BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20273_g1_i3 len=2117 path=[263:0-625 889:626-773 221:774-814
@262@!:815-1286 1507:1287-1295 4687:1296-1313 4713:1314-1325
1545:1326-1349 134:1350-2116]

Length=2117
                                                                      Score     E

ref|XP_009770568.1|  PREDICTED: probable tocopherol cyclase, chlo...    584   0.0      
gb|AIC85301.1|  tocopherol cyclase                                      581   0.0      
ref|XP_011081804.1|  PREDICTED: probable tocopherol cyclase, chlo...    572   0.0      
ref|XP_009604121.1|  PREDICTED: probable tocopherol cyclase, chlo...    576   0.0      
ref|XP_004291189.1|  PREDICTED: tocopherol cyclase, chloroplastic...    566   0.0      
ref|NP_001274927.1|  tocopherol cyclase                                 569   0.0      
emb|CDP16181.1|  unnamed protein product                                566   0.0      
gb|AHH29648.1|  tocopherol cyclase                                      554   0.0      
gb|KDP34191.1|  hypothetical protein JCGZ_07762                         547   0.0      
dbj|BAH10644.1|  tocopherol cyclase                                     549   0.0      Hevea brasiliensis [jebe]
ref|XP_002281424.1|  PREDICTED: tocopherol cyclase, chloroplastic       563   0.0      Vitis vinifera
ref|XP_007012099.1|  Tocopherol cyclase, chloroplast / vitamin E ...    561   0.0      
ref|XP_009367482.1|  PREDICTED: tocopherol cyclase, chloroplastic...    545   0.0      
ref|XP_008393882.1|  PREDICTED: tocopherol cyclase, chloroplastic       545   0.0      
gb|EYU20447.1|  hypothetical protein MIMGU_mgv1a005177mg                558   0.0      
ref|XP_010254049.1|  PREDICTED: probable tocopherol cyclase, chlo...    547   0.0      
ref|XP_003526485.1|  PREDICTED: tocopherol cyclase, chloroplastic...    546   0.0      
ref|XP_009346080.1|  PREDICTED: tocopherol cyclase, chloroplastic...    541   0.0      
gb|KHN10209.1|  Tocopherol cyclase, chloroplastic                       546   0.0      
ref|XP_003522704.1|  PREDICTED: tocopherol cyclase, chloroplastic...    545   0.0      
ref|XP_004245276.1|  PREDICTED: probable tocopherol cyclase, chlo...    547   0.0      
gb|KCW81552.1|  hypothetical protein EUGRSUZ_C02909                     547   0.0      
ref|XP_010049096.1|  PREDICTED: tocopherol cyclase, chloroplastic       546   0.0      
gb|KHN18183.1|  Tocopherol cyclase, chloroplastic                       542   0.0      
ref|XP_007222342.1|  hypothetical protein PRUPE_ppa004789mg             541   0.0      
gb|ADZ24706.1|  tocopherol cyclase                                      546   0.0      
ref|XP_010526175.1|  PREDICTED: tocopherol cyclase, chloroplastic...    552   0.0      
gb|AAP97931.1|  tocopherol cyclase                                      545   0.0      Eucalyptus gunnii
ref|XP_008220061.1|  PREDICTED: tocopherol cyclase, chloroplastic       539   0.0      
gb|ABB52812.1|  tocopherol cyclase                                      556   0.0      Helianthus annuus
ref|XP_007137201.1|  hypothetical protein PHAVU_009G108200g             544   0.0      
ref|XP_006578222.1|  PREDICTED: tocopherol cyclase, chloroplastic...    539   0.0      
gb|ABB52813.1|  tocopherol cyclase                                      554   0.0      Helianthus annuus
gb|KGN62825.1|  Tocopherol cyclase                                      546   0.0      
gb|KEH36047.1|  tocopherol cyclase                                      542   0.0      
ref|XP_002516548.1|  Tocopherol cyclase, chloroplast precursor, p...    535   0.0      Ricinus communis
ref|XP_006371708.1|  hypothetical protein POPTR_0018s00510g             551   0.0      
ref|XP_010668187.1|  PREDICTED: tocopherol cyclase, chloroplastic       544   0.0      
gb|KDO79771.1|  hypothetical protein CISIN_1g011258mg                   532   0.0      
gb|AFK39487.1|  unknown                                                 539   0.0      
ref|XP_011026617.1|  PREDICTED: probable tocopherol cyclase, chlo...    542   0.0      
gb|KHG07989.1|  Tocopherol cyclase, chloroplastic -like protein         536   0.0      
ref|XP_006412433.1|  hypothetical protein EUTSA_v10025006mg             544   0.0      
ref|XP_008445022.1|  PREDICTED: tocopherol cyclase, chloroplastic...    541   0.0      
ref|XP_006450664.1|  hypothetical protein CICLE_v10008169mg             530   0.0      
ref|XP_006476062.1|  PREDICTED: tocopherol cyclase, chloroplastic...    528   0.0      
ref|XP_006283540.1|  hypothetical protein CARUB_v10004591mg             538   0.0      
ref|XP_007012100.1|  Tocopherol cyclase, chloroplast / vitamin E ...    561   0.0      
gb|EPS71540.1|  chloroplast tocopherol cyclase                          543   0.0      
gb|KDO79770.1|  hypothetical protein CISIN_1g011258mg                   523   0.0      
ref|XP_003636442.1|  Tocopherol cyclase                                 529   0.0      
gb|KHF98490.1|  Tocopherol cyclase, chloroplastic -like protein         540   0.0      
gb|AFB74210.1|  tocopherol cyclase                                      532   0.0      
ref|XP_009138143.1|  PREDICTED: tocopherol cyclase, chloroplastic       532   0.0      
emb|CDX72372.1|  BnaC07g43940D                                          528   0.0      
gb|ADC91914.1|  tocopherol cyclase                                      560   0.0      
ref|XP_004501172.1|  PREDICTED: tocopherol cyclase, chloroplastic...    530   0.0      
ref|NP_567906.1|  tocopherol cyclase                                    531   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432668.1|  PREDICTED: tocopherol cyclase, chloroplastic...    529   0.0      
gb|AFB74209.1|  tocopherol cyclase                                      529   0.0      
ref|XP_002869246.1|  hypothetical protein ARALYDRAFT_491430             531   0.0      
gb|KFK29888.1|  hypothetical protein AALP_AA7G191900                    531   0.0      
ref|XP_007137202.1|  hypothetical protein PHAVU_009G108200g             553   0.0      
ref|XP_010437856.1|  PREDICTED: tocopherol cyclase, chloroplastic...    529   0.0      
ref|XP_010447345.1|  PREDICTED: tocopherol cyclase, chloroplastic       528   0.0      
ref|XP_010526177.1|  PREDICTED: tocopherol cyclase, chloroplastic...    552   0.0      
ref|XP_010526174.1|  PREDICTED: tocopherol cyclase, chloroplastic...    554   0.0      
ref|XP_008365124.1|  PREDICTED: tocopherol cyclase, chloroplastic...    551   0.0      
ref|XP_008783245.1|  PREDICTED: probable tocopherol cyclase, chlo...    528   0.0      
ref|XP_004150291.1|  PREDICTED: tocopherol cyclase, chloroplastic...    546   0.0      
ref|XP_010915874.1|  PREDICTED: probable tocopherol cyclase, chlo...    533   0.0      
gb|ACD50891.1|  tocopherol cyclase                                      545   0.0      Phaseolus vulgaris [French bean]
ref|XP_008445023.1|  PREDICTED: tocopherol cyclase, chloroplastic...    541   0.0      
ref|XP_004164041.1|  PREDICTED: tocopherol cyclase, chloroplastic...    507   0.0      
gb|ABE41799.1|  tocopherol cyclase                                      540   0.0      Gossypium hirsutum [American cotton]
ref|NP_001046545.1|  Os02g0276500                                       516   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010915875.1|  PREDICTED: probable tocopherol cyclase, chlo...    533   7e-180   
ref|XP_009413813.1|  PREDICTED: probable tocopherol cyclase, chlo...    533   4e-179   
ref|XP_002453692.1|  hypothetical protein SORBIDRAFT_04g010660          507   3e-178   Sorghum bicolor [broomcorn]
dbj|BAJ93900.1|  predicted protein                                      497   1e-176   
gb|ACN26641.1|  unknown                                                 507   3e-176   Zea mays [maize]
ref|XP_010234137.1|  PREDICTED: probable tocopherol cyclase, chlo...    497   2e-175   
ref|NP_001105015.1|  probable tocopherol cyclase, chloroplastic p...    504   3e-175   Zea mays [maize]
gb|ABE41800.1|  tocopherol cyclase                                      495   9e-174   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006833384.1|  hypothetical protein AMTR_s00109p00113060          494   1e-173   
pir||T04448  hypothetical protein F4D11.30 - Arabidopsis thaliana       490   9e-173
ref|XP_004952221.1|  PREDICTED: probable tocopherol cyclase, chlo...    489   9e-172   
ref|XP_006648539.1|  PREDICTED: probable tocopherol cyclase, chlo...    478   5e-168   
ref|XP_010436708.1|  PREDICTED: tocopherol cyclase, chloroplastic...    497   1e-165   
ref|XP_010100251.1|  hypothetical protein L484_007248                   493   4e-164   
ref|XP_010100249.1|  hypothetical protein L484_007246                   484   6e-161   
ref|XP_010254050.1|  PREDICTED: probable tocopherol cyclase, chlo...    484   2e-160   
gb|ACN26692.1|  unknown                                                 449   1e-158   Zea mays [maize]
ref|XP_008644261.1|  PREDICTED: probable tocopherol cyclase, chlo...    446   6e-158   
gb|EMT18659.1|  hypothetical protein F775_29371                         423   9e-155   
gb|AFW70911.1|  sucrose export defective1                               453   9e-151   
gb|AFW70913.1|  sucrose export defective1                               453   1e-150   
gb|AFW70914.1|  sucrose export defective1                               457   1e-150   
gb|KDO79773.1|  hypothetical protein CISIN_1g011258mg                   379   4e-147   
ref|XP_001770864.1|  predicted protein                                  437   4e-146   
gb|KDO79774.1|  hypothetical protein CISIN_1g011258mg                   362   9e-142   
ref|XP_002971673.1|  hypothetical protein SELMODRAFT_172178             412   9e-133   
ref|XP_001753489.1|  predicted protein                                  399   5e-127   
gb|AFW70915.1|  sucrose export defective1                               336   7e-125   
dbj|BAD21817.1|  putative tocopherol cyclase                            325   2e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002965666.1|  hypothetical protein SELMODRAFT_143592             381   1e-121   
emb|CDP01472.1|  unnamed protein product                                290   2e-117   
ref|XP_005850523.1|  hypothetical protein CHLNCDRAFT_19624              335   2e-107   
ref|WP_009783104.1|  hypothetical protein                               311   3e-95    
ref|WP_007357481.1|  MULTISPECIES: tocopherol cyclase                   311   3e-95    
ref|WP_015172570.1|  tocopherol cyclase                                 309   2e-94    
ref|WP_023068270.1|  tocopherol cyclase family protein                  308   3e-94    
ref|WP_015203162.1|  tocopherol cyclase                                 307   1e-93    
ref|XP_001689451.1|  tocopherol cyclase                                 279   6e-93    Chlamydomonas reinhardtii
ref|XP_005651298.1|  tocopherol cyclase                                 281   7e-93    
ref|WP_015181879.1|  tocopherol cyclase                                 296   3e-92    
ref|WP_036005526.1|  tocopherol cyclase                                 303   3e-92    
ref|WP_026796046.1|  MULTISPECIES: tocopherol cyclase                   301   2e-91    
ref|WP_011611435.1|  tocopherol cyclase                                 300   3e-91    
ref|XP_002956377.1|  hypothetical protein VOLCADRAFT_42287              275   7e-91    
ref|WP_026785239.1|  MULTISPECIES: tocopherol cyclase                   298   2e-90    
gb|KEI67078.1|  tocopherol cyclase                                      298   2e-90    
ref|WP_017742923.1|  hypothetical protein                               294   1e-88    
ref|WP_012597428.1|  hypothetical protein                               294   1e-88    
ref|WP_017315776.1|  tocopherol cyclase                                 293   2e-88    
ref|WP_013320167.1|  hypothetical protein                               293   2e-88    
ref|WP_015139661.1|  hypothetical protein                               293   2e-88    
ref|WP_037216494.1|  tocopherol cyclase                                 293   3e-88    
ref|WP_011319489.1|  tocopherol cyclase                                 292   3e-88    
ref|WP_015178838.1|  tocopherol cyclase                                 293   3e-88    
ref|WP_017716220.1|  hypothetical protein                               292   3e-88    
ref|WP_008181943.1|  tocopherol cyclase                                 292   6e-88    
ref|WP_015200244.1|  tocopherol cyclase                                 292   6e-88    
ref|WP_017300145.1|  hypothetical protein                               291   7e-88    
ref|WP_015189813.1|  tocopherol cyclase                                 291   7e-88    
ref|WP_019491661.1|  tocopherol cyclase                                 290   1e-87    
ref|WP_038081215.1|  tocopherol cyclase                                 291   1e-87    
ref|WP_012628024.1|  tocopherol cyclase                                 290   2e-87    
ref|WP_006634000.1|  hypothetical protein                               287   2e-87    
ref|WP_006097816.1|  hypothetical protein                               284   5e-87    
ref|WP_033375481.1|  tocopherol cyclase                                 289   5e-87    
ref|WP_017652428.1|  tocopherol cyclase                                 288   1e-86    
ref|WP_009633747.1|  hypothetical protein                               288   1e-86    
ref|WP_015150098.1|  hypothetical protein                               280   1e-86    
ref|WP_010994422.1|  hypothetical protein                               288   2e-86    
ref|WP_017322824.1|  tocopherol cyclase                                 287   2e-86    
ref|WP_015129484.1|  tocopherol cyclase                                 288   2e-86    
ref|WP_012406978.1|  hypothetical protein                               287   3e-86    
ref|WP_015112619.1|  tocopherol cyclase                                 287   4e-86    
ref|WP_028082234.1|  tocopherol cyclase                                 285   6e-86    
ref|WP_022604526.1|  tocopherol cyclase                                 286   9e-86    
ref|WP_035985926.1|  tocopherol cyclase                                 286   1e-85    
ref|WP_028089255.1|  tocopherol cyclase                                 285   2e-85    
ref|WP_006197743.1|  hypothetical protein                               285   2e-85    
ref|WP_015153712.1|  tocopherol cyclase                                 285   4e-85    
ref|WP_015217110.1|  tocopherol cyclase                                 284   5e-85    
gb|AFK37256.1|  unknown                                                 186   6e-85    
ref|WP_015211029.1|  tocopherol cyclase                                 285   8e-85    
ref|WP_016950282.1|  tocopherol cyclase                                 279   8e-85    
ref|WP_015078334.1|  hypothetical protein                               276   1e-84    
ref|WP_026732195.1|  tocopherol cyclase                                 283   2e-84    
ref|WP_039715919.1|  tocopherol cyclase                                 281   6e-84    
ref|WP_026097521.1|  tocopherol cyclase                                 281   8e-84    
gb|AFK40450.1|  unknown                                                 182   9e-84    
ref|WP_016874874.1|  tocopherol cyclase                                 281   1e-83    
ref|WP_018397956.1|  hypothetical protein                               279   1e-83    
ref|WP_039743255.1|  tocopherol cyclase                                 277   3e-83    
ref|WP_017310725.1|  tocopherol cyclase                                 278   7e-83    
ref|WP_026721705.1|  tocopherol cyclase                                 278   9e-83    
ref|WP_015116287.1|  tocopherol cyclase                                 277   1e-82    
ref|WP_016863050.1|  tocopherol cyclase                                 277   2e-82    
ref|WP_027402929.1|  tocopherol cyclase                                 277   3e-82    
ref|WP_006276485.1|  hypothetical protein                               277   3e-82    
ref|WP_029634470.1|  tocopherol cyclase [                               272   8e-82    
ref|WP_006621065.1|  MULTISPECIES: hypothetical protein                 271   2e-81    
ref|WP_027844634.1|  tocopherol cyclase                                 275   2e-81    
ref|WP_009556716.1|  tocopherol cyclase                                 274   4e-81    
ref|WP_015229100.1|  hypothetical protein                               273   6e-81    
ref|WP_035153386.1|  tocopherol cyclase                                 273   7e-81    
ref|WP_009343547.1|  hypothetical protein                               273   9e-81    
ref|WP_015141968.1|  hypothetical protein                               272   1e-80    
ref|WP_012162904.1|  tocopherol cyclase                                 273   1e-80    
ref|WP_015227537.1|  tocopherol cyclase                                 272   1e-80    
ref|WP_006616677.1|  tocopherol cyclase                                 268   2e-80    
gb|KFM23407.1|  Tocopherol cyclase, chloroplastic                       248   2e-80    
ref|WP_039778778.1|  tocopherol cyclase                                 272   3e-80    
ref|WP_010468944.1|  tocopherol cyclase                                 272   5e-80    
ref|WP_013192134.1|  hypothetical protein                               270   7e-80    
ref|WP_016871339.1|  tocopherol cyclase                                 267   1e-79    
ref|WP_015194825.1|  tocopherol cyclase                                 269   5e-79    
ref|WP_017286424.1|  hypothetical protein                               266   1e-78    
ref|WP_006527820.1|  hypothetical protein                               265   6e-78    
ref|WP_009455785.1|  tocopherol cyclase                                 261   7e-78    
ref|WP_019505141.1|  hypothetical protein                               262   2e-77    
ref|WP_016868113.1|  tocopherol cyclase                                 259   1e-76    
ref|WP_008274753.1|  hypothetical protein                               256   6e-76    
ref|WP_036534715.1|  tocopherol cyclase                                 258   2e-75    
ref|WP_035823998.1|  tocopherol cyclase                                 254   3e-74    
ref|WP_007303288.1|  hypothetical protein                               253   5e-74    
gb|EHJ15109.1|  2-methyl-6-phytyl-1,4-benzoquinone cyclase              253   5e-74    
ref|WP_012306299.1|  hypothetical protein                               254   6e-74    
ref|WP_021834809.1|  2-methyl-6-phytyl-1,4-benzoquinone cyclase         253   6e-74    
ref|WP_009545153.1|  MULTISPECIES: hypothetical protein                 248   9e-74    
ref|WP_015162192.1|  hypothetical protein                               256   1e-73    
ref|WP_015134317.1|  tocopherol cyclase                                 253   3e-73    
ref|WP_015783472.1|  hypothetical protein                               251   1e-72    
ref|WP_006509396.1|  hypothetical protein                               250   2e-72    
ref|WP_036485872.1|  tocopherol cyclase                                 249   4e-72    
gb|ACY66884.1|  tocopherol cyclase                                      240   2e-71    Linum usitatissimum
ref|WP_012594427.1|  tocopherol cyclase                                 248   3e-71    
ref|WP_030005917.1|  tocopherol cyclase                                 246   5e-71    
ref|WP_029681977.1|  tocopherol cyclase                                 245   2e-70    
ref|WP_023076966.1|  tocopherol cyclase                                 244   4e-70    
ref|WP_039725362.1|  tocopherol cyclase                                 240   1e-68    
ref|XP_002291625.1|  tocopherol cyclase                                 220   5e-67    Thalassiosira pseudonana CCMP1335
ref|WP_008316235.1|  hypothetical protein                               236   6e-67    
ref|WP_006456241.1|  hypothetical protein                               216   8e-67    
ref|WP_023172101.1|  tocopherol cyclase                                 223   2e-62    
ref|XP_002500102.1|  predicted protein                                  197   6e-62    Micromonas commoda
ref|WP_011143082.1|  hypothetical protein                               221   1e-61    
ref|WP_017323971.1|  hypothetical protein                               219   9e-61    
ref|XP_002176411.1|  tocopherol cyclase                                 194   8e-60    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_006382056.1|  hypothetical protein POPTR_0006s25680g             213   1e-59    
ref|WP_002765023.1|  putative tocopherol cyclase                        213   8e-59    
ref|WP_004160609.1|  Similar to tr|Q8Z056|Q8Z056                        213   1e-58    
gb|AIE74217.1|  2-methyl-6-phytyl-1,4-benzoquinone cyclase / 2,3-...    213   2e-58    
ref|WP_002801708.1|  putative tocopherol cyclase                        211   6e-58    
ref|WP_015125967.1|  tocopherol cyclase                                 211   8e-58    
ref|WP_002787665.1|  putative tocopherol cyclase                        211   9e-58    
ref|WP_002756744.1|  putative tocopherol cyclase                        210   1e-57    
ref|WP_002731633.1|  tocopherol cyclase                                 210   2e-57    
ref|WP_002777500.1|  putative tocopherol cyclase                        209   3e-57    
dbj|GAL91741.1|  2-methyl-6-phytyl-1,4-benzoquinone cyclase             209   3e-57    
ref|WP_002796597.1|  putative tocopherol cyclase                        209   3e-57    
ref|WP_002794494.1|  putative tocopherol cyclase                        209   3e-57    
gb|KHN10210.1|  Tocopherol cyclase, chloroplastic                       203   6e-57    
ref|WP_016515207.1|  hypothetical protein                               208   7e-57    
ref|WP_002745745.1|  tocopherol cyclase                                 208   8e-57    
ref|WP_024968777.1|  tocopherol cyclase                                 207   1e-56    
ref|WP_008199571.1|  putative tocopherol cyclase                        207   1e-56    
ref|WP_004158859.1|  putative tocopherol cyclase                        207   2e-56    
ref|WP_012268147.1|  tocopherol cyclase                                 207   2e-56    
gb|EJK48105.1|  hypothetical protein THAOC_33130                        200   3e-56    
emb|CEF96598.1|  Tocopherol cyclase                                     188   3e-54    
ref|WP_010872405.1|  hypothetical protein                               200   7e-54    
ref|XP_003074244.1|  RNA methyltransferase family protein (ISS)         191   3e-53    
ref|WP_019499269.1|  hypothetical protein                               196   9e-53    
ref|WP_011432254.1|  tocopherol cyclase                                 183   5e-52    
ref|WP_011429551.1|  tocopherol cyclase                                 177   5e-49    
ref|XP_005789624.1|  hypothetical protein EMIHUDRAFT_54133              184   2e-48    
dbj|BAM51527.1|  hypothetical protein BEST7613_2596                     178   2e-46    
ref|WP_015169090.1|  hypothetical protein                               169   1e-45    
ref|WP_011429780.1|  tocopherol cyclase                                 174   3e-45    
ref|XP_003057828.1|  predicted protein                                  148   3e-45    
ref|XP_001415456.1|  predicted protein                                  149   4e-44    Ostreococcus lucimarinus CCE9901
ref|XP_009038399.1|  hypothetical protein AURANDRAFT_65060              171   2e-43    
ref|XP_005702972.1|  tocopherol cyclase                                 160   2e-41    
ref|XP_005788015.1|  hypothetical protein EMIHUDRAFT_98577              160   5e-40    
ref|XP_007515274.1|  tocopherol cyclase                                 147   6e-39    
ref|XP_005777723.1|  hypothetical protein EMIHUDRAFT_237937             153   9e-39    
ref|WP_015164335.1|  tocopherol cyclase                                 154   3e-37    
gb|ACN25942.1|  unknown                                                 142   3e-36    Zea mays [maize]
ref|XP_005536930.1|  hypothetical protein, conserved                    152   6e-36    
ref|XP_010100248.1|  hypothetical protein L484_007245                 92.0    3e-18    
ref|XP_010100250.1|  hypothetical protein L484_007247                 91.3    4e-17    
ref|WP_009633749.1|  hypothetical protein                             67.8    6e-10    
ref|WP_008517520.1|  hypothetical protein                             68.9    4e-09    
ref|WP_036419766.1|  hypothetical protein                             65.9    4e-08    
ref|WP_034328322.1|  hypothetical protein                             64.7    9e-08    
ref|WP_021657598.1|  hypothetical protein                             62.0    6e-07    
ref|WP_018205414.1|  hypothetical protein                             60.8    1e-06    
ref|WP_035422594.1|  MULTISPECIES: hypothetical protein               60.8    2e-06    
ref|WP_039678825.1|  hypothetical protein                             60.5    2e-06    
ref|WP_008824925.1|  hypothetical protein                             60.1    2e-06    
gb|EHJ00743.1|  hypothetical protein CDLVIII_4219                     60.1    3e-06    
ref|WP_035302482.1|  hypothetical protein                             60.1    3e-06    
ref|WP_020730537.1|  hypothetical protein                             60.1    3e-06    
ref|WP_020786957.1|  hypothetical protein                             60.1    3e-06    
ref|WP_012395071.1|  MULTISPECIES: hypothetical protein               60.1    3e-06    
ref|WP_006783189.1|  hypothetical protein                             59.7    3e-06    
ref|WP_009607167.1|  hypothetical protein                             59.7    3e-06    
ref|WP_023365290.1|  hypothetical protein                             59.7    4e-06    
gb|EUA89259.1|  tocopherol cyclase family protein                     57.8    6e-06    
ref|WP_027626783.1|  hypothetical protein                             58.9    7e-06    
ref|WP_032119593.1|  hypothetical protein                             58.5    7e-06    
ref|WP_027631373.1|  hypothetical protein                             58.5    8e-06    
ref|WP_007631280.1|  hypothetical protein                             58.5    9e-06    
ref|WP_017835500.1|  hypothetical protein                             58.2    1e-05    
ref|WP_010541329.1|  hypothetical protein                             57.8    2e-05    
ref|WP_036402527.1|  hypothetical protein                             57.4    2e-05    
ref|WP_016623269.1|  hypothetical protein                             56.6    3e-05    
ref|WP_011740636.1|  hypothetical protein                             55.5    7e-05    
ref|WP_007170975.1|  hypothetical protein                             55.5    8e-05    
ref|WP_026901732.1|  hypothetical protein                             55.1    1e-04    
gb|EKF48479.1|  hypothetical protein H17ap60334_11373                 53.1    1e-04    
ref|WP_023388358.1|  hypothetical protein                             54.3    2e-04    
ref|WP_011032471.1|  hypothetical protein                             54.3    2e-04    
ref|WP_019723774.1|  hypothetical protein                             53.9    2e-04    
ref|WP_010734396.1|  hypothetical protein                             53.5    3e-04    
ref|WP_013472326.1|  hypothetical protein                             53.5    3e-04    
ref|WP_011895271.1|  hypothetical protein                             53.5    3e-04    
ref|WP_039636926.1|  hypothetical protein                             53.5    4e-04    
ref|WP_022597557.1|  hypothetical protein                             52.8    6e-04    
ref|WP_005518047.1|  hypothetical protein                             52.8    6e-04    
ref|WP_013417016.1|  hypothetical protein                             52.8    6e-04    
ref|WP_016177674.1|  hypothetical protein                             52.8    6e-04    
ref|WP_012579744.1|  hypothetical protein                             52.8    7e-04    
ref|WP_004029931.1|  hypothetical protein                             52.8    7e-04    
ref|WP_031307239.1|  hypothetical protein                             52.4    8e-04    
gb|EYT48047.1|  hypothetical protein D641_0113395                     52.4    8e-04    



>ref|XP_009770568.1| PREDICTED: probable tocopherol cyclase, chloroplastic [Nicotiana 
sylvestris]
Length=513

 Score =   584 bits (1505),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 306/364 (84%), Gaps = 2/364 (1%)
 Frame = -1

Query  1895  ARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSG  1716
             + F     L+  K   A  V AV+  DS+VE    E +EA+KPVY+ TPSNRPLRTPHSG
Sbjct  48    STFPSTLKLQCQKSRHACVVNAVAGADSSVEMTKQENREAVKPVYSSTPSNRPLRTPHSG  107

Query  1715  YHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQ  1536
             YHFDG+ R+FFEGWFFKVSIPECRQSFC+MYSVENPAF K LS  EE+QYG RFTGVGAQ
Sbjct  108   YHFDGSSRKFFEGWFFKVSIPECRQSFCFMYSVENPAFPKKLSSFEELQYGPRFTGVGAQ  167

Query  1535  ILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQV  1356
             ILG DDKYICQYT ES NFWG RHEL LGNTFIAQ +ARPPNKEVPPQEFN RV+EGFQV
Sbjct  168   ILGPDDKYICQYTQESSNFWGSRHELMLGNTFIAQNSARPPNKEVPPQEFNRRVVEGFQV  227

Query  1355  TPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHW  1176
             TPLWHQG IRDDGRTDY + VKTA WEYSTRPIYGWG+V SKQKSTAGW AAFPVFEPHW
Sbjct  228   TPLWHQGSIRDDGRTDYTEIVKTASWEYSTRPIYGWGDVNSKQKSTAGWPAAFPVFEPHW  287

Query  1175  QVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTS  996
             Q+CMAAGLSTGWIEWDG+RYEF+NAPSYSEKNWG  FPRKWFWVQC+VFEGA G+V+LT+
Sbjct  288   QICMAAGLSTGWIEWDGQRYEFQNAPSYSEKNWGGAFPRKWFWVQCSVFEGAIGDVALTA  347

Query  995   GGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHK  816
             GGGLRQ+  PG S  FENAALI +HYGG+FYEFVPWN S++WEI+ WG W+I  EN TH 
Sbjct  348   GGGLRQL--PGLSQTFENAALIGIHYGGIFYEFVPWNASISWEIAQWGKWHIFGENETHT  405

Query  815   SQVE  804
              ++E
Sbjct  406   VELE  409


 Score =   179 bits (453),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA   DPGTTLRAPT EMGLAP CRDTC++DLRL+LWER+ +GSKGK ILDVTSNMA
Sbjct  406  VELEATAEDPGTTLRAPTDEMGLAPACRDTCFSDLRLRLWERKSNGSKGKVILDVTSNMA  465

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            G+EVGGGPWFNTWKG    PEI+ +A+N PVD++GIFGL P  KPPGL
Sbjct  466  GLEVGGGPWFNTWKGKAQMPEIVTRAINVPVDLDGIFGLTPFLKPPGL  513



>gb|AIC85301.1| tocopherol cyclase [Nicotiana tabacum]
Length=513

 Score =   581 bits (1497),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 273/364 (75%), Positives = 306/364 (84%), Gaps = 2/364 (1%)
 Frame = -1

Query  1895  ARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSG  1716
             + F     L+  K   A  V AV+  DS+VE    E +EA+KPVY+ TPSNRPLRTPHSG
Sbjct  48    STFPSTLKLQCQKSRHACVVNAVAGADSSVEMTKQENREAVKPVYSSTPSNRPLRTPHSG  107

Query  1715  YHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQ  1536
             YHFDG+ R+FFEGWFFKVSIPECRQSFC+MYSVENPAF + LS  EE+QYG RFTGVGAQ
Sbjct  108   YHFDGSSRKFFEGWFFKVSIPECRQSFCFMYSVENPAFPEKLSSFEELQYGPRFTGVGAQ  167

Query  1535  ILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQV  1356
             ILG DDKYICQYT ES NFWG RHEL LGNTFIAQ +ARPPNKEVPPQEFN RV+EGFQV
Sbjct  168   ILGPDDKYICQYTQESSNFWGSRHELMLGNTFIAQNSARPPNKEVPPQEFNRRVVEGFQV  227

Query  1355  TPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHW  1176
             TPLWHQG IRDDGRTDY + VKTA WEYST+PIYGWG+V SKQKSTAGW AAFPVFEPHW
Sbjct  228   TPLWHQGSIRDDGRTDYTEIVKTASWEYSTQPIYGWGDVNSKQKSTAGWPAAFPVFEPHW  287

Query  1175  QVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTS  996
             Q+CMAAGLSTGWIEWDG+RYEF+NAPSYSEKNWG  FPRKWFWVQC+VFEGA G+V+LT+
Sbjct  288   QICMAAGLSTGWIEWDGQRYEFQNAPSYSEKNWGGAFPRKWFWVQCSVFEGAIGDVALTA  347

Query  995   GGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHK  816
             GGGLRQ+  PG S  FENAALI +HYGG+FYEFVPWN S++WEI+ WG W+I  EN TH 
Sbjct  348   GGGLRQL--PGLSQTFENAALIGIHYGGIFYEFVPWNASISWEIAQWGKWHIFGENETHT  405

Query  815   SQVE  804
              ++E
Sbjct  406   VELE  409


 Score =   179 bits (453),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA   DPGTTLRAPT EMGLAP CRDTC++DLRL+LWER+ +GSKGK ILDVTSNMA
Sbjct  406  VELEATAEDPGTTLRAPTDEMGLAPACRDTCFSDLRLRLWERKSNGSKGKVILDVTSNMA  465

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            G+EVGGGPWFNTWKG    PEI+ +A+N PVD++GIFGL P  KPPGL
Sbjct  466  GLEVGGGPWFNTWKGKAQMPEIVTRAINVPVDLDGIFGLTPFLKPPGL  513



>ref|XP_011081804.1| PREDICTED: probable tocopherol cyclase, chloroplastic [Sesamum 
indicum]
 gb|ABW98674.1| chloroplast tocopherol cyclase [Sesamum indicum]
Length=494

 Score =   572 bits (1475),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 280/393 (71%), Positives = 316/393 (80%), Gaps = 12/393 (3%)
 Frame = -1

Query  1958  ESMETLLAC---SSAVSPPTQSYTARFSPRKHLRVGKK-SPAFRVKAVSAPDS----AVE  1803
             ES+  +  C   +S + P   +   +FS    LR GKK    F VK+V   DS     V+
Sbjct  2     ESLAAMANCPCFNSLMIPHKAAARLQFSA-PELRFGKKFRHPFAVKSVFGADSISSSLVD  60

Query  1802  NPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMY  1623
              P  EI   ++PVY PTP NRP+RTPHSGYHFDGT R+FFEGW+FKVSIPECRQSFC+MY
Sbjct  61    EPRKEIVH-VEPVYEPTPPNRPIRTPHSGYHFDGTSRKFFEGWYFKVSIPECRQSFCFMY  119

Query  1622  SVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNT  1443
             SVENPAF K LS +EEVQYG RFTGVGAQILGADDKYICQYT ES+NFWG R EL+LGNT
Sbjct  120   SVENPAFRKKLSTLEEVQYGPRFTGVGAQILGADDKYICQYTEESQNFWGNRDELTLGNT  179

Query  1442  FIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTR  1263
             F+AQ   +PP KE+PPQEFN RV+EGFQVTPLWHQGFIRDDGRT+Y + VKTARW YSTR
Sbjct  180   FVAQEKMQPPKKEIPPQEFNRRVVEGFQVTPLWHQGFIRDDGRTNYTEIVKTARWAYSTR  239

Query  1262  PIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEK  1083
             P+YGWGNVGSKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWD + YEF+NAPSYSEK
Sbjct  240   PVYGWGNVGSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDDKLYEFKNAPSYSEK  299

Query  1082  NWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFY  903
             NWG GFPRKWFWVQCNVFEGADGEV+LT+ GGLRQ+  PG S+ FENAAL  VHY G FY
Sbjct  300   NWGAGFPRKWFWVQCNVFEGADGEVALTAAGGLRQV--PGLSETFENAALFGVHYDGAFY  357

Query  902   EFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
             EFVPWNG V WEI+PWGHW I+AEN  +  ++E
Sbjct  358   EFVPWNGVVNWEIAPWGHWSISAENEMYTVELE  390


 Score =   179 bits (454),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T DPGTTLRAPT E GLAPVC+DTC+ADLRL+LWERRYDGS+GK ILDVTSNMA
Sbjct  387  VELEATTKDPGTTLRAPTTEAGLAPVCKDTCFADLRLRLWERRYDGSEGKVILDVTSNMA  446

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VEVGGGPWF TWKG T  PEI+K+ +  PVD+EG+FGL P  +PPGL
Sbjct  447  AVEVGGGPWFTTWKGKTQTPEIIKRVVGLPVDVEGMFGLAPFLRPPGL  494



>ref|XP_009604121.1| PREDICTED: probable tocopherol cyclase, chloroplastic [Nicotiana 
tomentosiformis]
Length=513

 Score =   576 bits (1484),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 271/362 (75%), Positives = 302/362 (83%), Gaps = 2/362 (1%)
 Frame = -1

Query  1889  FSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYH  1710
             FS    L+  K   A  VKAV+  DS+VE    E +E +KP+Y+ TPSNRPLRTPHSGYH
Sbjct  50    FSSTLKLQCQKSRHACVVKAVAGADSSVEMIKEENREVVKPIYSSTPSNRPLRTPHSGYH  109

Query  1709  FDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQIL  1530
             FDG+ R+ FEGWFFKVSIPECRQSFC+MYSVENPAF K LS  EE+QYG RFTGVGAQIL
Sbjct  110   FDGSSRKLFEGWFFKVSIPECRQSFCFMYSVENPAFPKKLSSFEELQYGPRFTGVGAQIL  169

Query  1529  GADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTP  1350
             G DDKYICQYT ES NFWG RHEL LGNTFI Q +AR P KEVPPQEFN RV+EGFQVTP
Sbjct  170   GPDDKYICQYTQESSNFWGSRHELMLGNTFITQNSARSPKKEVPPQEFNRRVVEGFQVTP  229

Query  1349  LWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQV  1170
             LWHQG IRDDGRTDY + VKTA WEYSTRPIYGWG+V SKQKSTAGW AAFPVFEPHWQ+
Sbjct  230   LWHQGSIRDDGRTDYTEIVKTASWEYSTRPIYGWGDVNSKQKSTAGWPAAFPVFEPHWQI  289

Query  1169  CMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGG  990
             CMAAGLSTGWIEWDG+RYEF+NAPSYSEKNWG  FPRKWFWVQC+VFEGA G+V+LT+GG
Sbjct  290   CMAAGLSTGWIEWDGQRYEFQNAPSYSEKNWGGAFPRKWFWVQCSVFEGAIGDVALTAGG  349

Query  989   GLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQ  810
             GLRQ+  PG S  FE+AALI +HYGG+FYEFVPWN SV+WEI+ WG W+I  EN TH  +
Sbjct  350   GLRQL--PGLSQTFESAALIGIHYGGIFYEFVPWNASVSWEIAQWGKWHILGENETHTVE  407

Query  809   VE  804
             +E
Sbjct  408   LE  409


 Score =   174 bits (440),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA   DPGTTLRAPT EMGLAP CRDTC+ DLRLQLWER+ +GSKGK ILDV SNMA
Sbjct  406  VELEATVEDPGTTLRAPTDEMGLAPACRDTCFGDLRLQLWERKSNGSKGKVILDVRSNMA  465

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            G+EVGGGPWFNTWKG    PEI+ +A+N PVD++GIF   P  KPPGL
Sbjct  466  GLEVGGGPWFNTWKGKAQMPEIVTRAINVPVDLDGIFRFTPFLKPPGL  513



>ref|XP_004291189.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=484

 Score =   566 bits (1458),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/360 (74%), Positives = 303/360 (84%), Gaps = 7/360 (2%)
 Frame = -1

Query  1880  RKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDG  1701
             R++L +G     FR  +  +  ++     P    A +PVYTPTP NR LRTPHSGYHFDG
Sbjct  29    RRNLNLG-----FRTNSAVSVSASASKTEPIASSAAEPVYTPTPPNRDLRTPHSGYHFDG  83

Query  1700  TRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGAD  1521
             T R+FFEGW+FKVSIPE RQSFC+MYSVENPAF +PL+G+E  Q+G R TGVGAQILGAD
Sbjct  84    TARKFFEGWYFKVSIPERRQSFCFMYSVENPAFRQPLTGLELAQHGPRTTGVGAQILGAD  143

Query  1520  DKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWH  1341
             DKYICQY+ ESKNFWG RHEL LGNTF+A+  ++PPNKEVPPQEFN RV+EGFQVTPLWH
Sbjct  144   DKYICQYSEESKNFWGSRHELMLGNTFVAEKQSKPPNKEVPPQEFNKRVMEGFQVTPLWH  203

Query  1340  QGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMA  1161
             QGFIRDDGRT+Y +TV+TARWEYSTRPI+GWG+VGSKQK TAGWLAAFPVFEPHWQ+C+A
Sbjct  204   QGFIRDDGRTNYVETVRTARWEYSTRPIFGWGDVGSKQKPTAGWLAAFPVFEPHWQICLA  263

