYCTYLCYSGLVSEPRDYECN  571
            +Y  YL +S + + P D  CN
Sbjct  268  MYTMYLTWSAMSNNPDD-TCN  287



>ref|XP_003071312.1| TMS membrane protein, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER29167.1| TMS membrane protein, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EFW14899.1| membrane protein TMS1 [Coccidioides posadasii str. Silveira]
Length=480

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 110/203 (54%), Gaps = 12/203 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R++    LF   L+ +++GV++ KD R  + +G W  KI  W  +++  FF+P     ++
Sbjct  99   RINFALGLFHIILALLLLGVRSSKDQRAGIQNGYWGPKIIVWLALIVLSFFIPEPFFFVW  158

Query  185  ETTSKF-GSGlfllvqvvllldfvHGWN----DKWVGYNEQFWYIALFVVTLICYVATFA  349
             +   F G+ LFLL+ ++LL+D  H W     +K      + W + L   TL  Y+A+FA
Sbjct  159  GSYFAFVGAILFLLLGLILLVDLAHSWAELCFEKIEDSGSRMWQVLLIGSTLGMYLASFA  218

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGS-----IFPASVLSLY  514
               +++ FFA SG  C +N   I + LI     +VV++ P+V+ +     +  A+++++Y
Sbjct  219  MTIVMYIFFARSG--CAMNQAAITINLIVFLIISVVSIQPAVQAANPRAGLAQAAMVTVY  276

Query  515  CTYLCYSGLVSEPRDYECNGFLN  583
            CTYL  S +  EP D +CN  L 
Sbjct  277  CTYLTMSAVSMEPDDKQCNPLLR  299



>ref|XP_010191635.1| PREDICTED: serine incorporator 3 [Mesitornis unicolor]
Length=417

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 107/202 (53%), Gaps = 12/202 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSL  181
            R+S    +FF  LS +MI VK   DPR SVH+G W  KI     I++  F++P       
Sbjct  45   RISFAMAVFFFILSLLMIEVKTSNDPRASVHNGFWFFKIAAIVAIMVGAFYIPEGPFTRA  104

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +     FG+  F+L+Q+VLL+DF H WN+ WV      N + WY AL + T + Y  +  
Sbjct  105  WFVIGIFGAFCFILIQLVLLVDFAHSWNESWVDKMEEGNSKCWYAALLLCTSLFYALSLV  164

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
            F  +LF+ F     +C  N FFI + LI     ++V++ P V     +  +  +SV++LY
Sbjct  165  F-IVLFYVFYTMPDDCTENKFFISINLILCIAVSIVSILPKVQEHQPRSGLLQSSVITLY  223

Query  515  CTYLCYSGLVSEPRDYECNGFL  580
              YL +S + +EP +  CN  L
Sbjct  224  TMYLTWSAMSNEP-ERSCNPSL  244



>ref|XP_004890198.1| PREDICTED: serine incorporator 3 [Heterocephalus glaber]
 ref|XP_004858244.1| PREDICTED: serine incorporator 3 [Heterocephalus glaber]
 gb|EHB06501.1| Serine incorporator 3 [Heterocephalus glaber]
Length=473

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 101/187 (54%), Gaps = 14/187 (7%)
 Frame = +2

Query  53   MIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNE-IVSLYETTSKFGSGlfllvq  229
            M+ VK  KDPR S+H+G W  KI     I++  F++P     S++      G+  F+L+Q
Sbjct  116  MLKVKTSKDPRASIHNGFWFFKIAALIGIMVGSFYIPEGYFTSVWFVVGLIGAAFFILIQ  175

Query  230  vvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFAFNGLLF-HFFAPSGHE  394
            +VLL+D  H WN+ WV      N + WY AL  VT + Y+ +    GLL+ H+  P G  
Sbjct  176  LVLLVDLAHSWNEAWVNNMEEGNPRVWYAALLSVTSLFYILSIVSAGLLYTHYTKPDG--  233

Query  395  CGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLYCTYLCYSGLVSEPRD  559
            C  N  FI + L+     +V+++HP V     +  +  +SV++LY  YL +S + +EP D
Sbjct  234  CTENKVFISINLVLCTVVSVISVHPKVQEHQPRSGLLQSSVITLYTLYLTWSAMTNEP-D  292