Query  1160  AGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLR  981
              GLSTGWIEWDGERYEF+NAPSYSEKNWG  FPRKWFWVQCNVFEGA GEV+LT+GGGLR
Sbjct  264   GGLSTGWIEWDGERYEFQNAPSYSEKNWGGAFPRKWFWVQCNVFEGATGEVALTAGGGLR  323

Query  980   QIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             QI  PG S+ FENAALI VH+GG FYEFVPWNG VTWEI+ WGHW + AEN TH  ++E 
Sbjct  324   QI--PGLSETFENAALIGVHFGGKFYEFVPWNGVVTWEIATWGHWSMAAENETHMVELEA  381


 Score =   178 bits (451),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -3

Query  783  CEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTS  604
               VELEA T DPGTTLRAPT E GLAP C+DTC+  L+LQ+WERRYDGSKGK ILDV S
Sbjct  374  THMVELEATTEDPGTTLRAPTAEAGLAPACKDTCFGVLKLQMWERRYDGSKGKMILDVKS  433

Query  603  NMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            NMA VEVGGGPWF  WKG TN PE+LK+A+ APVD+EG + LVPLFKPPGL
Sbjct  434  NMAAVEVGGGPWFTAWKGKTNTPELLKRAIRAPVDVEGAYNLVPLFKPPGL  484



>ref|NP_001274927.1| tocopherol cyclase [Solanum tuberosum]
 gb|AAT09809.1| tocopherol cyclase [Solanum tuberosum]
Length=501

 Score =   569 bits (1467),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/352 (76%), Positives = 303/352 (86%), Gaps = 6/352 (2%)
 Frame = -1

Query  1859  KKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFE  1680
             K   AF VKA    DS+V+    E +E +KP+Y+ TPSNRPLRTPHSGYHFDG+ R+FFE
Sbjct  51    KSRHAFVVKA----DSSVDTTKKENREPVKPLYSSTPSNRPLRTPHSGYHFDGSTRKFFE  106

Query  1679  GWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQY  1500
             GWFFKVSIPECRQSFC+MYSVE+P+FTK LS  EE+QYG RFTGVGAQILGADDKYICQY
Sbjct  107   GWFFKVSIPECRQSFCFMYSVESPSFTKKLSSFEELQYGPRFTGVGAQILGADDKYICQY  166

Query  1499  TPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDD  1320
             + ES NFWG RHEL LGNTF+AQ +A+PPNKEV PQEFN RV EGFQVTPLWHQG IRDD
Sbjct  167   SEESSNFWGSRHELMLGNTFVAQNSAKPPNKEVRPQEFNHRVTEGFQVTPLWHQGSIRDD  226

Query  1319  GRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGW  1140
             GRTDY + VKTA WEYSTRPIYGWG+V SKQKSTAGW AAFPVFEPHWQVCMAAGLSTGW
Sbjct  227   GRTDYTEIVKTASWEYSTRPIYGWGDVNSKQKSTAGWPAAFPVFEPHWQVCMAAGLSTGW  286

Query  1139  IEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGT  960
             IEWDG+R+EF+NAPSYSEKNWG  FPRKWFWVQC+VFEGA G+V+LT+GGGLR++  PG 
Sbjct  287   IEWDGQRFEFQNAPSYSEKNWGGSFPRKWFWVQCSVFEGAIGDVALTAGGGLRRL--PGL  344

Query  959   SDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
             ++ FE+ ALI +HYGG+FYEFVPWN SV+WEI+PWG W+I+AEN TH   +E
Sbjct  345   NETFESVALIGIHYGGIFYEFVPWNASVSWEITPWGKWHISAENETHMVLLE  396


 Score =   168 bits (426),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              V LEA T DPGTTLRAPT+EMGLAP CRDTC+ +LRLQLWER+ +GSKG+ ILDVTSN
Sbjct  391  HMVLLEATTEDPGTTLRAPTEEMGLAPACRDTCFGELRLQLWERKSNGSKGEVILDVTSN  450

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVP-LFKPPGL  451
            MAG+EVGGGPWFNTW+G    PEI+ +A+N PVD++GIF  VP L KPPGL
Sbjct  451  MAGLEVGGGPWFNTWEGKAEMPEIVTRAINVPVDLDGIFSCVPSLLKPPGL  501



>emb|CDP16181.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   566 bits (1460),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/328 (79%), Positives = 290/328 (88%), Gaps = 2/328 (1%)
 Frame = -1

Query  1790  EIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVEN  1611
             E   A+ PVY PTPSNRPLRTPHSGYHFDG+ R+FFEGW+FKVSIPECRQSFC+MYSVEN
Sbjct  79    ESAAAVNPVYKPTPSNRPLRTPHSGYHFDGSARKFFEGWYFKVSIPECRQSFCFMYSVEN  138

Query  1610  PAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQ  1431
             PAF+K LS +E +QYG RFTGVGAQILGADDKYICQYT +S NFWG RHEL LGNTF A+
Sbjct  139   PAFSKKLSTLEVLQYGPRFTGVGAQILGADDKYICQYTEDSPNFWGSRHELMLGNTFSAK  198

Query  1430  TAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYG  1251
                +PP+KEVPPQEF+ RVLEGFQVTPLWHQGFIR+DGRT Y +TVKTARW YSTRPIYG
Sbjct  199   KNMQPPSKEVPPQEFDQRVLEGFQVTPLWHQGFIRNDGRTSYVETVKTARWGYSTRPIYG  258

Query  1250  WGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGD  1071
             WGNV SKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EFENAPSYSEKNWG 
Sbjct  259   WGNVDSKQKSTAGWLAAFPVFEPHWQMCMAGGLSTGWIEWDGERFEFENAPSYSEKNWGG  318

Query  1070  GFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVP  891
             GFPR+WFWVQCNVFEGA G+++LT+ GGLRQ+  PG SD FENAALI VHY GVFYEFVP
Sbjct  319   GFPRRWFWVQCNVFEGASGDIALTAAGGLRQL--PGLSDTFENAALIGVHYRGVFYEFVP  376

Query  890   WNGSVTWEISPWGHWYITAENATHKSQV  807
             WNG V WE+S WG+W+++AEN THK ++
Sbjct  377   WNGVVKWEVSQWGYWFMSAENKTHKVEL  404


 Score =   163 bits (412),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +VEL A T DPGTTLRAPT E G A  C+DTC A+LRLQLW+RR DGSKG  ILDVTSN
Sbjct  400  HKVELVATTKDPGTTLRAPTSEAGFASACKDTCSAELRLQLWDRRSDGSKGNIILDVTSN  459

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VEVGGGPWF+ WKG TNAPE + +AL+ PVD+EG+   VPL KPPGL
Sbjct  460  MAAVEVGGGPWFSPWKGQTNAPEFVSRALSLPVDVEGLLDSVPLLKPPGL  509



>gb|AHH29648.1| tocopherol cyclase, partial [Juglans regia]
Length=450

 Score =   554 bits (1428),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/329 (77%), Positives = 287/329 (87%), Gaps = 2/329 (1%)
 Frame = -1

Query  1790  EIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVEN  1611
             E   ++ P Y PTP NR LRTPHSGYHFDG+ R+FFEGW+FKVSIPE RQSFC+MYSVEN
Sbjct  20    ESSGSVSPAYVPTPPNRELRTPHSGYHFDGSARKFFEGWYFKVSIPERRQSFCFMYSVEN  79

Query  1610  PAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQ  1431
             PAF K L+ +E  Q G RFTGVGAQILGA+DKYICQY+ ES+ FWG RHEL LGNTF+ +
Sbjct  80    PAFPKKLTALEVAQRGPRFTGVGAQILGANDKYICQYSEESQYFWGSRHELILGNTFVGE  139

Query  1430  TAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYG  1251
               ++PP KEVPPQEFN RVLEGFQV+PLWHQGFIRDDGR++Y  TVKTARWEYSTRPIYG
Sbjct  140   KESKPPYKEVPPQEFNKRVLEGFQVSPLWHQGFIRDDGRSNYVDTVKTARWEYSTRPIYG  199

Query  1250  WGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGD  1071
             WGNVGSKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EF+NAPSYSEKNWG 
Sbjct  200   WGNVGSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFQNAPSYSEKNWGG  259

Query  1070  GFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVP  891
              FPRKWFWVQCNVFEGA G+V+LT+GGGLRQ+  PG ++NFENAAL+ VHY G+FYEFVP
Sbjct  260   AFPRKWFWVQCNVFEGATGDVALTAGGGLRQL--PGLTENFENAALVGVHYNGIFYEFVP  317

Query  890   WNGSVTWEISPWGHWYITAENATHKSQVE  804
             WNG V WEI+PWGHWY+ AEN THK ++E
Sbjct  318   WNGVVNWEIAPWGHWYMAAENRTHKVELE  346


 Score =   174 bits (442),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +VELEA T D GTTLRAPT E GLAP C+D+C+  LRL+LWE+RYDGSKGK ILDVTSN
Sbjct  341  HKVELEATTKDTGTTLRAPTAESGLAPACKDSCFGVLRLRLWEKRYDGSKGKIILDVTSN  400

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VEVGGGPWFN WKG T+ PE+L QA+  PVD+EGIF  VP FKPPGL
Sbjct  401  MAAVEVGGGPWFNAWKGVTSTPELLSQAIGVPVDVEGIFNYVPFFKPPGL  450



>gb|KDP34191.1| hypothetical protein JCGZ_07762 [Jatropha curcas]
Length=501

 Score =   547 bits (1410),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 252/338 (75%), Positives = 291/338 (86%), Gaps = 2/338 (1%)
 Frame = -1

Query  1814  SAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSF  1635
             ++V NP  E   ++ PVY PTP NR LRTPHSGYHFDGT RQFFEGW+FKVSIPE +QSF
Sbjct  63    NSVTNPETEFLSSVSPVYAPTPPNRELRTPHSGYHFDGTTRQFFEGWYFKVSIPERKQSF  122

Query  1634  CYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELS  1455
             C+MYS+ENPAF K L+  E  Q+G R TGVGAQILGA DKYICQ+  ES+NFWG RHEL 
Sbjct  123   CFMYSLENPAFRKKLTPFEVAQHGPRSTGVGAQILGAYDKYICQHVEESQNFWGNRHELV  182

Query  1454  LGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWE  1275
             LGNTF+A+   +PP KEVPPQ+F+ RV EGFQVTPLWHQGFIRDDGR+DY +TVKTARWE
Sbjct  183   LGNTFVAEKGMQPPTKEVPPQDFSRRVSEGFQVTPLWHQGFIRDDGRSDYVQTVKTARWE  242

Query  1274  YSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPS  1095
             YSTRP+YGWG+VGSKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EF++APS
Sbjct  243   YSTRPVYGWGDVGSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFKDAPS  302

Query  1094  YSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYG  915
             YSEKNWG GFPRKWFWVQCNVFEGA GEV+LT+ GGLRQ+  PG ++NFE+AALI VHY 
Sbjct  303   YSEKNWGAGFPRKWFWVQCNVFEGAIGEVALTAAGGLRQL--PGLTENFESAALIGVHYE  360

Query  914   GVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             G+FYEFVPWNG + WEISPWG+W+ITAEN +H  +++ 
Sbjct  361   GIFYEFVPWNGVLNWEISPWGYWFITAENKSHLVELKA  398


 Score =   181 bits (459),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VEL+A T DPGTTLRAPT E G AP C+DTC+ DL+LQ+WERRYDG+KGK ILDVTS+MA
Sbjct  394  VELKATTKDPGTTLRAPTTESGFAPACKDTCFGDLKLQIWERRYDGTKGKMILDVTSDMA  453

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VEVGGGPWFNTWKG T  PE+L +ALN PVD+EGIF  +PLFKPPGL
Sbjct  454  AVEVGGGPWFNTWKGKTTTPELLNRALNVPVDVEGIFNFLPLFKPPGL  501



>dbj|BAH10644.1| tocopherol cyclase [Hevea brasiliensis]
Length=508

 Score =   549 bits (1414),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/362 (72%), Positives = 298/362 (82%), Gaps = 6/362 (2%)
 Frame = -1

Query  1877  KHLRVGKKSPAFRVKAVSA----PDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYH  1710
             + L+VG +S   R+   ++      S VE    E   +  PVY  TP NR LRTPHSGYH
Sbjct  45    RSLQVGFRSSRSRLLVSNSVTDRQTSTVERGGTEGVASASPVYVATPPNRELRTPHSGYH  104

Query  1709  FDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQIL  1530
             FDGT RQFFEGW+FKVSIPE ++SFC+MYSVENPAF K LS +E  Q+G R TGVGAQIL
Sbjct  105   FDGTTRQFFEGWYFKVSIPERKESFCFMYSVENPAFRKKLSPLEVAQHGPRSTGVGAQIL  164

Query  1529  GADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTP  1350
             GA DKYICQY+ ES+NFWG RHEL LGNTF+A+   +PP+KEVPPQEFN  V EGFQVTP
Sbjct  165   GASDKYICQYSEESQNFWGSRHELMLGNTFVAEKGMQPPSKEVPPQEFNRMVSEGFQVTP  224

Query  1349  LWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQV  1170
             LW+QGFIRDDGR+DY KTVKTARWEYSTRP+YGWGNVGSKQ+STAGWLAAFPVFEPHWQ+
Sbjct  225   LWNQGFIRDDGRSDYVKTVKTARWEYSTRPVYGWGNVGSKQQSTAGWLAAFPVFEPHWQI  284

Query  1169  CMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGG  990
             CMAAGLSTGWIEWDGER+EF++APSYSEKNWG GFPRKWFW QCN FEGA GEV+LT GG
Sbjct  285   CMAAGLSTGWIEWDGERFEFKDAPSYSEKNWGGGFPRKWFWAQCNTFEGASGEVALTVGG  344

Query  989   GLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQ  810
             GLRQ+  PG ++ FENAALI VHY G+FYEFVPW G VTWEISPWG+W++TAEN TH  +
Sbjct  345   GLRQL--PGLTETFENAALIGVHYDGIFYEFVPWKGVVTWEISPWGYWFVTAENETHLVE  402

Query  809   VE  804
             +E
Sbjct  403   LE  404


 Score =   177 bits (448),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T DPGTTLRAPT E GLAP C+DTCY  L+L+LWERRYDGSKGK ILDVTS+MA
Sbjct  401  VELEATTKDPGTTLRAPTTEAGLAPACKDTCYGVLKLKLWERRYDGSKGKIILDVTSDMA  460

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VEVGGGPWFNTWKG T  PE+L +AL  P+D++GIF  +PLFKPPGL
Sbjct  461  AVEVGGGPWFNTWKGKTTTPELLSRALRVPLDVDGIFNFLPLFKPPGL  508



>ref|XP_002281424.1| PREDICTED: tocopherol cyclase, chloroplastic [Vitis vinifera]
 emb|CBI20869.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   563 bits (1451),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/359 (74%), Positives = 302/359 (84%), Gaps = 6/359 (2%)
 Frame = -1

Query  1871  LRVGKKSPAFRVKAVSAPD----SAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFD  1704
             LR+ + S  F + + S  +    SA E+   E   ++ P+Y PTPSNR LRTPHSGYHFD
Sbjct  41    LRLRRSSQIFALNSTSTSEGNRSSAAESGETESLGSVSPIYVPTPSNRELRTPHSGYHFD  100

Query  1703  GTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGA  1524
             G+ RQFFEGW+FKVSIPE +QSFC+MYSVENPAF K L   EE+QYG RFTGVGAQILGA
Sbjct  101   GSPRQFFEGWYFKVSIPEQKQSFCFMYSVENPAFQKKLGTFEELQYGPRFTGVGAQILGA  160

Query  1523  DDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLW  1344
             DDKYICQ++ ES NFWG RHEL LG+TF+ +   RPPNKEVPP+EFN RV+EGFQVTPLW
Sbjct  161   DDKYICQFSEESTNFWGCRHELMLGHTFVGRKDLRPPNKEVPPEEFNRRVIEGFQVTPLW  220

Query  1343  HQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCM  1164
             HQGFIRDDGR++Y  TVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQ+CM
Sbjct  221   HQGFIRDDGRSNYVDTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQICM  280

Query  1163  AAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGL  984
             A GLSTGWIEWDGERYEFENAPSYSEKNWG GFPRKWFWVQCN FEGADGEVSLT+ GGL
Sbjct  281   AGGLSTGWIEWDGERYEFENAPSYSEKNWGGGFPRKWFWVQCNAFEGADGEVSLTAAGGL  340

Query  983   RQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQV  807
             R+I  PG ++ FENAAL+ VHY G+FYEFVPWNG V+WEI+ WG+WYI+AEN +H  ++
Sbjct  341   RKI--PGLTEVFENAALVGVHYDGIFYEFVPWNGVVSWEINQWGYWYISAENESHMVEL  397


 Score =   162 bits (411),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  783  CEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTS  604
               VEL A T DPGTTLRAPT E GLAP C+D C   L+LQ+W+R ++GSKGK ILDVTS
Sbjct  392  SHMVELVATTKDPGTTLRAPTTEAGLAPACKDNCSGALKLQIWKRTFNGSKGKMILDVTS  451

Query  603  NMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            NMA VEVGGGPWFNTWKG T APE+++ AL  PVD + IFGL P FKPPGL
Sbjct  452  NMAAVEVGGGPWFNTWKGKTAAPELVRLALQVPVDEDAIFGLAPFFKPPGL  502



>ref|XP_007012099.1| Tocopherol cyclase, chloroplast / vitamin E deficient 1 (VTE1) 
/ sucrose export defective 1 (SXD1) isoform 1 [Theobroma cacao]
 gb|EOY29718.1| Tocopherol cyclase, chloroplast / vitamin E deficient 1 (VTE1) 
/ sucrose export defective 1 (SXD1) isoform 1 [Theobroma cacao]
Length=509

 Score =   561 bits (1447),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 270/393 (69%), Positives = 315/393 (80%), Gaps = 8/393 (2%)
 Frame = -1

Query  1964  CCESMETLLACSSAVSPPTQSYTARFSPR--KHLRVGKKSPA--FRVKAVSAPDSAVENP  1797
             CC     L +  +     + ++   FSPR  + LRVG +S +      +V+ P++   +P
Sbjct  17    CCIGFRPLNSKPTVKFSQSSTFNG-FSPRGLRPLRVGFRSNSRIIACSSVAEPETGTSSP  75

Query  1796  APEIKE-AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYS  1620
             A E    ++ PVY PTP+NR  RTPHSGYHFDGT RQFFEGW+FKV+IPE RQSFC+MYS
Sbjct  76    AAESSAVSVNPVYVPTPANRNARTPHSGYHFDGTTRQFFEGWYFKVAIPEQRQSFCFMYS  135

Query  1619  VENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTF  1440
             VENPAF + L+ +E +Q+G RFTGVGAQILGA DKYICQYT ES+NFWG RHEL LGNTF
Sbjct  136   VENPAFRRKLTPLEMLQHGPRFTGVGAQILGAYDKYICQYTEESQNFWGSRHELILGNTF  195

Query  1439  IAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRP  1260
             +A   +RPP+KEVPPQEFN +VLEGFQV+PLWHQGFIRDDGRT YA  VKTARWEYSTRP
Sbjct  196   LANKDSRPPSKEVPPQEFNRKVLEGFQVSPLWHQGFIRDDGRTTYANIVKTARWEYSTRP  255

Query  1259  IYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKN  1080
             IYGWGNVGSKQKSTAGWLAA P+FEPHWQ+CMA GLSTGWIEWD ER+EF+NAPSYSEKN
Sbjct  256   IYGWGNVGSKQKSTAGWLAALPIFEPHWQICMAGGLSTGWIEWDSERFEFQNAPSYSEKN  315

Query  1079  WGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYE  900
             WG GFPRKWFW QCNVFEGA GEVSLT+GGGLRQ+  PG ++ FENAALI VHY GVFYE
Sbjct  316   WGGGFPRKWFWAQCNVFEGASGEVSLTAGGGLRQL--PGLTETFENAALIGVHYDGVFYE  373

Query  899   FVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             FVPWNG V+WEI+ WG WY+ A+N TH +++E 
Sbjct  374   FVPWNGVVSWEIAQWGSWYMEAKNETHMAELEA  406


 Score =   164 bits (414),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
               ELEA T+DPGTTLRAPT   GLAP C+DTC+ DLRL++WE++  G+KGK ILDV S+
Sbjct  400  HMAELEATTNDPGTTLRAPTTVAGLAPACKDTCFGDLRLKIWEKKSGGTKGKLILDVKSD  459

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWKG T  PE++K AL   VD+EGIFGL P FKPPGL
Sbjct  460  MAALEVGGGPWFNTWKGETTTPEVIKNALQVDVDVEGIFGLAPFFKPPGL  509



>ref|XP_009367482.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009367893.1| PREDICTED: tocopherol cyclase, chloroplastic [Pyrus x bretschneideri]
Length=486

 Score =   545 bits (1403),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 252/328 (77%), Positives = 285/328 (87%), Gaps = 2/328 (1%)
 Frame = -1

Query  1784  KEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPA  1605
             K A    Y PTP +R LRTPHSGYHFDGT R+FFEGW+FKV+IPE RQSFC+MYSVENPA
Sbjct  58    KAAASSAYVPTPQSRDLRTPHSGYHFDGTTRKFFEGWYFKVTIPERRQSFCFMYSVENPA  117

Query  1604  FTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTA  1425
             F KPL+ +E  Q G+R+TGVGAQILGA DKYICQY+ ES+NFWG R EL LGNTFIA+  
Sbjct  118   FQKPLTALELAQNGQRWTGVGAQILGAYDKYICQYSEESQNFWGSREELMLGNTFIAEKQ  177

Query  1424  ARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWG  1245
              +PPNKEVPP+EF+SRV+EGFQVTPLWHQG IRDDGR+DY +TV TARWEYSTRPIYGWG
Sbjct  178   LKPPNKEVPPKEFDSRVVEGFQVTPLWHQGSIRDDGRSDYVETVPTARWEYSTRPIYGWG  237

Query  1244  NVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGF  1065
             +VGSKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EFE+APSYSEKNWG  F
Sbjct  238   DVGSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFEDAPSYSEKNWGGAF  297

Query  1064  PRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWN  885
             PRKWFWVQCNVFEGA GE++LTSGGGLRQ+  PG ++ FENAALI VHYGG FYEFVPWN
Sbjct  298   PRKWFWVQCNVFEGATGEIALTSGGGLRQL--PGLTETFENAALIGVHYGGKFYEFVPWN  355

Query  884   GSVTWEISPWGHWYITAENATHKSQVEV  801
             G V+WE++PWG+W I AEN TH  ++E 
Sbjct  356   GIVSWEVAPWGYWSIAAENETHMVELEA  383


 Score =   180 bits (457),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -3

Query  783  CEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTS  604
               VELEA T DPGTTLRAPT E GLAP C+DTC+ DL+L++WERRYDGSKGK ILDVTS
Sbjct  376  THMVELEATTEDPGTTLRAPTSEAGLAPACKDTCFGDLKLKMWERRYDGSKGKMILDVTS  435

Query  603  NMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            NMA VEVGGGPWFNTWKG T  PE+L +AL  PVD+EG++ LVPL KPPGL
Sbjct  436  NMAAVEVGGGPWFNTWKGKTTTPELLSRALRVPVDVEGVYNLVPLLKPPGL  486



>ref|XP_008393882.1| PREDICTED: tocopherol cyclase, chloroplastic [Malus domestica]
Length=486

 Score =   545 bits (1404),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 253/328 (77%), Positives = 285/328 (87%), Gaps = 2/328 (1%)
 Frame = -1

Query  1784  KEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPA  1605
             K A   VY PTP +R LRTPHSGYHFDGT R+FFEGW+FKVSIPE RQSFC+MYSVENPA
Sbjct  58    KAAASSVYVPTPQSRDLRTPHSGYHFDGTTRKFFEGWYFKVSIPERRQSFCFMYSVENPA  117

Query  1604  FTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTA  1425
             F KPL+ +E  Q G+R TGVGAQILGA DKYICQY+ ES+NFWG R EL LGNTFIA+  
Sbjct  118   FQKPLTALELAQNGQRSTGVGAQILGAYDKYICQYSEESQNFWGSREELMLGNTFIAEKQ  177

Query  1424  ARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWG  1245
             ++PPNKEVPP+EF+SRV EGFQVTPLWHQG IRDDGR+DY +TV TARWEYSTRPIYGWG
Sbjct  178   SKPPNKEVPPKEFDSRVXEGFQVTPLWHQGSIRDDGRSDYVETVPTARWEYSTRPIYGWG  237

Query  1244  NVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGF  1065
             +VGSKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EFE+APSYSEKNWG  F
Sbjct  238   DVGSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFEDAPSYSEKNWGGAF  297

Query  1064  PRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWN  885
             PRKWFWVQCNVFEGA GEV+LT+GGGLRQ+  PG ++ FENAALI VHYGG FYEFVPWN
Sbjct  298   PRKWFWVQCNVFEGATGEVALTAGGGLRQL--PGLTETFENAALIGVHYGGKFYEFVPWN  355

Query  884   GSVTWEISPWGHWYITAENATHKSQVEV  801
             G V+WE++PWG+W I AEN T+  ++E 
Sbjct  356   GLVSWEVAPWGYWSIVAENETYMVELEA  383


 Score =   179 bits (454),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T DPGTTLRAPT E GLAP C+DTC+ DL+L++WERRYDGSKGK ILDVTSNMA
Sbjct  379  VELEATTEDPGTTLRAPTSEAGLAPACKDTCFGDLKLKMWERRYDGSKGKMILDVTSNMA  438

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VEVGGGPWF+TWKG T  PE+L +AL  PVD+EG++ LVPL KPPGL
Sbjct  439  AVEVGGGPWFSTWKGKTTTPELLSRALRVPVDVEGVYNLVPLLKPPGL  486



>gb|EYU20447.1| hypothetical protein MIMGU_mgv1a005177mg [Erythranthe guttata]
Length=494

 Score =   558 bits (1439),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 271/396 (68%), Positives = 309/396 (78%), Gaps = 8/396 (2%)
 Frame = -1

Query  1979  VRRRCCCESMETLLACSSAVSPPTQSYTARFSPRKHLRVGKKSP-AFRVKAVSA--PDSA  1809
             +   C   +   L  CS  + P  +     FSP + LR  KKS   F VK+V    P  +
Sbjct  1     MENLCTIATNPCLNPCSFPLKPAARP---PFSPPELLRPRKKSHRPFAVKSVLKYDPLDS  57

Query  1808  VENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCY  1629
             + N A      + PVY PTP NRPLRTPHSGYHFDGT R+FFEGW+FKVSIPECRQSFC+
Sbjct  58    IANDAGNHVLNVDPVYEPTPRNRPLRTPHSGYHFDGTSRKFFEGWYFKVSIPECRQSFCF  117

Query  1628  MYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLG  1449
             MYS+E+P+F K L+ +E  QYG RFTGVGAQILGA DKYICQY   S+NFW  R EL LG
Sbjct  118   MYSIESPSFPKKLTALETAQYGPRFTGVGAQILGAGDKYICQYNEGSRNFWANRDELMLG  177

Query  1448  NTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYS  1269
             NTF+ +T  +PP KE+PPQEFN RV EGFQVTPLWHQG IRDDGRT+YA+TVKTARW YS
Sbjct  178   NTFVGKTNTKPPKKEIPPQEFNQRVTEGFQVTPLWHQGSIRDDGRTNYAETVKTARWAYS  237

Query  1268  TRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYS  1089
             TRP+YGWG+VGSKQKSTAGWLAAFPVFEPHWQVCMA GLSTGWIEWD +RYEF++APSY 
Sbjct  238   TRPVYGWGDVGSKQKSTAGWLAAFPVFEPHWQVCMAGGLSTGWIEWDDKRYEFKDAPSYC  297

Query  1088  EKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGV  909
             EKNWG  FPRKWFWVQCNVFEGADGEV+LTSGGGLRQI  PG ++ FENAA+I VHYGGV
Sbjct  298   EKNWGGAFPRKWFWVQCNVFEGADGEVALTSGGGLRQI--PGLTETFENAAMIGVHYGGV  355

Query  908   FYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             FYEF PWNG V WE++ WGHW+ITAEN TH  ++E 
Sbjct  356   FYEFAPWNGVVNWEVAQWGHWFITAENETHTVELEA  391


 Score =   164 bits (414),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA+T DPGTTLRAPT E GLAP C+DTC+ADLRL++W ++ +G++GK ILDVTS MA
Sbjct  387  VELEAKTKDPGTTLRAPTSEAGLAPACKDTCFADLRLRIWVKQNNGTQGKVILDVTSKMA  446

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VEVGGGPWF+TWKG T+ PEI+ + +  P+D+EG+FG  P FKPPGL
Sbjct  447  AVEVGGGPWFSTWKGKTSTPEIINRVVGLPIDVEGLFGFAPFFKPPGL  494



>ref|XP_010254049.1| PREDICTED: probable tocopherol cyclase, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=523

 Score =   547 bits (1409),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/335 (75%), Positives = 282/335 (84%), Gaps = 2/335 (1%)
 Frame = -1

Query  1805  ENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYM  1626
             E    E + ++ PVY PTP NR LRTPHSGYHFDG+ R+FFEGW+FKVSIPE RQSFC+M
Sbjct  88    EKQETESRASLNPVYKPTPLNRELRTPHSGYHFDGSARRFFEGWYFKVSIPERRQSFCFM  147

Query  1625  YSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGN  1446
             YSVENPAF K L  +EE  YGRRFTGVGAQILGADDKYICQY+ ES+ FWG RHEL LGN
Sbjct  148   YSVENPAFRKKLGPLEEAAYGRRFTGVGAQILGADDKYICQYSQESQYFWGSRHELMLGN  207

Query  1445  TFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYST  1266
             TF       PPNKE PPQEF+ RVLEGFQVTPLWHQGFIRDDGR+ Y +TV TARWEYST
Sbjct  208   TFTVGKNLPPPNKETPPQEFHGRVLEGFQVTPLWHQGFIRDDGRSTYVQTVTTARWEYST  267

Query  1265  RPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSE  1086
             RP+YGWG+VGSKQ STAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EFENAPSYSE
Sbjct  268   RPVYGWGDVGSKQNSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFENAPSYSE  327

Query  1085  KNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVF  906
             KNWG  FPRKWFWVQCNVF+GA GEV+LT+ GGLR++  PG +D FENAAL+ +HY G F
Sbjct  328   KNWGAAFPRKWFWVQCNVFQGASGEVALTAAGGLREL--PGLADTFENAALVGIHYSGKF  385

Query  905   YEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             YEFVPWNG V WEI+PWG+W ++AEN THK ++E 
Sbjct  386   YEFVPWNGVVNWEIAPWGYWQMSAENETHKVELEA  420


 Score =   174 bits (440),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +VELEA T DPGTTLRAPT+E GLAP C+DTC+ DLRL++ E+R+DGS+GK ILDVTSN
Sbjct  414  HKVELEATTKDPGTTLRAPTKEAGLAPACKDTCFGDLRLRMSEKRHDGSEGKIILDVTSN  473

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWKG T+ PEIL QAL  PVD+EGI G VP+ +PPGL
Sbjct  474  MAALEVGGGPWFNTWKGKTSTPEILSQALRVPVDVEGILGFVPIIRPPGL  523



>ref|XP_003526485.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Glycine max]
Length=480

 Score =   546 bits (1407),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/329 (74%), Positives = 290/329 (88%), Gaps = 2/329 (1%)
 Frame = -1

Query  1790  EIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVEN  1611
             ++  ++KP Y+PTP NR LRTPHSGYHFDGT R+FFEGW+FK+SIPE RQSFC+MYSVE+
Sbjct  50    QLVTSVKPTYSPTPPNRHLRTPHSGYHFDGTTRKFFEGWYFKLSIPERRQSFCFMYSVES  109

Query  1610  PAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQ  1431
             P+F KPL+ +E  QYG RFTGVGAQILGADDKYICQ++PES+ FWG RHEL LGNTF+  
Sbjct  110   PSFRKPLTPLEVAQYGSRFTGVGAQILGADDKYICQFSPESQFFWGSRHELMLGNTFVPN  169

Query  1430  TAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYG  1251
               ++PPNKEVPPQEFN RVLEGFQV+PLWHQGFIRDDGR++Y +TVKTARWEYSTRP+YG
Sbjct  170   QNSKPPNKEVPPQEFNDRVLEGFQVSPLWHQGFIRDDGRSNYVETVKTARWEYSTRPVYG  229

Query  1250  WGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGD  1071
             WG+VGS QKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDG+R EF+NAPSYSEKNWG 
Sbjct  230   WGDVGSTQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGKRIEFDNAPSYSEKNWGG  289

Query  1070  GFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVP  891
             GFPRKWFWVQCNVFEGA GE++LT+ GGLRQI  PG ++ FENAALI +HYGG+FYEFVP
Sbjct  290   GFPRKWFWVQCNVFEGASGEIALTAAGGLRQI--PGIAETFENAALIGIHYGGIFYEFVP  347

Query  890   WNGSVTWEISPWGHWYITAENATHKSQVE  804
             WNG V WE++ WG+W+++A+N  +  ++E
Sbjct  348   WNGVVNWEVTTWGYWFMSADNGRYVVEIE  376


 Score =   174 bits (440),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T DPGTTLRAPT E GLAP C+DTC+ DL+LQ+WERRYDGSKGK ILDV+SNMA
Sbjct  373  VEIEATTEDPGTTLRAPTAEAGLAPACKDTCFGDLKLQMWERRYDGSKGKIILDVSSNMA  432

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFNTWKG T+ P  L + L  P+D+EGIF  VPLFKPPGL
Sbjct  433  ALEVGGGPWFNTWKGKTSTPAALSRVLELPIDVEGIFNPVPLFKPPGL  480



>ref|XP_009346080.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009346081.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Pyrus x bretschneideri]
Length=486

 Score =   541 bits (1395),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 253/328 (77%), Positives = 283/328 (86%), Gaps = 2/328 (1%)
 Frame = -1

Query  1784  KEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPA  1605
             K A   VY PTP NR LRTPHSGYHFDGT R+FFEGW+FKV+IPE RQSFC+MYSVENP 
Sbjct  58    KAASTSVYVPTPRNRDLRTPHSGYHFDGTSRKFFEGWYFKVAIPERRQSFCFMYSVENPV  117

Query  1604  FTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTA  1425
             F KPL+ +E VQ G R TGVGAQILGA DKYICQY+ ES+NFWG R EL LGNTFIA+  
Sbjct  118   FRKPLTALELVQNGPRSTGVGAQILGAYDKYICQYSEESQNFWGSRDELMLGNTFIAEKQ  177

Query  1424  ARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWG  1245
             ++PPN EVPP+EF+ RV+EGFQVTPLWHQG I DDGR+DY +TV TARWEYSTRPIYGWG
Sbjct  178   SKPPNNEVPPKEFDGRVIEGFQVTPLWHQGSICDDGRSDYVETVPTARWEYSTRPIYGWG  237

Query  1244  NVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGF  1065
             +VGSKQKSTAGWLAAFPVFEPHWQ+CM+ GLSTGWIEWDGER+EFENAPSYSEKNWG  F
Sbjct  238   DVGSKQKSTAGWLAAFPVFEPHWQICMSGGLSTGWIEWDGERFEFENAPSYSEKNWGGAF  297

Query  1064  PRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWN  885
             PRKWFWVQCNVFEGA GEV+LTSGGGLRQ+  PG +++FENAALI VHYGG FYEFVPWN
Sbjct  298   PRKWFWVQCNVFEGATGEVALTSGGGLRQL--PGLTESFENAALIGVHYGGKFYEFVPWN  355

Query  884   GSVTWEISPWGHWYITAENATHKSQVEV  801
             G V+WEI+PWG+W I AEN TH  ++E 
Sbjct  356   GVVSWEIAPWGYWSIAAENETHMVEIEA  383


 Score =   177 bits (450),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VE+EA T DPGTTLRAPT E GLAP C+DTC+ DL+L++WERRYDG+KGK ILDV+SN
Sbjct  377  HMVEIEATTEDPGTTLRAPTSEAGLAPACKDTCFGDLKLKMWERRYDGNKGKMILDVSSN  436

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VEVGGGPWF+TWKG T  PE+L +AL  PVD+EG++ LVPLFKPPGL
Sbjct  437  MAAVEVGGGPWFSTWKGKTTTPELLSRALRVPVDVEGLYNLVPLFKPPGL  486



>gb|KHN10209.1| Tocopherol cyclase, chloroplastic [Glycine soja]
Length=489

 Score =   546 bits (1406),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/326 (76%), Positives = 287/326 (88%), Gaps = 2/326 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++KP Y+PTP NR LRTPHSGYHFDGT R+FFEGW+FKVSIPE RQSFC+MYSVE+P+F 
Sbjct  63    SVKPTYSPTPPNRDLRTPHSGYHFDGTTRKFFEGWYFKVSIPERRQSFCFMYSVESPSFR  122

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             KPL+ +E  QYG RFTGVGAQILGADDKYICQY+P+S+ FWG RHEL LGNTF++   ++
Sbjct  123   KPLTPLELAQYGPRFTGVGAQILGADDKYICQYSPQSQFFWGSRHELILGNTFVSNQNSK  182

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP KEVPPQEFN RVLEGFQVTPLWHQGFIRDDGR++Y +TVKTARWEYSTRP+YGWG+V
Sbjct  183   PPKKEVPPQEFNDRVLEGFQVTPLWHQGFIRDDGRSNYVETVKTARWEYSTRPVYGWGDV  242

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
             GS QKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER EF+NAPSYSEKNWG GFPR
Sbjct  243   GSTQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERIEFDNAPSYSEKNWGGGFPR  302

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWVQCNVFEGA GE++LT+ GGLRQI  PG ++ FENAALI +HYGG FYEFVPWNG 
Sbjct  303   KWFWVQCNVFEGASGEIALTAAGGLRQI--PGITETFENAALIGIHYGGNFYEFVPWNGV  360

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             V WE++ WG+W+++A+N  +  ++E 
Sbjct  361   VNWEVTTWGYWFMSADNGKYVVELEA  386


 Score =   172 bits (436),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T DPGTTLRAPT E G AP C+DTC+ +L+LQ+WERRYDGSKGK ILDV+SNMA
Sbjct  382  VELEATTEDPGTTLRAPTAEAGFAPACKDTCFGNLKLQMWERRYDGSKGKIILDVSSNMA  441

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFNTWKG T+ P  L + L  P+D+EGIF  VPLFKPPGL
Sbjct  442  ALEVGGGPWFNTWKGKTSTPAALSRVLELPIDVEGIFNPVPLFKPPGL  489



>ref|XP_003522704.1| PREDICTED: tocopherol cyclase, chloroplastic-like isoform X1 
[Glycine max]
Length=489

 Score =   545 bits (1404),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/326 (76%), Positives = 287/326 (88%), Gaps = 2/326 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++KP Y+PT  NR LRTPHSGYHFDGT R+FFEGW+FKVSIPE RQSFC+MYSVE+P+F 
Sbjct  63    SVKPTYSPTLPNRDLRTPHSGYHFDGTTRKFFEGWYFKVSIPERRQSFCFMYSVESPSFR  122

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             KPL+ +E  QYG RFTGVGAQILGADDKYICQY+P+S+ FWG RHEL LGNTF++   ++
Sbjct  123   KPLTPLELAQYGPRFTGVGAQILGADDKYICQYSPQSQFFWGSRHELMLGNTFVSNQNSK  182

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PPNKEVPPQEFN RVLEGFQVTPLWHQGFIRDDGR++Y +TVKTARWEYSTRP+YGWG+V
Sbjct  183   PPNKEVPPQEFNDRVLEGFQVTPLWHQGFIRDDGRSNYVETVKTARWEYSTRPVYGWGDV  242

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
             GS QKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER EF+NAPSYSEKNWG GFPR
Sbjct  243   GSTQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERIEFDNAPSYSEKNWGGGFPR  302