Query  560  YECNGFL  580
              CN  L
Sbjct  293  RSCNPTL  299



>gb|KFO81079.1| Serine incorporator 3, partial [Cuculus canorus]
Length=457

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 105/202 (52%), Gaps = 12/202 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSL  181
            RVS    +FF  LS +MI VK   DPR S+H+G W  KI     I++  F++P       
Sbjct  87   RVSFAMAVFFFLLSVLMIQVKTSNDPRASIHNGFWFFKIAAIVAIMVGAFYIPEGPFTRA  146

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +     FG+  F+L+Q+VLL+DF H WN+ WV      N + WY AL   T + Y  +  
Sbjct  147  WFAIGIFGASCFILIQLVLLMDFAHSWNESWVNRMDEGNTKCWYAALLFCTSLFYALSLV  206

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
            F  +LF  F     +C  N FFI + LI     +VV++ P V     +  +  +SV++LY
Sbjct  207  F-VVLFSIFYTKPDDCTENKFFISINLILCVAVSVVSVLPKVQEHHPRSGLLQSSVITLY  265

Query  515  CTYLCYSGLVSEPRDYECNGFL  580
              YL +S + +EP +  CN  L
Sbjct  266  TMYLTWSAMSNEP-ERNCNPSL  286



>ref|XP_002994401.1| hypothetical protein SELMODRAFT_449363 [Selaginella moellendorffii]
 gb|EFJ04535.1| hypothetical protein SELMODRAFT_449363 [Selaginella moellendorffii]
Length=386

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 104/190 (55%), Gaps = 3/190 (2%)
 Frame = +2

Query  2    LRVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSL  181
            LR+S G F+FF  +    +G       RD+ H+G W  K   W ++++  F +P   + +
Sbjct  76   LRISFGCFVFFLVMFVTTVGTTRLYGARDAWHNGWWPAKGVMWVILMVLPFLVPPSFIHI  135

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQFWYIALFVVTLICYVATFAFNGL  361
            Y   +++G+G+FLL+Q++ +++F++ WN++W+  +E+     + VV  + + A+      
Sbjct  136  YGEVARYGAGIFLLIQLLSVINFIYWWNEEWL--SEEKCKAPMLVVAFVSFGASIVATTY  193

Query  362  LFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGSIFPASVLSLYCTYLCYSGL  541
            +  +FAP    C LN FF   T I +     ++LH  V   +  + ++S+Y  +LC+S +
Sbjct  194  MSLWFAPH-ISCTLNIFFTSWTAILINVMTAISLHSKVNAGLMTSGLMSVYLCFLCWSAI  252

Query  542  VSEPRDYECN  571
            +SEP    CN
Sbjct  253  MSEPLSEACN  262



>ref|XP_007077812.1| PREDICTED: serine incorporator 3 [Panthera tigris altaica]
Length=473

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 109/200 (55%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R++    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     + 
Sbjct  100  RINFALAIFFFVFSLLMLKVKTSKDPRAAVHNGFWFFKIAAIVGIMVGSFYIPGGHFATA  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+DF H  N+ WV      N + WY AL  VT  CY+ +  
Sbjct  160  WFVVGMVGAFLFILIQLVLLVDFAHSLNESWVNRMEEGNPRCWYAALLSVTSFCYILSVV  219

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F GL + ++  P G  C  N FFI + L+     +V+++HP +     +  +  +S+++L
Sbjct  220  FVGLFYTYYTKPDG--CTENKFFISINLVLCVVVSVISIHPKIQEHQPRSGLLQSSLITL  277

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  278  YTMYLTWSAMSNEP-DRSCN  296



>ref|XP_001245605.1| hypothetical protein CIMG_05046 [Coccidioides immitis RS]
 gb|EAS34303.2| membrane protein TMS1 [Coccidioides immitis RS]
Length=480

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 110/203 (54%), Gaps = 12/203 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R++    LF   L+ +++GV++ KD R  + +G W  KI  W  +++  FF+P     ++
Sbjct  99   RINFALGLFHIILALLLLGVRSSKDQRAGLQNGYWGPKIIVWLALIVLSFFIPEPFFFVW  158

Query  185  ETTSKF-GSGlfllvqvvllldfvHGWN----DKWVGYNEQFWYIALFVVTLICYVATFA  349
             +   F G+ LFLL+ ++LL+D  H W     +K      + W + L   TL  Y+A+FA
Sbjct  159  GSYFAFVGAILFLLLGLILLVDLAHSWAELCFEKIEDSGSRMWQVLLIGSTLGMYLASFA  218

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGS-----IFPASVLSLY  514
               +++ FFA SG  C +N   I + LI     +VV++ P+V+ +     +  A+++++Y
Sbjct  219  MTIVMYIFFARSG--CAMNQAAITINLIVFLIISVVSIQPAVQAANPRAGLAQAAMVTVY  276

Query  515  CTYLCYSGLVSEPRDYECNGFLN  583
            CTYL  S +  EP D +CN  L 
Sbjct  277  CTYLTMSAVSMEPDDKQCNPLLR  299



>ref|XP_004687460.1| PREDICTED: serine incorporator 3 [Condylura cristata]
Length=473

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 107/199 (54%), Gaps = 12/199 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R+     ++F   S +M+ VK+ KDPR ++H+G W  KI     I++  F++P     + 
Sbjct  100  RIYFALAIYFFAFSLLMLKVKSSKDPRAAIHNGFWFFKIAAIVGIMVGSFYIPGGHFTTA  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ +F+L+Q+VLL+D  H WN+ WV      N + WY+ L  +T + Y+ +  
Sbjct  160  WFIIGMAGAAIFILIQLVLLVDLAHSWNESWVNRMEEGNPRCWYVGLLSITSLFYILSII  219

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
               LL+ FF  S   C  N FFI + LI     +V+++HP +     +  +  +S+++LY
Sbjct  220  LAVLLYTFFTRS-DGCTENKFFISINLILCVVVSVISVHPKIQEHQPRSGLLQSSIITLY  278

Query  515  CTYLCYSGLVSEPRDYECN  571
              YL +S + +EP D  CN
Sbjct  279  TMYLTWSAIANEP-DRSCN  296



>gb|KFQ26316.1| Serine incorporator 3, partial [Mesitornis unicolor]
Length=458

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 107/202 (53%), Gaps = 12/202 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSL  181
            R+S    +FF  LS +MI VK   DPR SVH+G W  KI     I++  F++P       
Sbjct  87   RISFAMAVFFFILSLLMIEVKTSNDPRASVHNGFWFFKIAAIVAIMVGAFYIPEGPFTRA  146

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +     FG+  F+L+Q+VLL+DF H WN+ WV      N + WY AL + T + Y  +  
Sbjct  147  WFVIGIFGAFCFILIQLVLLVDFAHSWNESWVDKMEEGNSKCWYAALLLCTSLFYALSLV  206

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
            F  +LF+ F     +C  N FFI + LI     ++V++ P V     +  +  +SV++LY
Sbjct  207  F-IVLFYVFYTMPDDCTENKFFISINLILCIAVSIVSILPKVQEHQPRSGLLQSSVITLY  265

Query  515  CTYLCYSGLVSEPRDYECNGFL  580
              YL +S + +EP +  CN  L
Sbjct  266  TMYLTWSAMSNEP-ERSCNPSL  286



>emb|CEG70157.1| hypothetical protein RMATCC62417_06104 [Rhizopus microsporus]
Length=494

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 103/199 (52%), Gaps = 12/199 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            RVS    LF   L  ++IGV + +  R ++ +G W  KI  W  +V+  FF+P+    ++
Sbjct  96   RVSFALVLFHAILGCLLIGVHDSRQKRAAIQNGWWGPKILAWITLVVVSFFIPSGFFMVW  155

Query  185  ETT-SKFGSGlfllvqvvllldfvHGWNDKWVGYNE----QFWYIALFVVTLICYVATFA  349
                + FG+ +F+L  +VLL+DF H W +K +   E      W   L   TL+ +     
Sbjct  156  GNYFALFGAAVFILFGLVLLVDFAHSWTEKCMEKYEYEGSNLWKNILIGGTLLMFAGAIT  215

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
              G+++ +FA +G  C LN FF+ + +I      VV + P +     +  +  AS++ +Y
Sbjct  216  LTGIMYGYFATNG--CSLNQFFVTLNMILCLLVTVVCISPKIQEANPRSGLSQASIVVIY  273