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWVQCNVFEGA GE++LT+ GGLRQI  PG ++ FENAALI +HYGG FYEFVPWNG 
Sbjct  303   KWFWVQCNVFEGASGEIALTAAGGLRQI--PGITETFENAALIGIHYGGNFYEFVPWNGV  360

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             V WE++ WG+W+++A+N  +  ++E 
Sbjct  361   VNWEVTTWGYWFMSADNGKYVVELEA  386


 Score =   172 bits (436),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T DPGTTLRAPT E G AP C+DTC+ +L+LQ+WERRYDGSKGK ILDV+SNMA
Sbjct  382  VELEATTEDPGTTLRAPTAEAGFAPACKDTCFGNLKLQMWERRYDGSKGKIILDVSSNMA  441

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFNTWKG T+ P  L + L  P+D+EGIF  VPLFKPPGL
Sbjct  442  ALEVGGGPWFNTWKGKTSTPAALSRVLELPIDVEGIFNPVPLFKPPGL  489



>ref|XP_004245276.1| PREDICTED: probable tocopherol cyclase, chloroplastic [Solanum 
lycopersicum]
Length=498

 Score =   547 bits (1409),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/356 (75%), Positives = 303/356 (85%), Gaps = 6/356 (2%)
 Frame = -1

Query  1871  LRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRR  1692
             L+  K   AF VKA    DSAV+    E +E +KPVY+ TPSNRPLRTPHSGYHFDG+ R
Sbjct  44    LQSQKSRHAFVVKA----DSAVDTTKKENREPVKPVYSSTPSNRPLRTPHSGYHFDGSTR  99

Query  1691  QFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKY  1512
             +FFEGWFFKVSIPECRQSFC+MYSVE+P+FTK LS +EE+QYG RFTGVGAQILGADDKY
Sbjct  100   KFFEGWFFKVSIPECRQSFCFMYSVESPSFTKKLSSLEELQYGPRFTGVGAQILGADDKY  159

Query  1511  ICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGF  1332
             ICQY+ ES NFWG RHEL LGNTF+AQ +A+PPNKEV PQEFN  V EGFQVTPLWHQG 
Sbjct  160   ICQYSEESSNFWGSRHELMLGNTFVAQNSAKPPNKEVSPQEFNRCVTEGFQVTPLWHQGS  219

Query  1331  IRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGL  1152
             IRDDGRTDY + VKTA WEYSTRPIYGWG+V SKQKSTAGW AAFPVFEPHWQVCMAAGL
Sbjct  220   IRDDGRTDYTEIVKTASWEYSTRPIYGWGDVNSKQKSTAGWPAAFPVFEPHWQVCMAAGL  279

Query  1151  STGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIP  972
             STGWIEWDG+R+EF+NAPSYSEKNWG  FPRKWFWVQC+VFEGA G+V+LT+GGGLR + 
Sbjct  280   STGWIEWDGQRFEFQNAPSYSEKNWGGSFPRKWFWVQCSVFEGAIGDVALTAGGGLRLL-  338

Query  971   GPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
              PG ++ FE+ ALI +HY G+FYEFVPWN SV+WEI+PWG W+I+AEN TH   +E
Sbjct  339   -PGLNETFESVALIGIHYRGIFYEFVPWNASVSWEITPWGKWHISAENETHMVLLE  393


 Score =   170 bits (430),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              V LEA   DPGTTLRAPT+EMGLAP CRDTC+ +LRLQLWER+ +GSKGK ILDVTSN
Sbjct  388  HMVLLEATAEDPGTTLRAPTEEMGLAPACRDTCFGELRLQLWERKSNGSKGKVILDVTSN  447

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVP-LFKPPGL  451
            MAG+EVGGGPWFNTWKG    PEI+ +A+N PVD++GIF  VP L KPPGL
Sbjct  448  MAGLEVGGGPWFNTWKGNAEMPEIVTRAINVPVDLDGIFSCVPSLLKPPGL  498



>gb|KCW81552.1| hypothetical protein EUGRSUZ_C02909 [Eucalyptus grandis]
Length=593

 Score =   547 bits (1409),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 250/322 (78%), Positives = 282/322 (88%), Gaps = 2/322 (1%)
 Frame = -1

Query  1766  VYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLS  1587
             VY PTP NR  RTPHSGYHFD + R+FFEGW+FKVSIPE RQSFC+MYSVENPAF K LS
Sbjct  171   VYVPTPPNRESRTPHSGYHFDRSSRKFFEGWYFKVSIPESRQSFCFMYSVENPAFPKQLS  230

Query  1586  GIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNK  1407
              +E  QYG R+TGVGAQILGADDKYICQ++ ES NFWG RHEL LGNTF+A+  A+PPNK
Sbjct  231   ALEVAQYGPRYTGVGAQILGADDKYICQFSEESANFWGSRHELVLGNTFMAEKDAKPPNK  290

Query  1406  EVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQ  1227
             EVPPQEFN RV EGFQV+PLWHQGFIRDDGR+DY +TVKTARWEYSTRP+YGWGNVGS+Q
Sbjct  291   EVPPQEFNERVAEGFQVSPLWHQGFIRDDGRSDYVETVKTARWEYSTRPVYGWGNVGSQQ  350

Query  1226  KSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFW  1047
             KSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEW+GER+EF++APSYSEKNWG  FPRKWFW
Sbjct  351   KSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWEGERFEFQDAPSYSEKNWGGAFPRKWFW  410

Query  1046  VQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWE  867
             VQCNVFEGA GEV+LT+ GGLRQ+  PG ++ FENAALI VHY G+FYEFVPWNG V+WE
Sbjct  411   VQCNVFEGAKGEVALTAAGGLRQL--PGLTETFENAALIGVHYDGIFYEFVPWNGVVSWE  468

Query  866   ISPWGHWYITAENATHKSQVEV  801
             ++PWG WY+ A+N THK  VE 
Sbjct  469   VAPWGSWYMEADNETHKVVVEA  490


 Score =   169 bits (428),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +V +EA T D GTTLRAPT E GLAP C DTC+ DL+LQ+WERRYDGSKGK ILDVTSN
Sbjct  484  HKVVVEATTKDRGTTLRAPTVEAGLAPACNDTCFGDLKLQIWERRYDGSKGKLILDVTSN  543

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VE+GGGPWF+TWKG T+ PE+L +AL  PVD++G FGL P  KPPGL
Sbjct  544  MAAVEIGGGPWFSTWKGKTSTPELLSRALRVPVDVDGFFGLAPFLKPPGL  593



>ref|XP_010049096.1| PREDICTED: tocopherol cyclase, chloroplastic [Eucalyptus grandis]
Length=515

 Score =   546 bits (1408),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 250/322 (78%), Positives = 282/322 (88%), Gaps = 2/322 (1%)
 Frame = -1

Query  1766  VYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLS  1587
             VY PTP NR  RTPHSGYHFD + R+FFEGW+FKVSIPE RQSFC+MYSVENPAF K LS
Sbjct  93    VYVPTPPNRESRTPHSGYHFDRSSRKFFEGWYFKVSIPESRQSFCFMYSVENPAFPKQLS  152

Query  1586  GIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNK  1407
              +E  QYG R+TGVGAQILGADDKYICQ++ ES NFWG RHEL LGNTF+A+  A+PPNK
Sbjct  153   ALEVAQYGPRYTGVGAQILGADDKYICQFSEESANFWGSRHELVLGNTFMAEKDAKPPNK  212

Query  1406  EVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQ  1227
             EVPPQEFN RV EGFQV+PLWHQGFIRDDGR+DY +TVKTARWEYSTRP+YGWGNVGS+Q
Sbjct  213   EVPPQEFNERVAEGFQVSPLWHQGFIRDDGRSDYVETVKTARWEYSTRPVYGWGNVGSQQ  272

Query  1226  KSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFW  1047
             KSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEW+GER+EF++APSYSEKNWG  FPRKWFW
Sbjct  273   KSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWEGERFEFQDAPSYSEKNWGGAFPRKWFW  332

Query  1046  VQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWE  867
             VQCNVFEGA GEV+LT+ GGLRQ+  PG ++ FENAALI VHY G+FYEFVPWNG V+WE
Sbjct  333   VQCNVFEGAKGEVALTAAGGLRQL--PGLTETFENAALIGVHYDGIFYEFVPWNGVVSWE  390

Query  866   ISPWGHWYITAENATHKSQVEV  801
             ++PWG WY+ A+N THK  VE 
Sbjct  391   VAPWGSWYMEADNETHKVVVEA  412


 Score =   169 bits (428),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +V +EA T D GTTLRAPT E GLAP C DTC+ DL+LQ+WERRYDGSKGK ILDVTSN
Sbjct  406  HKVVVEATTKDRGTTLRAPTVEAGLAPACNDTCFGDLKLQIWERRYDGSKGKLILDVTSN  465

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VE+GGGPWF+TWKG T+ PE+L +AL  PVD++G FGL P  KPPGL
Sbjct  466  MAAVEIGGGPWFSTWKGKTSTPELLSRALRVPVDVDGFFGLAPFLKPPGL  515



>gb|KHN18183.1| Tocopherol cyclase, chloroplastic [Glycine soja]
Length=481

 Score =   542 bits (1396),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/330 (74%), Positives = 290/330 (88%), Gaps = 3/330 (1%)
 Frame = -1

Query  1790  EIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVEN  1611
             ++  ++KP Y+PTP NR LRTPHSGYHFDGT R+FFEGW+FK+SIPE RQSFC+MYSVE+
Sbjct  50    QLVTSVKPTYSPTPPNRHLRTPHSGYHFDGTTRKFFEGWYFKLSIPERRQSFCFMYSVES  109

Query  1610  PAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQ  1431
             P+F KPL+ +E  QYG RFTGVGAQILGADDKYICQ++PES+ FWG RHEL LGNTF+  
Sbjct  110   PSFRKPLTPLEVAQYGSRFTGVGAQILGADDKYICQFSPESQFFWGSRHELMLGNTFVPN  169

Query  1430  TAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYG  1251
               ++PPNKEVPPQEFN RVLEGFQV+PLWHQGFIRDDGR++Y +TVKTARWEYSTRP+YG
Sbjct  170   QNSKPPNKEVPPQEFNDRVLEGFQVSPLWHQGFIRDDGRSNYVETVKTARWEYSTRPVYG  229

Query  1250  WGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTG-WIEWDGERYEFENAPSYSEKNWG  1074
             WG+VGS QKSTAGWLAAFPVFEPHWQ+CMA GLSTG WIEWDG+R EF+NAPSYSEKNWG
Sbjct  230   WGDVGSTQKSTAGWLAAFPVFEPHWQICMAGGLSTGSWIEWDGKRIEFDNAPSYSEKNWG  289

Query  1073  DGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFV  894
              GFPRKWFWVQCNVFEGA GE++LT+ GGLRQI  PG ++ FENAALI +HYGG+FYEFV
Sbjct  290   GGFPRKWFWVQCNVFEGASGEIALTAAGGLRQI--PGIAETFENAALIGIHYGGIFYEFV  347

Query  893   PWNGSVTWEISPWGHWYITAENATHKSQVE  804
             PWNG V WE++ WG+W+++A+N  +  ++E
Sbjct  348   PWNGVVNWEVTTWGYWFMSADNGRYVVEIE  377


 Score =   174 bits (440),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T DPGTTLRAPT E GLAP C+DTC+ DL+LQ+WERRYDGSKGK ILDV+SNMA
Sbjct  374  VEIEATTEDPGTTLRAPTAEAGLAPACKDTCFGDLKLQMWERRYDGSKGKIILDVSSNMA  433

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFNTWKG T+ P  L + L  P+D+EGIF  VPLFKPPGL
Sbjct  434  ALEVGGGPWFNTWKGKTSTPAALSRVLELPIDVEGIFNPVPLFKPPGL  481



>ref|XP_007222342.1| hypothetical protein PRUPE_ppa004789mg [Prunus persica]
 gb|EMJ23541.1| hypothetical protein PRUPE_ppa004789mg [Prunus persica]
Length=491

 Score =   541 bits (1395),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/326 (77%), Positives = 282/326 (87%), Gaps = 2/326 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++ PVY PTP NR LRTPHSGYHFDGT R+FFEGW+FKVSIPE RQSFC+MYSVENPAF 
Sbjct  65    SVNPVYVPTPQNRDLRTPHSGYHFDGTNRKFFEGWYFKVSIPERRQSFCFMYSVENPAFR  124

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             K L+ +E  Q G R TGVGAQILGA DKYICQY+ ES+NFWG R EL LGNTF+A+   +
Sbjct  125   KKLTPLEVAQNGPRSTGVGAQILGAYDKYICQYSEESQNFWGSRDELMLGNTFVAEKQLK  184

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PPNKEVPP+EF+ RV+EGFQVTPLWHQG IRDDGR+DY +TV TARWEYSTRP+YGWG+V
Sbjct  185   PPNKEVPPKEFDRRVMEGFQVTPLWHQGSIRDDGRSDYVETVPTARWEYSTRPVYGWGDV  244

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
             GSKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEW GER+EF+NAPSYSEKNWG  FPR
Sbjct  245   GSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWGGERFEFQNAPSYSEKNWGGAFPR  304

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWVQCNVFEGA GEV+LT+GGGLRQ+  PG ++ FENAALI VHYGG FYEFVPW G 
Sbjct  305   KWFWVQCNVFEGASGEVALTAGGGLRQL--PGLTETFENAALIGVHYGGKFYEFVPWYGD  362

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             V+WEISPWG+W I AEN THK ++E 
Sbjct  363   VSWEISPWGYWSIAAENETHKIELEA  388


 Score =   174 bits (441),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -3

Query  783  CEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTS  604
              ++ELEA T D GTTLRAPT E GLAP C+DTC+ +L+LQ+WERRYDGSKGK ILDV S
Sbjct  381  THKIELEATTEDSGTTLRAPTAESGLAPACKDTCFGELKLQIWERRYDGSKGKLILDVKS  440

Query  603  NMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            NMA VEVGGGPWF+TWKG T+ PE+L +AL  PVD+EG + LVPLFKPPGL
Sbjct  441  NMAAVEVGGGPWFSTWKGKTSTPELLSRALRVPVDVEGAYNLVPLFKPPGL  491



>gb|ADZ24706.1| tocopherol cyclase [Solanum pennellii]
Length=498

 Score =   546 bits (1407),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/356 (75%), Positives = 303/356 (85%), Gaps = 6/356 (2%)
 Frame = -1

Query  1871  LRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRR  1692
             L+  K   AF VKA    DSAV+    E +E +KPVY+ TPSNRPLRTPHSGYHFDG+ R
Sbjct  44    LQSQKSRHAFVVKA----DSAVDTTKKENREPVKPVYSSTPSNRPLRTPHSGYHFDGSTR  99

Query  1691  QFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKY  1512
             +FFEGWFFKVSIPECRQSFC+MYSVE+P+FTK LS +EE+QYG RFTGVGAQILGADDKY
Sbjct  100   KFFEGWFFKVSIPECRQSFCFMYSVESPSFTKKLSSLEELQYGPRFTGVGAQILGADDKY  159

Query  1511  ICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGF  1332
             ICQY+ ES NFWG RHEL LGNTF+AQ +A+PPNKEV PQEFN  V EGFQVTPLWHQG 
Sbjct  160   ICQYSEESSNFWGSRHELMLGNTFVAQNSAKPPNKEVRPQEFNRCVTEGFQVTPLWHQGS  219

Query  1331  IRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGL  1152
             IRDDGRTDY + VKTA WEYSTRPIYGWG+V SKQKSTAGW AAFPVFEPHWQVCMAAGL
Sbjct  220   IRDDGRTDYTEIVKTASWEYSTRPIYGWGDVNSKQKSTAGWPAAFPVFEPHWQVCMAAGL  279

Query  1151  STGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIP  972
             STGWIEWDG+R+EF+NAPSYSEKNWG  FPRKWFWVQC+VFEGA G+V+LT+GGGLR + 
Sbjct  280   STGWIEWDGQRFEFQNAPSYSEKNWGGSFPRKWFWVQCSVFEGAIGDVALTAGGGLRLL-  338

Query  971   GPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
              PG ++ FE+ ALI +HY G+FYEFVPWN SV+WEI+PWG W+I+AEN TH   +E
Sbjct  339   -PGLNETFESVALIGIHYRGIFYEFVPWNASVSWEITPWGKWHISAENETHMVLLE  393


 Score =   169 bits (427),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              V LEA T DPGTTLRAPT+E GLAP CRDTC+ +LRLQLWER+ +GSKGK ILDVTSN
Sbjct  388  HMVLLEATTEDPGTTLRAPTEETGLAPACRDTCFGELRLQLWERKSNGSKGKVILDVTSN  447

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVP-LFKPPGL  451
            MAG+EVGGGPWFNTWKG    PEI+ +A+N PVD++GIF  VP L KPPGL
Sbjct  448  MAGLEVGGGPWFNTWKGNAEMPEIVTRAINVPVDLDGIFSCVPSLLKPPGL  498



>ref|XP_010526175.1| PREDICTED: tocopherol cyclase, chloroplastic isoform X2 [Tarenaya 
hassleriana]
Length=498

 Score =   552 bits (1423),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/326 (79%), Positives = 288/326 (88%), Gaps = 2/326 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++KPVY PTPSNR LRTPHSGYHFDGT R+FFEGW+FKVSIPE +QSFC+MYSVENPAF 
Sbjct  71    SVKPVYVPTPSNRELRTPHSGYHFDGTTRKFFEGWYFKVSIPERKQSFCFMYSVENPAFP  130

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             K LS ++   YG RFTGVGAQILGA DKYICQYT ES+NFWG+RHEL LGNTF A   AR
Sbjct  131   KKLSPLDMALYGPRFTGVGAQILGAYDKYICQYTQESQNFWGDRHELVLGNTFAAVEGAR  190

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP+KEVPP+EFN RV EGFQVTPLWHQG+I DDGRT+Y +TVK+ARWEYSTRP+YGWGNV
Sbjct  191   PPSKEVPPEEFNKRVSEGFQVTPLWHQGYICDDGRTNYLETVKSARWEYSTRPVYGWGNV  250

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
             GSKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EFE+APSYSEKNWG GFPR
Sbjct  251   GSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFEDAPSYSEKNWGGGFPR  310

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWVQCNVFEGADGEV+ T+ GGLRQ+  PG ++ FENAALI VHY G+FYEFVPWNG 
Sbjct  311   KWFWVQCNVFEGADGEVAFTAAGGLRQL--PGLTETFENAALIGVHYDGIFYEFVPWNGV  368

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             + WE++PWG+WY+TAEN TH  +VE 
Sbjct  369   LKWEMTPWGYWYMTAENETHVVEVEA  394


 Score =   162 bits (410),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EART++ GT LRAPT E GLAP CRD+CY +LRLQLWERRYDGSKGK ILDV S+MA
Sbjct  390  VEVEARTNEAGTPLRAPTMESGLAPACRDSCYGELRLQLWERRYDGSKGKGILDVRSSMA  449

Query  594  GVEVGGGPWFNTWKGTT-NAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VE+GGGPWFN+WKG T N P  LK AL  P+D++ +FGL P  KPPGL
Sbjct  450  AVEIGGGPWFNSWKGETDNTPPFLKNALQFPLDLDSVFGLAPPLKPPGL  498



>gb|AAP97931.1| tocopherol cyclase [Eucalyptus gunnii]
Length=515

 Score =   545 bits (1403),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/322 (77%), Positives = 282/322 (88%), Gaps = 2/322 (1%)
 Frame = -1

Query  1766  VYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLS  1587
             VY PTP NR  RTPHSGYH+DG+ R+FFEGW+FKVSIPE RQSFC+MYSVENPAF K LS
Sbjct  93    VYVPTPPNRESRTPHSGYHWDGSSRKFFEGWYFKVSIPESRQSFCFMYSVENPAFPKKLS  152

Query  1586  GIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNK  1407
              +E  QYG R+TGVGAQILGADDKYICQ++ ES NFWG RHEL LGNTF+A+  A+PPNK
Sbjct  153   ALEVAQYGPRYTGVGAQILGADDKYICQFSEESANFWGSRHELILGNTFMAEKDAKPPNK  212

Query  1406  EVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQ  1227
             EVPPQEFN RV EGFQV+PLWHQGFIRDDGR+DY +TVKTARWEYSTRP+YGWGN GS+Q
Sbjct  213   EVPPQEFNKRVAEGFQVSPLWHQGFIRDDGRSDYVETVKTARWEYSTRPVYGWGNAGSQQ  272

Query  1226  KSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFW  1047
             KSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEW+GER+EF++APSYSEKNWG  FPRKWFW
Sbjct  273   KSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWEGERFEFQDAPSYSEKNWGGAFPRKWFW  332

Query  1046  VQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWE  867
             VQCNVFEGA GEV+LT+ GGLRQ+  PG ++ FENAALI VHY G+FYEFVPWNG V+WE
Sbjct  333   VQCNVFEGAKGEVALTAAGGLRQL--PGLTETFENAALIGVHYDGIFYEFVPWNGVVSWE  390

Query  866   ISPWGHWYITAENATHKSQVEV  801
             ++PWG WY+ A+N THK  VE 
Sbjct  391   VAPWGSWYMEADNETHKVVVEA  412


 Score =   169 bits (428),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +V +EA T D GTTLRAPT E GLAP C DTC+ DL+LQ+WERRYDGSKGK ILDVTSN
Sbjct  406  HKVVVEATTKDRGTTLRAPTVEAGLAPACNDTCFGDLKLQIWERRYDGSKGKLILDVTSN  465

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VE+GGGPWF+TWKG T+ PE+L +AL  PVD++G FGL P  KPPGL
Sbjct  466  MAAVEIGGGPWFSTWKGKTSTPELLSRALRVPVDVDGFFGLAPFLKPPGL  515



>ref|XP_008220061.1| PREDICTED: tocopherol cyclase, chloroplastic [Prunus mume]
Length=491

 Score =   539 bits (1388),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 250/326 (77%), Positives = 281/326 (86%), Gaps = 2/326 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++ PVY PTP NR LRTPHSGYHFDGT R+FFEGW+FKVSIPE RQSFC+MYSVENPAF 
Sbjct  65    SVNPVYVPTPQNRDLRTPHSGYHFDGTSRKFFEGWYFKVSIPERRQSFCFMYSVENPAFR  124

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             K L+ +E  Q G R TGVGAQILGA DKYICQY+ ES+NFWG R EL LGNTF+A+   +
Sbjct  125   KKLTPLEVAQNGPRSTGVGAQILGAYDKYICQYSEESQNFWGSRDELMLGNTFVAEKQLK  184

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PPNKEVPP+EF+ RV+EGFQVTPLWHQG IRDDGR+DY +TV TARWEYSTRP+YGWG+V
Sbjct  185   PPNKEVPPKEFDRRVMEGFQVTPLWHQGSIRDDGRSDYVETVPTARWEYSTRPVYGWGDV  244

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
             GSKQKSTAGWLAAFPVFEPHWQ+CMA G STGWIEW GER+EF+NAPSYSEKNWG  FPR
Sbjct  245   GSKQKSTAGWLAAFPVFEPHWQICMAGGSSTGWIEWGGERFEFQNAPSYSEKNWGGAFPR  304

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWVQCNVFEGA GEV+LT+GGGLRQ+  PG ++ FENAALI VHYGG FYEFVPW G 
Sbjct  305   KWFWVQCNVFEGASGEVALTAGGGLRQL--PGLTETFENAALIGVHYGGKFYEFVPWYGD  362

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             V+WEISPWG+W I AEN THK ++E 
Sbjct  363   VSWEISPWGYWSIAAENETHKIELEA  388


 Score =   174 bits (442),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -3

Query  783  CEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTS  604
              ++ELEA T D GTTLRAPT E GLAP C+DTC+ +L+LQ+WERRYDGSKGK ILDV S
Sbjct  381  THKIELEATTEDSGTTLRAPTAESGLAPACKDTCFGELKLQMWERRYDGSKGKLILDVKS  440

Query  603  NMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            NMA VEVGGGPWF+TWKG T+ PE+L +AL  PVD+EG + LVPLFKPPGL
Sbjct  441  NMAAVEVGGGPWFSTWKGKTSTPELLSRALRVPVDVEGAYNLVPLFKPPGL  491



>gb|ABB52812.1| tocopherol cyclase [Helianthus annuus]
 gb|ABB52814.1| tocopherol cyclase [Helianthus annuus]
 gb|ABB52815.1| tocopherol cyclase [Helianthus annuus]
 gb|ABB52816.1| tocopherol cyclase [Helianthus annuus]
Length=483

 Score =   556 bits (1434),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/376 (70%), Positives = 305/376 (81%), Gaps = 3/376 (1%)
 Frame = -1

Query  1931  SSAVSPPTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPT  1752
             ++  SP   S  A   P  +++   +    R + +SA  + V     + +E + PVY PT
Sbjct  5     TTTTSPLFSSLLASSKP-NNVKSSVRLKLERNRRLSAAKTDVYGVELQSQEIVNPVYVPT  63

Query  1751  PSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEV  1572
             P+NRPLR PHSGYHFDGT R+FFEGW+FKVSIPE RQSFC+MYSVENPAF K L+ +E++
Sbjct  64    PTNRPLRPPHSGYHFDGTTRKFFEGWYFKVSIPEQRQSFCFMYSVENPAFKKDLNILEQL  123

Query  1571  QYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQ  1392
             Q+G RFTGVGAQILGA DKYICQY+ ES NFWG RHEL LGN+F  QT  +PPN EVPPQ
Sbjct  124   QHGPRFTGVGAQILGAHDKYICQYSKESHNFWGSRHELMLGNSFSVQTGKQPPNSEVPPQ  183

Query  1391  EFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAG  1212
              FN RV+EGFQVTPLWHQGFIRDDGRT YA+TVKTARWEYSTRP+YGWG+VGSKQKSTAG
Sbjct  184   VFNQRVIEGFQVTPLWHQGFIRDDGRTSYAETVKTARWEYSTRPVYGWGDVGSKQKSTAG  243

Query  1211  WLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNV  1032
             WLAAFPVFEPHWQ+CMA GLSTGWIEW  ERYEFENAPSY EKNWG GFPRKWFWVQCNV
Sbjct  244   WLAAFPVFEPHWQICMAGGLSTGWIEWGDERYEFENAPSYCEKNWGGGFPRKWFWVQCNV  303

Query  1031  FEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWG  852
             F+GA GEV LT GGGLRQ+  PG ++ FENAALI VH+GG+FYEFVPWNG V WE++ WG
Sbjct  304   FKGASGEVGLTCGGGLRQL--PGLNETFENAALIGVHHGGIFYEFVPWNGVVEWEVAEWG  361

Query  851   HWYITAENATHKSQVE  804
             +W++TA+N THK ++E
Sbjct  362   YWHVTAQNETHKVELE  377


 Score =   156 bits (394),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 86/112 (77%), Gaps = 2/112 (2%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWER--RYDGSKGKAILDVT  607
             +VELEA T DPGTTLRAPT E GLAP C+DTC+A L L+LWE+      + GK ILDVT
Sbjct  372  HKVELEASTKDPGTTLRAPTTEAGLAPACKDTCFAHLTLKLWEKGSAAAAADGKLILDVT  431

Query  606  SNMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            SNMA VEVGGGPWFNTWKG T  PE++ +ALN PVD++GI G  PL KPPGL
Sbjct  432  SNMAAVEVGGGPWFNTWKGKTYTPEVINRALNLPVDVDGILGSFPLLKPPGL  483



>ref|XP_007137201.1| hypothetical protein PHAVU_009G108200g [Phaseolus vulgaris]
 gb|ESW09195.1| hypothetical protein PHAVU_009G108200g [Phaseolus vulgaris]
Length=488

 Score =   544 bits (1401),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/360 (71%), Positives = 300/360 (83%), Gaps = 5/360 (1%)
 Frame = -1

Query  1871  LRVGKKSPAFRVKAVSA-PDSAVENPAPEIKEAIK--PVYTPTPSNRPLRTPHSGYHFDG  1701
             LR    +P  R+ A S+  DS      P+   ++K  P Y+PTP NR LRTPHSGYHFDG
Sbjct  28    LRFPSTTPTTRLLAHSSLSDSVPVQNTPQTPPSVKVQPTYSPTPPNRDLRTPHSGYHFDG  87

Query  1700  TRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGAD  1521
             T R+FFEGW+FKVSIPE RQSFC+MYSVE+P+F KPLS +E+VQYG RFTGVGAQILGAD
Sbjct  88    TARKFFEGWYFKVSIPERRQSFCFMYSVESPSFRKPLSPLEQVQYGPRFTGVGAQILGAD  147

Query  1520  DKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWH  1341
             DKYICQY+PES+ FWG RHEL+LGNTF+    ++PPNKE+PPQEFN RVLEGFQVTPLW+
Sbjct  148   DKYICQYSPESQFFWGSRHELTLGNTFVPNQNSKPPNKELPPQEFNDRVLEGFQVTPLWN  207

Query  1340  QGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMA  1161
             QGFI+DDGR++Y +TVKTARWEYST P+YGWG+VGS QKSTAGWLAAFPVFEPHWQ+CMA
Sbjct  208   QGFIQDDGRSNYVETVKTARWEYSTLPVYGWGDVGSTQKSTAGWLAAFPVFEPHWQICMA  267

Query  1160  AGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLR  981
             AGLSTGWIEWDGER EFENAPSYSEKNWG GFPRKWFWVQCNVFEG  GE++LT+ GGLR
Sbjct  268   AGLSTGWIEWDGERIEFENAPSYSEKNWGGGFPRKWFWVQCNVFEGGSGEIALTAAGGLR  327

Query  980   QIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             QI  PG ++ FENAALI +H  G FYEFVPWNG V WE++ WG+W++TA+N  +  ++E 
Sbjct  328   QI--PGITETFENAALIGIHCDGKFYEFVPWNGIVNWEVTTWGYWFMTADNGKYVVELEA  385


 Score =   167 bits (424),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA   DPGT LRAPT E GLAP C+DTC+  L+LQ+WERRYDGSKGK IL+V+SNMA
Sbjct  381  VELEATADDPGTPLRAPTAEAGLAPACKDTCFGSLKLQMWERRYDGSKGKIILNVSSNMA  440

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWF+TWKG T+ P  L+ AL  P+D+E IF LVPLFKPPGL
Sbjct  441  ALEVGGGPWFDTWKGKTSTPAALRSALELPIDVEAIFNLVPLFKPPGL  488



>ref|XP_006578222.1| PREDICTED: tocopherol cyclase, chloroplastic-like isoform X2 
[Glycine max]
Length=479

 Score =   539 bits (1388),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 299/368 (81%), Gaps = 11/368 (3%)
 Frame = -1

Query  1892  RFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKE----AIKPVYTPTPSNRPLRTP  1725
             RFS  KH       P+   + V+    +   P  + KE    ++KP Y+PTP NR LRTP
Sbjct  16    RFSSLKH-----AFPSTTTRLVAHNSVSETVPIHKEKEQTLPSVKPTYSPTPPNRGLRTP  70

Query  1724  HSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGV  1545
             HSGYHFDGT R+FFEGW+FKVSIPE +QSFC+MY+VE+P F KPL+ +E  QYG RFTGV
Sbjct  71    HSGYHFDGTTRKFFEGWYFKVSIPERKQSFCFMYTVESPLFRKPLTQLELAQYGPRFTGV  130

Query  1544  GAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEG  1365
             GAQILGADDKY+CQ++P+S  FWG RHEL LGNTF     ++PPNKEVPPQEFN RVLEG
Sbjct  131   GAQILGADDKYVCQHSPQSHFFWGSRHELMLGNTFEPNQNSKPPNKEVPPQEFNDRVLEG  190

Query  1364  FQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFE  1185
             FQVTPLWHQGFIRDDGR++Y +TVKTARWEYSTRP+YGWG+VGS QKSTAGWLAAFPVFE
Sbjct  191   FQVTPLWHQGFIRDDGRSNYVETVKTARWEYSTRPVYGWGDVGSTQKSTAGWLAAFPVFE  250

Query  1184  PHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVS  1005
             PHWQ+CMA GLSTGWIEWDGER EF+NAPSYSEKNWG GFPRKWFWVQCNVFEGA GE++
Sbjct  251   PHWQICMAGGLSTGWIEWDGERIEFDNAPSYSEKNWGGGFPRKWFWVQCNVFEGASGEIA  310

Query  1004  LTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENA  825
             LT+ GGLRQI  PG ++ FENAALI +HYGG FYEFVPWNG V WE++ WG+W+++A+N 
Sbjct  311   LTAAGGLRQI--PGITETFENAALIGIHYGGNFYEFVPWNGVVNWEVTTWGYWFMSADNG  368

Query  824   THKSQVEV  801
              +  ++E 
Sbjct  369   KYVVELEA  376


 Score =   172 bits (435),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T DPGTTLRAPT E G AP C+DTC+ +L+LQ+WERRYDGSKGK ILDV+SNMA
Sbjct  372  VELEATTEDPGTTLRAPTAEAGFAPACKDTCFGNLKLQMWERRYDGSKGKIILDVSSNMA  431

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFNTWKG T+ P  L + L  P+D+EGIF  VPLFKPPGL
Sbjct  432  ALEVGGGPWFNTWKGKTSTPAALSRVLELPIDVEGIFNPVPLFKPPGL  479



>gb|ABB52813.1| tocopherol cyclase [Helianthus annuus]
Length=483

 Score =   554 bits (1428),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/376 (69%), Positives = 305/376 (81%), Gaps = 3/376 (1%)
 Frame = -1

Query  1931  SSAVSPPTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPT  1752
             ++  SP   S  A   P  +++   +    R + +SA  + V     + +E + PVY PT
Sbjct  5     TTTTSPLFSSLLASSKP-NNVKSSVRLKHERNRRLSAAKTDVYGVELQSQEIVNPVYVPT  63

Query  1751  PSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEV  1572
             P+NRPLR PHSGYHFDGT R+FFEGW+FKVSIPE RQSFC+MYSVENPAF K L+ +E++
Sbjct  64    PTNRPLRPPHSGYHFDGTTRKFFEGWYFKVSIPEQRQSFCFMYSVENPAFKKDLNILEQL  123

Query  1571  QYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQ  1392
             Q+G RFTGVGAQILGA DKYICQY+ ES NFWG RHEL LGN+F  QT  +PPN EVPPQ
Sbjct  124   QHGPRFTGVGAQILGAHDKYICQYSKESHNFWGSRHELMLGNSFSVQTGKQPPNSEVPPQ  183

Query  1391  EFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAG  1212
              FN RV+EGFQVTPLWHQGFIRDDGRT YA+TVKTARWEYSTRP+YGWG+VGSKQKSTAG
Sbjct  184   VFNQRVIEGFQVTPLWHQGFIRDDGRTSYAETVKTARWEYSTRPVYGWGDVGSKQKSTAG  243

Query  1211  WLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNV  1032
             WLAAFPVFEPHWQ+CMA GLSTGWIEW  ERYEFE+APSY EKNWG GFPRKWFWVQCNV
Sbjct  244   WLAAFPVFEPHWQICMAGGLSTGWIEWGDERYEFEDAPSYCEKNWGGGFPRKWFWVQCNV  303

Query  1031  FEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWG  852
             F+GA GEV LT GGGLRQ+  PG ++ FENAALI VH+GG+FYEFVPWNG V WE++ WG
Sbjct  304   FKGASGEVGLTCGGGLRQL--PGLNETFENAALIGVHHGGIFYEFVPWNGVVEWEVAEWG  361

Query  851   HWYITAENATHKSQVE  804
             +W++TA+N THK ++E
Sbjct  362   YWHVTAQNETHKVELE  377


 Score =   156 bits (394),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 86/112 (77%), Gaps = 2/112 (2%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWER--RYDGSKGKAILDVT  607
             +VELEA T DPGTTLRAPT E GLAP C+DTC+A L L+LWE+      + GK ILDVT
Sbjct  372  HKVELEASTKDPGTTLRAPTTEAGLAPACKDTCFAHLTLKLWEKGSAAAAADGKLILDVT  431

Query  606  SNMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            SNMA VEVGGGPWFNTWKG T  PE++ +ALN PVD++GI G  PL KPPGL
Sbjct  432  SNMAAVEVGGGPWFNTWKGKTYTPEVINRALNLPVDVDGILGSFPLLKPPGL  483



>gb|KGN62825.1| Tocopherol cyclase [Cucumis sativus]
Length=517

 Score =   546 bits (1406),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 304/376 (81%), Gaps = 10/376 (3%)
 Frame = -1

Query  1910  TQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKE-------AIKPVYTPT  1752
             + S+  R      L +  +S + RV A S+ +S  E+PA    E          P Y PT
Sbjct  41    SSSFRLRSGGSSKLELKSRSTSIRVLA-SSSNSVYESPASSKIEKDDDGGLVCPPGYRPT  99

Query  1751  PSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEV  1572
             P+NR LRTPHSGYHFDG+ R+FFEGW+FKVSIP+ RQSFC+MYSVENPAF K L+ ++  
Sbjct  100   PANRELRTPHSGYHFDGSTRKFFEGWYFKVSIPQKRQSFCFMYSVENPAFPKKLTAVDIA  159

Query  1571  QYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQ  1392
             Q+G RFTGVGAQILGA DKYICQY+ ES+NFWG RHELSLGN+F  +   +PPNKEV P+
Sbjct  160   QHGPRFTGVGAQILGAYDKYICQYSEESQNFWGSRHELSLGNSFATKGGFKPPNKEVDPE  219

Query  1391  EFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAG  1212
             EFN +V+EGFQVTPLWHQGFIRDDGRT+Y +TVKTARWEYS+RP+YGWGNVGSKQKSTAG
Sbjct  220   EFNKKVVEGFQVTPLWHQGFIRDDGRTNYLETVKTARWEYSSRPVYGWGNVGSKQKSTAG  279

Query  1211  WLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNV  1032
             WLAAFPVFEPHWQ+CMA GLSTGWIEW+ ER+EF NAPSYSEKNWG GFPRKWFWVQCNV
Sbjct  280   WLAAFPVFEPHWQICMAGGLSTGWIEWEDERFEFVNAPSYSEKNWGGGFPRKWFWVQCNV  339

Query  1031  FEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWG  852
             FEGA GEV+LT+GGGLRQ+  PG ++ FENAAL+ VHY G FYEFVPWNG+V WEI+ WG
Sbjct  340   FEGARGEVALTAGGGLRQL--PGLTETFENAALVGVHYDGTFYEFVPWNGTVNWEINTWG  397

Query  851   HWYITAENATHKSQVE  804
             +WYI AEN THK ++E
Sbjct  398   YWYIAAENETHKVELE  413


 Score =   164 bits (415),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +VELE +T +PG+ LRAPT E GL   C+DTC+  L+LQ+WERR+DGSKGK +LDVTSN
Sbjct  408  HKVELEGKTDEPGSPLRAPTSECGLDTACKDTCFGTLKLQIWERRFDGSKGKIVLDVTSN  467

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWKG T  PEILK+AL  P+D++  F L+PLFKPPGL
Sbjct  468  MAALEVGGGPWFNTWKGETTTPEILKRALTTPIDVDQAFNLLPLFKPPGL  517



>gb|KEH36047.1| tocopherol cyclase [Medicago truncatula]
Length=479

 Score =   542 bits (1397),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 252/345 (73%), Positives = 293/345 (85%), Gaps = 5/345 (1%)
 Frame = -1

Query  1835  KAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSI  1656
             K + A +S  E    +  ++ KP+Y+PTP NR LRTPHSGYHFDGT R+FFEGW+FKVSI
Sbjct  37    KLIIAHNSHTEQ---QQSQSSKPIYSPTPPNRQLRTPHSGYHFDGTARKFFEGWYFKVSI  93

Query  1655  PECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFW  1476
             PE RQSFC+MYSVENPAF K LS +E  QYG RFTGVGAQILGADDKYICQYTP+S NFW
Sbjct  94    PEKRQSFCFMYSVENPAFRKELSTLELAQYGPRFTGVGAQILGADDKYICQYTPQSPNFW  153

Query  1475  GERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKT  1296
             G R+EL LGNTF A+  ++PPNKEVPP+EFN +VLEGFQVTPLW+QGFI DDGR+DY +T
Sbjct  154   GSRNELMLGNTFAAKQNSKPPNKEVPPKEFNDKVLEGFQVTPLWNQGFICDDGRSDYVET  213

Query  1295  VKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERY  1116
             VKTARWEYSTRP+YGWG+VGS QKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER 
Sbjct  214   VKTARWEYSTRPVYGWGDVGSTQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERI  273

Query  1115  EFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAA  936
             EFENAPSYSEKNWG  FPRKWFW QCNVFEGA GE++LT+ GGLRQI  PG ++ FENAA
Sbjct  274   EFENAPSYSEKNWGGAFPRKWFWAQCNVFEGASGEIALTAAGGLRQI--PGLTETFENAA  331

Query  935   LIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             LI +HYGG FYEFVPWNG V+WE++ WG+W+++A+N  +  ++E 
Sbjct  332   LIGIHYGGKFYEFVPWNGVVSWEVATWGYWFMSADNGNYVVELEA  376


 Score =   166 bits (420),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T DPGTTLRAPT E GL+  C+DTC+  L+L+LWERRYDGSKGK ILDVTS+MA
Sbjct  372  VELEATTEDPGTTLRAPTSEAGLSQACKDTCFGILKLKLWERRYDGSKGKIILDVTSDMA  431

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFNTWKG T+ P +L +A+  PVD++G++ L PLFKPPGL
Sbjct  432  ALEVGGGPWFNTWKGKTSTPPVLSRAIGLPVDVDGLYNLFPLFKPPGL  479



>ref|XP_002516548.1| Tocopherol cyclase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF45889.1| Tocopherol cyclase, chloroplast precursor, putative [Ricinus 
communis]
Length=505

 Score =   535 bits (1377),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/330 (74%), Positives = 281/330 (85%), Gaps = 2/330 (1%)
 Frame = -1

Query  1790  EIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVEN  1611
             E   ++ P+Y PTPSNR LRTPHSGYHFDGT R+FFEGW+F+VSIPE +QSFC+MY+VEN
Sbjct  75    ESASSVSPLYVPTPSNRQLRTPHSGYHFDGTARKFFEGWYFRVSIPERKQSFCFMYAVEN  134

Query  1610  PAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQ  1431
             PAF   ++ +E  Q+G R TGV AQILGADDKYICQ + ES+NFWG RHEL LG+TF+ +
Sbjct  135   PAFRSKMTPLEIAQHGPRSTGVMAQILGADDKYICQCSEESQNFWGSRHELVLGSTFVPE  194

Query  1430  TAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYG  1251
                +PP KEVPP+EFN RV EGFQVTPLWHQGFIRDDGR+DY +TVKTA WEYSTRPIYG
Sbjct  195   KGMQPPTKEVPPEEFNKRVSEGFQVTPLWHQGFIRDDGRSDYVETVKTASWEYSTRPIYG  254

Query  1250  WGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGD  1071
             WG+V SKQKSTAGWLAA PVFEPHWQ+CMA GLSTGWIEWDGERYEF++APSYSEKNWG 
Sbjct  255   WGDVESKQKSTAGWLAALPVFEPHWQICMAGGLSTGWIEWDGERYEFQDAPSYSEKNWGG  314

Query  1070  GFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVP  891
             GFPRKWFWVQCNVFEGA GE++LT GGGLRQ+  PG ++NFENAAL+ VHY G FYEFVP
Sbjct  315   GFPRKWFWVQCNVFEGATGEIALTVGGGLRQL--PGLTENFENAALVGVHYDGNFYEFVP  372

Query  890   WNGSVTWEISPWGHWYITAENATHKSQVEV  801
             WNG V WE+SPWGHW+ TAEN TH  ++E 
Sbjct  373   WNGVVNWEVSPWGHWFFTAENETHLVELEA  402


 Score =   173 bits (439),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T DPGT L APT E+GLAP CRDTC+ADL+LQ+WERRYDGSKGK ILDVTS+MA
Sbjct  398  VELEATTKDPGTPLLAPTAEVGLAPACRDTCFADLKLQMWERRYDGSKGKLILDVTSDMA  457

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VEVGGGPWFNTWKG T+ PE+L +AL  PVD++ I   +PLFKPPGL
Sbjct  458  AVEVGGGPWFNTWKGKTSTPELLSRALQVPVDMDEILSFLPLFKPPGL  505



>ref|XP_006371708.1| hypothetical protein POPTR_0018s00510g [Populus trichocarpa]
 gb|ERP49505.1| hypothetical protein POPTR_0018s00510g [Populus trichocarpa]
Length=501

 Score =   551 bits (1419),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/371 (69%), Positives = 305/371 (82%), Gaps = 5/371 (1%)
 Frame = -1

Query  1910  TQSYTARFSPRKHLRVGKKSPAFRVKA--VSAPDSAVENPAPEIKEAIKPVYTPTPSNRP  1737
             ++  T   +  K L++G +S      +  ++  D+++ +   E + ++ PVY PTP NR 
Sbjct  30    SRDSTFSITLSKSLKLGFRSSPLLAASTPITNTDTSLASNG-ENERSVSPVYVPTPPNRG  88

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             LRTPHSGYH+DGT R FFEGW+FKVSIPE +Q+FC+MYSVENPAF K L+ +E  Q+G R
Sbjct  89    LRTPHSGYHYDGTTRNFFEGWYFKVSIPERKQNFCFMYSVENPAFPKKLTALESAQHGSR  148

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
               GVGAQILGA DKYICQ++ ES++FWG RHEL+LGNTF+A+   RPP KEVPPQEF+ R
Sbjct  149   SIGVGAQILGAYDKYICQFSEESQDFWGSRHELALGNTFVAERNMRPPTKEVPPQEFDKR  208

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             VLEGFQV+PLWHQGFIRDDGR+DY +TVKTARW+YSTRP+YGWGNVGS QKSTAGWLAAF
Sbjct  209   VLEGFQVSPLWHQGFIRDDGRSDYVETVKTARWQYSTRPVYGWGNVGSTQKSTAGWLAAF  268

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             PVFEPHWQ+CMA GLSTGWIEWDGER+EFE+APSYSEKNWG  FPRKWFWVQCNVFEGA 
Sbjct  269   PVFEPHWQICMAGGLSTGWIEWDGERFEFEDAPSYSEKNWGGAFPRKWFWVQCNVFEGAS  328

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
             GEV+LT+ GGLRQIPGP  S+ FENAAL+ VHY G+FYEFVPWNG V WEISPWG+WY+ 
Sbjct  329   GEVALTAAGGLRQIPGP--SETFENAALVGVHYDGIFYEFVPWNGVVNWEISPWGYWYMA  386

Query  836   AENATHKSQVE  804
             A+N TH  ++E
Sbjct  387   ADNGTHLVELE  397


 Score =   156 bits (394),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T + GT LRAPT E GL+P C+DT ++ L+LQ+WERRYDG+KGK ILDVTS+MA
Sbjct  394  VELEATTKELGTALRAPTAEAGLSPACKDTGFSFLKLQIWERRYDGTKGKLILDVTSDMA  453

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VEVGGGPWF TWKG T+  E++ + + AP+D++GIF  VPLFKPPGL
Sbjct  454  LVEVGGGPWFTTWKGKTSMAELVSRTIGAPIDVDGIFSFVPLFKPPGL  501



>ref|XP_010668187.1| PREDICTED: tocopherol cyclase, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=505

 Score =   544 bits (1401),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 253/326 (78%), Positives = 282/326 (87%), Gaps = 4/326 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             AI PVY PTP NR LRTPHSGYHFDG+ RQFFEGW+FKVSIPE RQSFC+MYSVENPAF 
Sbjct  81    AITPVYAPTPPNRELRTPHSGYHFDGSTRQFFEGWYFKVSIPERRQSFCFMYSVENPAFR  140

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             K L+ IEE +YGRRFTGVGAQILGADDKYICQY+ ES NFWG RHEL LG+TF +  +++
Sbjct  141   KKLTPIEEAKYGRRFTGVGAQILGADDKYICQYSEESPNFWGSRHELMLGSTFKSSGSSQ  200

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PPNKEVPP+EFN RV EGFQVTPLWHQGFI DDGR+DY +TVKTARWEYS RP+YGWGNV
Sbjct  201   PPNKEVPPEEFNERVSEGFQVTPLWHQGFICDDGRSDYVETVKTARWEYSNRPVYGWGNV  260

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
              SKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EFENAPSYSEKNWG GFP+
Sbjct  261   SSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFENAPSYSEKNWGAGFPK  320

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWVQCNVFEGA GEV+LT GGGLR++PG       ENAAL+ VH  G+FYEFVPWNGS
Sbjct  321   KWFWVQCNVFEGATGEVALTVGGGLRELPG----GRIENAALVGVHDRGIFYEFVPWNGS  376

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             V WEI+PWG+W I+A N ++  +VE 
Sbjct  377   VEWEIAPWGYWKISANNGSYMVEVEA  402


 Score =   161 bits (407),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA+T DPGT LRAPT E GLA  C+DTC+  L+LQLWERR DGSKGK IL+VTSNMA
Sbjct  398  VEVEAKTEDPGTPLRAPTPENGLAVACKDTCFGQLKLQLWERRSDGSKGKVILEVTSNMA  457

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWF  WKG T  PEIL  AL  P+D+E +FG +P  KPPGL
Sbjct  458  ALEVGGGPWFEAWKGRTTTPEILSAALKVPIDMESVFGFIPFLKPPGL  505



>gb|KDO79771.1| hypothetical protein CISIN_1g011258mg [Citrus sinensis]
 gb|KDO79772.1| hypothetical protein CISIN_1g011258mg [Citrus sinensis]
Length=476

 Score =   532 bits (1371),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 243/325 (75%), Positives = 278/325 (86%), Gaps = 3/325 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++ PVY PTP NR LRTPHSGYHFDG+ R+FFEGW+F+VSIPE +QSFC +YSVENPAF 
Sbjct  51    SVNPVYKPTPRNRELRTPHSGYHFDGSTRRFFEGWYFRVSIPERKQSFCIIYSVENPAFK  110

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             K LS +E  Q+G RFTGVG QILGADDKY+C Y+ ES NFWG RHEL LGNTF A   ++
Sbjct  111   KKLSSLEVAQHGPRFTGVGVQILGADDKYMCHYSEESSNFWGSRHELMLGNTFRADKGSQ  170

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP KEVPPQEFN RVLEGFQVTPLWHQG I DDGRT++A+TVK+ARWEYSTRP+YGWGNV
Sbjct  171   PPTKEVPPQEFNRRVLEGFQVTPLWHQGCIHDDGRTNFAETVKSARWEYSTRPVYGWGNV  230

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
             GSKQ STAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EF++APSYSEKNWG  FPR
Sbjct  231   GSKQNSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFQDAPSYSEKNWGGAFPR  290

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWVQCNVFEGA GEV+LT+GGGLRQ+P     D+FENAA+I +HY G+ YEFVPWNG 
Sbjct  291   KWFWVQCNVFEGATGEVALTAGGGLRQLP---VLDSFENAAMIGIHYDGILYEFVPWNGV  347

Query  878   VTWEISPWGHWYITAENATHKSQVE  804
             V+WEIS WG+WY  AEN TH  +++
Sbjct  348   VSWEISQWGYWYFAAENQTHMVELK  372


 Score =   172 bits (436),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VEL+A T  PGTTLRAPT E GLAP C+DTC+ +L LQLWERRYDG+KGK ILDVTS+
Sbjct  367  HMVELKATTKYPGTTLRAPTSEAGLAPACKDTCFGELTLQLWERRYDGTKGKMILDVTSD  426

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWK  T  PE+L++ LN PVD++G+FG VP FKPPGL
Sbjct  427  MAALEVGGGPWFNTWKAKTATPELLRRTLNVPVDVDGLFGFVPFFKPPGL  476



>gb|AFK39487.1| unknown [Medicago truncatula]
Length=479

 Score =   539 bits (1389),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 250/345 (72%), Positives = 292/345 (85%), Gaps = 5/345 (1%)
 Frame = -1

Query  1835  KAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSI  1656
             K + A +S  E    +  ++ KP+Y+PTP NR LRTPHSGYHFDGT R+FFEGW+FKVSI
Sbjct  37    KLIIAHNSHTEQ---QQSQSSKPIYSPTPPNRQLRTPHSGYHFDGTARKFFEGWYFKVSI  93

Query  1655  PECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFW  1476
             PE RQSFC+MYSVENPAF K LS +E  QYG RFTGVGAQILGADDKYICQYTP+S NFW
Sbjct  94    PEKRQSFCFMYSVENPAFRKELSTLELAQYGPRFTGVGAQILGADDKYICQYTPQSPNFW  153

Query  1475  GERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKT  1296
             G R+EL LGNTF A+  ++PPNKEVPP+EFN +VLEGFQVTPLW+QGFI DDG++DY +T
Sbjct  154   GSRNELMLGNTFAAKQNSKPPNKEVPPKEFNDKVLEGFQVTPLWNQGFICDDGKSDYVET  213

Query  1295  VKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERY  1116
             VKT RWEYSTRP+YGWG+VGS QKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER 
Sbjct  214   VKTTRWEYSTRPVYGWGDVGSTQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERI  273

Query  1115  EFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAA  936
             EFENAPSYSEKNWG  FPRKWFW QCNVFEGA GE++LT+ GGLRQI  PG ++ FENAA
Sbjct  274   EFENAPSYSEKNWGGAFPRKWFWAQCNVFEGASGEIALTAAGGLRQI--PGLTETFENAA  331

Query  935   LIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             LI +HYGG FYEFVPWNG V+WE++ WG+W+++A+N  +  ++E 
Sbjct  332   LIGIHYGGKFYEFVPWNGVVSWEVATWGYWFMSADNGNYVVELEA  376


 Score =   165 bits (417),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T DPGTTLRAPT E GL+  C+DTC+  L+L+LWERRYDGSKGK ILDVTS+MA
Sbjct  372  VELEATTEDPGTTLRAPTSEAGLSQACKDTCFGILKLKLWERRYDGSKGKIILDVTSDMA  431

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFNTWKG T+ P +  +A+  PVD++G++ L PLFKPPGL
Sbjct  432  ALEVGGGPWFNTWKGKTSTPPVFSRAIGLPVDVDGLYNLFPLFKPPGL  479



>ref|XP_011026617.1| PREDICTED: probable tocopherol cyclase, chloroplastic [Populus 
euphratica]
Length=501

 Score =   542 bits (1397),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/360 (70%), Positives = 296/360 (82%), Gaps = 5/360 (1%)
 Frame = -1

Query  1877  KHLRVGKKSPAFRVKA--VSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFD  1704
             K L++G +S      +  V+  D+ + +   E + ++ PVY PTP +R LRTPHSGYH+D
Sbjct  41    KSLKLGFRSSPLLAASTPVTNADTLLASKG-ENERSVSPVYVPTPPDRVLRTPHSGYHYD  99

Query  1703  GTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGA  1524
             GT R FFEGW+FKVSIPE +Q+FC+MYSVENPAF K L+ +E   +G R  GVGAQILGA
Sbjct  100   GTTRNFFEGWYFKVSIPERKQNFCFMYSVENPAFPKKLTALESALHGSRSVGVGAQILGA  159

Query  1523  DDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLW  1344
              DKYICQ++ ES+NFWG RHEL LGNTF+ +   RPP KEVPPQEF+ RVLEGFQV+PLW
Sbjct  160   YDKYICQFSEESQNFWGSRHELVLGNTFVTERNMRPPTKEVPPQEFDKRVLEGFQVSPLW  219

Query  1343  HQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCM  1164
             HQGFI DDGR+DY +TVKTARW+YSTRP+YGWGNVGS QKSTAGWLAAFPVFEPHWQ+CM
Sbjct  220   HQGFIHDDGRSDYVETVKTARWQYSTRPVYGWGNVGSPQKSTAGWLAAFPVFEPHWQICM  279

Query  1163  AAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGL  984
             A GLSTGWIEWDGER+EFE+APSYSEKNWG  FPRKW+WVQCNVFEGA GEV+LT+ GGL
Sbjct  280   AGGLSTGWIEWDGERFEFEDAPSYSEKNWGGAFPRKWYWVQCNVFEGASGEVALTAAGGL  339

Query  983   RQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
             RQIPGP  S+ FENAAL+ VHY G+FYEFVPWNG V WEISPWG+WY+ A+N TH  ++E
Sbjct  340   RQIPGP--SETFENAALVGVHYHGIFYEFVPWNGVVNWEISPWGYWYMAADNGTHLVELE  397


 Score =   162 bits (409),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T D GT LRAPT E GL+P C+DTC+A L+LQ+WERR DG+KGK ILDVTS+MA
Sbjct  394  VELEATTKDLGTALRAPTAEAGLSPACKDTCFAFLKLQIWERRNDGTKGKLILDVTSDMA  453

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VEVGGGPWF TWKG T+ PE++ + + AP+D++GIF  VPLFKPPGL
Sbjct  454  LVEVGGGPWFTTWKGKTSMPELVSRTIGAPIDMDGIFSFVPLFKPPGL  501



>gb|KHG07989.1| Tocopherol cyclase, chloroplastic -like protein [Gossypium arboreum]
Length=513

 Score =   536 bits (1380),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 252/391 (64%), Positives = 306/391 (78%), Gaps = 10/391 (3%)
 Frame = -1

Query  1964  CCESMETLLACSSAVSPPTQSYTARFSPR-KHLRVG--KKSPAFRVKAVSAPDSAVENPA  1794
             C   + +L + ++     + ++   F  R + LR+G    SP     +++  D+   + A
Sbjct  17    CYIGLRSLNSKTAVKLSQSSNFNGLFPRRLRPLRLGFRSNSPIIACSSIAETDTETSSTA  76

Query  1793  PEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVE  1614
                  ++ PVY PTP+NR  RTPHSGYHFDGT RQFFEGW+FKVSIPE +QSFC+MYSVE
Sbjct  77    SNRPVSVNPVYVPTPANRDTRTPHSGYHFDGTTRQFFEGWYFKVSIPERKQSFCFMYSVE  136

Query  1613  NPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIA  1434
             NP F + L+ +E +Q+G RFTGVGAQILGA DKYICQY+ ES+NFWG RHEL LGNTF+ 
Sbjct  137   NPVFRRKLTQLETLQHGPRFTGVGAQILGAYDKYICQYSDESQNFWGSRHELILGNTFLT  196

Query  1433  QTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIY  1254
                +RPP+KEVPP+EFN +VLEGFQV+PLWHQGFIRDDGRT YA+TVKTA WEY+TRP Y
Sbjct  197   NKNSRPPSKEVPPEEFNRKVLEGFQVSPLWHQGFIRDDGRTSYARTVKTACWEYTTRPTY  256

Query  1253  GWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWG  1074
             GWG+VGSKQKSTAGWLAAFP+FEPHWQ+CMA     GWIEWDGER+EF++APSYSEKNWG
Sbjct  257   GWGDVGSKQKSTAGWLAAFPIFEPHWQICMA-----GWIEWDGERFEFQDAPSYSEKNWG  311

Query  1073  DGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFV  894
               FPRKWFW QCNVFEGA GEV+LT+GGGLRQ+  PG ++ FENAALI VHY G+FYEFV
Sbjct  312   GAFPRKWFWAQCNVFEGASGEVALTAGGGLRQL--PGLTETFENAALIGVHYDGIFYEFV  369

Query  893   PWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             PWNG ++WEI+PWG+W I AEN TH  ++E 
Sbjct  370   PWNGILSWEIAPWGYWCIAAENETHMVELEA  400


 Score =   167 bits (424),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEA T+DPGTTLRAPT E GLAP C+DTC+ +LRLQ+  ++Y G+KGK ILDV S+
Sbjct  394  HMVELEATTNDPGTTLRAPTIEAGLAPACKDTCFGNLRLQIRVKKYGGTKGKLILDVKSD  453

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL*FTGTSK  430
            MA +EVGGGPWFNTWKG T  PE+LK AL  PVD+EGIFGL P FKPPGL    TS+
Sbjct  454  MAALEVGGGPWFNTWKGKTTTPEVLKTALQVPVDVEGIFGLAPFFKPPGLTHHQTSR  510



>ref|XP_006412433.1| hypothetical protein EUTSA_v10025006mg [Eutrema salsugineum]
 dbj|BAJ34420.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53886.1| hypothetical protein EUTSA_v10025006mg [Eutrema salsugineum]
Length=494

 Score =   544 bits (1402),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/393 (66%), Positives = 308/393 (78%), Gaps = 3/393 (1%)
 Frame = -1

Query  1979  VRRRCCCESMETLLACSSAVSPPTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVEN  1800
             +  R    SM T  + S  +S P    T   +P +  ++G +S +    ++S P+S   +
Sbjct  1     METRSLVVSMNTNFS-SYELSLPASPLTRSLAPFRSAKLGSRSISRVSASISTPNSEPSS  59

Query  1799  PAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYS  1620
                +   ++KPVY PTP NR LRTPHSGYHFDGT R+FFEGW+F+VSIPE ++SFC+MYS
Sbjct  60    SGKDAAISVKPVYVPTPPNRDLRTPHSGYHFDGTARKFFEGWYFRVSIPEKKESFCFMYS  119

Query  1619  VENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTF  1440
             VENPAF K LS +E   YG RFTGVGAQILGA+DKYICQYT ES NFWG+RHEL LGNTF
Sbjct  120   VENPAFRKRLSPLEVALYGPRFTGVGAQILGANDKYICQYTQESHNFWGDRHELVLGNTF  179

Query  1439  IAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRP  1260
              A   AR P+KEVPP+EFN RV EGFQVTP WHQG I DDGRTDYA+TVK+ARWEYSTRP
Sbjct  180   SAVPGARSPSKEVPPEEFNRRVSEGFQVTPFWHQGHICDDGRTDYAETVKSARWEYSTRP  239

Query  1259  IYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKN  1080
             +YGWG+VG+KQKSTAGW AAFPVFEPHWQ+CMA GLSTGWIEW GER+EF +APSYSEKN
Sbjct  240   VYGWGDVGAKQKSTAGWPAAFPVFEPHWQICMAGGLSTGWIEWGGERFEFRDAPSYSEKN  299

Query  1079  WGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYE  900
             WG GFPRKWFWVQCNVFEGA GEV+LT+ GGLRQ+  PG ++ +ENAAL+ VH+ G  YE
Sbjct  300   WGGGFPRKWFWVQCNVFEGASGEVALTAAGGLRQL--PGLTETYENAALVCVHFDGKLYE  357

Query  899   FVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             FVPWNG V W++SPWG+WY+TAEN TH  ++E 
Sbjct  358   FVPWNGVVRWDMSPWGYWYMTAENETHMVELEA  390


 Score =   159 bits (402),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEART++ GT LRAPT E GLA  CRD+CY +L+LQ+WER YDGSKGK IL+  S+
Sbjct  384  HMVELEARTNEAGTPLRAPTTEAGLATACRDSCYGELKLQIWERLYDGSKGKVILETKSS  443

Query  600  MAGVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VE+GGGPWF TWKG T+N PE+LK++L  P+D+E +FG VP FKPPGL
Sbjct  444  MAAVEIGGGPWFGTWKGDTSNTPELLKRSLQVPLDLETVFGWVPFFKPPGL  494



>ref|XP_008445022.1| PREDICTED: tocopherol cyclase, chloroplastic isoform X1 [Cucumis 
melo]
Length=517

 Score =   541 bits (1393),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/372 (69%), Positives = 303/372 (81%), Gaps = 8/372 (2%)
 Frame = -1

Query  1901  YTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKE------AIKPVYTPTPSNR  1740
             +  R+     L +  +S + RV A S+      + + +I++         P Y PTP+NR
Sbjct  44    FRLRWGGSSKLELKSRSTSIRVLASSSNSVYESSASLKIEKDDDGGLVCPPGYRPTPANR  103

Query  1739  PLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGR  1560
              LRTPHSGYHFDG+ R+FFEGW+FKVSIP+ RQSFC+MYSVENPAF K L+ ++  Q+G 
Sbjct  104   ELRTPHSGYHFDGSTRKFFEGWYFKVSIPQKRQSFCFMYSVENPAFPKKLTAVDIAQHGP  163

Query  1559  RFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNS  1380
             RFTGVGAQILGA DKYICQY+ ES+NFWG RHELSLGN+F  +   +PPNKEV P+EFN 
Sbjct  164   RFTGVGAQILGAYDKYICQYSEESQNFWGSRHELSLGNSFATKGGFKPPNKEVDPEEFNK  223

Query  1379  RVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAA  1200
             +V+EGFQVTPLWHQGFIRDDGRT+Y +TVKTARWEYS+RP+YGWGNVGSKQKSTAGWLAA
Sbjct  224   KVVEGFQVTPLWHQGFIRDDGRTNYLETVKTARWEYSSRPVYGWGNVGSKQKSTAGWLAA  283

Query  1199  FPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGA  1020
             FPVFEPHWQ+CMA GLSTGWIEW+ ER+EF NAPSYSEKNWG GFPRKWFWVQCNVFEGA
Sbjct  284   FPVFEPHWQICMAGGLSTGWIEWEDERFEFVNAPSYSEKNWGGGFPRKWFWVQCNVFEGA  343

Query  1019  DGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYI  840
              GEV+LT+GGGLRQ+  PG ++ FENAAL+ VHY G+FYEFVPWNG+V WEIS WG+WYI
Sbjct  344   RGEVALTAGGGLRQL--PGLTETFENAALVGVHYDGIFYEFVPWNGTVNWEISTWGYWYI  401

Query  839   TAENATHKSQVE  804
              AEN THK ++E
Sbjct  402   AAENETHKVELE  413


 Score =   161 bits (408),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +VELE +T  PG+ LRAPT E GL   C+DTC+  L+LQ+WERR+DGSKGK +LDVTSN
Sbjct  408  HKVELEGKTDVPGSPLRAPTSECGLDTACKDTCFGTLKLQIWERRFDGSKGKIVLDVTSN  467

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWKG T  PEILK+AL  P+D++  F L+PLFKPPGL
Sbjct  468  MAALEVGGGPWFNTWKGETTTPEILKRALTTPIDVDRAFNLLPLFKPPGL  517



>ref|XP_006450664.1| hypothetical protein CICLE_v10008169mg [Citrus clementina]
 gb|ESR63904.1| hypothetical protein CICLE_v10008169mg [Citrus clementina]
Length=476

 Score =   530 bits (1366),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 242/325 (74%), Positives = 277/325 (85%), Gaps = 3/325 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++ PVY PTP NR LRTPHSGYHFDG+ R+FFEGW+F+VSIPE +QSFC +YSVENPAF 
Sbjct  51    SVNPVYKPTPRNRELRTPHSGYHFDGSTRRFFEGWYFRVSIPERKQSFCIIYSVENPAFK  110

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             K LS +E  Q+G RFTGVG QILGADDKY+C Y+ ES NFWG RHEL LGNTF A   ++
Sbjct  111   KKLSSLEVAQHGPRFTGVGVQILGADDKYMCHYSEESSNFWGSRHELMLGNTFRADKGSQ  170

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP KEVPPQEFN RV EGFQVTPLWHQG I DDGRT++A+TVK+ARWEYSTRP+YGWGNV
Sbjct  171   PPTKEVPPQEFNRRVSEGFQVTPLWHQGCIHDDGRTNFAETVKSARWEYSTRPVYGWGNV  230

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
             GSKQ STAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EF++APSYSEKNWG  FPR
Sbjct  231   GSKQNSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFQDAPSYSEKNWGGAFPR  290

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWVQCNVFEGA GEV+LT+GGGLRQ+P     D+FENAA+I +HY G+ YEFVPWNG 
Sbjct  291   KWFWVQCNVFEGATGEVALTAGGGLRQLP---VLDSFENAAMIGIHYDGILYEFVPWNGV  347

Query  878   VTWEISPWGHWYITAENATHKSQVE  804
             V+WEIS WG+WY  AEN TH  +++
Sbjct  348   VSWEISQWGYWYFAAENQTHMVELK  372


 Score =   171 bits (434),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VEL+A T+ PGTTLRAPT E GLAP C+DTC+ +L LQLWERRYDG+KGK ILDVTS+
Sbjct  367  HMVELKATTNYPGTTLRAPTSEAGLAPACKDTCFGELTLQLWERRYDGTKGKMILDVTSD  426

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWK  T  PE+L++ LN PVD++G+FG VP FKPPGL
Sbjct  427  MAALEVGGGPWFNTWKAKTATPELLRRTLNVPVDVDGLFGSVPFFKPPGL  476



>ref|XP_006476062.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Citrus sinensis]
Length=476

 Score =   528 bits (1359),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/325 (74%), Positives = 276/325 (85%), Gaps = 3/325 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++ PVY PTP NR LRTPHSGYHFDG+ R+FFEGW+F+VSIPE +QSFC +YSVENPAF 
Sbjct  51    SVNPVYKPTPRNRELRTPHSGYHFDGSTRRFFEGWYFRVSIPERKQSFCIIYSVENPAFK  110

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             K LS +E  Q+G RFTGVG QILGADDKY+C Y+ ES NFWG RHEL LGNTF A   ++
Sbjct  111   KKLSSLEVAQHGPRFTGVGVQILGADDKYMCHYSEESSNFWGSRHELMLGNTFRADKGSQ  170

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP KEVPPQEF  RV EGFQVTPLWHQG I DDGRT++A+TVK+ARWEYSTRP+YGWGNV
Sbjct  171   PPTKEVPPQEFKRRVSEGFQVTPLWHQGCIHDDGRTNFAETVKSARWEYSTRPVYGWGNV  230

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
             GSKQ STAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EF++APSYSEKNWG  FPR
Sbjct  231   GSKQNSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFQDAPSYSEKNWGGAFPR  290

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWVQCNVFEGA GEV+LT+GGGLRQ+P     D+FENAA+I +HY G+ YEFVPWNG 
Sbjct  291   KWFWVQCNVFEGATGEVALTAGGGLRQLP---VLDSFENAAMIGIHYDGILYEFVPWNGV  347

Query  878   VTWEISPWGHWYITAENATHKSQVE  804
             V+WEIS WG+WY  AEN TH  +++
Sbjct  348   VSWEISQWGYWYFAAENQTHMVELK  372


 Score =   172 bits (436),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VEL+A T  PGTTLRAPT E GLAP C+DTC+ +L LQLWERRYDG+KGK ILDVTS+
Sbjct  367  HMVELKATTKYPGTTLRAPTSEAGLAPACKDTCFGELTLQLWERRYDGTKGKMILDVTSD  426

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWK  T  PE+L++ LN PVD++G+FG VP FKPPGL
Sbjct  427  MAALEVGGGPWFNTWKAKTATPELLRRTLNVPVDVDGLFGFVPFFKPPGL  476



>ref|XP_006283540.1| hypothetical protein CARUB_v10004591mg [Capsella rubella]
 gb|EOA16438.1| hypothetical protein CARUB_v10004591mg [Capsella rubella]
Length=520

 Score =   538 bits (1386),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/389 (67%), Positives = 303/389 (78%), Gaps = 4/389 (1%)
 Frame = -1

Query  1970  RCCCESMETLLACSSAVSPPTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAP  1791
             R    SM   L+ S  +S P    T    P K  ++  +S      ++S P+S   +   
Sbjct  31    RSLVVSMNPNLS-SFELSRPVSPITRSLVPFKSAKLRPRSIPRVSASISTPNSETSSSDT  89

Query  1790  EIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVEN  1611
             + K ++KP+Y PTP NR LRTPHSGYHFDGT R+FFEGW+F+VSIPE R+SFC+MYSVEN
Sbjct  90    D-KISVKPLYVPTPPNRELRTPHSGYHFDGTARKFFEGWYFRVSIPEKRESFCFMYSVEN  148

Query  1610  PAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQ  1431
             PAF + LS +E   YG RFTGVGAQILGA+DKYICQYT +S NFWG+RHEL LGNTF A 
Sbjct  149   PAFRQSLSPLETALYGPRFTGVGAQILGANDKYICQYTQQSHNFWGDRHELVLGNTFSAV  208

Query  1430  TAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYG  1251
               A PPNKEVPP+EFN+RV EGFQ TP WHQG I DDGRTDY + VK+ARWEYSTRP+YG
Sbjct  209   PGATPPNKEVPPEEFNTRVSEGFQATPFWHQGHICDDGRTDYTEIVKSARWEYSTRPVYG  268

Query  1250  WGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGD  1071
             WG+VG+KQKSTAGW A FPVFEPHWQ+CMA GLSTGWIEW GER+EF +APSYSEKNWG 
Sbjct  269   WGDVGAKQKSTAGWPAVFPVFEPHWQICMAGGLSTGWIEWGGERFEFRDAPSYSEKNWGG  328

Query  1070  GFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVP  891
             GFPRKWFWVQCNVFEGA GEV+LT+GGGLR++  PG ++ FENAAL+ VHY G  YEFVP
Sbjct  329   GFPRKWFWVQCNVFEGASGEVALTAGGGLREL--PGLTETFENAALVCVHYDGKLYEFVP  386

Query  890   WNGSVTWEISPWGHWYITAENATHKSQVE  804
             WNG V WE+SPWG+WYITAEN TH  ++E
Sbjct  387   WNGVVRWEMSPWGYWYITAENETHMVELE  415


 Score =   161 bits (408),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEART + GT LRAPT E+GLA  CRD+CY +L+LQ+WER YDGSKGK IL+  S+
Sbjct  410  HMVELEARTDEAGTPLRAPTTEVGLATACRDSCYGELKLQIWERLYDGSKGKVILETKSS  469

Query  600  MAGVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VE+GGGPWF TWKG T+N PE+LK+AL  P+D+E  FGLVP FKPPGL
Sbjct  470  MAAVEIGGGPWFGTWKGDTSNTPELLKRALQVPLDLETTFGLVPFFKPPGL  520



>ref|XP_007012100.1| Tocopherol cyclase, chloroplast / vitamin E deficient 1 (VTE1) 
/ sucrose export defective 1 (SXD1) isoform 2 [Theobroma cacao]
 gb|EOY29719.1| Tocopherol cyclase, chloroplast / vitamin E deficient 1 (VTE1) 
/ sucrose export defective 1 (SXD1) isoform 2 [Theobroma cacao]
Length=452

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/393 (69%), Positives = 315/393 (80%), Gaps = 8/393 (2%)
 Frame = -1

Query  1964  CCESMETLLACSSAVSPPTQSYTARFSPR--KHLRVGKKSPA--FRVKAVSAPDSAVENP  1797
             CC     L +  +     + ++   FSPR  + LRVG +S +      +V+ P++   +P
Sbjct  17    CCIGFRPLNSKPTVKFSQSSTFNG-FSPRGLRPLRVGFRSNSRIIACSSVAEPETGTSSP  75

Query  1796  APEIKE-AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYS  1620
             A E    ++ PVY PTP+NR  RTPHSGYHFDGT RQFFEGW+FKV+IPE RQSFC+MYS
Sbjct  76    AAESSAVSVNPVYVPTPANRNARTPHSGYHFDGTTRQFFEGWYFKVAIPEQRQSFCFMYS  135

Query  1619  VENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTF  1440
             VENPAF + L+ +E +Q+G RFTGVGAQILGA DKYICQYT ES+NFWG RHEL LGNTF
Sbjct  136   VENPAFRRKLTPLEMLQHGPRFTGVGAQILGAYDKYICQYTEESQNFWGSRHELILGNTF  195

Query  1439  IAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRP  1260
             +A   +RPP+KEVPPQEFN +VLEGFQV+PLWHQGFIRDDGRT YA  VKTARWEYSTRP
Sbjct  196   LANKDSRPPSKEVPPQEFNRKVLEGFQVSPLWHQGFIRDDGRTTYANIVKTARWEYSTRP  255

Query  1259  IYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKN  1080
             IYGWGNVGSKQKSTAGWLAA P+FEPHWQ+CMA GLSTGWIEWD ER+EF+NAPSYSEKN
Sbjct  256   IYGWGNVGSKQKSTAGWLAALPIFEPHWQICMAGGLSTGWIEWDSERFEFQNAPSYSEKN  315

Query  1079  WGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYE  900
             WG GFPRKWFW QCNVFEGA GEVSLT+GGGLRQ+  PG ++ FENAALI VHY GVFYE
Sbjct  316   WGGGFPRKWFWAQCNVFEGASGEVSLTAGGGLRQL--PGLTETFENAALIGVHYDGVFYE  373

Query  899   FVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             FVPWNG V+WEI+ WG WY+ A+N TH +++E 
Sbjct  374   FVPWNGVVSWEIAQWGSWYMEAKNETHMAELEA  406


 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGK  625
               ELEA T+DPGTTLRAPT   GLAP C+DTC+ DLRL++WE++  G+KGK
Sbjct  400  HMAELEATTNDPGTTLRAPTTVAGLAPACKDTCFGDLRLKIWEKKSGGTKGK  451



>gb|EPS71540.1| chloroplast tocopherol cyclase, partial [Genlisea aurea]
Length=456

 Score =   543 bits (1398),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/328 (75%), Positives = 282/328 (86%), Gaps = 1/328 (0%)
 Frame = -1

Query  1787  IKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENP  1608
             I    +P Y PTP NR LRTPHSGYHFDGT R FFEGW+FKVSIPECRQSFC+MYSVE+P
Sbjct  26    IAVDFRPAYQPTPRNRVLRTPHSGYHFDGTTRNFFEGWYFKVSIPECRQSFCFMYSVESP  85

Query  1607  AFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQT  1428
             AF   L+ +EE++YG +FTGVGAQILGADDKYICQY+ ES+NFWG R EL LGNTF+ + 
Sbjct  86    AFPNKLTTLEEIRYGTKFTGVGAQILGADDKYICQYSEESQNFWGNRDELMLGNTFLPKK  145

Query  1427  AARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGW  1248
              A PP  E+PPQEF+ RVLEGFQVTPLWHQGFIRDDGRT+Y +TV+TARWEYSTRP+YGW
Sbjct  146   NAEPPKNEIPPQEFSRRVLEGFQVTPLWHQGFIRDDGRTNYVETVRTARWEYSTRPVYGW  205

Query  1247  GNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDG  1068
             G+VGSKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDG RYEF++APSYSEKNWG  
Sbjct  206   GDVGSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGTRYEFKDAPSYSEKNWGGA  265

Query  1067  FPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPW  888
             FPRKWFWVQCN FEGADGEV+LT+ GGLRQIP   T+  FEN A+I VH  G+FYEFVPW
Sbjct  266   FPRKWFWVQCNAFEGADGEVALTAAGGLRQIPSL-TTQTFENVAMIGVHCSGIFYEFVPW  324

Query  887   NGSVTWEISPWGHWYITAENATHKSQVE  804
             NG+V WEI+PWGHW ++AEN TH+ ++E
Sbjct  325   NGAVEWEIAPWGHWRMSAENETHEVKLE  352


 Score =   153 bits (386),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +V+LEA+T + GTTLRAPT E GLAP C+DTC+AD+RL+LWE+RYDGS+GK ILDVTSN
Sbjct  347  HEVKLEAKTPESGTTLRAPTSEGGLAPACKDTCFADMRLRLWEKRYDGSEGKVILDVTSN  406

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VEVGGGPWF+TWKG + + + + + +   +D+E +F L P  KPPGL
Sbjct  407  MAAVEVGGGPWFSTWKGKSRSVDAVARVVGLRIDVEALFVLTPFLKPPGL  456



>gb|KDO79770.1| hypothetical protein CISIN_1g011258mg [Citrus sinensis]
Length=490

 Score =   523 bits (1346),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 243/339 (72%), Positives = 278/339 (82%), Gaps = 17/339 (5%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++ PVY PTP NR LRTPHSGYHFDG+ R+FFEGW+F+VSIPE +QSFC +YSVENPAF 
Sbjct  51    SVNPVYKPTPRNRELRTPHSGYHFDGSTRRFFEGWYFRVSIPERKQSFCIIYSVENPAFK  110