Query  515  CTYLCYSGLVSEPRDYECN  571
            CTYL  S + +EP D ECN
Sbjct  274  CTYLVLSAVANEPNDKECN  292



>ref|XP_003303516.1| hypothetical protein PTT_15753 [Pyrenophora teres f. teres 0-1]
 gb|EFQ88392.1| hypothetical protein PTT_15753 [Pyrenophora teres f. teres 0-1]
Length=532

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 110/203 (54%), Gaps = 12/203 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R++     F   ++ M+IGV++ KD R ++ +G W  KI  W  +++  FF+PN    ++
Sbjct  144  RINFALGFFHVLMALMLIGVRSSKDGRATIQNGFWAPKILGWIGMIVLTFFIPNSFFIVW  203

Query  185  ETT-SKFGSGlfllvqvvllldfvHGW----NDKWVGYNEQFWYIALFVVTLICYVATFA  349
                +  G+ LFLL+ ++LL+D  H W     +K      + W   L    +  Y+A+FA
Sbjct  204  GNYFAMVGACLFLLIGLILLVDLAHNWAEYCQEKIETTESRVWTGMLVGSAMSMYLASFA  263

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
               +++ FFA SG  CG+N   I + LI +   +V ++HP+V     +  +  ++++++Y
Sbjct  264  MTIVMYIFFAKSG--CGMNQAAITINLILLLVSSVASIHPAVQDVNPRAGLAQSAIVAVY  321

Query  515  CTYLCYSGLVSEPRDYECNGFLN  583
            CTYL  S +  EP D++CN  + 
Sbjct  322  CTYLTLSAVGMEPDDHQCNPLIR  344



>ref|XP_007530938.1| PREDICTED: serine incorporator 3 [Erinaceus europaeus]
Length=473

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 104/199 (52%), Gaps = 12/199 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            RVS    +FF   S +MI VK  KDPR SVH+G W  KI     I+I  F++P     + 
Sbjct  100  RVSFALAIFFLVFSLLMIKVKTSKDPRASVHNGFWFFKIAAIVGIMIGSFYIPGGHFTTA  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+D  H WN+ WV      N + WY AL   T + Y  +  
Sbjct  160  WFIIGMGGAFLFILIQLVLLVDCAHSWNESWVNNMEEGNPRCWYAALLSATSLLYTLSIV  219

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
            F GLL+ ++  S   C  N FFI   LI     +V+++ P V     +  +  +SV++ Y
Sbjct  220  FVGLLYAYYTKS-DGCTENKFFISFNLILCVVVSVISVLPKVQEHQPRSGLLQSSVITCY  278

Query  515  CTYLCYSGLVSEPRDYECN  571
              YL +S + +EP D  CN
Sbjct  279  TMYLTWSAMSNEP-DRSCN  296



>gb|EIE81637.1| hypothetical protein RO3G_06342 [Rhizopus delemar RA 99-880]
Length=497

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 104/199 (52%), Gaps = 12/199 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R+S    LF   L  ++IGV + +  R ++ +G W  KI  W ++VI  FF+P+    ++
Sbjct  96   RISFALVLFHAILGCLLIGVHDSRQKRAAIQNGWWGPKILAWIVLVIVSFFIPSGFFMVW  155

Query  185  ET-TSKFGSGlfllvqvvllldfvHGWNDKWVGYNEQ----FWYIALFVVTLICYVATFA  349
                + FG+ +F+L  +VLL+DF H W +K +   E      W   L   TL+ +     
Sbjct  156  GNYLALFGAAVFILFGLVLLVDFAHSWTEKCMEKYEMEDSTLWKNILIGGTLLMFSGAIT  215

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
              G+++ FFA   ++C LN FF+ + +I      V+ + P +     K  +  AS++ +Y
Sbjct  216  LTGIMYGFFAT--NDCSLNQFFVTLNMILCLLVTVLCVSPKIQEANPKSGLSQASIVVIY  273

Query  515  CTYLCYSGLVSEPRDYECN  571
            CTYL  S + +EP D ECN
Sbjct  274  CTYLVLSAVANEPNDKECN  292



>ref|XP_009507905.1| PREDICTED: serine incorporator 3-like [Phalacrocorax carbo]
Length=417