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             K LS +E  Q+G RFTGVG QILGADDKY+C Y+ ES NFWG RHEL LGNTF A   ++
Sbjct  111   KKLSSLEVAQHGPRFTGVGVQILGADDKYMCHYSEESSNFWGSRHELMLGNTFRADKGSQ  170

Query  1418  PPNKEVPPQ--------------EFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTAR  1281
             PP KEVPPQ              EFN RVLEGFQVTPLWHQG I DDGRT++A+TVK+AR
Sbjct  171   PPTKEVPPQVRGSYLLLHGFSWQEFNRRVLEGFQVTPLWHQGCIHDDGRTNFAETVKSAR  230

Query  1280  WEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENA  1101
             WEYSTRP+YGWGNVGSKQ STAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EF++A
Sbjct  231   WEYSTRPVYGWGNVGSKQNSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFQDA  290

Query  1100  PSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVH  921
             PSYSEKNWG  FPRKWFWVQCNVFEGA GEV+LT+GGGLRQ+P     D+FENAA+I +H
Sbjct  291   PSYSEKNWGGAFPRKWFWVQCNVFEGATGEVALTAGGGLRQLP---VLDSFENAAMIGIH  347

Query  920   YGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
             Y G+ YEFVPWNG V+WEIS WG+WY  AEN TH  +++
Sbjct  348   YDGILYEFVPWNGVVSWEISQWGYWYFAAENQTHMVELK  386


 Score =   172 bits (437),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VEL+A T  PGTTLRAPT E GLAP C+DTC+ +L LQLWERRYDG+KGK ILDVTS+
Sbjct  381  HMVELKATTKYPGTTLRAPTSEAGLAPACKDTCFGELTLQLWERRYDGTKGKMILDVTSD  440

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWK  T  PE+L++ LN PVD++G+FG VP FKPPGL
Sbjct  441  MAALEVGGGPWFNTWKAKTATPELLRRTLNVPVDVDGLFGFVPFFKPPGL  490



>ref|XP_003636442.1| Tocopherol cyclase [Medicago truncatula]
Length=480

 Score =   529 bits (1362),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/346 (72%), Positives = 291/346 (84%), Gaps = 6/346 (2%)
 Frame = -1

Query  1835  KAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSI  1656
             K + A +S  E    +  ++ KP+Y+PTP NR LRTPHSGYHFDGT R+FFEGW+FKVSI
Sbjct  37    KLIIAHNSHTEQ---QQSQSSKPIYSPTPPNRQLRTPHSGYHFDGTARKFFEGWYFKVSI  93

Query  1655  PECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFW  1476
             PE RQSFC+MYSVENPAF K LS +E  QYG RFTGVGAQILGADDKYICQYTP+S NFW
Sbjct  94    PEKRQSFCFMYSVENPAFRKELSTLELAQYGPRFTGVGAQILGADDKYICQYTPQSPNFW  153

Query  1475  GERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKT  1296
             G R+EL LGNTF A+  ++PPNKEVPP+EFN +VLEGFQVTPLW+QGFI DDGR+DY +T
Sbjct  154   GSRNELMLGNTFAAKQNSKPPNKEVPPKEFNDKVLEGFQVTPLWNQGFICDDGRSDYVET  213

Query  1295  VKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERY  1116
             VKTARWEYSTRP+YGWG+VGS QKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER 
Sbjct  214   VKTARWEYSTRPVYGWGDVGSTQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERI  273

Query  1115  EFENAPSYSEKNWGDGFPRKWFWV-QCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENA  939
             EFENAPSYSEKNWG  FPR  F + QCNVFEGA GE++LT+ GGLRQI  PG ++ FENA
Sbjct  274   EFENAPSYSEKNWGGAFPRNGFGIAQCNVFEGASGEIALTAAGGLRQI--PGLTETFENA  331

Query  938   ALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             ALI +HYGG FYEFVPWNG V+WE++ WG+W+++A+N  +  ++E 
Sbjct  332   ALIGIHYGGKFYEFVPWNGVVSWEVATWGYWFMSADNGNYVVELEA  377


 Score =   166 bits (420),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T DPGTTLRAPT E GL+  C+DTC+  L+L+LWERRYDGSKGK ILDVTS+MA
Sbjct  373  VELEATTEDPGTTLRAPTSEAGLSQACKDTCFGILKLKLWERRYDGSKGKIILDVTSDMA  432

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFNTWKG T+ P +L +A+  PVD++G++ L PLFKPPGL
Sbjct  433  ALEVGGGPWFNTWKGKTSTPPVLSRAIGLPVDVDGLYNLFPLFKPPGL  480



>gb|KHF98490.1| Tocopherol cyclase, chloroplastic -like protein [Gossypium arboreum]
Length=503

 Score =   540 bits (1390),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/366 (69%), Positives = 300/366 (82%), Gaps = 11/366 (3%)
 Frame = -1

Query  1889  FSPR--KHLRVG--KKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPH  1722
             FSPR  + LR+G    SP    ++VS  ++   +PA +   ++ PVY PTP NR  RTPH
Sbjct  41    FSPRELRPLRLGFRSNSPVVACRSVSEIETETSSPAAKRSVSVSPVYVPTPVNRDTRTPH  100

Query  1721  SGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVG  1542
             SGYHFDGT RQFFEGW+FKVSIPE +QSFC+MYSVENPAF + L+ +E +Q+G RFTGVG
Sbjct  101   SGYHFDGTTRQFFEGWYFKVSIPERKQSFCFMYSVENPAFKRTLTPLEMLQHGPRFTGVG  160

Query  1541  AQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGF  1362
             AQ+LGA  KYICQY+ ES+NFWG RHEL+LGNTF+A  A+RPP+KEVPPQEFN +VLEGF
Sbjct  161   AQVLGAKGKYICQYSEESQNFWGSRHELTLGNTFVANKASRPPSKEVPPQEFNRKVLEGF  220

Query  1361  QVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEP  1182
             QV+PLW+QGFI DDGRT YAKTVKTARWEYSTRPIYGWG+VGSKQKSTAGW AA P+FEP
Sbjct  221   QVSPLWNQGFICDDGRTYYAKTVKTARWEYSTRPIYGWGDVGSKQKSTAGWAAALPIFEP  280

Query  1181  HWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSL  1002
             HWQ+CMA+     WIEWDGER+EF++APSYSEKNWG GFPRKWFW QCNVFEGA G++SL
Sbjct  281   HWQICMAS-----WIEWDGERFEFQDAPSYSEKNWGGGFPRKWFWAQCNVFEGASGKISL  335

Query  1001  TSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENAT  822
             T+ GGLRQ+  PG ++ FEN ALI VHY G+FYEFVPWNG VTWEI+ WG+W I AEN T
Sbjct  336   TAAGGLRQL--PGLTETFENTALIGVHYDGIFYEFVPWNGVVTWEIAQWGYWNIAAENKT  393

Query  821   HKSQVE  804
             H  ++E
Sbjct  394   HMVELE  399


 Score =   154 bits (390),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEA T+D GTTLRAPT E GL P C DTC  DL L++WE+   GSKGK ILDV S+
Sbjct  394  HMVELEATTTDSGTTLRAPTVEAGLTPACLDTCLGDLTLKIWEKNVGGSKGKLILDVKSD  453

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWKG T  PE++K AL  P+D+E IFGL P  KPPGL
Sbjct  454  MAALEVGGGPWFNTWKGKTTTPEVIKSALQVPIDVECIFGLAPFLKPPGL  503



>gb|AFB74210.1| tocopherol cyclase [Brassica napus]
 emb|CDY13502.1| BnaA03g52200D [Brassica napus]
Length=490

 Score =   532 bits (1370),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/390 (66%), Positives = 297/390 (76%), Gaps = 7/390 (2%)
 Frame = -1

Query  1970  RCCCESMETLLACSSAVSPPTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAP  1791
             R    SM T  A        +   +A+ SPR   R         +   ++  S   N   
Sbjct  4     RSLAVSMNTNFASFDLSRHLSPLRSAKLSPRSIPRASAS-----ISTTNSDSSPSGNAIN  58

Query  1790  EIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVEN  1611
                 ++KPVY PTP NR LRTPHSGYHFDGT R+FFEGW+F+VSIPE R+SFC+MYSVEN
Sbjct  59    SEAISVKPVYVPTPPNRELRTPHSGYHFDGTARKFFEGWYFRVSIPEKRESFCFMYSVEN  118

Query  1610  PAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQ  1431
             PAF K LS +E   YG RFTGVGAQILGA+DKY+CQYT +S NFWG+RHEL LGNTF A 
Sbjct  119   PAFRKRLSPLEVGLYGPRFTGVGAQILGANDKYLCQYTEDSHNFWGDRHELVLGNTFSAM  178

Query  1430  TAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYG  1251
               AR P+KEVPP+EFN RV EGFQ TP WHQG I DDGRTDYA+TVK+ARWEYSTRP+YG
Sbjct  179   PGARSPDKEVPPEEFNRRVSEGFQATPFWHQGHICDDGRTDYAETVKSARWEYSTRPVYG  238

Query  1250  WGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGD  1071
             WG+VG+KQKSTAGW AAFPVFEPHWQ+CMA GLSTGWIEW  ER+EF +APSYSEKNWG 
Sbjct  239   WGDVGTKQKSTAGWPAAFPVFEPHWQICMAGGLSTGWIEWGDERFEFRDAPSYSEKNWGG  298

Query  1070  GFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVP  891
             GFPRKWFWVQCNVFEGA GE++LT+ GGLRQ+  PG ++ FENAAL+ VHY G  YEFVP
Sbjct  299   GFPRKWFWVQCNVFEGAKGEIALTAAGGLRQL--PGLTETFENAALVCVHYDGKLYEFVP  356

Query  890   WNGSVTWEISPWGHWYITAENATHKSQVEV  801
             WNG V+WE+SPWG+WY+TAEN TH  ++E 
Sbjct  357   WNGVVSWEMSPWGYWYMTAENETHMVELEA  386


 Score =   161 bits (408),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEART++ GT LRAPT E GLA  C+D+CY +L+LQ+WERRYDGSKGK I++  S+
Sbjct  380  HMVELEARTNEAGTPLRAPTSEAGLATACKDSCYGELKLQIWERRYDGSKGKVIMEAKSS  439

Query  600  MAGVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VE+GGGPWF TWKG T+N PE+LK++L  P+D+E +FG VP FKPPGL
Sbjct  440  MAAVEIGGGPWFGTWKGDTSNTPELLKRSLQVPLDLESVFGWVPFFKPPGL  490



>ref|XP_009138143.1| PREDICTED: tocopherol cyclase, chloroplastic [Brassica rapa]
Length=490

 Score =   532 bits (1370),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/390 (66%), Positives = 297/390 (76%), Gaps = 7/390 (2%)
 Frame = -1

Query  1970  RCCCESMETLLACSSAVSPPTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAP  1791
             R    S  T  A      P +   +A+ SPR   R         +   ++  S   N   
Sbjct  4     RSLAVSTNTNFASFDLSRPFSPLRSAKLSPRSIPRASAS-----ISTTNSDSSPSGNAIN  58

Query  1790  EIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVEN  1611
                 ++KPVY PTP NR LRTPHSGYHFDGT R+FFEGW+F+VSIPE R+SFC+MYSVEN
Sbjct  59    SEAISVKPVYVPTPPNRELRTPHSGYHFDGTARKFFEGWYFRVSIPEKRESFCFMYSVEN  118

Query  1610  PAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQ  1431
             PAF K LS +E   YG RFTGVGAQILGA+DKY+CQYT +S NFWG+RHEL LGNTF A 
Sbjct  119   PAFRKRLSPLEVGLYGPRFTGVGAQILGANDKYLCQYTEDSHNFWGDRHELVLGNTFSAM  178

Query  1430  TAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYG  1251
               AR P+KEVPP+EFN RV EGFQ TP WHQG I DDGRTDYA+TVK+ARWEYSTRP+YG
Sbjct  179   PGARSPDKEVPPEEFNRRVSEGFQATPFWHQGHICDDGRTDYAETVKSARWEYSTRPVYG  238

Query  1250  WGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGD  1071
             WG+VG+KQKSTAGW AAFPVFEPHWQ+CMA GLSTGWIEW  ER+EF +APSYSEKNWG 
Sbjct  239   WGDVGTKQKSTAGWPAAFPVFEPHWQICMAGGLSTGWIEWGDERFEFRDAPSYSEKNWGG  298

Query  1070  GFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVP  891
             GFPRKWFWVQCNVFEGA GE++LT+ GGLRQ+  PG ++ FENAAL+ VHY G  YEFVP
Sbjct  299   GFPRKWFWVQCNVFEGAKGEIALTAAGGLRQL--PGLTETFENAALVCVHYDGKLYEFVP  356

Query  890   WNGSVTWEISPWGHWYITAENATHKSQVEV  801
             WNG V+WE+SPWG+WY+TAEN TH  ++E 
Sbjct  357   WNGVVSWEMSPWGYWYMTAENETHMVELEA  386


 Score =   161 bits (407),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEART++ GT LRAPT E GLA  C+D+CY +L+LQ+WERRYDGSKGK I++  S+
Sbjct  380  HMVELEARTNEAGTPLRAPTSEAGLATACKDSCYGELKLQIWERRYDGSKGKVIMEAKSS  439

Query  600  MAGVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VE+GGGPWF TWKG T+N PE+LK++L  P+D+E +FG VP FKPPGL
Sbjct  440  MAAVEIGGGPWFGTWKGDTSNTPELLKRSLQVPLDLESVFGWVPFFKPPGL  490



>emb|CDX72372.1| BnaC07g43940D [Brassica napus]
Length=490

 Score =   528 bits (1361),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 253/383 (66%), Positives = 297/383 (78%), Gaps = 5/383 (1%)
 Frame = -1

Query  1940  LACSSAVSPPTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKE---AIK  1770
             LA S   +  +   +   SP +  ++  +S      ++S  +S        I     ++K
Sbjct  6     LAVSMNTNFASFDLSRHLSPLRSTKLSPRSIPRASASISTTNSETSPSGNAINSEAISVK  65

Query  1769  PVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPL  1590
             PVY PTP NR LRTPHSGYHFDGT R+FFEGW+F+VSIPE R+SFC+MYSVENPAF K L
Sbjct  66    PVYVPTPPNRELRTPHSGYHFDGTARKFFEGWYFRVSIPEKRESFCFMYSVENPAFRKRL  125

Query  1589  SGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPN  1410
             S +E   YG RFTGVGAQILGA+DKY+CQYT +S NFWG+RHEL LGNTF A+   R P+
Sbjct  126   SPLEVGLYGPRFTGVGAQILGANDKYLCQYTEDSHNFWGDRHELVLGNTFSAKPGTRSPD  185

Query  1409  KEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSK  1230
             KEVPP+EFN RV EGFQ TP WHQG I DDGRTDYA+TVK+ARWEYSTRP+YGWG+VG+K
Sbjct  186   KEVPPEEFNRRVSEGFQATPFWHQGHICDDGRTDYAETVKSARWEYSTRPVYGWGDVGTK  245

Query  1229  QKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWF  1050
             QKSTAGW AAFPVFEPHWQ+CMA GLSTGWIEW  ER+EF +APSYSEKNWG GFPRKWF
Sbjct  246   QKSTAGWPAAFPVFEPHWQICMAGGLSTGWIEWGDERFEFRDAPSYSEKNWGGGFPRKWF  305

Query  1049  WVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTW  870
             WVQCNVFE A GEV+LT+ GGLRQ+  PG ++ FENAALI VHY G  YEFVPWNG V+W
Sbjct  306   WVQCNVFERAKGEVALTAAGGLRQL--PGLTETFENAALICVHYDGKLYEFVPWNGVVSW  363

Query  869   EISPWGHWYITAENATHKSQVEV  801
             E+SPWG+WY+TAEN TH  ++E 
Sbjct  364   EMSPWGYWYMTAENETHMVELEA  386


 Score =   164 bits (416),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEART++ GT LRAPT E GLA  C+D+CY +L+LQ+WERRYDGSKGK I++  S+
Sbjct  380  HMVELEARTNEAGTPLRAPTSEAGLATACKDSCYGELKLQIWERRYDGSKGKVIMEAKSS  439

Query  600  MAGVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VE+GGGPWF TWKG T+N PE+LK++L  P+DIE +FGLVP FKPPGL
Sbjct  440  MAAVEIGGGPWFGTWKGDTSNTPELLKRSLQVPLDIESVFGLVPFFKPPGL  490



>gb|ADC91914.1| tocopherol cyclase [Lactuca sativa]
Length=506

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/364 (73%), Positives = 301/364 (83%), Gaps = 7/364 (2%)
 Frame = -1

Query  1892  RFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPE-IKEAIKPVYTPTPSNRPLRTPHSG  1716
             +F  ++ L V K  P    KA     S VE  A E +KE + PVY PTPSNRPLRTPHSG
Sbjct  49    KFEGKRRLSVVKSIP----KAEINDSSTVEVKATEDVKEIVNPVYVPTPSNRPLRTPHSG  104

Query  1715  YHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQ  1536
             YHFDGT R+FFEGW+FKVSIPE +Q+FC+MYSVENPAF KPL+G+E++QYG+RFTGVGAQ
Sbjct  105   YHFDGTTRKFFEGWYFKVSIPERKQNFCFMYSVENPAFKKPLNGLEQLQYGQRFTGVGAQ  164

Query  1535  ILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQV  1356
             ILGA+D+YICQYT ES NFWG RHEL LGN+F  Q   +PPN EV PQ FN  V+EGFQV
Sbjct  165   ILGANDEYICQYTEESHNFWGSRHELKLGNSFTLQNGKKPPNNEVSPQVFNQSVVEGFQV  224

Query  1355  TPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHW  1176
             TPLW+QGFIRDD +T YAKTVKTARWEYSTRP+YGWGNVGS QKSTAGWLAAFPVFEPHW
Sbjct  225   TPLWNQGFIRDDEKTPYAKTVKTARWEYSTRPVYGWGNVGSTQKSTAGWLAAFPVFEPHW  284

Query  1175  QVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTS  996
             Q+CMA GLSTGWIEW  ERYEF+NAPSYSEKNWG GFPRKWFWVQCNVF+GA GEV LT 
Sbjct  285   QICMAGGLSTGWIEWGEERYEFQNAPSYSEKNWGGGFPRKWFWVQCNVFKGASGEVGLTC  344

Query  995   GGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHK  816
              GGLRQ+  PG S+ FENAALI VHYGG+FYEFVPWNG V WE++ WG+W++TA N THK
Sbjct  345   AGGLRQL--PGLSETFENAALIGVHYGGIFYEFVPWNGVVEWEVTQWGYWHVTAYNETHK  402

Query  815   SQVE  804
              ++E
Sbjct  403   IELE  406


 Score =   151 bits (382),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 88/124 (71%), Gaps = 4/124 (3%)
 Frame = -3

Query  822  TQVTSGSITEIIICEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRY  643
            TQ     +T      ++ELEA T DPGTTLRAPT E G A  C+DTC ADL L++WE+  
Sbjct  387  TQWGYWHVTAYNETHKIELEASTKDPGTTLRAPTTEAGFAAACKDTCTADLTLKIWEK--  444

Query  642  DGSKGKAILDVTSNMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFK  463
              + GK ILDVTS+MA VEVGGGPWFNTWKG T  PEI+ +A+N P+D+EGI G  PL K
Sbjct  445  --ANGKLILDVTSDMAAVEVGGGPWFNTWKGRTYTPEIVSRAINLPIDVEGILGSFPLLK  502

Query  462  PPGL  451
            PPGL
Sbjct  503  PPGL  506



>ref|XP_004501172.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Cicer arietinum]
Length=483

 Score =   530 bits (1365),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/320 (77%), Positives = 276/320 (86%), Gaps = 2/320 (1%)
 Frame = -1

Query  1763  YTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSG  1584
             Y+PTP NR LRTPHSGYHFDGT R+FFEGW+FKVSIPE RQSFC+MYSVENPAF K L+ 
Sbjct  62    YSPTPPNRQLRTPHSGYHFDGTARKFFEGWYFKVSIPERRQSFCFMYSVENPAFRKQLTP  121

Query  1583  IEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKE  1404
              E  QYG RFTGVGAQILGADDKYICQYTPES NFWG RHEL LGNTF A+  + PPNKE
Sbjct  122   FELAQYGPRFTGVGAQILGADDKYICQYTPESHNFWGSRHELMLGNTFAAKQNSIPPNKE  181

Query  1403  VPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQK  1224
             V PQEFN RVLEGFQVTPLW+QG I DDGR++Y KTVKTARWEYSTRP+YGWG+VGS QK
Sbjct  182   VTPQEFNDRVLEGFQVTPLWNQGSICDDGRSNYVKTVKTARWEYSTRPVYGWGDVGSTQK  241

Query  1223  STAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWV  1044
             STAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER EF+NAPSYSEKNWG  FPRKWFW 
Sbjct  242   STAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERIEFDNAPSYSEKNWGGAFPRKWFWA  301

Query  1043  QCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEI  864
             QCNVFEGA GE++LT+ GGLRQI  PG ++ FENAALI +HY G FYEFVPWNG VTWE+
Sbjct  302   QCNVFEGASGEIALTAAGGLRQI--PGLTETFENAALIGIHYSGKFYEFVPWNGVVTWEV  359

Query  863   SPWGHWYITAENATHKSQVE  804
             + WG+W+++AEN  +  ++E
Sbjct  360   ATWGYWFMSAENGNYVVELE  379


 Score =   162 bits (411),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELE    DPGTTLRAPT E GL+  C+DTC+  L+L+LWERRYDGSKGK ILDVTS+MA
Sbjct  376  VELEGTADDPGTTLRAPTSEAGLSQACKDTCFGILKLKLWERRYDGSKGKMILDVTSDMA  435

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWF+TWKG T+ P IL +A+  PVD++GI+ L PLFKPPGL
Sbjct  436  ALEVGGGPWFSTWKGKTSTPPILSRAIGLPVDVDGIYNLFPLFKPPGL  483



>ref|NP_567906.1| tocopherol cyclase [Arabidopsis thaliana]
 sp|Q94FY7.1|TOCC_ARATH RecName: Full=Tocopherol cyclase, chloroplastic; AltName: Full=Sucrose 
export defective 1; AltName: Full=Vitamin E pathway 
gene 1 protein; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK60503.1|AF302188_1 sucrose export defective 1 precursor [Arabidopsis thaliana]
 dbj|BAE98687.1| sucrose export defective 1 precursor [Arabidopsis thaliana]
 gb|AEE86116.1| tocopherol cyclase [Arabidopsis thaliana]
Length=488

 Score =   531 bits (1369),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 257/389 (66%), Positives = 302/389 (78%), Gaps = 9/389 (2%)
 Frame = -1

Query  1970  RCCCESMETLLACSSAVSPPTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAP  1791
             R    SM   L+ S  +S P    T    P +  ++  +S +    ++S P+S  +    
Sbjct  4     RSLIVSMNPNLS-SFELSRPVSPLTRSLVPFRSTKLVPRSISRVSASISTPNSETD----  58

Query  1790  EIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVEN  1611
               K ++KPVY PT  NR LRTPHSGYHFDGT R+FFEGW+F+VSIPE R+SFC+MYSVEN
Sbjct  59    --KISVKPVYVPTSPNRELRTPHSGYHFDGTPRKFFEGWYFRVSIPEKRESFCFMYSVEN  116

Query  1610  PAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQ  1431
             PAF + LS +E   YG RFTGVGAQILGA+DKY+CQY  +S NFWG+RHEL LGNTF A 
Sbjct  117   PAFRQSLSPLEVALYGPRFTGVGAQILGANDKYLCQYEQDSHNFWGDRHELVLGNTFSAV  176

Query  1430  TAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYG  1251
               A+ PNKEVPP+EFN RV EGFQ TP WHQG I DDGRTDYA+TVK+ARWEYSTRP+YG
Sbjct  177   PGAKAPNKEVPPEEFNRRVSEGFQATPFWHQGHICDDGRTDYAETVKSARWEYSTRPVYG  236

Query  1250  WGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGD  1071
             WG+VG+KQKSTAGW AAFPVFEPHWQ+CMA GLSTGWIEW GER+EF +APSYSEKNWG 
Sbjct  237   WGDVGAKQKSTAGWPAAFPVFEPHWQICMAGGLSTGWIEWGGERFEFRDAPSYSEKNWGG  296

Query  1070  GFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVP  891
             GFPRKWFWVQCNVFEGA GEV+LT+GGGLRQ+  PG ++ +ENAAL+ VHY G  YEFVP
Sbjct  297   GFPRKWFWVQCNVFEGATGEVALTAGGGLRQL--PGLTETYENAALVCVHYDGKMYEFVP  354

Query  890   WNGSVTWEISPWGHWYITAENATHKSQVE  804
             WNG V WE+SPWG+WYITAEN  H  ++E
Sbjct  355   WNGVVRWEMSPWGYWYITAENENHVVELE  383


 Score =   161 bits (407),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEART++ GT LRAPT E+GLA  CRD+CY +L+LQ+WER YDGSKGK IL+  S+MA
Sbjct  380  VELEARTNEAGTPLRAPTTEVGLATACRDSCYGELKLQIWERLYDGSKGKVILETKSSMA  439

Query  594  GVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VE+GGGPWF TWKG T+N PE+LKQAL  P+D+E   GLVP FKPPGL
Sbjct  440  AVEIGGGPWFGTWKGDTSNTPELLKQALQVPLDLESALGLVPFFKPPGL  488



>ref|XP_010432668.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Camelina sativa]
Length=486

 Score =   529 bits (1363),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/345 (72%), Positives = 289/345 (84%), Gaps = 2/345 (1%)
 Frame = -1

Query  1835  KAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSI  1656
             +++SA  S+    +   K ++KPVY PTP NR LRTPHSGYHFDGT R+FFEGW+F+VSI
Sbjct  40    RSISASISSETPSSNTDKISVKPVYIPTPPNRELRTPHSGYHFDGTARKFFEGWYFRVSI  99

Query  1655  PECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFW  1476
             PE ++SFC+MYSVENPAF + LS +E   +G RFTGVGAQILGA DKY+CQYT +S NFW
Sbjct  100   PEKKESFCFMYSVENPAFRQRLSPLETALHGPRFTGVGAQILGAYDKYLCQYTQDSHNFW  159

Query  1475  GERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKT  1296
             G+RHEL LGNTF A   A PPNKEVPP++FN+RV EGFQ TP WHQG I DDGRTDYA+T
Sbjct  160   GDRHELVLGNTFSAVPGATPPNKEVPPEDFNTRVSEGFQATPFWHQGHICDDGRTDYAET  219

Query  1295  VKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERY  1116
             V +ARWEYSTRP+YGWG+VG+KQKSTAGW AAFPVFEPHWQ+CMA GLSTGWIEW GER+
Sbjct  220   VTSARWEYSTRPVYGWGDVGAKQKSTAGWPAAFPVFEPHWQICMAGGLSTGWIEWGGERF  279

Query  1115  EFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAA  936
             EF +APSYSEKNWG GFPRKWFWVQCNVFEGA GEV+LT+GGGLRQ+  PG ++ +ENAA
Sbjct  280   EFRDAPSYSEKNWGGGFPRKWFWVQCNVFEGASGEVALTAGGGLRQL--PGLTETYENAA  337

Query  935   LIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             L+ VHY G FYEFVPWNG V WE+SPWG+WYITAEN TH  ++E 
Sbjct  338   LVCVHYDGKFYEFVPWNGVVRWEMSPWGYWYITAENETHMVELEA  382


 Score =   161 bits (407),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEART++ GT LRAPT E+GLA  CRD+CY +L+LQ+WER YDGSKGK IL+  S+
Sbjct  376  HMVELEARTNEAGTPLRAPTTEVGLATACRDSCYGELKLQIWERLYDGSKGKVILETKSS  435

Query  600  MAGVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VE+GGGPWF TWKG T+N PE+LK+AL  P+D+E  FGLVP FKPPGL
Sbjct  436  MAAVEIGGGPWFGTWKGDTSNTPELLKRALQVPLDLETAFGLVPFFKPPGL  486



>gb|AFB74209.1| tocopherol cyclase [Brassica napus]
Length=490

 Score =   529 bits (1362),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 253/383 (66%), Positives = 297/383 (78%), Gaps = 5/383 (1%)
 Frame = -1

Query  1940  LACSSAVSPPTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKE---AIK  1770
             LA S   +  +   +   SP +  ++  +S      ++S  +S        I     ++K
Sbjct  6     LAVSMNTNFASFDLSRHLSPLRSTKLSPRSIPRASASISTTNSETSPSGNAINSEAISVK  65

Query  1769  PVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPL  1590
             PVY PTP NR LRTPHSGYHFDGT R+FFEGW+F+VSIPE R+SFC+MYSVENPAF K L
Sbjct  66    PVYVPTPPNRELRTPHSGYHFDGTARKFFEGWYFRVSIPEKRESFCFMYSVENPAFRKRL  125

Query  1589  SGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPN  1410
             S +E   YG RFTGVGAQILGA+DKY+CQYT +S NFWG+RHEL LGNTF A+   R P+
Sbjct  126   SPLEVGLYGPRFTGVGAQILGANDKYLCQYTEDSHNFWGDRHELVLGNTFSAKPGTRSPD  185

Query  1409  KEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSK  1230
             KEVPP+EFN RV EGFQ TP WHQG I DDGRTDYA+TVK+ARWEYSTRP+YGWG+VG+K
Sbjct  186   KEVPPEEFNRRVSEGFQATPFWHQGHICDDGRTDYAETVKSARWEYSTRPVYGWGDVGTK  245

Query  1229  QKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWF  1050
             QKSTAGW AAFPVFEPHWQ+CMA GLSTGWIEW  ER+EF +APSYSEKNWG GFPRKWF
Sbjct  246   QKSTAGWPAAFPVFEPHWQICMAGGLSTGWIEWGDERFEFRDAPSYSEKNWGGGFPRKWF  305

Query  1049  WVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTW  870
             WVQCNVFE A GEV+LT+ GGLRQ+  PG ++ FENAALI VHY G  YEFVPWNG V+W
Sbjct  306   WVQCNVFERAKGEVALTAAGGLRQL--PGLTETFENAALICVHYDGKLYEFVPWNGVVSW  363

Query  869   EISPWGHWYITAENATHKSQVEV  801
             E+SPWG+WY+TAEN TH  ++E 
Sbjct  364   EMSPWGYWYMTAENETHMVELEA  386


 Score =   161 bits (407),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEART++ GT LRAPT E GLA  C+D+CY +L+LQ+WERRYDGSKGK I++  S+
Sbjct  380  HMVELEARTNEAGTPLRAPTSEAGLATACKDSCYGELKLQIWERRYDGSKGKVIMEAKSS  439

Query  600  MAGVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VE+GGGPWF TWKG T+N PE+LK++L  P+DIE +FGLVP FKPP L
Sbjct  440  MAAVEIGGGPWFGTWKGDTSNTPELLKRSLQVPLDIESVFGLVPFFKPPIL  490



>ref|XP_002869246.1| hypothetical protein ARALYDRAFT_491430 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45505.1| hypothetical protein ARALYDRAFT_491430 [Arabidopsis lyrata subsp. 
lyrata]
Length=482

 Score =   531 bits (1368),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/375 (68%), Positives = 300/375 (80%), Gaps = 7/375 (2%)
 Frame = -1

Query  1925  AVSPPTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEI-KEAIKPVYTPTP  1749
             +++P   S+       + LR  K  P    +++S   +++  PA +  K ++KPVY PTP
Sbjct  9     SMNPNFSSFELSRPVTRSLRSTKLVP----RSISRVSASISTPASDTDKISVKPVYVPTP  64

Query  1748  SNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQ  1569
              NR LRTPHSGYHFDGT R+FFEGW+F+VSIP+ R+SFC+MYSVENPAF + LS +E   
Sbjct  65    PNRELRTPHSGYHFDGTARKFFEGWYFRVSIPDKRESFCFMYSVENPAFRQRLSPLEVAL  124

Query  1568  YGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQE  1389
             +G RFTGVGAQILGA+DKY+CQYT ES NFWG+RHEL LGNTF A   A  PNKEVPP+E
Sbjct  125   HGPRFTGVGAQILGANDKYLCQYTQESHNFWGDRHELVLGNTFSAVPGANSPNKEVPPEE  184

Query  1388  FNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGW  1209
             FN RV EGFQ TP WHQG I DDGRTDYA+TVK+ARWEYSTRP+YGWG+VG+KQKSTAGW
Sbjct  185   FNRRVSEGFQATPFWHQGHICDDGRTDYAETVKSARWEYSTRPVYGWGDVGAKQKSTAGW  244

Query  1208  LAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVF  1029
              AAFPVFEPHWQ+CMA GLSTGWIEW GER+EF +APSYSEKNWG GFPRKWFWVQCNVF
Sbjct  245   PAAFPVFEPHWQICMAGGLSTGWIEWGGERFEFRDAPSYSEKNWGGGFPRKWFWVQCNVF  304

Query  1028  EGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGH  849
             EGA GEV+LT+GGGLRQ+  PG ++ +ENAAL+ VHY G   EFVPWNG V WE+SPWG+
Sbjct  305   EGASGEVALTAGGGLRQL--PGLTETYENAALVCVHYDGKLSEFVPWNGVVRWEMSPWGY  362

Query  848   WYITAENATHKSQVE  804
             WYITAEN TH  ++E
Sbjct  363   WYITAENETHMVELE  377


 Score =   158 bits (399),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEART++ GT LRAPT E+GLA  CRD+CY +L+L++WER YDGSKGK IL+  S+
Sbjct  372  HMVELEARTNEAGTPLRAPTTEVGLATACRDSCYGELKLRIWERLYDGSKGKVILETKSS  431

Query  600  MAGVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VE+GGGPWF TWKG T+N PE+LK+AL  P+D+E   GLVP FKPPGL
Sbjct  432  MAAVEIGGGPWFGTWKGDTSNTPELLKRALQVPLDLESTLGLVPFFKPPGL  482



>gb|KFK29888.1| hypothetical protein AALP_AA7G191900 [Arabis alpina]
Length=487

 Score =   531 bits (1367),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 297/368 (81%), Gaps = 8/368 (2%)
 Frame = -1

Query  1886  SPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKE------AIKPVYTPTPSNRPLRTP  1725
             +P + +++  +S +    ++S PDS        I        ++KPVY PTP NR LRTP
Sbjct  18    TPFRSVKLNLRSISRVSASISTPDSKTSPSGNAIDTEKDTAISVKPVYVPTPPNRELRTP  77

Query  1724  HSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGV  1545
             HSGYHF+G+ R+FFEGW+F+VSIPE ++SFC+MYSVENPAF K LS +E   YG RFTGV
Sbjct  78    HSGYHFNGSPRKFFEGWYFRVSIPEKKESFCFMYSVENPAFRKKLSPLEVGLYGPRFTGV  137

Query  1544  GAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEG  1365
             GAQILGA++KYICQYT ES NFWG+RHEL LGNTF A+  AR PNKEVPP+EFN RV EG
Sbjct  138   GAQILGANEKYICQYTEESHNFWGDRHELVLGNTFNAKPGARSPNKEVPPEEFNKRVSEG  197

Query  1364  FQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFE  1185
             FQ TP WHQG I DDGRTDYA+TVK+ARWEYSTRP+YGWG+VG+KQKSTAGW AAFPVFE
Sbjct  198   FQATPFWHQGHICDDGRTDYAETVKSARWEYSTRPVYGWGDVGAKQKSTAGWPAAFPVFE  257

Query  1184  PHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVS  1005
             PHWQ+CMA GLSTGWIEW GER+EF +APSYSEKNWG GFPRKWFWVQCNVFEGA GEV+
Sbjct  258   PHWQICMAGGLSTGWIEWGGERFEFRDAPSYSEKNWGGGFPRKWFWVQCNVFEGASGEVA  317

Query  1004  LTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENA  825
             LT+ GGLRQ+  PG ++ +ENAAL+ VH+ G FYEFVPWN  VTWE+SPWG+WY+TAEN 
Sbjct  318   LTAAGGLRQL--PGLTETYENAALVCVHHDGKFYEFVPWNAVVTWEMSPWGYWYMTAENE  375

Query  824   THKSQVEV  801
             TH  ++E 
Sbjct  376   THIVELEA  383


 Score =   158 bits (400),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEART++ GT LRAPT E GL   CRD+CY +L+LQ+WER YDGSKGK IL+  S+MA
Sbjct  379  VELEARTNEAGTPLRAPTTEAGLVTACRDSCYGELKLQIWERLYDGSKGKVILETKSSMA  438

Query  594  GVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VE+GGGPWF TWKG T+  P +LKQAL  P+D+E +FGLVP FKPPGL
Sbjct  439  AVEIGGGPWFGTWKGDTSKTPALLKQALQVPLDLESVFGLVPFFKPPGL  487



>ref|XP_007137202.1| hypothetical protein PHAVU_009G108200g [Phaseolus vulgaris]
 gb|ESW09196.1| hypothetical protein PHAVU_009G108200g [Phaseolus vulgaris]
Length=411

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/401 (66%), Positives = 316/401 (79%), Gaps = 22/401 (5%)
 Frame = -1

Query  1871  LRVGKKSPAFRVKAVSA-PDSAVENPAPEIKEAIK--PVYTPTPSNRPLRTPHSGYHFDG  1701
             LR    +P  R+ A S+  DS      P+   ++K  P Y+PTP NR LRTPHSGYHFDG
Sbjct  28    LRFPSTTPTTRLLAHSSLSDSVPVQNTPQTPPSVKVQPTYSPTPPNRDLRTPHSGYHFDG  87

Query  1700  TRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGAD  1521
             T R+FFEGW+FKVSIPE RQSFC+MYSVE+P+F KPLS +E+VQYG RFTGVGAQILGAD
Sbjct  88    TARKFFEGWYFKVSIPERRQSFCFMYSVESPSFRKPLSPLEQVQYGPRFTGVGAQILGAD  147

Query  1520  DKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWH  1341
             DKYICQY+PES+ FWG RHEL+LGNTF+    ++PPNKE+PPQEFN RVLEGFQVTPLW+
Sbjct  148   DKYICQYSPESQFFWGSRHELTLGNTFVPNQNSKPPNKELPPQEFNDRVLEGFQVTPLWN  207

Query  1340  QGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMA  1161
             QGFI+DDGR++Y +TVKTARWEYST P+YGWG+VGS QKSTAGWLAAFPVFEPHWQ+CMA
Sbjct  208   QGFIQDDGRSNYVETVKTARWEYSTLPVYGWGDVGSTQKSTAGWLAAFPVFEPHWQICMA  267

Query  1160  AGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLR  981
             AGLSTGWIEWDGER EFENAPSYSEKNWG GFPRKWFWVQCNVFEG  GE++LT+ GGLR
Sbjct  268   AGLSTGWIEWDGERIEFENAPSYSEKNWGGGFPRKWFWVQCNVFEGGSGEIALTAAGGLR  327

Query  980   QIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             QI  PG ++ FENAALI +H  G FYEFVPWNG V WE++ WG+W++TA+N  +      
Sbjct  328   QI--PGITETFENAALIGIHCDGKFYEFVPWNGIVNWEVTTWGYWFMTADNGKY------  379

Query  800   *RR**YVSRWNLKQERVTRAQHCVPLLKRWVLLLYVEILVM  678
                        +KQ+++ +  HCV   ++  L L V+I V+
Sbjct  380   -----------VKQQQMIQVLHCVLQQQKLALPLLVKIHVL  409



>ref|XP_010437856.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Camelina sativa]
Length=487

 Score =   529 bits (1362),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/345 (72%), Positives = 290/345 (84%), Gaps = 3/345 (1%)
 Frame = -1

Query  1835  KAVSAPDSAVENPAPEI-KEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVS  1659
             +++SA  S+   P+  + K ++KPVY PTP NR LRTPHSGYHFDGT R+FFEGW+F+VS
Sbjct  40    RSISASISSETPPSDTVDKISVKPVYVPTPPNRELRTPHSGYHFDGTARKFFEGWYFRVS  99

Query  1658  IPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNF  1479
             IPE ++SFC+MYSVENPAF + LS +E   +G RFTGVGAQILGA DKY+CQYT +S NF
Sbjct  100   IPEKKESFCFMYSVENPAFRQRLSPLEVALHGPRFTGVGAQILGAYDKYLCQYTQDSHNF  159

Query  1478  WGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAK  1299
             WG+RHEL LGNTF A   A PPNKEVPP+EFN+RV +GFQ TP WHQG I DDGRTDY +
Sbjct  160   WGDRHELVLGNTFSAVPGATPPNKEVPPEEFNTRVSQGFQATPFWHQGHICDDGRTDYTE  219

Query  1298  TVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGER  1119
             TV +ARWEYSTRP+YGWG+VG KQKSTAGWLAAFPVFEPHWQ+C+A GLSTGWIEW GER
Sbjct  220   TVTSARWEYSTRPVYGWGDVGPKQKSTAGWLAAFPVFEPHWQICIAGGLSTGWIEWGGER  279

Query  1118  YEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENA  939
             +EF +APSYSEKNWG GFPRKWFWVQCNVFEGA GEV+LT+GGGLRQ+  PG ++ +ENA
Sbjct  280   FEFRDAPSYSEKNWGGGFPRKWFWVQCNVFEGASGEVALTAGGGLRQL--PGLTETYENA  337

Query  938   ALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
             AL+ VHY G FYEFVPWNG V WE+SPWG+WYITAEN TH  ++E
Sbjct  338   ALVCVHYDGKFYEFVPWNGVVRWEMSPWGYWYITAENETHMGELE  382


 Score =   159 bits (402),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = -3

Query  771  ELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMAG  592
            ELEART++ GT LRAPT E+GLA  CRD+CY +L+LQ+WER YDGSKGK IL+  S+MA 
Sbjct  380  ELEARTNEAGTPLRAPTTEVGLATACRDSCYGELKLQIWERLYDGSKGKVILETKSSMAA  439

Query  591  VEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            VE+GGGPWF TWKG T+N PE+LK+AL  P+D+E  FGLVP FKPPGL
Sbjct  440  VEIGGGPWFGTWKGDTSNTPELLKRALQVPLDLETAFGLVPFFKPPGL  487



>ref|XP_010447345.1| PREDICTED: tocopherol cyclase, chloroplastic [Camelina sativa]
Length=486

 Score =   528 bits (1361),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/344 (72%), Positives = 288/344 (84%), Gaps = 2/344 (1%)
 Frame = -1

Query  1835  KAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSI  1656
             +++SA  S+    +   K ++KPVY PTP NR LRTPHSGYHFDGT R+FFEGW+F+VSI
Sbjct  40    RSISASVSSETPSSNTDKISVKPVYVPTPPNRELRTPHSGYHFDGTARKFFEGWYFRVSI  99

Query  1655  PECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFW  1476
             PE ++SFC+MYSVENPAF + LS +E   +G RFTGVGAQILGA DKY+CQYT +S NFW
Sbjct  100   PEKKESFCFMYSVENPAFRQRLSPLEVALHGPRFTGVGAQILGASDKYLCQYTQDSHNFW  159

Query  1475  GERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKT  1296
             G+RHEL LGNTF A   A PPNKEVPP++FN+RV EGFQ TP WHQG I DDGRTDYA+T
Sbjct  160   GDRHELVLGNTFSAVPGATPPNKEVPPEDFNTRVSEGFQATPFWHQGHICDDGRTDYAET  219

Query  1295  VKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERY  1116
             V +ARWEYSTRP+YGWG+VG+KQKSTAGW AAFPVFEPHWQ+CMA GLSTGWIEW GER+
Sbjct  220   VTSARWEYSTRPVYGWGDVGAKQKSTAGWPAAFPVFEPHWQICMAGGLSTGWIEWGGERF  279

Query  1115  EFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAA  936
             EF +APSYSEKNWG GFPRKWFWVQCNVFEGA GEV+LT+GGGLRQ+  PG ++ +ENAA
Sbjct  280   EFRDAPSYSEKNWGGGFPRKWFWVQCNVFEGASGEVALTAGGGLRQL--PGLTETYENAA  337

Query  935   LIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
             L+ VHY G  YEFVPWNG V WE+SPWG+WYITAEN TH  ++E
Sbjct  338   LVCVHYDGKLYEFVPWNGVVRWEMSPWGYWYITAENETHMVELE  381


 Score =   160 bits (404),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEART++ GT LRAPT E+GLA  CRD+CY +L+LQ+WER YDGSKGK IL+  S+
Sbjct  376  HMVELEARTNEAGTPLRAPTTEVGLATACRDSCYGELKLQIWERLYDGSKGKVILETKSS  435

Query  600  MAGVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            +A VE+GGGPWF TWKG T+N PE+LK+AL  P+D+E  FGLVP FKPPGL
Sbjct  436  LAAVEIGGGPWFGTWKGDTSNTPELLKRALQVPLDLETAFGLVPFFKPPGL  486



>ref|XP_010526177.1| PREDICTED: tocopherol cyclase, chloroplastic isoform X3 [Tarenaya 
hassleriana]
Length=440

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/326 (79%), Positives = 288/326 (88%), Gaps = 2/326 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++KPVY PTPSNR LRTPHSGYHFDGT R+FFEGW+FKVSIPE +QSFC+MYSVENPAF 
Sbjct  71    SVKPVYVPTPSNRELRTPHSGYHFDGTTRKFFEGWYFKVSIPERKQSFCFMYSVENPAFP  130

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             K LS ++   YG RFTGVGAQILGA DKYICQYT ES+NFWG+RHEL LGNTF A   AR
Sbjct  131   KKLSPLDMALYGPRFTGVGAQILGAYDKYICQYTQESQNFWGDRHELVLGNTFAAVEGAR  190

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP+KEVPP+EFN RV EGFQVTPLWHQG+I DDGRT+Y +TVK+ARWEYSTRP+YGWGNV
Sbjct  191   PPSKEVPPEEFNKRVSEGFQVTPLWHQGYICDDGRTNYLETVKSARWEYSTRPVYGWGNV  250

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
             GSKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EFE+APSYSEKNWG GFPR
Sbjct  251   GSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFEDAPSYSEKNWGGGFPR  310

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWVQCNVFEGADGEV+ T+ GGLRQ+  PG ++ FENAALI VHY G+FYEFVPWNG 
Sbjct  311   KWFWVQCNVFEGADGEVAFTAAGGLRQL--PGLTETFENAALIGVHYDGIFYEFVPWNGV  368

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             + WE++PWG+WY+TAEN TH  +VE 
Sbjct  369   LKWEMTPWGYWYMTAENETHVVEVEA  394


 Score = 87.4 bits (215),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGK  625
            VE+EART++ GT LRAPT E GLAP CRD+CY +LRLQLWERRYDGSKGK
Sbjct  390  VEVEARTNEAGTPLRAPTMESGLAPACRDSCYGELRLQLWERRYDGSKGK  439



>ref|XP_010526174.1| PREDICTED: tocopherol cyclase, chloroplastic isoform X1 [Tarenaya 
hassleriana]
Length=538

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/326 (79%), Positives = 288/326 (88%), Gaps = 2/326 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++KPVY PTPSNR LRTPHSGYHFDGT R+FFEGW+FKVSIPE +QSFC+MYSVENPAF 
Sbjct  71    SVKPVYVPTPSNRELRTPHSGYHFDGTTRKFFEGWYFKVSIPERKQSFCFMYSVENPAFP  130

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             K LS ++   YG RFTGVGAQILGA DKYICQYT ES+NFWG+RHEL LGNTF A   AR
Sbjct  131   KKLSPLDMALYGPRFTGVGAQILGAYDKYICQYTQESQNFWGDRHELVLGNTFAAVEGAR  190

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP+KEVPP+EFN RV EGFQVTPLWHQG+I DDGRT+Y +TVK+ARWEYSTRP+YGWGNV
Sbjct  191   PPSKEVPPEEFNKRVSEGFQVTPLWHQGYICDDGRTNYLETVKSARWEYSTRPVYGWGNV  250

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
             GSKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EFE+APSYSEKNWG GFPR
Sbjct  251   GSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFEDAPSYSEKNWGGGFPR  310

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWVQCNVFEGADGEV+ T+ GGLRQ+  PG ++ FENAALI VHY G+FYEFVPWNG 
Sbjct  311   KWFWVQCNVFEGADGEVAFTAAGGLRQL--PGLTETFENAALIGVHYDGIFYEFVPWNGV  368

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             + WE++PWG+WY+TAEN TH  +VE 
Sbjct  369   LKWEMTPWGYWYMTAENETHVVEVEA  394


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYD  640
            VE+EART++ GT LRAPT E GLAP CRD+CY +LRLQLWERRYD
Sbjct  390  VEVEARTNEAGTPLRAPTMESGLAPACRDSCYGELRLQLWERRYD  434



>ref|XP_008365124.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Malus domestica]
Length=485

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/371 (71%), Positives = 305/371 (82%), Gaps = 13/371 (4%)
 Frame = -1

Query  1913  PTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPL  1734
             P  S++++ S  + L++G     FR  + + P S  ++     K A   VY PTP NR L
Sbjct  25    PLLSHSSKRSSLRTLKLG-----FRTTS-TVPSSTAQD-----KAAASSVYVPTPRNRDL  73

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             RTPHSGYHFDGT R+FFEGW+FKV+IPE RQSFC+MYSVENPAF KPL+ +E VQ G R 
Sbjct  74    RTPHSGYHFDGTSRKFFEGWYFKVAIPERRQSFCFMYSVENPAFXKPLTALELVQNGPRS  133

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             TGVGAQILGA DKYICQY+ ES+NFWG R EL LGNTFIA+  ++PPN EV P+EF+SRV
Sbjct  134   TGVGAQILGAYDKYICQYSEESQNFWGSRDELMLGNTFIAEKQSKPPNNEVLPKEFDSRV  193

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EGFQVTPLWHQG IRDDGR+DY +TV +ARWEYSTRPIYGWG+VGSKQKSTAGWLAAFP
Sbjct  194   TEGFQVTPLWHQGSIRDDGRSDYVETVPSARWEYSTRPIYGWGDVGSKQKSTAGWLAAFP  253

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             VFEPHWQ+CM+ GLSTGWIEWDGER+EFENAPSYSEKNWG  FPRKWFWVQCNVFEGA G
Sbjct  254   VFEPHWQICMSGGLSTGWIEWDGERFEFENAPSYSEKNWGGAFPRKWFWVQCNVFEGATG  313

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             EV+LTSGGGLRQ+  PG +++FENAALI VHYGG FYEFVPWNG V+WEI+PWG+W ITA
Sbjct  314   EVALTSGGGLRQL--PGLTESFENAALIGVHYGGKFYEFVPWNGVVSWEIAPWGYWSITA  371

Query  833   ENATHKSQVEV  801
             EN TH  ++E 
Sbjct  372   ENETHMVELEA  382


 Score =   171 bits (434),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -3

Query  804  SITEIIICEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGK  625
            SIT       VELEA T DPGTTLRAPT E GLAP C+D+C+ DL+L++WERRYDG+KGK
Sbjct  368  SITAENETHMVELEATTEDPGTTLRAPTSEAGLAPACKDSCFGDLKLKMWERRYDGNKGK  427

Query  624  AILDVTSNMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             ILDVTSNMA VEVGGGPWF+TWK     PE L +AL  PVD+EG++ LVPLFKP GL
Sbjct  428  VILDVTSNMAAVEVGGGPWFSTWKVKATTPEHLSRALRVPVDVEGMYNLVPLFKPAGL  485



>ref|XP_008783245.1| PREDICTED: probable tocopherol cyclase, chloroplastic [Phoenix 
dactylifera]
Length=492

 Score =   528 bits (1360),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/365 (68%), Positives = 293/365 (80%), Gaps = 5/365 (1%)
 Frame = -1

Query  1895  ARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSG  1716
             A FS R+    G++    R + V+   S   +   E   ++ PVY PTP +R LRTPHSG
Sbjct  31    APFSLRRPFPAGEQGLRARSRVVA---SVAVSGGEETAASVAPVYKPTPPDRELRTPHSG  87

Query  1715  YHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQ  1536
             YHFDGT R FFEGW+FKVSIPEC+QSFC+MYSVENPAF   +S +++  +G RFTGVGAQ
Sbjct  88    YHFDGTPRPFFEGWYFKVSIPECKQSFCFMYSVENPAFLNGMSMLDKALHGPRFTGVGAQ  147

Query  1535  ILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQV  1356
             ILGADDKYICQ+T  SKNFWG RHEL+LGNTFIA   + PP+ EVPPQEF  RV EGFQV
Sbjct  148   ILGADDKYICQFTETSKNFWGSRHELTLGNTFIAGKDSAPPDGEVPPQEFRKRVEEGFQV  207

Query  1355  TPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHW  1176
             +P+WHQGFIRDDGR+ Y +TVKTA WEYSTRP+YGWG+V SKQKSTAGWLAAFPVFEPHW
Sbjct  208   SPIWHQGFIRDDGRSKYVQTVKTASWEYSTRPVYGWGDVKSKQKSTAGWLAAFPVFEPHW  267

Query  1175  QVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTS  996
             QVCMAAGLSTGWIEWDGER+EFENAPSYSEKNWG GFPRKWF VQCNVFEGA G V+LT+
Sbjct  268   QVCMAAGLSTGWIEWDGERFEFENAPSYSEKNWGGGFPRKWFQVQCNVFEGASGAVALTA  327

Query  995   GGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHK  816
              GG+R++   G +DNFEN ALI VH  G+FYEFVPW G+V+WEI+ WG+W+++AEN  H 
Sbjct  328   AGGMRKL--SGLADNFENVALIGVHCEGIFYEFVPWTGTVSWEIATWGYWHMSAENDKHM  385

Query  815   SQVEV  801
              ++E 
Sbjct  386   VELEA  390


 Score =   152 bits (383),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 85/110 (77%), Gaps = 1/110 (1%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEA T +PGT LRAPT E GL   C+DTC  DLRLQLWERRYDGSKGK ILDVTSN
Sbjct  384  HMVELEATTREPGTPLRAPTMEAGLVTACKDTCLGDLRLQLWERRYDGSKGKMILDVTSN  443

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWF+ WKGT+++ E++ +AL  PVD+E +  L P  +PPGL
Sbjct  444  MAALEVGGGPWFSEWKGTSSSSELVSRALRVPVDVESLVPL-PFLRPPGL  492



>ref|XP_004150291.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Cucumis sativus]
Length=472

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 304/376 (81%), Gaps = 10/376 (3%)
 Frame = -1

Query  1910  TQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKE-------AIKPVYTPT  1752
             + S+  R      L +  +S + RV A S+ +S  E+PA    E          P Y PT
Sbjct  41    SSSFRLRSGGSSKLELKSRSTSIRVLA-SSSNSVYESPASSKIEKDDDGGLVCPPGYRPT  99

Query  1751  PSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEV  1572
             P+NR LRTPHSGYHFDG+ R+FFEGW+FKVSIP+ RQSFC+MYSVENPAF K L+ ++  
Sbjct  100   PANRELRTPHSGYHFDGSTRKFFEGWYFKVSIPQKRQSFCFMYSVENPAFPKKLTAVDIA  159

Query  1571  QYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQ  1392
             Q+G RFTGVGAQILGA DKYICQY+ ES+NFWG RHELSLGN+F  +   +PPNKEV P+
Sbjct  160   QHGPRFTGVGAQILGAYDKYICQYSEESQNFWGSRHELSLGNSFATKGGFKPPNKEVDPE  219

Query  1391  EFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAG  1212
             EFN +V+EGFQVTPLWHQGFIRDDGRT+Y +TVKTARWEYS+RP+YGWGNVGSKQKSTAG
Sbjct  220   EFNKKVVEGFQVTPLWHQGFIRDDGRTNYLETVKTARWEYSSRPVYGWGNVGSKQKSTAG  279

Query  1211  WLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNV  1032
             WLAAFPVFEPHWQ+CMA GLSTGWIEW+ ER+EF NAPSYSEKNWG GFPRKWFWVQCNV
Sbjct  280   WLAAFPVFEPHWQICMAGGLSTGWIEWEDERFEFVNAPSYSEKNWGGGFPRKWFWVQCNV  339

Query  1031  FEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWG  852
             FEGA GEV+LT+GGGLRQ+  PG ++ FENAAL+ VHY G FYEFVPWNG+V WEI+ WG
Sbjct  340   FEGARGEVALTAGGGLRQL--PGLTETFENAALVGVHYDGTFYEFVPWNGTVNWEINTWG  397

Query  851   HWYITAENATHKSQVE  804
             +WYI AEN THK ++E
Sbjct  398   YWYIAAENETHKVELE  413


 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +VELE +T +PG+ LRAPT E GL   C+DTC+  L+LQ+WERR+DGSKGK +LDVTSN
Sbjct  408  HKVELEGKTDEPGSPLRAPTSECGLDTACKDTCFGTLKLQIWERRFDGSKGKIVLDVTSN  467

Query  600  M  598
            +
Sbjct  468  I  468



>ref|XP_010915874.1| PREDICTED: probable tocopherol cyclase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=492

 Score =   533 bits (1373),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 294/368 (80%), Gaps = 5/368 (1%)
 Frame = -1

Query  1895  ARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSG  1716
             A FS R     G++    R + V+A      +   E   ++ PVY PTP +R LRTPHSG
Sbjct  31    APFSFRPSFPAGEQGLRARSRVVAA---VAVSGGEETAASVAPVYKPTPPDRELRTPHSG  87

Query  1715  YHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQ  1536
             YHFDGT R FFEGW+FKVSIPEC+QSFC+MYSVENPAF   +S +++  +G RFTGVGAQ
Sbjct  88    YHFDGTARAFFEGWYFKVSIPECKQSFCFMYSVENPAFPNGMSTLDKALHGPRFTGVGAQ  147

Query  1535  ILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQV  1356
             ILGADDKYICQ+T +SKNFWG RHEL LGNTF+A   + PP+ EVPPQEF  RVLEGFQV
Sbjct  148   ILGADDKYICQFTEKSKNFWGSRHELILGNTFVAGNGSAPPDGEVPPQEFRKRVLEGFQV  207

Query  1355  TPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHW  1176
             +P+WHQGFIRDDGR+ Y +TVKTA WEYST P+YGWG+VGSKQKSTAGWLAAFPVFEPHW
Sbjct  208   SPIWHQGFIRDDGRSKYVQTVKTASWEYSTHPVYGWGDVGSKQKSTAGWLAAFPVFEPHW  267

Query  1175  QVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTS  996
             QVCMAAGLSTGWIEW GER+EFENAPSYSEKNWG GFPRKWFWVQCNVFEGA G VSLT+
Sbjct  268   QVCMAAGLSTGWIEWGGERFEFENAPSYSEKNWGGGFPRKWFWVQCNVFEGASGAVSLTA  327

Query  995   GGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHK  816
              GG+R++   G +DNFEN AL+ VH  GVFYEFVPW G+V+WEI+ WG+W+I+AEN  H 
Sbjct  328   AGGMRKL--SGLADNFENVALVGVHCEGVFYEFVPWTGTVSWEIATWGYWHISAENEKHI  385

Query  815   SQVEV*RR  792
              ++E   R
Sbjct  386   VELEATTR  393


 Score =   144 bits (362),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T +PGT LRAPT E GL   C+DTC  DLRLQLWERRYDGSKGK ILDVTSNMA
Sbjct  386  VELEATTREPGTPLRAPTTEAGLVTACKDTCLGDLRLQLWERRYDGSKGKMILDVTSNMA  445

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIE  493
             +EVGGGPWF+ WKGT+ +PE++ +AL  PVD+E
Sbjct  446  ALEVGGGPWFSDWKGTSLSPELISRALRIPVDVE  479



>gb|ACD50891.1| tocopherol cyclase [Phaseolus vulgaris]
Length=494

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/401 (66%), Positives = 313/401 (78%), Gaps = 22/401 (5%)
 Frame = -1

Query  1871  LRVGKKSPAFRVKAVSA-PDSAVENPAPEIKEAIK--PVYTPTPSNRPLRTPHSGYHFDG  1701
             LR    +P  R+ A S+  DS      P+   ++K  P Y+PTP NR LRTPHSGYHFDG
Sbjct  28    LRFPSTTPTTRLLAHSSLSDSVPVQNTPQTPPSVKVQPTYSPTPPNRDLRTPHSGYHFDG  87

Query  1700  TRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGAD  1521
             T R+FFEGW+FKVSIPE RQSFC+MYSVE+P+F KPLS +E+VQYG RFTGVGAQILGAD
Sbjct  88    TSRKFFEGWYFKVSIPERRQSFCFMYSVESPSFRKPLSPLEQVQYGPRFTGVGAQILGAD  147

Query  1520  DKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWH  1341
             DKYICQY+PES+ FWG RHEL+LGNTF+    ++PPNKE+PPQEFN RVLEGFQVTPLW+
Sbjct  148   DKYICQYSPESQFFWGSRHELTLGNTFVPNQNSKPPNKELPPQEFNDRVLEGFQVTPLWN  207

Query  1340  QGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMA  1161
             QGFI+DDGR++Y +TVKTARWEYST P+YGWG+VGS QKSTAGWLAAFPVFEPHWQ+CMA
Sbjct  208   QGFIQDDGRSNYVETVKTARWEYSTLPVYGWGDVGSTQKSTAGWLAAFPVFEPHWQICMA  267

Query  1160  AGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLR  981
             AGLSTGWIEWDGER EFENAPSYSEKNWG GFPRKWFWVQCNVFEG  GE++LT+ GGLR
Sbjct  268   AGLSTGWIEWDGERIEFENAPSYSEKNWGGGFPRKWFWVQCNVFEGGSGEIALTAAGGLR  327

Query  980   QIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             QI  PG ++ FENAALI +H  G FYEFVPWNG V WE++  G+W++TA+N  +      
Sbjct  328   QI--PGITETFENAALIGIHCDGKFYEFVPWNGIVNWEVTTCGYWFMTADNGKY------  379

Query  800   *RR**YVSRWNLKQERVTRAQHCVPLLKRWVLLLYVEILVM  678
                        +KQ+++ +  HCV   ++  L L  +I V 
Sbjct  380   -----------VKQQQMIQVLHCVLQQQKLALPLLCKIHVF  409


 Score =   110 bits (274),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -3

Query  720  QEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMAGVEVGGGPWFNTWKGTTN  541
            Q++ L  +C+   +  L+LQ+WERRYDGSKGK IL+V+SNMA +EVGGGPWF+TWKG T+
Sbjct  396  QKLALPLLCKIHVFGSLKLQMWERRYDGSKGKIILNVSSNMAALEVGGGPWFDTWKGKTS  455

Query  540  APEILKQALNAPVDIEGIFGL  478
             P  L+ AL  P+D+E IF L
Sbjct  456  TPAALRSALELPIDVEAIFNL  476



>ref|XP_008445023.1| PREDICTED: tocopherol cyclase, chloroplastic isoform X2 [Cucumis 
melo]
Length=500

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/372 (69%), Positives = 303/372 (81%), Gaps = 8/372 (2%)
 Frame = -1

Query  1901  YTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKE------AIKPVYTPTPSNR  1740
             +  R+     L +  +S + RV A S+      + + +I++         P Y PTP+NR
Sbjct  44    FRLRWGGSSKLELKSRSTSIRVLASSSNSVYESSASLKIEKDDDGGLVCPPGYRPTPANR  103

Query  1739  PLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGR  1560
              LRTPHSGYHFDG+ R+FFEGW+FKVSIP+ RQSFC+MYSVENPAF K L+ ++  Q+G 
Sbjct  104   ELRTPHSGYHFDGSTRKFFEGWYFKVSIPQKRQSFCFMYSVENPAFPKKLTAVDIAQHGP  163

Query  1559  RFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNS  1380
             RFTGVGAQILGA DKYICQY+ ES+NFWG RHELSLGN+F  +   +PPNKEV P+EFN 
Sbjct  164   RFTGVGAQILGAYDKYICQYSEESQNFWGSRHELSLGNSFATKGGFKPPNKEVDPEEFNK  223

Query  1379  RVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAA  1200
             +V+EGFQVTPLWHQGFIRDDGRT+Y +TVKTARWEYS+RP+YGWGNVGSKQKSTAGWLAA
Sbjct  224   KVVEGFQVTPLWHQGFIRDDGRTNYLETVKTARWEYSSRPVYGWGNVGSKQKSTAGWLAA  283

Query  1199  FPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGA  1020
             FPVFEPHWQ+CMA GLSTGWIEW+ ER+EF NAPSYSEKNWG GFPRKWFWVQCNVFEGA
Sbjct  284   FPVFEPHWQICMAGGLSTGWIEWEDERFEFVNAPSYSEKNWGGGFPRKWFWVQCNVFEGA  343

Query  1019  DGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYI  840
              GEV+LT+GGGLRQ+  PG ++ FENAAL+ VHY G+FYEFVPWNG+V WEIS WG+WYI
Sbjct  344   RGEVALTAGGGLRQL--PGLTETFENAALVGVHYDGIFYEFVPWNGTVNWEISTWGYWYI  401

Query  839   TAENATHKSQVE  804
              AEN THK ++E
Sbjct  402   AAENETHKVELE  413


 Score =   127 bits (318),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +VELE +T  PG+ LRAPT E GL   C+DTC+  L+LQ+WERR+DGSKGK +LDVTSN
Sbjct  408  HKVELEGKTDVPGSPLRAPTSECGLDTACKDTCFGTLKLQIWERRFDGSKGKIVLDVTSN  467

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQAL  514
            MA +EVGGG WFNTWKG T  PEIL   L
Sbjct  468  MAALEVGGGAWFNTWKGETTTPEILNNTL  496



>ref|XP_004164041.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Cucumis sativus]
Length=419

 Score =   507 bits (1306),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 233/304 (77%), Positives = 268/304 (88%), Gaps = 2/304 (1%)
 Frame = -1

Query  1715  YHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQ  1536
             YHFDG+ R+FFEGW+FKVSIP+ RQSFC+MYSVENPAF K L+ ++  Q+G RFTGVGAQ
Sbjct  14    YHFDGSTRKFFEGWYFKVSIPQKRQSFCFMYSVENPAFPKKLTAVDIAQHGPRFTGVGAQ  73

Query  1535  ILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQV  1356
             ILGA DKYICQY+ ES+NFWG RHELSLGN+F  +   +PPNKEV P+EFN +V+EGFQV
Sbjct  74    ILGAYDKYICQYSEESQNFWGSRHELSLGNSFATKEGFKPPNKEVDPEEFNKKVVEGFQV  133

Query  1355  TPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHW  1176
             TPLWHQGFIRDDGRT+Y +TVKTARWEYS+RP+YGWGNVGSKQKSTAGWLAAFPVFEPHW
Sbjct  134   TPLWHQGFIRDDGRTNYLETVKTARWEYSSRPVYGWGNVGSKQKSTAGWLAAFPVFEPHW  193

Query  1175  QVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTS  996
             Q+CMA GLSTGWIEW+ ER+EF NAPSYSEKNWG GFPRKWFWVQCNVFEGA GEV+LT+
Sbjct  194   QICMAGGLSTGWIEWEDERFEFVNAPSYSEKNWGGGFPRKWFWVQCNVFEGARGEVALTA  253

Query  995   GGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHK  816
             GGGLRQ+  PG ++ FENAAL+ VHY G FYEFVPWNG+V WEI+ WG+WYI AEN THK
Sbjct  254   GGGLRQL--PGLTETFENAALVGVHYDGTFYEFVPWNGTVNWEINTWGYWYIAAENETHK  311

Query  815   SQVE  804
              ++E
Sbjct  312   VELE  315


 Score =   161 bits (407),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +VELE +T +PG+ LRAPT E GL   C+ TC+  L+LQ+WERR+DGSKGK +LDVTSN
Sbjct  310  HKVELEGKTDEPGSPLRAPTSECGLDTACKGTCFGTLKLQIWERRFDGSKGKIVLDVTSN  369

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWKG T  PEILK+AL  P+D++  F L+PLFKPPGL
Sbjct  370  MAALEVGGGPWFNTWKGETTTPEILKRALTTPIDVDQAFNLLPLFKPPGL  419



>gb|ABE41799.1| tocopherol cyclase [Gossypium hirsutum]
Length=481

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/398 (66%), Positives = 311/398 (78%), Gaps = 6/398 (2%)
 Frame = -1

Query  1982  DVRRRCCCESMETLLACSSAVSPPTQSYTARFSPRKH--LRVG--KKSPAFRVKAVSAPD  1815
             ++R    C      L   +AV     S      PR+   LR+G    SP     +++  D
Sbjct  10    ELRHFSSCYIGLRSLNSKTAVKLSQSSNFNGLFPRRLRPLRLGFRSNSPIIACSSIAETD  69

Query  1814  SAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSF  1635
             +   + A +    + PVY PTP+NR  RTPHSGYHFDGT RQFFEGW+FKVSIPE +QSF
Sbjct  70    TETSSTASDRPVPVNPVYVPTPANRDTRTPHSGYHFDGTTRQFFEGWYFKVSIPERKQSF  129

Query  1634  CYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELS  1455
             C+MYSVENP F + L+ +E +Q+G RFTGVGAQILGA DKYICQY+ ES+NFWG RHEL 
Sbjct  130   CFMYSVENPVFRRKLTQLETLQHGPRFTGVGAQILGAYDKYICQYSDESQNFWGSRHELI  189

Query  1454  LGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWE  1275
             LGNTF+A   +RPP+KEVPP+EFN +VLEGFQV+PLWHQGFIRDDGRT YA+TVKTARWE
Sbjct  190   LGNTFLANKNSRPPSKEVPPEEFNRKVLEGFQVSPLWHQGFIRDDGRTSYARTVKTARWE  249

Query  1274  YSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPS  1095
             YSTRP YGWG+VGSKQKSTAGWLAAFP+FEPHWQ+CMA GLSTGWIEWDGER+EF++APS
Sbjct  250   YSTRPTYGWGDVGSKQKSTAGWLAAFPIFEPHWQICMAGGLSTGWIEWDGERFEFQDAPS  309

Query  1094  YSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYG  915
             YSEKNWG  FPRKWFW QCNVFEGA GEV+LT+GGGLRQ+  PG ++ FENAALI VHY 
Sbjct  310   YSEKNWGGAFPRKWFWAQCNVFEGASGEVALTAGGGLRQL--PGLTETFENAALIGVHYD  367

Query  914   GVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             G+FYEFVPWNG ++WEI+PWG+W I AEN TH  ++E 
Sbjct  368   GIFYEFVPWNGVLSWEIAPWGYWCIAAENETHMVELEA  405


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKA----ILD  613
              VELEA T+DPGTTLRAPT E GLAP C+DTC+ +LRLQ+WE++Y G+KGK     + D
Sbjct  399  HMVELEATTNDPGTTLRAPTIEAGLAPACKDTCFGNLRLQIWEKKYGGTKGKVCYSYLFD  458

Query  612  VTSNM  598
               N+
Sbjct  459  AKCNL  463



>ref|NP_001046545.1| Os02g0276500 [Oryza sativa Japonica Group]
 sp|Q6K7V6.1|TOCC_ORYSJ RecName: Full=Probable tocopherol cyclase, chloroplastic; AltName: 
Full=Vitamin E pathway gene 1 protein; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD21816.1| putative tocopherol cyclase [Oryza sativa Japonica Group]
 dbj|BAD28673.1| putative tocopherol cyclase [Oryza sativa Japonica Group]
 dbj|BAF08459.1| Os02g0276500 [Oryza sativa Japonica Group]
 dbj|BAG92802.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72910.1| hypothetical protein OsI_06739 [Oryza sativa Indica Group]
 gb|EEE56731.1| hypothetical protein OsJ_06237 [Oryza sativa Japonica Group]
Length=470

 Score =   516 bits (1329),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/322 (73%), Positives = 270/322 (84%), Gaps = 3/322 (1%)
 Frame = -1

Query  1769  PVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPL  1590
             PVY PTP +R LRTPHSGYH+DGT R FFEGW+FKVSIPECRQSFC+MYSVENP F   +
Sbjct  49    PVYAPTPRDRALRTPHSGYHYDGTARPFFEGWYFKVSIPECRQSFCFMYSVENPLFRDGM  108

Query  1589  SGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPN  1410
             S ++ V +G RFTGVGAQILGADDKYICQ+T +S NFWG RHEL LGNTFI    + PP 
Sbjct  109   SDLDRVIHGSRFTGVGAQILGADDKYICQFTEKSNNFWGSRHELMLGNTFIPNNGSTPPE  168

Query  1409  KEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSK  1230
              EVPPQEF+SRVLEGFQVTP+WHQGFIRDDGR+ Y   V+TARWEYSTRP+YGWG+V SK
Sbjct  169   GEVPPQEFSSRVLEGFQVTPIWHQGFIRDDGRSKYVPNVQTARWEYSTRPVYGWGDVTSK  228

Query  1229  QKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWF  1050
             QKSTAGWLAAFP FEPHWQ+CMA GLSTGWIEWDGER+EFENAPSYSEKNWG GFPRKW+
Sbjct  229   QKSTAGWLAAFPFFEPHWQICMAGGLSTGWIEWDGERFEFENAPSYSEKNWGAGFPRKWY  288

Query  1049  WVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTW  870
             WVQCNVF GA GEV+LT+ GGLR+I   G  + +E+ +LI +HY G FYEFVPW G+V+W
Sbjct  289   WVQCNVFSGASGEVALTAAGGLRKI---GLGETYESPSLIGIHYEGKFYEFVPWTGTVSW  345

Query  869   EISPWGHWYITAENATHKSQVE  804
             +I+PWGHW ++ EN  H  ++E
Sbjct  346   DIAPWGHWKLSGENKNHLVEIE  367


 Score =   147 bits (372),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T +PGT LRAPT E GL P C+DTCY DLRLQ+WE+R DG KGK ILD TSNMA
Sbjct  364  VEIEATTKEPGTALRAPTMEAGLVPACKDTCYGDLRLQMWEKRNDGGKGKMILDATSNMA  423

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT + EI+   +   VD+E +F  +P  KPPGL
Sbjct  424  ALEVGGGPWFNGWKGTTVSNEIVNNVVGTQVDVESLF-PIPFLKPPGL  470



>ref|XP_010915875.1| PREDICTED: probable tocopherol cyclase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=449

 Score =   533 bits (1372),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 294/368 (80%), Gaps = 5/368 (1%)
 Frame = -1

Query  1895  ARFSPRKHLRVGKKSPAFRVKAVSAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSG  1716
             A FS R     G++    R + V+A      +   E   ++ PVY PTP +R LRTPHSG
Sbjct  31    APFSFRPSFPAGEQGLRARSRVVAA---VAVSGGEETAASVAPVYKPTPPDRELRTPHSG  87

Query  1715  YHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQ  1536
             YHFDGT R FFEGW+FKVSIPEC+QSFC+MYSVENPAF   +S +++  +G RFTGVGAQ
Sbjct  88    YHFDGTARAFFEGWYFKVSIPECKQSFCFMYSVENPAFPNGMSTLDKALHGPRFTGVGAQ  147

Query  1535  ILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQV  1356
             ILGADDKYICQ+T +SKNFWG RHEL LGNTF+A   + PP+ EVPPQEF  RVLEGFQV
Sbjct  148   ILGADDKYICQFTEKSKNFWGSRHELILGNTFVAGNGSAPPDGEVPPQEFRKRVLEGFQV  207

Query  1355  TPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHW  1176
             +P+WHQGFIRDDGR+ Y +TVKTA WEYST P+YGWG+VGSKQKSTAGWLAAFPVFEPHW
Sbjct  208   SPIWHQGFIRDDGRSKYVQTVKTASWEYSTHPVYGWGDVGSKQKSTAGWLAAFPVFEPHW  267

Query  1175  QVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTS  996
             QVCMAAGLSTGWIEW GER+EFENAPSYSEKNWG GFPRKWFWVQCNVFEGA G VSLT+
Sbjct  268   QVCMAAGLSTGWIEWGGERFEFENAPSYSEKNWGGGFPRKWFWVQCNVFEGASGAVSLTA  327

Query  995   GGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHK  816
              GG+R++   G +DNFEN AL+ VH  GVFYEFVPW G+V+WEI+ WG+W+I+AEN  H 
Sbjct  328   AGGMRKL--SGLADNFENVALVGVHCEGVFYEFVPWTGTVSWEIATWGYWHISAENEKHI  385

Query  815   SQVEV*RR  792
              ++E   R
Sbjct  386   VELEATTR  393


 Score = 82.4 bits (202),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTS  604
            VELEA T +PGT LRAPT E GL   C+DTC  DLRLQLWERRYDGSKGK  +   +
Sbjct  386  VELEATTREPGTPLRAPTTEAGLVTACKDTCLGDLRLQLWERRYDGSKGKVCISFPA  442



>ref|XP_009413813.1| PREDICTED: probable tocopherol cyclase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=499

 Score =   533 bits (1372),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 249/348 (72%), Positives = 287/348 (82%), Gaps = 5/348 (1%)
 Frame = -1

Query  1835  KAVS---APDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFK  1665
             +AVS   AP  A  +   +   +  PVYTPTP NR LRTPHSGYHFDGT R FFEGW+FK
Sbjct  51    RAVSRDLAPVPAASDGEEKTPVSAAPVYTPTPPNRELRTPHSGYHFDGTTRLFFEGWYFK  110

Query  1664  VSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESK  1485
             VSIPECRQSFCYMYSVENPAF   +  ++   +G RFTGVGAQILG DDKYICQ+T +SK
Sbjct  111   VSIPECRQSFCYMYSVENPAFPNGMGLLDNAVHGPRFTGVGAQILGPDDKYICQFTKDSK  170

Query  1484  NFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDY  1305
             NFWG RHEL LGNTF+    + PP +E+ PQ+F  RV EGFQVTPLWHQGFIRDDGR++Y
Sbjct  171   NFWGSRHELMLGNTFVVGKGSTPPFEEIQPQDFRKRVSEGFQVTPLWHQGFIRDDGRSNY  230

Query  1304  AKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDG  1125
              +TVKTARWEYSTRP+YGWG+V SKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDG
Sbjct  231   VQTVKTARWEYSTRPVYGWGDVKSKQKSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDG  290

Query  1124  ERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFE  945
             ER+EFENAPSYSEKNWG GFPRKWFWVQCNVFEGA GEV+LT+ GGLR++  PG  DN+E
Sbjct  291   ERFEFENAPSYSEKNWGAGFPRKWFWVQCNVFEGASGEVALTAAGGLRKL--PGLIDNYE  348

Query  944   NAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             NAALI VHYGG FYEFVPW G+++W+I+ WG W+++AEN TH  ++E 
Sbjct  349   NAALIGVHYGGSFYEFVPWTGTISWDIAQWGFWHMSAENDTHVIELEA  396


 Score =   138 bits (348),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 87/132 (66%), Gaps = 15/132 (11%)
 Frame = -3

Query  843  HNCRECDTQVTSGSITEIIICEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRL  664
            H   E DT V             +ELEA   D GT LRAPT E G    C+DTC+ DLRL
Sbjct  382  HMSAENDTHV-------------IELEATAGDHGTPLRAPTTEAGFVTACKDTCFGDLRL  428

Query  663  QLWERRY-DGSKGKAILDVTSNMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGI  487
            QLWERR  DG KGK ILDV+SNMA +EVGGGPWF+ WKG+T++ E++++ L  P+D+E  
Sbjct  429  QLWERRNGDGGKGKMILDVSSNMAALEVGGGPWFSGWKGSTSSLEVVRRVLRVPIDVESF  488

Query  486  FGLVPLFKPPGL  451
            F L P+FKP GL
Sbjct  489  FPL-PIFKPAGL  499



>ref|XP_002453692.1| hypothetical protein SORBIDRAFT_04g010660 [Sorghum bicolor]
 gb|EES06668.1| hypothetical protein SORBIDRAFT_04g010660 [Sorghum bicolor]
Length=475