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 107/202 (53%), Gaps = 12/202 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSL  181
            R+S    +FF  LS +MI VK   DPR +VH+G W  KI     I++  F++P       
Sbjct  45   RISFAMAVFFFLLSLLMIEVKTSNDPRAAVHNGFWFFKIAAIVAIMVGAFYIPEGPFTRA  104

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +     FG+  F+L+Q+VLL+DF H WN+ WV      N + WY AL   T++ Y  +  
Sbjct  105  WFAIGIFGAFCFILIQLVLLVDFAHSWNESWVERMEEGNSKCWYAALLSCTILFYGLSLV  164

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
            F  +LF+ F     +C  N FFI + +I     ++V++ P V     +  +  +SV+SLY
Sbjct  165  F-VVLFYVFYTKPDDCTENKFFISINMILCIAVSIVSILPKVQDHQPRSGLLQSSVISLY  223

Query  515  CTYLCYSGLVSEPRDYECNGFL  580
              YL +S + +EP +  CN  L
Sbjct  224  TMYLTWSAMSNEP-ERSCNPSL  244



>gb|KFW97042.1| Serine incorporator 3, partial [Phalacrocorax carbo]
Length=438

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 107/202 (53%), Gaps = 12/202 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSL  181
            R+S    +FF  LS +MI VK   DPR +VH+G W  KI     I++  F++P       
Sbjct  67   RISFAMAVFFFLLSLLMIEVKTSNDPRAAVHNGFWFFKIAAIVAIMVGAFYIPEGPFTRA  126

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +     FG+  F+L+Q+VLL+DF H WN+ WV      N + WY AL   T++ Y  +  
Sbjct  127  WFAIGIFGAFCFILIQLVLLVDFAHSWNESWVERMEEGNSKCWYAALLSCTILFYGLSLV  186

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
            F  +LF+ F     +C  N FFI + +I     ++V++ P V     +  +  +SV+SLY
Sbjct  187  F-VVLFYVFYTKPDDCTENKFFISINMILCIAVSIVSILPKVQDHQPRSGLLQSSVISLY  245

Query  515  CTYLCYSGLVSEPRDYECNGFL  580
              YL +S + +EP +  CN  L
Sbjct  246  TMYLTWSAMSNEP-ERSCNPSL  266



>ref|XP_006921897.1| PREDICTED: serine incorporator 3 [Pteropus alecto]
 gb|ELK04217.1| Serine incorporator 3 [Pteropus alecto]
Length=473

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 110/203 (54%), Gaps = 14/203 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R+S    +FF   S +M+ VK  KDPR +VH+G W  KI     I++  F++P     + 
Sbjct  100  RISFALAIFFFAFSLLMLKVKTSKDPRAAVHNGFWFFKIAAIVGIMVGSFYIPGGHFTTA  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ LF+L+Q+VLL+D  H  N+ WV      N +FWY  L  VT I Y+ +  
Sbjct  160  WFVIGMCGAFLFILIQLVLLVDLAHSLNESWVNRMEEGNPRFWYAVLLSVTSILYIVSII  219

Query  350  FNGLLFHF-FAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F GLL+ +   P G  C  N FFI + LI     +++++HP +     +  +  +SV++L
Sbjct  220  FVGLLYVYSTKPDG--CTENKFFISINLILCIVVSIISIHPKIQEHQPRSGLLQSSVITL  277

Query  512  YCTYLCYSGLVSEPRDYECNGFL  580
            Y  YL +S + +EP D+ CN  L
Sbjct  278  YTIYLTWSAMTNEP-DHSCNPSL  299



>ref|XP_001538371.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN10173.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=611

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 110/203 (54%), Gaps = 12/203 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            R++    LF   L+ +++GV++ KD R  + +G W  KI  W L+V+  FF+P     ++
Sbjct  229  RINFALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIPEGFFFVW  288

Query  185  ETTSKF-GSGlfllvqvvllldfvHGWND----KWVGYNEQFWYIALFVVTLICYVATFA  349
             +   F G+ LFLL+ ++LL+D  H W +    K    + Q W + L   TL  Y+A+ A
Sbjct  289  GSYISFIGAILFLLLGLILLVDLAHTWAEICLQKIEELDSQMWRVLLIGSTLGMYLASIA  348

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGS-----IFPASVLSLY  514
               +++ FFA SG  C +N   I   LI     +VV++ P+V+ S     +  A+++++Y
Sbjct  349  MTVIMYIFFAHSG--CTMNQAAITTNLIIFLIISVVSVQPAVQASNPRAGLAQAAMVTVY  406

Query  515  CTYLCYSGLVSEPRDYECNGFLN  583
            CTYL  S +  EP D +CN  + 
Sbjct  407  CTYLMLSAVSMEPDDRQCNPLVR  429



>ref|XP_009806828.1| PREDICTED: serine incorporator 3 [Gavia stellata]
Length=417

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 105/202 (52%), Gaps = 12/202 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSL  181
            R+S    +FF  LS +MI VK   DPR SVH+G W  KI     I++  F++P       
Sbjct  45   RISFAMAMFFFLLSLLMIAVKTSNDPRASVHNGFWFFKIAAIVAIMVGAFYIPEGPFTRA  104

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+  F+L+Q+VLL+DF H WN+ WV      N + WY AL   T + Y  +  
Sbjct  105  WFVIGICGAAFFILIQLVLLVDFAHSWNESWVERMEEGNSKCWYAALLSCTSLFYALSLV  164

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
            F  +LF+ F     +C  N FFI + +I     +VV++ P V     +  +  +SV++LY
Sbjct  165  FI-VLFYVFYTKPDDCTENKFFISINMILCIVVSVVSILPKVQEHQPRSGLLQSSVITLY  223

Query  515  CTYLCYSGLVSEPRDYECNGFL  580
              YL +S + +EP +  CN  L
Sbjct  224  TMYLTWSAMSNEP-ERSCNPSL  244



>gb|EPB88143.1| hypothetical protein HMPREF1544_05087 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=495

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 105/199 (53%), Gaps = 12/199 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPNEIVSLY  184
            RVS    LF   L  ++IGV + +  R ++ +G W  KI  W ++++  FF+P+    ++
Sbjct  96   RVSFALVLFHAILGCLLIGVHDSRQKRAAIQNGWWGPKILAWMVLLVISFFIPSGFFMVW  155

Query  185  ETT-SKFGSGlfllvqvvllldfvHGWNDKWVGYNE----QFWYIALFVVTLICYVATFA  349
                + FG+ +F+L  +VLL+DF H W ++ +   E      W   L + TL+ +     
Sbjct  156  GNYFALFGAAIFILFGLVLLVDFAHSWTERCMENYEMNDSNLWKNILIIGTLLMFAGAIT  215

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSLY  514
              G+++ FFA +G  C LN FF+ + LI      ++ + P +     +  +  AS++ +Y
Sbjct  216  LTGIMYGFFATNG--CSLNQFFVTLNLILCVLVTLLCVSPRIQEGNSRSGLSQASIVVIY  273

Query  515  CTYLCYSGLVSEPRDYECN  571
            CTYL  S + +EP D ECN
Sbjct  274  CTYLVLSAVANEPNDKECN  292



>ref|NP_001076881.1| serine incorporator 3 precursor [Bos taurus]
 ref|XP_005903246.1| PREDICTED: serine incorporator 3 [Bos mutus]
 ref|XP_010839289.1| PREDICTED: serine incorporator 3 [Bison bison bison]
 sp|A4FUZ5.1|SERC3_BOVIN RecName: Full=Serine incorporator 3 [Bos taurus]
 gb|AAI23502.1| SERINC3 protein [Bos taurus]
 tpg|DAA23205.1| TPA: serine incorporator 3 [Bos taurus]
Length=472

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 109/200 (55%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R+S    +FF   S +M+ VK  KDPR ++H+G W  KI     +++  F++P     + 
Sbjct  99   RISFALAVFFFAFSLLMLNVKTSKDPRAAIHNGFWFFKIAAIVGVMVGSFYIPGGHFNTA  158

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+  F+L+Q+VLL+DF H WN+ WV      N + WY AL  VT + Y+ +  
Sbjct  159  WFVIGMVGAAFFILIQLVLLVDFAHSWNESWVNRMEEGNPKCWYAALLSVTSLFYILSII  218

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F GLL+ ++  P G  C  N FFI   LI     +V+++HP +     +  +  +S+++L
Sbjct  219  FAGLLYTYYTKPDG--CTENKFFISFNLILCVVISVLSIHPKIQEHQPRSGLLQSSLITL  276