 Score =   507 bits (1305),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 229/322 (71%), Positives = 269/322 (84%), Gaps = 3/322 (1%)
 Frame = -1

Query  1769  PVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPL  1590
             P+Y PTP +RPLRTPHSGYHFDGT R FFEGW+FKVSIPECRQSFC+MYSVENP F   +
Sbjct  54    PIYAPTPQDRPLRTPHSGYHFDGTARPFFEGWYFKVSIPECRQSFCFMYSVENPLFRDGM  113

Query  1589  SGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPN  1410
             S ++++ +G RFTGVGAQILGADDKYICQ++ +S NFWG RHEL LGNTFI    + PP 
Sbjct  114   SDLDKLVHGPRFTGVGAQILGADDKYICQFSEKSNNFWGSRHELMLGNTFIPNKESTPPQ  173

Query  1409  KEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSK  1230
              EVPPQ+F+ RVLEGFQVTP+WHQGFIRDDGR+ Y   V+TARWEYSTRP+YGWG+V SK
Sbjct  174   GEVPPQDFSKRVLEGFQVTPIWHQGFIRDDGRSKYVPNVQTARWEYSTRPVYGWGDVKSK  233

Query  1229  QKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWF  1050
             Q STAGWLAAFP FEPHWQ+CMA GLSTGWIEWDGER+EFENAPSYSEKNWG GFPRKW+
Sbjct  234   QLSTAGWLAAFPFFEPHWQICMAGGLSTGWIEWDGERFEFENAPSYSEKNWGGGFPRKWY  293

Query  1049  WVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTW  870
             W+QCNVF GA GEVSLT+ GGLR+I   G  D +E+ +LI +HY G F+EFVPW G+V+W
Sbjct  294   WIQCNVFSGASGEVSLTAAGGLRKI---GLGDTYESPSLIGIHYEGQFFEFVPWTGTVSW  350

Query  869   EISPWGHWYITAENATHKSQVE  804
             +I+ WG W ++ EN TH  ++E
Sbjct  351   DIALWGRWKMSGENKTHLVEIE  372


 Score =   148 bits (374),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T++PGT LRAPT E GL P C+DTCY DLRLQLWE++YDGSKG  ILD TSNMA
Sbjct  369  VEIEATTTEPGTALRAPTIEAGLVPACKDTCYGDLRLQLWEKKYDGSKGAMILDATSNMA  428

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT   E +   +  P+D+E +F  +P  KPPGL
Sbjct  429  ALEVGGGPWFNGWKGTTVTNEAVNNIVGTPIDVESLF-PIPFLKPPGL  475



>dbj|BAJ93900.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90609.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00085.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   497 bits (1280),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 224/315 (71%), Positives = 264/315 (84%), Gaps = 3/315 (1%)
 Frame = -1

Query  1745  NRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
             +RPLRTPHSGYH+DGT R FFEGW+FKVSIPECRQSFC+MYSVENP F   ++ +++  +
Sbjct  56    DRPLRTPHSGYHYDGTARAFFEGWYFKVSIPECRQSFCFMYSVENPFFRDGMTALDQAIH  115

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEF  1386
             G RFTGVGA ILGADDKYICQY+ +S NFWG RHEL LGNTFI    + PP +E+PPQEF
Sbjct  116   GPRFTGVGAHILGADDKYICQYSEKSNNFWGSRHELILGNTFIPSKGSTPPEREIPPQEF  175

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
             ++RVLEG+QVTP WHQGFIRDDGR+ Y   V+TARWEYSTRP+YGWG+V SKQKSTAGWL
Sbjct  176   SNRVLEGYQVTPTWHQGFIRDDGRSKYVPNVQTARWEYSTRPVYGWGDVTSKQKSTAGWL  235

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             AAFP FEPHWQ+CMA GLSTGWIEWDGERYEFENAPSYSEKNWG GFPRKW+W+QCNVF 
Sbjct  236   AAFPFFEPHWQICMAGGLSTGWIEWDGERYEFENAPSYSEKNWGGGFPRKWYWIQCNVFP  295

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
             GA GEV+LT+ GGLR+I   G  D +E+ +LI VH+ G FYEFVPW G+V+W+I+PWGHW
Sbjct  296   GASGEVALTAAGGLRKI---GLGDTYESPSLIGVHHEGKFYEFVPWTGTVSWDIAPWGHW  352

Query  845   YITAENATHKSQVEV  801
              ++ EN  H  ++E 
Sbjct  353   RMSGENKNHLVEIEA  367


 Score =   152 bits (385),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T +PGT LRAPT E G  P C+DTCY DL+LQ+WE++YDGSKGK ILD TSNMA
Sbjct  363  VEIEATTKEPGTALRAPTIEAGFVPACKDTCYGDLKLQMWEKKYDGSKGKMILDTTSNMA  422

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VEVGGGPWFN WKGTT +PE+L   +   +D+E +F  +P+ KPPGL
Sbjct  423  AVEVGGGPWFNGWKGTTASPELLNNIVGTQIDVESLF-PIPILKPPGL  469



>gb|ACN26641.1| unknown [Zea mays]
 gb|AFW70912.1| sucrose export defective1 [Zea mays]
Length=474

 Score =   507 bits (1306),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 230/326 (71%), Positives = 271/326 (83%), Gaps = 3/326 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             A  P+YTPTP +R LRTPHSGYHFDGT R FFEGW+FKVSIPECRQSFC+MYSVENP F 
Sbjct  50    AAAPIYTPTPQDRSLRTPHSGYHFDGTARPFFEGWYFKVSIPECRQSFCFMYSVENPLFR  109

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
               +S ++++ Y  RFTGVGAQILGADDKYICQ++ +S NFWG RHEL LGNTFI+   + 
Sbjct  110   DGMSDLDKLLYRPRFTGVGAQILGADDKYICQFSEKSNNFWGSRHELMLGNTFISNKEST  169

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP  EVPPQ+F+ RVLEGFQVTP+WHQGFIRDDGR++Y   V+TARWEYSTRP+YGWG+V
Sbjct  170   PPQGEVPPQDFSRRVLEGFQVTPIWHQGFIRDDGRSNYVPNVQTARWEYSTRPVYGWGDV  229

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
              SKQ STAGWLAAFP FEPHWQ+CMA+GLSTGWIEWDGER+EFENAPSYSEKNWG GFPR
Sbjct  230   KSKQLSTAGWLAAFPFFEPHWQICMASGLSTGWIEWDGERFEFENAPSYSEKNWGGGFPR  289

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KW+W+QCNVF GA GEVSLT+ GGLR+I   G  D +E+ +LI +HY G F+EFVPW G+
Sbjct  290   KWYWIQCNVFPGASGEVSLTAAGGLRKI---GLGDTYESPSLIGIHYEGQFFEFVPWTGT  346

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             V+W+I  WG W ++ EN TH  ++E 
Sbjct  347   VSWDIGLWGLWKMSGENKTHLVEIEA  372


 Score =   141 bits (355),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T++ GT LRAPT E GL P C+DTCY DLRLQLWE++YDGSKG+ ILD TSNMA
Sbjct  368  VEIEATTAESGTALRAPTIEAGLVPACKDTCYGDLRLQLWEKKYDGSKGEMILDATSNMA  427

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT   E++   +  PVD+E +   +P  KPPGL
Sbjct  428  ALEVGGGPWFNGWKGTTVVNEVVNNIVGTPVDVESLL-PIPFLKPPGL  474



>ref|XP_010234137.1| PREDICTED: probable tocopherol cyclase, chloroplastic [Brachypodium 
distachyon]
Length=471

 Score =   497 bits (1279),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 223/314 (71%), Positives = 265/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  1745  NRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
             +RPLRTPHSGYH+DGT R FFEGW+FKVSIPE RQSFC+MYSVENP F   +S ++ + Y
Sbjct  58    DRPLRTPHSGYHYDGTARPFFEGWYFKVSIPEVRQSFCFMYSVENPFFRDGMSALDRILY  117

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEF  1386
             G RFTGVGAQILGADDKYICQ++ +S NFWG RHEL LGNTFI    +  P+ EVPPQEF
Sbjct  118   GPRFTGVGAQILGADDKYICQFSEKSNNFWGSRHELMLGNTFIPSKGSTSPDGEVPPQEF  177

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
             ++RVLEG+QVTP+WHQGFIRDDGR+ Y   V+TARWEYSTRP+ GWG+V SKQKSTAGWL
Sbjct  178   SNRVLEGYQVTPIWHQGFIRDDGRSKYVPNVQTARWEYSTRPVCGWGDVTSKQKSTAGWL  237

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             AAFP+FEPHWQ+CMA G+STGWIEWDGER+EFENAPSYSEKNWG GFPRKW+W+QCNVF 
Sbjct  238   AAFPLFEPHWQICMAGGVSTGWIEWDGERFEFENAPSYSEKNWGGGFPRKWYWIQCNVFS  297

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
             GA GEV+LT+ GGLR+I   G  D +E+ +LI VHY GVFYEFVPW G+V+W+I+PWG W
Sbjct  298   GASGEVALTAAGGLRKI---GLGDTYESPSLIGVHYDGVFYEFVPWTGTVSWDIAPWGQW  354

Query  845   YITAENATHKSQVE  804
              ++ EN +H  ++E
Sbjct  355   KMSGENKSHLVEIE  368


 Score =   149 bits (375),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T +PGTTLRAPT E GL P C+DTCY DL+LQLWE+R+DG KGK ILD TSNMA
Sbjct  365  VEIEATTKEPGTTLRAPTMEAGLVPACKDTCYGDLKLQLWEKRHDGGKGKMILDTTSNMA  424

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT + E++   +   VD++ +  L+P+ KPPGL
Sbjct  425  ALEVGGGPWFNEWKGTTVSNELVNSIIGTQVDVDSLL-LIPVLKPPGL  471



>ref|NP_001105015.1| probable tocopherol cyclase, chloroplastic precursor [Zea mays]
 sp|Q94FY8.1|TOCC_MAIZE RecName: Full=Probable tocopherol cyclase, chloroplastic; AltName: 
Full=Sucrose export defective 1; Flags: Precursor [Zea 
mays]
 gb|AAK60502.1|AF302187_1 sucrose export defective 1 [Zea mays]
Length=474

 Score =   504 bits (1298),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 229/326 (70%), Positives = 269/326 (83%), Gaps = 3/326 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             A  P+YTPTP +R LRTPHSGYHFDGT R FFEGW+FKVSIPECRQSFC+MYSVENP F 
Sbjct  50    AAAPIYTPTPQDRSLRTPHSGYHFDGTARPFFEGWYFKVSIPECRQSFCFMYSVENPLFR  109

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
               +S ++++ Y  RFTGVGAQILGADDKYICQ++ +S NFWG RHEL LGNTFI+   + 
Sbjct  110   DGMSDLDKLLYRPRFTGVGAQILGADDKYICQFSEKSNNFWGSRHELMLGNTFISNKEST  169

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP  EVPPQ+F+ RVLEG QVTP+WHQGFIRDDGR++Y   V+TARWEYSTRP+YGWG+V
Sbjct  170   PPQGEVPPQDFSRRVLEGLQVTPIWHQGFIRDDGRSNYVPNVQTARWEYSTRPVYGWGDV  229

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
              SKQ STAGWLAAFP FEPHWQ+CMA GLSTGWIEWDGER+EFENAPSYSEKNWG GFPR
Sbjct  230   KSKQLSTAGWLAAFPFFEPHWQICMARGLSTGWIEWDGERFEFENAPSYSEKNWGGGFPR  289

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KW+W+QCNVF GA GEVSLT+ GGLR+I   G  D +E+ +LI +HY G F+EFVPW G+
Sbjct  290   KWYWIQCNVFPGASGEVSLTAAGGLRKI---GLGDTYESPSLIGIHYEGQFFEFVPWTGT  346

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             V+W+I  WG W ++ EN TH  ++E 
Sbjct  347   VSWDIGLWGLWKMSGENKTHLVEIEA  372


 Score =   141 bits (355),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T++ GT LRAPT E GL P C+DTCY DLRLQLWE++YDGSKG+ ILD TSNMA
Sbjct  368  VEIEATTAESGTALRAPTIEAGLVPACKDTCYGDLRLQLWEKKYDGSKGEMILDATSNMA  427

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT   E++   +  PVD+E +   +P  KPPGL
Sbjct  428  ALEVGGGPWFNGWKGTTVVNEVVNNIVGTPVDVESLL-PIPFLKPPGL  474



>gb|ABE41800.1| tocopherol cyclase [Triticum aestivum]
Length=467

 Score =   495 bits (1275),  Expect(2) = 9e-174, Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 263/315 (83%), Gaps = 3/315 (1%)
 Frame = -1

Query  1745  NRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
             +RPLRTPHSGYH+DGT R FFEGW+FKVSIPECRQSFC+MYSVENP F   ++ ++   Y
Sbjct  54    DRPLRTPHSGYHYDGTARAFFEGWYFKVSIPECRQSFCFMYSVENPFFRDGMTALDRTLY  113

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEF  1386
             G +FTGVGAQILGADDKYICQ++ +S NFWG RHEL LGNTFI    + PP +E+PPQEF
Sbjct  114   GPQFTGVGAQILGADDKYICQFSEKSNNFWGSRHELILGNTFIPNKGSTPPEREIPPQEF  173

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
             ++RVLEG+QVTP WHQGFIRDDGR+ Y   V+TARWEYSTRP+YGWG+V SKQKSTAGWL
Sbjct  174   SNRVLEGYQVTPTWHQGFIRDDGRSKYVPNVQTARWEYSTRPVYGWGDVTSKQKSTAGWL  233

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             AAFP FEPHWQ+CMA GLSTGWIEWDGER+EFENAPSYSEKNWG GFPRKW+W+QCNVF 
Sbjct  234   AAFPFFEPHWQICMAGGLSTGWIEWDGERFEFENAPSYSEKNWGGGFPRKWYWIQCNVFS  293

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
             G  GEV+LT+ GGLR+I   G  D +E+ +LI +H+ G FYEFVPW G+V+W+I+PWGHW
Sbjct  294   GTSGEVALTAAGGLRKI---GLGDTYESPSLIGIHHEGKFYEFVPWTGTVSWDIAPWGHW  350

Query  845   YITAENATHKSQVEV  801
              ++ EN  H  ++E 
Sbjct  351   KMSGENKNHLVEIEA  365


 Score =   145 bits (365),  Expect(2) = 9e-174, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T +PGT LRAPT E GL P C+DTCY DL+LQ+WE++YDGSKGK ILD TSNMA
Sbjct  361  VEIEATTKEPGTALRAPTIEAGLVPACKDTCYGDLKLQMWEKKYDGSKGKIILDTTSNMA  420

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT   E +   +   +D+E +F  +P  KPPGL
Sbjct  421  ALEVGGGPWFNGWKGTTATNEPVNNIVGTQIDVESLF-PIPFLKPPGL  467



>ref|XP_006833384.1| hypothetical protein AMTR_s00109p00113060 [Amborella trichopoda]
 gb|ERM98662.1| hypothetical protein AMTR_s00109p00113060 [Amborella trichopoda]
Length=481

 Score =   494 bits (1273),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 226/324 (70%), Positives = 269/324 (83%), Gaps = 2/324 (1%)
 Frame = -1

Query  1775  IKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTK  1596
             + P Y  TP+NR LRTPHSGYHFDG+ R+FFEGW+FKVSIPE +QSFC+MYSVE+PAF+ 
Sbjct  56    VMPEYEHTPANRELRTPHSGYHFDGSARRFFEGWYFKVSIPEQKQSFCFMYSVEDPAFSG  115

Query  1595  PLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARP  1416
              L   +E  YG RFTGVGAQILGA +KYICQ++ ES NFWG+RHEL+LGNTF+A+ A   
Sbjct  116   KLGKFDEAVYGSRFTGVGAQILGAHEKYICQFSEESNNFWGDRHELTLGNTFLAREAVSA  175

Query  1415  PNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVG  1236
             PN EV PQEF   VLEGFQVTP+WHQGFIRDDGR+ Y +TVK+ARWEYSTRPIYGWG+VG
Sbjct  176   PNGEVSPQEFQKCVLEGFQVTPIWHQGFIRDDGRSPYVQTVKSARWEYSTRPIYGWGDVG  235

Query  1235  SKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRK  1056
             S QKSTA W AA PVFEPHWQVCMA GLSTGWIEWDGE++EFE+APSYSEKNWG  FP+K
Sbjct  236   SNQKSTASWPAALPVFEPHWQVCMAGGLSTGWIEWDGEQFEFEDAPSYSEKNWGGAFPKK  295

Query  1055  WFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSV  876
             WFWVQCNVFEG  GEV+LT+ GG R++   G ++ FE+ ALI VHY G FYEFVPW  +V
Sbjct  296   WFWVQCNVFEGVTGEVALTAAGGTRKL--VGLTETFEDVALIGVHYDGKFYEFVPWTSTV  353

Query  875   TWEISPWGHWYITAENATHKSQVE  804
              W+I+PWG+WY++ EN ++K ++E
Sbjct  354   KWKIAPWGYWYMSGENDSYKVELE  377


 Score =   145 bits (366),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VELEA T   GT LRAPT E GL P CRDTC  DL+L+LWERRYDG++GK ILDVTS+M
Sbjct  373  KVELEATTKSDGTVLRAPTIEGGLIPYCRDTCSGDLKLRLWERRYDGTEGKLILDVTSDM  432

Query  597  AGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            A +E GGGPW++TWK T+ +P ++ Q L  P+D++ IF  +P  KPPGL
Sbjct  433  AALETGGGPWYDTWKTTSASPPLVGQILRFPIDVDAIFKPIPFLKPPGL  481



>pir||T04448 hypothetical protein F4D11.30 - Arabidopsis thaliana
 emb|CAA18584.1| putative protein [Arabidopsis thaliana]
 emb|CAB79994.1| putative protein [Arabidopsis thaliana]
Length=455

 Score =   490 bits (1261),  Expect(2) = 9e-173, Method: Compositional matrix adjust.
 Identities = 228/304 (75%), Positives = 260/304 (86%), Gaps = 2/304 (1%)
 Frame = -1

Query  1715  YHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQ  1536
             YHFDGT R+FFEGW+F+VSIPE R+SFC+MYSVENPAF + LS +E   YG RFTGVGAQ
Sbjct  25    YHFDGTPRKFFEGWYFRVSIPEKRESFCFMYSVENPAFRQSLSPLEVALYGPRFTGVGAQ  84

Query  1535  ILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQV  1356
             ILGA+DKY+CQY  +S NFWG+RHEL LGNTF A   A+ PNKEVPP+EFN RV EGFQ 
Sbjct  85    ILGANDKYLCQYEQDSHNFWGDRHELVLGNTFSAVPGAKAPNKEVPPEEFNRRVSEGFQA  144

Query  1355  TPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHW  1176
             TP WHQG I DDGRTDYA+TVK+ARWEYSTRP+YGWG+VG+KQKSTAGW AAFPVFEPHW
Sbjct  145   TPFWHQGHICDDGRTDYAETVKSARWEYSTRPVYGWGDVGAKQKSTAGWPAAFPVFEPHW  204

Query  1175  QVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTS  996
             Q+CMA GLSTGWIEW GER+EF +APSYSEKNWG GFPRKWFWVQCNVFEGA GEV+LT+
Sbjct  205   QICMAGGLSTGWIEWGGERFEFRDAPSYSEKNWGGGFPRKWFWVQCNVFEGATGEVALTA  264

Query  995   GGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHK  816
             GGGLRQ+  PG ++ +ENAAL+ VHY G  YEFVPWNG V WE+SPWG+WYITAEN  H 
Sbjct  265   GGGLRQL--PGLTETYENAALVCVHYDGKMYEFVPWNGVVRWEMSPWGYWYITAENENHV  322

Query  815   SQVE  804
              ++E
Sbjct  323   VELE  326


 Score =   147 bits (371),  Expect(2) = 9e-173, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 89/133 (67%), Gaps = 25/133 (19%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGK----------  625
            VELEART++ GT LRAPT E+GLA  CRD+CY +L+LQ+WER YDGSKGK          
Sbjct  323  VELEARTNEAGTPLRAPTTEVGLATACRDSCYGELKLQIWERLYDGSKGKLKVLTNPKAV  382

Query  624  --------------AILDVTSNMAGVEVGGGPWFNTWKG-TTNAPEILKQALNAPVDIEG  490
                           IL+  S+MA VE+GGGPWF TWKG T+N PE+LKQAL  P+D+E 
Sbjct  383  KEDYERLLWLTMMQVILETKSSMAAVEIGGGPWFGTWKGDTSNTPELLKQALQVPLDLES  442

Query  489  IFGLVPLFKPPGL  451
              GLVP FKPPGL
Sbjct  443  ALGLVPFFKPPGL  455



>ref|XP_004952221.1| PREDICTED: probable tocopherol cyclase, chloroplastic-like [Setaria 
italica]
Length=480

 Score =   489 bits (1258),  Expect(2) = 9e-172, Method: Compositional matrix adjust.
 Identities = 225/323 (70%), Positives = 265/323 (82%), Gaps = 3/323 (1%)
 Frame = -1

Query  1769  PVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPL  1590
             PVY PTP +RPLRTPHSGYHFDGT R FFEGW+FKVSIPE RQSF +MYSVENP F   +
Sbjct  59    PVYAPTPQDRPLRTPHSGYHFDGTSRPFFEGWYFKVSIPEIRQSFGFMYSVENPLFRDGM  118

Query  1589  SGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPN  1410
             S ++++ +G RFTGVGAQILGADDKYI Q++ +S NFWG RHEL+LGNTFI    + PP 
Sbjct  119   SDLDKLVHGPRFTGVGAQILGADDKYIFQFSEKSNNFWGSRHELALGNTFIPNKDSIPPQ  178

Query  1409  KEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSK  1230
              EVPPQEF+ RVLEGFQVTP+WHQGFIRD+GR+ Y   V+TARWEYSTRP+YGWG+V SK
Sbjct  179   GEVPPQEFSKRVLEGFQVTPIWHQGFIRDNGRSKYVPNVQTARWEYSTRPVYGWGDVNSK  238

Query  1229  QKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWF  1050
             Q STAGWLAAFP FEPHWQ+CMA GLSTGWIEWDGER+EFENAPSYSEKNWG  FPRKW+
Sbjct  239   QLSTAGWLAAFPFFEPHWQICMAGGLSTGWIEWDGERFEFENAPSYSEKNWGGAFPRKWY  298

Query  1049  WVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTW  870
             W+QCNVF GA GEVSLT+ GGLR+I   G  D +E+ +LI +H  G F+EFVPW G+V+W
Sbjct  299   WIQCNVFSGASGEVSLTAAGGLRKI---GLGDTYESPSLIGIHCDGNFFEFVPWTGTVSW  355

Query  869   EISPWGHWYITAENATHKSQVEV  801
             +I+ WG W ++ EN TH  ++E 
Sbjct  356   DIALWGCWKMSGENKTHLVEIEA  378


 Score =   145 bits (365),  Expect(2) = 9e-172, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T++PG+TLRAPT E GLAP C+DT Y DLRLQLWE++YDG KGK ILD TSNMA
Sbjct  374  VEIEATTTEPGSTLRAPTTEAGLAPACKDTFYGDLRLQLWEKKYDGGKGKLILDATSNMA  433

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +E+GGGPWFN WKGTT   E++   +  P+D+E +F  VP  KPPGL
Sbjct  434  ALEIGGGPWFNGWKGTTVVNEVVNNVVGTPIDVESLF-PVPFLKPPGL  480



>ref|XP_006648539.1| PREDICTED: probable tocopherol cyclase, chloroplastic-like [Oryza 
brachyantha]
Length=421

 Score =   478 bits (1230),  Expect(2) = 5e-168, Method: Compositional matrix adjust.
 Identities = 216/305 (71%), Positives = 254/305 (83%), Gaps = 3/305 (1%)
 Frame = -1

Query  1715  YHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQ  1536
             YH+DGT R FFEGW+FKV+IPECRQSFC+MYSVENP F   +S ++ + +G RFTGVGAQ
Sbjct  18    YHYDGTARPFFEGWYFKVAIPECRQSFCFMYSVENPLFRDGMSDLDRLIHGPRFTGVGAQ  77

Query  1535  ILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQV  1356
             ILGADDKYICQ+T +S NFWG RHEL LGNTFI    + PP  EVPPQEF++RVLEGFQV
Sbjct  78    ILGADDKYICQFTEKSNNFWGSRHELMLGNTFIPNNDSTPPEGEVPPQEFSNRVLEGFQV  137

Query  1355  TPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHW  1176
             TP+WHQGFIRDDGR+ Y   V+TARWEYSTRP+YGWG+V SKQKSTAGWLAAFP FEPHW
Sbjct  138   TPIWHQGFIRDDGRSKYVPNVQTARWEYSTRPVYGWGDVTSKQKSTAGWLAAFPFFEPHW  197

Query  1175  QVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTS  996
             Q+CMA GLSTGWIEWDGER+EFENAPSYSEKNWG GFPRKW+W+QCNVF GA GEVSLT+
Sbjct  198   QICMAGGLSTGWIEWDGERFEFENAPSYSEKNWGGGFPRKWYWIQCNVFSGASGEVSLTA  257

Query  995   GGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHK  816
              GG R+I   G  + +E+ +LI +HY G FYEFVPW G+V+W+I+PWGHW ++ EN  H 
Sbjct  258   AGGQRKI---GLGETYESPSLIGIHYEGKFYEFVPWTGTVSWDIAPWGHWKMSGENKNHL  314

Query  815   SQVEV  801
              ++E 
Sbjct  315   VEIEA  319


 Score =   143 bits (361),  Expect(2) = 5e-168, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T++PGT LRAPT E GL P C+DTCY DL+LQ+WE+  DG KGK ILD TSNMA
Sbjct  315  VEIEATTNEPGTALRAPTIEAGLVPACKDTCYGDLKLQMWEKGDDGGKGKMILDATSNMA  374

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT + E++   +  PVD++ +F  VP  KPPGL
Sbjct  375  ALEVGGGPWFNGWKGTTVSNELVSNVVGTPVDVDSLF-PVPFLKPPGL  421



>ref|XP_010436708.1| PREDICTED: tocopherol cyclase, chloroplastic-like [Camelina sativa]
Length=468

 Score =   497 bits (1279),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 247/393 (63%), Positives = 289/393 (74%), Gaps = 19/393 (5%)
 Frame = -1

Query  1970  RCCCESMETLLACSSAVS---PPTQSYTARFSPRKHLRVGKKSPAFRVKAVSAPDSAVEN  1800
             R    SM   L+    +S   PP      RF      +  K++P       + P  +  N
Sbjct  4     RSLVVSMNPNLSSFELLSRSVPPITRSLVRF------KSAKQAPR------TIPRVSASN  51

Query  1799  PAPEIKEAIKPVYTPTPSNRPLRTPHSG-YHFDGTRRQFFEGWFFKVSIPECRQSFCYMY  1623
                     +KPVY PT SNR L+TP S  YHFDG+  +FFEGW+F+VSIPE ++ FC+MY
Sbjct  52    SDQTSSTDVKPVYVPTSSNRELQTPQSSLYHFDGSAAKFFEGWYFRVSIPEKKEGFCFMY  111

Query  1622  SVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNT  1443
             +VENPAF + LS +E   YG RFTGVGAQI GA+DKY+CQYT +S NFWG+ HEL LGNT
Sbjct  112   TVENPAFRQRLSPVEVALYGPRFTGVGAQIHGANDKYLCQYTHDSHNFWGDGHELVLGNT  171

Query  1442  FIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTR  1263
             F A   A  PNKEVPP+EFN RV EGFQ TP WHQG I DDGRTDYA+TVK+ARWEYSTR
Sbjct  172   FSAVPGATSPNKEVPPEEFNRRVSEGFQATPFWHQGHICDDGRTDYAETVKSARWEYSTR  231

Query  1262  PIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEK  1083
             P+YGWG+VG+KQKSTAGW AAFPVFEPHWQ+CMA GLSTG IEW GER+EF +APSYSEK
Sbjct  232   PVYGWGDVGAKQKSTAGWPAAFPVFEPHWQICMAKGLSTGLIEWSGERFEFRDAPSYSEK  291

Query  1082  NWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFY  903
             NWG GFPRKWFWVQCNVFE A GEV+LT+GGGLRQ+PG  T   +ENAAL+ VHY G FY
Sbjct  292   NWGIGFPRKWFWVQCNVFERASGEVALTAGGGLRQLPGLNT---YENAALVCVHYDGKFY  348

Query  902   EFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
             E VPWNG V WE+SPWG+WY+TAEN TH  ++E
Sbjct  349   ELVPWNGVVRWEMSPWGYWYVTAENETHMVELE  381


 Score =   108 bits (271),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VELEART++PGT L APT E+GLA VCRD+C+++L+LQ+WER +DGSKGK IL+  S 
Sbjct  376  HMVELEARTNEPGTPLHAPTGEVGLATVCRDSCHSELKLQIWERLHDGSKGKVILETKST  435

Query  600  MAGVEVGGGPWF  565
            MA VE+GGGPWF
Sbjct  436  MAAVEIGGGPWF  447



>ref|XP_010100251.1| hypothetical protein L484_007248 [Morus notabilis]
 gb|EXB82258.1| hypothetical protein L484_007248 [Morus notabilis]
Length=467

 Score =   493 bits (1269),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 241/356 (68%), Positives = 275/356 (77%), Gaps = 16/356 (4%)
 Frame = -1

Query  1826  SAPDSAVENPAPEIKE-AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPE  1650
             SAPDS  E    E K  ++ PVYTPTP NR LRTPHSGYHFDGT R+FFEGW+FKVSIPE
Sbjct  59    SAPDSVSEVRRDEEKSPSVSPVYTPTPPNRDLRTPHSGYHFDGTTRKFFEGWYFKVSIPE  118

Query  1649  CRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGE  1470
              +QSFC+MYSVENPAF + LS  E  Q+G RFTGVGAQILGA DKYICQ++ ES+NFWG 
Sbjct  119   TKQSFCFMYSVENPAFRRKLSPWEVAQHGPRFTGVGAQILGAYDKYICQFSEESQNFWGS  178

Query  1469  RHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVK  1290
             RHELSLGNTF A+    PPNKE PPQEFN RV+EGFQVTPLW+QGFI DDGR+DY   VK
Sbjct  179   RHELSLGNTFTAEKGQTPPNKEFPPQEFNRRVVEGFQVTPLWNQGFICDDGRSDYVDVVK  238

Query  1289  TARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF-------------EPHWQVCMAAGLS  1149
             TARWEYSTRP++GWG+VGSKQKSTAGWLAAFP F             +  ++      L 
Sbjct  239   TARWEYSTRPVFGWGDVGSKQKSTAGWLAAFPFFVGSKSAILTRRHCKYEFEFVKPVLLR  298

Query  1148  TGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPG  969
               WIEWDGER+EFENAPSY EKNWG  FPRKWFWVQ NVFEGA GEV+LT+ GG RQI  
Sbjct  299   LCWIEWDGERFEFENAPSYCEKNWGGAFPRKWFWVQSNVFEGATGEVALTAAGGYRQI--  356

Query  968   PGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             PG ++ FENAAL+ VHYGG FYEFVPWNG V+WEI+ WG+W++  EN TH  ++E 
Sbjct  357   PGLTETFENAALVGVHYGGKFYEFVPWNGVVSWEIASWGYWHLAGENNTHMVELEA  412


 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAI  619
            VELEA T   GTTLRAPT E GLAPVC+DTC+A L+LQ+WER++DGSKGK  
Sbjct  408  VELEATTQHSGTTLRAPTSEAGLAPVCKDTCFAVLKLQIWERKFDGSKGKVF  459



>ref|XP_010100249.1| hypothetical protein L484_007246 [Morus notabilis]
 gb|EXB82256.1| hypothetical protein L484_007246 [Morus notabilis]
Length=467

 Score =   484 bits (1247),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 238/355 (67%), Positives = 272/355 (77%), Gaps = 16/355 (5%)
 Frame = -1

Query  1826  SAPDSAVENPAPEIKE-AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPE  1650
             SA DS  E    E K  ++ PV TPTP NR LRTPHSGYHFDGT R+FFEGW+FKVSIPE
Sbjct  59    SASDSVSEVRRDEEKSPSVSPVCTPTPPNRDLRTPHSGYHFDGTTRKFFEGWYFKVSIPE  118

Query  1649  CRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGE  1470
              +QSFC+MY+VENPAF + LS  E  Q G RFTGVGAQILGA DKYICQ++ ES+NFWG 
Sbjct  119   TKQSFCFMYTVENPAFRRKLSPWEVAQDGPRFTGVGAQILGAYDKYICQFSEESQNFWGS  178

Query  1469  RHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVK  1290
             RHELSLGNTF A+    PPNKE PPQEFN RV+EGFQVTPLW+QGFI DDGR+DY   VK
Sbjct  179   RHELSLGNTFTAEKGQTPPNKEFPPQEFNRRVVEGFQVTPLWNQGFICDDGRSDYVDVVK  238

Query  1289  TARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF-------------EPHWQVCMAAGLS  1149
             T RWEYSTRP++GWG+VGSKQKSTAGWLAAFP F             +  ++      L 
Sbjct  239   TVRWEYSTRPVFGWGDVGSKQKSTAGWLAAFPFFIGSESAILIRRHCKYEFEFVKPVLLL  298

Query  1148  TGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPG  969
               WIEWDGER+EFENAPSY EKNWG  FPRKWFWVQ NVFEGA GEV+LT+ GG RQI  
Sbjct  299   LCWIEWDGERFEFENAPSYCEKNWGGAFPRKWFWVQSNVFEGATGEVALTAAGGYRQI--  356

Query  968   PGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
             PG ++ FENAAL+ VHYGG FYEFVPWNG V+WEI+PWG+W++  EN TH  ++E
Sbjct  357   PGLTETFENAALVGVHYGGKFYEFVPWNGVVSWEIAPWGYWHLAGENNTHMVELE  411


 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAI  619
              VELEA T   GTTLRAPT E GLAPVC+DTC+A L+LQ+WER++DGSKGK  
Sbjct  406  HMVELEATTQHSGTTLRAPTSEAGLAPVCKDTCFAVLKLQIWERKFDGSKGKVF  459



>ref|XP_010254050.1| PREDICTED: probable tocopherol cyclase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=484

 Score =   484 bits (1246),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 224/295 (76%), Positives = 249/295 (84%), Gaps = 2/295 (1%)
 Frame = -1

Query  1805  ENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYM  1626
             E    E + ++ PVY PTP NR LRTPHSGYHFDG+ R+FFEGW+FKVSIPE RQSFC+M
Sbjct  88    EKQETESRASLNPVYKPTPLNRELRTPHSGYHFDGSARRFFEGWYFKVSIPERRQSFCFM  147

Query  1625  YSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGN  1446
             YSVENPAF K L  +EE  YGRRFTGVGAQILGADDKYICQY+ ES+ FWG RHEL LGN
Sbjct  148   YSVENPAFRKKLGPLEEAAYGRRFTGVGAQILGADDKYICQYSQESQYFWGSRHELMLGN  207

Query  1445  TFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYST  1266
             TF       PPNKE PPQEF+ RVLEGFQVTPLWHQGFIRDDGR+ Y +TV TARWEYST
Sbjct  208   TFTVGKNLPPPNKETPPQEFHGRVLEGFQVTPLWHQGFIRDDGRSTYVQTVTTARWEYST  267

Query  1265  RPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSE  1086
             RP+YGWG+VGSKQ STAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EFENAPSYSE
Sbjct  268   RPVYGWGDVGSKQNSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFENAPSYSE  327

Query  1085  KNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVH  921
             KNWG  FPRKWFWVQCNVF+GA GEV+LT+ GGLR++  PG +D FENAAL+ + 
Sbjct  328   KNWGAAFPRKWFWVQCNVFQGASGEVALTAAGGLREL--PGLADTFENAALVELE  380


 Score =   173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA T DPGTTLRAPT+E GLAP C+DTC+ DLRL++ E+R+DGS+GK ILDVTSNMA
Sbjct  377  VELEATTKDPGTTLRAPTKEAGLAPACKDTCFGDLRLRMSEKRHDGSEGKIILDVTSNMA  436

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFNTWKG T+ PEIL QAL  PVD+EGI G VP+ +PPGL
Sbjct  437  ALEVGGGPWFNTWKGKTSTPEILSQALRVPVDVEGILGFVPIIRPPGL  484



>gb|ACN26692.1| unknown [Zea mays]
 gb|AFW70910.1| sucrose export defective1 [Zea mays]
Length=451

 Score =   449 bits (1154),  Expect(2) = 1e-158, Method: Compositional matrix adjust.
 Identities = 210/326 (64%), Positives = 249/326 (76%), Gaps = 26/326 (8%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             A  P+YTPTP +R LRTPHSGYHFDGT R FFEGW+FKVSIPECRQSFC+MYSVENP F 
Sbjct  50    AAAPIYTPTPQDRSLRTPHSGYHFDGTARPFFEGWYFKVSIPECRQSFCFMYSVENPLFR  109

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
               +S ++++ Y  RFTGVGAQILGADDKYICQ++ +S NFWG RHEL LGNTFI+   + 
Sbjct  110   DGMSDLDKLLYRPRFTGVGAQILGADDKYICQFSEKSNNFWGSRHELMLGNTFISNKEST  169

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP  EVPPQ+F+ RVLEGFQVTP+WHQGFIRDDGR++Y   V+TARWEYSTRP+YGWG+V
Sbjct  170   PPQGEVPPQDFSRRVLEGFQVTPIWHQGFIRDDGRSNYVPNVQTARWEYSTRPVYGWGDV  229

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
              SKQ STA                       GWIEWDGER+EFENAPSYSEKNWG GFPR
Sbjct  230   KSKQLSTA-----------------------GWIEWDGERFEFENAPSYSEKNWGGGFPR  266

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KW+W+QCNVF GA GEVSLT+ GGLR+I   G  D +E+ +LI +HY G F+EFVPW G+
Sbjct  267   KWYWIQCNVFPGASGEVSLTAAGGLRKI---GLGDTYESPSLIGIHYEGQFFEFVPWTGT  323

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             V+W+I  WG W ++ EN TH  ++E 
Sbjct  324   VSWDIGLWGLWKMSGENKTHLVEIEA  349


 Score =   141 bits (355),  Expect(2) = 1e-158, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T++ GT LRAPT E GL P C+DTCY DLRLQLWE++YDGSKG+ ILD TSNMA
Sbjct  345  VEIEATTAESGTALRAPTIEAGLVPACKDTCYGDLRLQLWEKKYDGSKGEMILDATSNMA  404

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT   E++   +  PVD+E +   +P  KPPGL
Sbjct  405  ALEVGGGPWFNGWKGTTVVNEVVNNIVGTPVDVESLL-PIPFLKPPGL  451



>ref|XP_008644261.1| PREDICTED: probable tocopherol cyclase, chloroplastic isoform 
X1 [Zea mays]
Length=439

 Score =   446 bits (1148),  Expect(2) = 6e-158, Method: Compositional matrix adjust.
 Identities = 208/326 (64%), Positives = 243/326 (75%), Gaps = 38/326 (12%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             A  P+YTPTP +R LRTPHSGYHFDGT R FFEGW+FKVSIPECRQSFC+MYSVENP F 
Sbjct  50    AAAPIYTPTPQDRSLRTPHSGYHFDGTARPFFEGWYFKVSIPECRQSFCFMYSVENPLFR  109

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
               +S ++++ Y  RFTGVGAQILGADDKYICQ++ +S NFWG RHEL LGNTFI+   + 
Sbjct  110   DGMSDLDKLLYRPRFTGVGAQILGADDKYICQFSEKSNNFWGSRHELMLGNTFISNKEST  169

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP  EVPPQ+F+ RVLEGFQVTP+WHQGFIRDDGR++Y   V+TARWEYSTRP+YGWG+V
Sbjct  170   PPQGEVPPQDFSRRVLEGFQVTPIWHQGFIRDDGRSNYVPNVQTARWEYSTRPVYGWGDV  229