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  277  YTMYLTWSAMSNEP-DRSCN  295



>gb|ELR50968.1| Serine incorporator 3 [Bos mutus]
Length=465

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 109/200 (55%), Gaps = 14/200 (7%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLP-NEIVSL  181
            R+S    +FF   S +M+ VK  KDPR ++H+G W  KI     +++  F++P     + 
Sbjct  92   RISFALAVFFFAFSLLMLNVKTSKDPRAAIHNGFWFFKIAAIVGVMVGSFYIPGGHFNTA  151

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+  F+L+Q+VLL+DF H WN+ WV      N + WY AL  VT + Y+ +  
Sbjct  152  WFVIGMVGAAFFILIQLVLLVDFAHSWNESWVNRMEEGNPKCWYAALLSVTSLFYILSII  211

Query  350  FNGLLFHFFA-PSGHECGLNTFFIVMTLIFVFCFAVVTLHPSV-----KGSIFPASVLSL  511
            F GLL+ ++  P G  C  N FFI   LI     +V+++HP +     +  +  +S+++L
Sbjct  212  FAGLLYTYYTKPDG--CTENKFFISFNLILCVVISVLSIHPKIQEHQPRSGLLQSSLITL  269

Query  512  YCTYLCYSGLVSEPRDYECN  571
            Y  YL +S + +EP D  CN
Sbjct  270  YTMYLTWSAMSNEP-DRSCN  288



>ref|XP_007248380.1| PREDICTED: serine incorporator 3-like [Astyanax mexicanus]
Length=480

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 106/202 (52%), Gaps = 12/202 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSL  181
            RV  G  + F   S +MI VKN +DPR +VH+G W  KI     + +  F++P       
Sbjct  100  RVCFGMSVCFLAFSLLMINVKNSRDPRAAVHNGFWFFKIAFIIGVTVGAFYIPEGPFTRT  159

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +      G+ +F+L+Q+V L+DF H WN+ W+      N + WY AL  V  + Y  +  
Sbjct  160  WFVVGMAGAFVFILIQLVFLVDFAHSWNESWMDRMENGNSRTWYCALLSVMGLNYALSIT  219

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVKGS-----IFPASVLSLY  514
               L++ F+  S  ECGLN FFI   +I     +VV++ P V+ S     +  +SV++LY
Sbjct  220  AIVLMYLFYTQS-EECGLNKFFISFNMILCITASVVSILPKVQDSQPRSGLLQSSVITLY  278

Query  515  CTYLCYSGLVSEPRDYECNGFL  580
              YL +S + +EP D  CN  L
Sbjct  279  TMYLTWSAITNEP-DRTCNPRL  299



>gb|EOB03622.1| Serine incorporator 3, partial [Anas platyrhynchos]
Length=406

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 106/202 (52%), Gaps = 12/202 (6%)
 Frame = +2

Query  5    RVSLGNFLFFTTLSFMMIGVKNQKDPRDSVHHGGWMMKICCWFLIVIFMFFLPN-EIVSL  181
            R+S    +FF  LS MMI VK   DPR +VH+G W  KI     I++  F++P       
Sbjct  34   RISFAMAVFFFVLSLMMIAVKTSNDPRAAVHNGFWFFKIAAIVGIMVGAFYIPEGPFTRA  93

Query  182  YETTSKFGSGlfllvqvvllldfvHGWNDKWVGY----NEQFWYIALFVVTLICYVATFA  349
            +     FG+  F+L+Q+VLL+DF H WN+ WV      N + WY AL   T + Y  +  
Sbjct  94   WFVVGIFGAFCFILIQLVLLVDFAHSWNENWVERMEEGNSKCWYAALLSCTSLFYGLSLV  153

Query  350  FNGLLFHFFAPSGHECGLNTFFIVMTLIFVFCFAVVTLHPSVK-----GSIFPASVLSLY  514
            F  +LF+ F     +C  N FFI + +I     ++V++ P V+       +  +S+++LY
Sbjct  154  F-VVLFYVFYTKPEDCAENKFFISINMILCIAVSIVSILPKVQEYQPHSGLLQSSIITLY  212

Query  515  CTYLCYSGLVSEPRDYECNGFL  580
              YL +S + +EP +  CN  L
Sbjct  213  TMYLTWSAMSNEP-ERNCNPSL  233



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1017575415288