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
              SKQ STAGWLAAFP FEPHWQ+CMA+GLSTGWIEWDGER+EFENAPSYSEKNWG GFPR
Sbjct  230   KSKQLSTAGWLAAFPFFEPHWQICMASGLSTGWIEWDGERFEFENAPSYSEKNWGGGFPR  289

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KW+W                                      I +HY G F+EFVPW G+
Sbjct  290   KWYW--------------------------------------IGIHYEGQFFEFVPWTGT  311

Query  878   VTWEISPWGHWYITAENATHKSQVEV  801
             V+W+I  WG W ++ EN TH  ++E 
Sbjct  312   VSWDIGLWGLWKMSGENKTHLVEIEA  337


 Score =   141 bits (355),  Expect(2) = 6e-158, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T++ GT LRAPT E GL P C+DTCY DLRLQLWE++YDGSKG+ ILD TSNMA
Sbjct  333  VEIEATTAESGTALRAPTIEAGLVPACKDTCYGDLRLQLWEKKYDGSKGEMILDATSNMA  392

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT   E++   +  PVD+E +   +P  KPPGL
Sbjct  393  ALEVGGGPWFNGWKGTTVVNEVVNNIVGTPVDVESLLP-IPFLKPPGL  439



>gb|EMT18659.1| hypothetical protein F775_29371 [Aegilops tauschii]
Length=432

 Score =   423 bits (1087),  Expect(2) = 9e-155, Method: Compositional matrix adjust.
 Identities = 200/324 (62%), Positives = 243/324 (75%), Gaps = 13/324 (4%)
 Frame = -1

Query  1763  YTPTPSNRPLRTPHSG---YHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKP  1593
             Y+   + RP  TP+S    YH+DGT R FFEGW+FKVSIPECRQSFC+MYSVENP F   
Sbjct  17    YSYNGTGRP--TPYSADYMYHYDGTARAFFEGWYFKVSIPECRQSFCFMYSVENPFFRDG  74

Query  1592  LSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPP  1413
             ++ ++   YG RFTGVGAQILGADDKYICQ++ +S NFWG RHEL LGNTFI    + PP
Sbjct  75    MTALDRTLYGPRFTGVGAQILGADDKYICQFSEKSNNFWGSRHELILGNTFIPNKGSTPP  134

Query  1412  NKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGS  1233
              +E+PPQ   + +       P   + F+    R+ Y   V+TARWEYSTRP+YGWG+V S
Sbjct  135   EREIPPQ---ASMASTMGAGPKSRKFFLAT--RSKYVPNVQTARWEYSTRPVYGWGDVTS  189

Query  1232  KQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKW  1053
             KQKSTAGWLAAFP FEPHWQ+CMA GLSTGWIEWDGER+EFENAPSYSEKNWG GFPRKW
Sbjct  190   KQKSTAGWLAAFPFFEPHWQICMAGGLSTGWIEWDGERFEFENAPSYSEKNWGGGFPRKW  249

Query  1052  FWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVT  873
             +W+QCN F G  GEV+LT+ GGLR+I   G  D +E+ +LI VH+ G FYEFVPW G+V+
Sbjct  250   YWIQCNAFSGISGEVALTAAGGLRKI---GLGDTYESPSLIGVHHEGKFYEFVPWTGTVS  306

Query  872   WEISPWGHWYITAENATHKSQVEV  801
             W+I+PWGHW ++ EN  H  ++E 
Sbjct  307   WDIAPWGHWRMSGENKNHLVEIEA  330


 Score =   154 bits (388),  Expect(2) = 9e-155, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T +PGT LRAPT E GL P C+DTCY DL+LQ+WE++YDGSKGK ILD TSNMA
Sbjct  326  VEIEATTKEPGTALRAPTMEAGLVPACKDTCYGDLKLQMWEKKYDGSKGKIILDTTSNMA  385

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VEVGGGPWFN WKGTT +PE++   +   +D+E +F  +P  KPPGL
Sbjct  386  AVEVGGGPWFNGWKGTTASPELVNNIVGTQIDVESLF-PIPFLKPPGL  432



>gb|AFW70911.1| sucrose export defective1 [Zea mays]
Length=332

 Score =   453 bits (1166),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 208/282 (74%), Positives = 240/282 (85%), Gaps = 3/282 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             A  P+YTPTP +R LRTPHSGYHFDGT R FFEGW+FKVSIPECRQSFC+MYSVENP F 
Sbjct  50    AAAPIYTPTPQDRSLRTPHSGYHFDGTARPFFEGWYFKVSIPECRQSFCFMYSVENPLFR  109

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
               +S ++++ Y  RFTGVGAQILGADDKYICQ++ +S NFWG RHEL LGNTFI+   + 
Sbjct  110   DGMSDLDKLLYRPRFTGVGAQILGADDKYICQFSEKSNNFWGSRHELMLGNTFISNKEST  169

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP  EVPPQ+F+ RVLEGFQVTP+WHQGFIRDDGR++Y   V+TARWEYSTRP+YGWG+V
Sbjct  170   PPQGEVPPQDFSRRVLEGFQVTPIWHQGFIRDDGRSNYVPNVQTARWEYSTRPVYGWGDV  229

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
              SKQ STAGWLAAFP FEPHWQ+CMA+GLSTGWIEWDGER+EFENAPSYSEKNWG GFPR
Sbjct  230   KSKQLSTAGWLAAFPFFEPHWQICMASGLSTGWIEWDGERFEFENAPSYSEKNWGGGFPR  289

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAAL  933
             KW+W+QCNVF GA GEVSLT+ GGLR+I   G  D +E+ +L
Sbjct  290   KWYWIQCNVFPGASGEVSLTAAGGLRKI---GLGDTYESPSL  328



>gb|AFW70913.1| sucrose export defective1 [Zea mays]
Length=328

 Score =   453 bits (1165),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 208/282 (74%), Positives = 240/282 (85%), Gaps = 3/282 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             A  P+YTPTP +R LRTPHSGYHFDGT R FFEGW+FKVSIPECRQSFC+MYSVENP F 
Sbjct  50    AAAPIYTPTPQDRSLRTPHSGYHFDGTARPFFEGWYFKVSIPECRQSFCFMYSVENPLFR  109

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
               +S ++++ Y  RFTGVGAQILGADDKYICQ++ +S NFWG RHEL LGNTFI+   + 
Sbjct  110   DGMSDLDKLLYRPRFTGVGAQILGADDKYICQFSEKSNNFWGSRHELMLGNTFISNKEST  169

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP  EVPPQ+F+ RVLEGFQVTP+WHQGFIRDDGR++Y   V+TARWEYSTRP+YGWG+V
Sbjct  170   PPQGEVPPQDFSRRVLEGFQVTPIWHQGFIRDDGRSNYVPNVQTARWEYSTRPVYGWGDV  229

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
              SKQ STAGWLAAFP FEPHWQ+CMA+GLSTGWIEWDGER+EFENAPSYSEKNWG GFPR
Sbjct  230   KSKQLSTAGWLAAFPFFEPHWQICMASGLSTGWIEWDGERFEFENAPSYSEKNWGGGFPR  289

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAAL  933
             KW+W+QCNVF GA GEVSLT+ GGLR+I   G  D +E+ +L
Sbjct  290   KWYWIQCNVFPGASGEVSLTAAGGLRKI---GLGDTYESPSL  328



>gb|AFW70914.1| sucrose export defective1 [Zea mays]
Length=435

 Score =   457 bits (1175),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 208/286 (73%), Positives = 242/286 (85%), Gaps = 3/286 (1%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             A  P+YTPTP +R LRTPHSGYHFDGT R FFEGW+FKVSIPECRQSFC+MYSVENP F 
Sbjct  50    AAAPIYTPTPQDRSLRTPHSGYHFDGTARPFFEGWYFKVSIPECRQSFCFMYSVENPLFR  109

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
               +S ++++ Y  RFTGVGAQILGADDKYICQ++ +S NFWG RHEL LGNTFI+   + 
Sbjct  110   DGMSDLDKLLYRPRFTGVGAQILGADDKYICQFSEKSNNFWGSRHELMLGNTFISNKEST  169

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             PP  EVPPQ+F+ RVLEGFQVTP+WHQGFIRDDGR++Y   V+TARWEYSTRP+YGWG+V
Sbjct  170   PPQGEVPPQDFSRRVLEGFQVTPIWHQGFIRDDGRSNYVPNVQTARWEYSTRPVYGWGDV  229

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
              SKQ STAGWLAAFP FEPHWQ+CMA+GLSTGWIEWDGER+EFENAPSYSEKNWG GFPR
Sbjct  230   KSKQLSTAGWLAAFPFFEPHWQICMASGLSTGWIEWDGERFEFENAPSYSEKNWGGGFPR  289

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVH  921
             KW+W+QCNVF GA GEVSLT+ GGLR+I   G  D +E+ +L+ + 
Sbjct  290   KWYWIQCNVFPGASGEVSLTAAGGLRKI---GLGDTYESPSLVEIE  332


 Score =   141 bits (355),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T++ GT LRAPT E GL P C+DTCY DLRLQLWE++YDGSKG+ ILD TSNMA
Sbjct  329  VEIEATTAESGTALRAPTIEAGLVPACKDTCYGDLRLQLWEKKYDGSKGEMILDATSNMA  388

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT   E++   +  PVD+E +   +P  KPPGL
Sbjct  389  ALEVGGGPWFNGWKGTTVVNEVVNNIVGTPVDVESLL-PIPFLKPPGL  435



>gb|KDO79773.1| hypothetical protein CISIN_1g011258mg [Citrus sinensis]
Length=403

 Score =   379 bits (974),  Expect(2) = 4e-147, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 201/238 (84%), Gaps = 5/238 (2%)
 Frame = -1

Query  1511  ICQYTPESKNFWGE--RHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQ  1338
             IC  T +S   +GE  RHEL LGNTF A   ++PP KEVPPQEFN RVLEGFQVTPLWHQ
Sbjct  65    ICAITLKSLQTFGEVSRHELMLGNTFRADKGSQPPTKEVPPQEFNRRVLEGFQVTPLWHQ  124

Query  1337  GFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAA  1158
             G I DDGRT++A+TVK+ARWEYSTRP+YGWGNVGSKQ STAGWLAAFPVFEPHWQ+CMA 
Sbjct  125   GCIHDDGRTNFAETVKSARWEYSTRPVYGWGNVGSKQNSTAGWLAAFPVFEPHWQICMAG  184

Query  1157  GLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQ  978
             GLSTGWIEWDGER+EF++APSYSEKNWG  FPRKWFWVQCNVFEGA GEV+LT+GGGLRQ
Sbjct  185   GLSTGWIEWDGERFEFQDAPSYSEKNWGGAFPRKWFWVQCNVFEGATGEVALTAGGGLRQ  244

Query  977   IPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
             +P     D+FENAA+I +HY G+ YEFVPWNG V+WEIS WG+WY  AEN TH  +++
Sbjct  245   LP---VLDSFENAAMIGIHYDGILYEFVPWNGVVSWEISQWGYWYFAAENQTHMVELK  299


 Score =   172 bits (436),  Expect(2) = 4e-147, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VEL+A T  PGTTLRAPT E GLAP C+DTC+ +L LQLWERRYDG+KGK ILDVTS+
Sbjct  294  HMVELKATTKYPGTTLRAPTSEAGLAPACKDTCFGELTLQLWERRYDGTKGKMILDVTSD  353

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWK  T  PE+L++ LN PVD++G+FG VP FKPPGL
Sbjct  354  MAALEVGGGPWFNTWKAKTATPELLRRTLNVPVDVDGLFGFVPFFKPPGL  403



>ref|XP_001770864.1| predicted protein [Physcomitrella patens]
 gb|EDQ64388.1| predicted protein [Physcomitrella patens]
Length=482

 Score =   437 bits (1123),  Expect(2) = 4e-146, Method: Compositional matrix adjust.
 Identities = 223/375 (59%), Positives = 267/375 (71%), Gaps = 23/375 (6%)
 Frame = -1

Query  1868  RVGKKSPAFRVKAVSAPDSAVENPA-----PE---IKEAIK------PVYTPTPSNRPLR  1731
             RV   +P+ R   V A  SA  NP      PE   +K+ +K       VYTPT ++R  R
Sbjct  11    RVAVYAPSRRGCVVKAESSAENNPVTGTSTPEGNALKDRVKSKQTAAAVYTPTLADRDTR  70

Query  1730  TPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSG----IEEVQYG  1563
             TPHSGYHFDGT R+FFEGW+FKVSIPE +QSF +MYSVE+P+     S       E+  G
Sbjct  71    TPHSGYHFDGTSRRFFEGWYFKVSIPEVKQSFAWMYSVEDPSVGSNSSASSLPFGELFQG  130

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEV-PPQEF  1386
               F GVGAQI+GADDKY+ Q+      FWG RHEL+LG TF  +    PP  EV P QEF
Sbjct  131   MSFPGVGAQIMGADDKYLLQFDENVTKFWGSRHELALGYTFTPKGRVSPPMGEVNPQQEF  190

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
              +RV EGFQVTP WHQG +RD+G+TDYA+TV  ARWEYSTRPIYGWG+ G++QKSTAGWL
Sbjct  191   VNRVEEGFQVTPTWHQGCLRDNGKTDYAETVPIARWEYSTRPIYGWGDSGAEQKSTAGWL  250

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             AA PVFEPHWQVCMA GLSTGWIEWDG+RYEFE+APSYSEKNWG  FP KWFW+QCNVFE
Sbjct  251   AALPVFEPHWQVCMAGGLSTGWIEWDGQRYEFEDAPSYSEKNWGGSFPLKWFWIQCNVFE  310

Query  1025  GADGEVSLTSGGGLRQIP-GPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGH  849
             G  GEV+LT+GGG R +P  PG    +E  A++ +HY G FYEFVPW GSV W+IS WG 
Sbjct  311   GVSGEVALTAGGGRRGLPLVPGA---YEEVAMVGIHYDGKFYEFVPWEGSVEWDISTWGS  367

Query  848   WYITAENATHKSQVE  804
             W ++A+   ++  +E
Sbjct  368   WKMSAKRDDYEVNLE  382


 Score =   111 bits (278),  Expect(2) = 4e-146, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 71/109 (65%), Gaps = 4/109 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V LEA    PG TLRAPT ++GLAP+CRD+ +  L+L +  R    S GK ILD TS+M
Sbjct  378  EVNLEATCDSPGCTLRAPTADLGLAPMCRDSFFGKLKLTIRNR----SSGKMILDTTSDM  433

Query  597  AGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
              +EVGGGPW+N+WK +    E LK  L   +D+E +F  VP  KPPGL
Sbjct  434  CALEVGGGPWYNSWKTSARVQEPLKSLLRYSIDVERVFSPVPQLKPPGL  482



>gb|KDO79774.1| hypothetical protein CISIN_1g011258mg [Citrus sinensis]
 gb|KDO79775.1| hypothetical protein CISIN_1g011258mg [Citrus sinensis]
Length=319

 Score =   362 bits (930),  Expect(2) = 9e-142, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 189/217 (87%), Gaps = 3/217 (1%)
 Frame = -1

Query  1454  LGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWE  1275
             LGNTF A   ++PP KEVPPQEFN RVLEGFQVTPLWHQG I DDGRT++A+TVK+ARWE
Sbjct  2     LGNTFRADKGSQPPTKEVPPQEFNRRVLEGFQVTPLWHQGCIHDDGRTNFAETVKSARWE  61

Query  1274  YSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPS  1095
             YSTRP+YGWGNVGSKQ STAGWLAAFPVFEPHWQ+CMA GLSTGWIEWDGER+EF++APS
Sbjct  62    YSTRPVYGWGNVGSKQNSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFQDAPS  121

Query  1094  YSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYG  915
             YSEKNWG  FPRKWFWVQCNVFEGA GEV+LT+GGGLRQ+P     D+FENAA+I +HY 
Sbjct  122   YSEKNWGGAFPRKWFWVQCNVFEGATGEVALTAGGGLRQLP---VLDSFENAAMIGIHYD  178

Query  914   GVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
             G+ YEFVPWNG V+WEIS WG+WY  AEN TH  +++
Sbjct  179   GILYEFVPWNGVVSWEISQWGYWYFAAENQTHMVELK  215


 Score =   171 bits (433),  Expect(2) = 9e-142, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
              VEL+A T  PGTTLRAPT E GLAP C+DTC+ +L LQLWERRYDG+KGK ILDVTS+
Sbjct  210  HMVELKATTKYPGTTLRAPTSEAGLAPACKDTCFGELTLQLWERRYDGTKGKMILDVTSD  269

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA +EVGGGPWFNTWK  T  PE+L++ LN PVD++G+FG VP FKPPGL
Sbjct  270  MAALEVGGGPWFNTWKAKTATPELLRRTLNVPVDVDGLFGFVPFFKPPGL  319



>ref|XP_002971673.1| hypothetical protein SELMODRAFT_172178 [Selaginella moellendorffii]
 gb|EFJ27422.1| hypothetical protein SELMODRAFT_172178 [Selaginella moellendorffii]
Length=453

 Score =   412 bits (1058),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 187/315 (59%), Positives = 239/315 (76%), Gaps = 2/315 (1%)
 Frame = -1

Query  1748  SNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQ  1569
             S+  +RTPHSGYHFDG+ R+F EGW+FKV++P+ +QSF +MYS+E+PAF++  SGI+E+ 
Sbjct  38    SHTAIRTPHSGYHFDGSSRRFMEGWYFKVALPDEKQSFAWMYSIEDPAFSESPSGIKELV  97

Query  1568  YGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQE  1389
              G RF G+GAQ+LG +D+Y+ Q+   ++ FW    EL+LG TF ++  + PP   +P QE
Sbjct  98    KGPRFPGMGAQVLGPNDEYLFQFQDTTRKFWASPTELALGGTFASKKGSSPPRSLLPSQE  157

Query  1388  FNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGW  1209
             F++RV EGFQV   WHQGF+RD+GR+    TV + RWEYSTRP+YGWGN GS QK+TAGW
Sbjct  158   FDTRVEEGFQVDAFWHQGFLRDNGRSPKLNTVDSVRWEYSTRPLYGWGNSGSGQKATAGW  217

Query  1208  LAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVF  1029
             LAAFPVFEPHWQ+CMA GLSTGWI+W  +RYEFE+ PSY EKNWG  FP KWFWVQCNVF
Sbjct  218   LAAFPVFEPHWQICMAHGLSTGWIQWGEKRYEFEDVPSYVEKNWGGTFPEKWFWVQCNVF  277

Query  1028  EGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGH  849
             EG+ G+V+LTSGGG R +P P  S  FE  A++ VH+ G FYEFVPW G V WEI+PWG 
Sbjct  278   EGSSGDVALTSGGGKRGLPFPPGS--FEEVAMVGVHHAGKFYEFVPWAGEVEWEITPWGS  335

Query  848   WYITAENATHKSQVE  804
             W I A    ++  +E
Sbjct  336   WKIAASTIEYEVLLE  350


 Score =   121 bits (303),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = -3

Query  831  ECDTQVT---SGSITEIIICEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQ  661
            E + ++T   S  I    I  +V LEA T  PGT LRAPT++ GL P+C+DT    L+LQ
Sbjct  325  EVEWEITPWGSWKIAASTIEYEVLLEATTDTPGTVLRAPTRD-GLVPICQDTFDGKLKLQ  383

Query  660  LWERRYDGSKGKAILDVTSNMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFG  481
            +WER  +G +GK +LDVTS MA +EVGGGPW+ TWK  +   E L+  +   +D+E IF 
Sbjct  384  IWERSVNGVRGKLVLDVTSEMAALEVGGGPWYTTWKKKSRMAEPLRSLVGLQLDLESIFS  443

Query  480  LVPLFKPPGL  451
             VP  KPPGL
Sbjct  444  SVPALKPPGL  453



>ref|XP_001753489.1| predicted protein [Physcomitrella patens]
 gb|EDQ81712.1| predicted protein [Physcomitrella patens]
Length=518

 Score =   399 bits (1025),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 246/382 (64%), Gaps = 45/382 (12%)
 Frame = -1

Query  1826  SAPDSAVENPAPEIKEAIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPEC  1647
             S    ++ N A    +  K  Y P P++R  RTPHSGYHFDGT R+FFEGW+FKVSIPE 
Sbjct  10    SMESMSISNGATVETKPRKAEYLPMPADRATRTPHSGYHFDGTSRRFFEGWYFKVSIPEV  69

Query  1646  RQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGER  1467
             +QSF +MY+ E P  ++   G  EV          AQ++GAD++Y+ Q  P  KNFW  R
Sbjct  70    KQSFAWMYTSELPGSSELTEG--EVFDPSSTPSGAAQVMGADEEYLLQDAPTLKNFWAAR  127

Query  1466  HELSLGNTFIAQTAARPPNKEVPP------------------------------------  1395
             HEL+LGNT++++    PP  EV P                                    
Sbjct  128   HELALGNTYVSKNGVAPPKSEVDPKVWSIQFVFKRSHLLRPGYSIREKRILLSVCNDLNY  187

Query  1394  -----QEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSK  1230
                  QEF   V EG+QVTP+WHQG +RD+G TD+AKTV T RWEYSTRP+YGWG++G +
Sbjct  188   EFLLKQEFWDSVEEGYQVTPIWHQGCLRDNGSTDFAKTVGTVRWEYSTRPVYGWGSIGER  247

Query  1229  QKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWF  1050
             Q +TAGWLA  PVFEPHWQ+CMA GLSTGWIEW   R+EFE+APSY EKNWG  FP+KWF
Sbjct  248   QLATAGWLAVMPVFEPHWQICMAGGLSTGWIEWGDRRFEFEDAPSYCEKNWGGAFPQKWF  307

Query  1049  WVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTW  870
             W+QCNVF+   GEV+LT+GGG R +  P   D FE+ AL+AVH+ G FYEFVPW G V W
Sbjct  308   WMQCNVFDDFSGEVALTAGGGRRGL--PLLKDTFEDVALVAVHFEGKFYEFVPWEGKVEW  365

Query  869   EISPWGHWYITAENATHKSQVE  804
             +I+PWG W +TA+  TH+ ++E
Sbjct  366   DIAPWGSWKMTAQTKTHEVKLE  387


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 71/122 (58%), Gaps = 3/122 (2%)
 Frame = -3

Query  810  SGSITEIIICEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSK  631
            S  +T      +V+LEA T  PG  LRAPT E G  P+C D+   +L+LQLWER  +GS 
Sbjct  372  SWKMTAQTKTHEVKLEASTDTPGCLLRAPTVE-GFKPICTDSFAGNLKLQLWERNANGSL  430

Query  630  GKAILDVTSNMAGVEVGGG--PWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPP  457
            GK +L+ TS+M  +E GG   PW  +W G     + LK  L  P++ E  +  VP FKPP
Sbjct  431  GKVLLEATSSMCALETGGSRDPWKESWTGKATMRQPLKTLLQLPINPEKFYNWVPGFKPP  490

Query  456  GL  451
            G+
Sbjct  491  GI  492



>gb|AFW70915.1| sucrose export defective1 [Zea mays]
Length=318

 Score =   336 bits (861),  Expect(2) = 7e-125, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 181/218 (83%), Gaps = 3/218 (1%)
 Frame = -1

Query  1454  LGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWE  1275
             LGNTFI+   + PP  EVPPQ+F+ RVLEGFQVTP+WHQGFIRDDGR++Y   V+TARWE
Sbjct  2     LGNTFISNKESTPPQGEVPPQDFSRRVLEGFQVTPIWHQGFIRDDGRSNYVPNVQTARWE  61

Query  1274  YSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPS  1095
             YSTRP+YGWG+V SKQ STAGWLAAFP FEPHWQ+CMA+GLSTGWIEWDGER+EFENAPS
Sbjct  62    YSTRPVYGWGDVKSKQLSTAGWLAAFPFFEPHWQICMASGLSTGWIEWDGERFEFENAPS  121

Query  1094  YSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYG  915
             YSEKNWG GFPRKW+W+QCNVF GA GEVSLT+ GGLR+I   G  D +E+ +LI +HY 
Sbjct  122   YSEKNWGGGFPRKWYWIQCNVFPGASGEVSLTAAGGLRKI---GLGDTYESPSLIGIHYE  178

Query  914   GVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
             G F+EFVPW G+V+W+I  WG W ++ EN TH  ++E 
Sbjct  179   GQFFEFVPWTGTVSWDIGLWGLWKMSGENKTHLVEIEA  216


 Score =   141 bits (356),  Expect(2) = 7e-125, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T++ GT LRAPT E GL P C+DTCY DLRLQLWE++YDGSKG+ ILD TSNMA
Sbjct  212  VEIEATTAESGTALRAPTIEAGLVPACKDTCYGDLRLQLWEKKYDGSKGEMILDATSNMA  271

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT   E++   +  PVD+E +   +P  KPPGL
Sbjct  272  ALEVGGGPWFNGWKGTTVVNEVVNNIVGTPVDVESLL-PIPFLKPPGL  318



>dbj|BAD21817.1| putative tocopherol cyclase [Oryza sativa Japonica Group]
 dbj|BAD28674.1| putative tocopherol cyclase [Oryza sativa Japonica Group]
Length=328

 Score =   325 bits (832),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 180/226 (80%), Gaps = 7/226 (3%)
 Frame = -1

Query  1469  RHELSLGNTFIAQT----AARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYA  1302
             R  L+ G  F+A      A+ P N     +EF+SRVLEGFQVTP+WHQGFIRDDGR+ Y 
Sbjct  3     RASLASGRRFLAPMISTYASSPRNPITFGEEFSSRVLEGFQVTPIWHQGFIRDDGRSKYV  62

Query  1301  KTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGE  1122
               V+TARWEYSTRP+YGWG+V SKQKSTAGWLAAFP FEPHWQ+CMA GLSTGWIEWDGE
Sbjct  63    PNVQTARWEYSTRPVYGWGDVTSKQKSTAGWLAAFPFFEPHWQICMAGGLSTGWIEWDGE  122

Query  1121  RYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFEN  942
             R+EFENAPSYSEKNWG GFPRKW+WVQCNVF GA GEV+LT+ GGLR+I   G  + +E+
Sbjct  123   RFEFENAPSYSEKNWGAGFPRKWYWVQCNVFSGASGEVALTAAGGLRKI---GLGETYES  179

Query  941   AALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
              +LI +HY G FYEFVPW G+V+W+I+PWGHW ++ EN  H  ++E
Sbjct  180   PSLIGIHYEGKFYEFVPWTGTVSWDIAPWGHWKLSGENKNHLVEIE  225


 Score =   148 bits (373),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+EA T +PGT LRAPT E GL P C+DTCY DLRLQ+WE+R DG KGK ILD TSNMA
Sbjct  222  VEIEATTKEPGTALRAPTMEAGLVPACKDTCYGDLRLQMWEKRNDGGKGKMILDATSNMA  281

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWFN WKGTT + EI+   +   VD+E +F  +P  KPPGL
Sbjct  282  ALEVGGGPWFNGWKGTTVSNEIVNNVVGTQVDVESLF-PIPFLKPPGL  328



>ref|XP_002965666.1| hypothetical protein SELMODRAFT_143592 [Selaginella moellendorffii]
 gb|EFJ33086.1| hypothetical protein SELMODRAFT_143592 [Selaginella moellendorffii]
Length=395

 Score =   381 bits (978),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 222/294 (76%), Gaps = 2/294 (1%)
 Frame = -1

Query  1685  FEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYIC  1506
              EGW+FKV++P+ +QSF +MYS+E+PAF++  SGI+E+  G RF G+GAQ+LG +D+Y+ 
Sbjct  1     MEGWYFKVALPDEKQSFAWMYSIEDPAFSESPSGIKELVKGPRFPGMGAQVLGPNDEYLF  60

Query  1505  QYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIR  1326
             Q+   ++ FW  R EL+LG TF ++  + PP   +P QEF+SRV EGFQV   WHQGF+R
Sbjct  61    QFQDTTRKFWASRTELALGGTFASKKGSSPPRSLLPSQEFDSRVEEGFQVDAFWHQGFLR  120

Query  1325  DDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLST  1146
             D+GR+    TV + RWEYSTRP+YGWGN GS QK+TAGWLAAFPVFEPHWQ+CMA GLST
Sbjct  121   DNGRSPKLNTVDSVRWEYSTRPLYGWGNSGSGQKATAGWLAAFPVFEPHWQICMAHGLST  180

Query  1145  GWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGP  966
             GWI+W  +RYEFE+ PSY EKNWG  FP KWFWVQCNVF+G+ G+V+LTSGGG R +P P
Sbjct  181   GWIQWGEKRYEFEDVPSYVEKNWGGTFPEKWFWVQCNVFQGSSGDVALTSGGGKRGLPFP  240

Query  965   GTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVE  804
               S  FE  A++ VH+ G FYEFVPW G V WEI+PWG W I A    ++  +E
Sbjct  241   PGS--FEEVAMVGVHHAGKFYEFVPWAGEVEWEITPWGSWKIAASTIEYEVLLE  292


 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = -3

Query  831  ECDTQVT---SGSITEIIICEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQ  661
            E + ++T   S  I    I  +V LEA T  PGT LRAPT++ GL P+C+DT    L+LQ
Sbjct  267  EVEWEITPWGSWKIAASTIEYEVLLEATTDTPGTVLRAPTRD-GLVPICQDTFDGKLKLQ  325

Query  660  LWERRYDGSKGKAILDVTSNMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFG  481
            +WER  +G +GK +LDVTS MA +EVGGGPW+ TWK  +   E L+  +   +D+E +F 
Sbjct  326  IWERSVNGVRGKLVLDVTSEMAALEVGGGPWYTTWKKKSRMAEPLRSLVGLQLDLESVFS  385

Query  480  LVPLFKPPGL  451
             VP  KPPGL
Sbjct  386  SVPALKPPGL  395



>emb|CDP01472.1| unnamed protein product [Coffea canephora]
Length=292

 Score =   290 bits (741),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 149/167 (89%), Gaps = 2/167 (1%)
 Frame = -1

Query  1307  YAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWD  1128
              +KTVKTARW YSTRPIYGWGNV SKQKSTAGWLAAFPVFEPHWQ+CMA GLSTGWIEWD
Sbjct  23    LSKTVKTARWGYSTRPIYGWGNVDSKQKSTAGWLAAFPVFEPHWQMCMAGGLSTGWIEWD  82

Query  1127  GERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNF  948
             GER+EFENAPSYSEKNWG GFPR+WFWVQCNVFEGA G+++LT+ GGLRQ+  PG SD F
Sbjct  83    GERFEFENAPSYSEKNWGGGFPRRWFWVQCNVFEGASGDIALTAAGGLRQL--PGLSDTF  140

Query  947   ENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQV  807
             ENAALI VHY GVFYEFVPWNG V WE+S WG+W+++AEN THK ++
Sbjct  141   ENAALIGVHYRGVFYEFVPWNGVVKWEVSQWGYWFMSAENKTHKVEL  187


 Score =   162 bits (411),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSN  601
             +VEL A T DPGTTLRAPT E G A  C+DTC A+LRLQLW+RR DGSKG  ILDVTSN
Sbjct  183  HKVELVATTKDPGTTLRAPTSEAGFASACKDTCSAELRLQLWDRRSDGSKGNIILDVTSN  242

Query  600  MAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
            MA VEVGGGPWF+ WKG TNAPE + +AL+ PVD+EG+   VPL KPPGL
Sbjct  243  MAAVEVGGGPWFSPWKGQTNAPEFVSRALSLPVDVEGLLDSVPLLKPPGL  292



>ref|XP_005850523.1| hypothetical protein CHLNCDRAFT_19624 [Chlorella variabilis]
 gb|EFN58421.1| hypothetical protein CHLNCDRAFT_19624 [Chlorella variabilis]
Length=465

 Score =   335 bits (859),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/321 (51%), Positives = 220/321 (69%), Gaps = 23/321 (7%)
 Frame = -1

Query  1745  NRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
              R LRTPHSGYH+DGT R+FFEGW+FKV++P   QSF  +YSVE+P              
Sbjct  56    GRSLRTPHSGYHWDGTPRRFFEGWYFKVTLPGDGQSFALIYSVEDPLGNN----------  105

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPN---KEVPP  1395
               +++GVGAQ++G DD Y+ QY+P+ + FW +R EL+LG  F  ++A++P +   + +PP
Sbjct  106   --KYSGVGAQVMGPDDGYLLQYSPQVQEFWADRSELALGAVFKQRSASQPLSGLKRVLPP  163

Query  1394  QEFNSRVLEGFQVTPLWHQGFI--RDDGRTD-YAKTVKTARWEYSTRPIYGWGNVGSKQK  1224
              +F + V +GFQ T  WHQG I  ++ G T     TV T RW +S RP+ GWG+VG +QK
Sbjct  164   AQFEAGVEQGFQATATWHQGSIVRQEAGATGTLTSTVDTCRWAFSVRPVVGWGDVGGRQK  223

Query  1223  STAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWV  1044
             +TAGWLA+ PVFEPHWQV MA GL+TGW+EW G+RYEF +AP Y EKNWG GFPR+W W+
Sbjct  224   ATAGWLASLPVFEPHWQVVMAHGLATGWVEWGGQRYEFTDAPHYVEKNWGGGFPRRWCWI  283

Query  1043  QCNVFEGADGEVSLTSGGGLRQIPG-PGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWE  867
             QCN FEG  G  S+T+ G LR + G PG     EN  +I +H+ G FYEF+P NGS++W+
Sbjct  284   QCNTFEGEPG-TSVTAVGALRGLLGVPGVE---ENVGMIGIHHRGRFYEFLPNNGSLSWD  339

Query  866   ISPWGHWYITAENATHKSQVE  804
             + PWG W I+A    H++ VE
Sbjct  340   VDPWGRWRISARTREHEAVVE  360


 Score = 84.7 bits (208),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  780  EQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTS-  604
             +  +EA    PGT LRAPT + GLAP CRD+    +R+++W     G  G  ILD TS 
Sbjct  355  HEAVVEAVCEAPGTPLRAPTIDEGLAPFCRDSFCGKVRIRVWAAGDTG--GTPILDCTSA  412

Query  603  -NMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPL-FKPPGL  451
             N   VEVGGGPWF+ W+        +KQ LN P+D+E +   +P   +PPGL
Sbjct  413  GNSGAVEVGGGPWFSRWQQEAEMAGPVKQLLNLPLDVEALADWLPAKLRPPGL  465



>ref|WP_009783104.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW38223.1| hypothetical protein L8106_09376 [Lyngbya sp. PCC 8106]
Length=355

 Score =   311 bits (796),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/306 (50%), Positives = 200/306 (65%), Gaps = 26/306 (8%)
 Frame = -1

Query  1745  NRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
               PL+TPHS YH+DG+  +FFEGW+F+V++ E RQ+F +MYS+E+P              
Sbjct  4     QNPLQTPHSHYHWDGSEHRFFEGWYFRVTLLEARQTFAFMYSIEDPIG------------  51

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEF  1386
             G   +G GAQILG DD Y+C+  P+ K FW     L LG+      ++ P   E  PQ F
Sbjct  52    GNLHSGGGAQILGPDDGYLCRTFPDVKTFWASPEALELGHWGQTDLSSAPGYLE--PQLF  109

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
             N  + +G+QVT  WHQG + D G      T +T RWEYST+PIYGWGN+G  Q+STAGWL
Sbjct  110   NHHIQQGYQVTTTWHQGILHDPG------TQQTCRWEYSTQPIYGWGNLGQSQQSTAGWL  163

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             +  P+FEP WQ+ MA GL+TGWIEW+   YEF +AP+YSEKNWG  FP+KWFW+ CN FE
Sbjct  164   SFLPIFEPGWQILMAHGLATGWIEWNDTIYEFNHAPAYSEKNWGGAFPQKWFWINCNCFE  223

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
               + +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V+W+I PWG W
Sbjct  224   N-EPDLALTAGGGRR-----GVLTWMESVAMIGIHYQGQFYEFVPWNSQVSWQIEPWGKW  277

Query  845   YITAEN  828
              + A+N
Sbjct  278   QVQAKN  283


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 9/75 (12%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGK-AILDVTSN  601
            QV L A T+ PGT LRAPTQ+ GL   CRDT  A++ L+L        +GK  IL+  S+
Sbjct  287  QVTLTATTNQPGTPLRAPTQD-GLIFFCRDTMQAEVSLEL-------KQGKEVILEAKSD  338

Query  600  MAGVEVGGGPWFNTW  556
              GVEVGG PW   W
Sbjct  339  QCGVEVGGHPWTEVW  353



>ref|WP_007357481.1| MULTISPECIES: tocopherol cyclase [Kamptonema]
 emb|CBN58299.1| tocopherol cyclase [ [[Oscillatoria] sp. PCC 6506]
Length=371

 Score =   311 bits (797),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 207/312 (66%), Gaps = 30/312 (10%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L+TPHSGYH+DG+ R+FFEGW+++V++P+ RQ+F +MYS+E+PA  +P SG         
Sbjct  5     LQTPHSGYHWDGSVRRFFEGWYYRVTLPQKRQTFAFMYSIEDPAGNQPESG---------  55

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
                  AQILG DD Y+C+  P    FWG R+ L LG+        +P  K + PQ F+S 
Sbjct  56    ---GAAQILGPDDGYLCRTFPNVNTFWGWRNALGLGHWGKTDLQIQP--KYLEPQVFDSH  110

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + EG+Q T  WHQG++ D G      + +T  W+Y  +P+YGWGN G  Q+STAG L++ 
Sbjct  111   IQEGYQATATWHQGYLHDPG------SDRTCYWQYEIKPVYGWGNSGEAQQSTAGLLSSL  164

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             P+FEP WQ+ MA GL++GWIEWDG+RYEF +AP+Y EKNWG  FP+KWFW+ CN F+G +
Sbjct  165   PIFEPGWQILMAHGLASGWIEWDGDRYEFTDAPAYGEKNWGGAFPKKWFWLNCNCFDG-E  223

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V W+I PWG W + 
Sbjct  224   SDLALTAGGGRR-----GVLWWMESVAMIGIHYRGKFYEFVPWNSEVKWDIDPWGRWQVN  278

Query  836   AENATHKSQVEV  801
             A+N    SQ EV
Sbjct  279   AKN----SQFEV  286


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 46/83 (55%), Gaps = 2/83 (2%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT E GL   CRDT    L LQL   +  G+  K IL+  SN+
Sbjct  285  EVELIGTTELPGTLLRAPT-EKGLVFCCRDTMQGKLSLQLRALQGKGNS-KIILEAQSNL  342

Query  597  AGVEVGGGPWFNTWKGTTNAPEI  529
             G+E GGGPW   W+  +    I
Sbjct  343  CGLETGGGPWDEAWRSQSEGLAI  365



>ref|WP_015172570.1| tocopherol cyclase [Geitlerinema sp. PCC 7407]
 ref|YP_007110058.1| tocopherol cyclase [Geitlerinema sp. PCC 7407]
 gb|AFY67006.1| tocopherol cyclase [Geitlerinema sp. PCC 7407]
Length=373

 Score =   309 bits (792),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/324 (47%), Positives = 211/324 (65%), Gaps = 26/324 (8%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             A     TP    R L+TPHSGYH+DG+ R+FFEGW+++V++P+ R++F +MYS+E+P   
Sbjct  5     ACSDFMTPGSPFRSLQTPHSGYHWDGSDRRFFEGWYYRVTLPDVRETFAFMYSIEDP---  61

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
                      Q G+  +G GAQILG  D+Y+C+  P+ + FW    EL+LG+         
Sbjct  62    ---------QGGQFHSGGGAQILGPRDEYLCRTFPDCRGFWASPGELALGHWQAIAPGET  112

Query  1418  PPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
             P  + +PP +F+ ++ EG+Q T  WHQG +RD G      + +TA WEY   P+YGWG+ 
Sbjct  113   P--RLLPPADFDHQIAEGYQATATWHQGKLRDPG------SGQTALWEYGIEPVYGWGDR  164

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
             G+ Q+STAGWL+  P+FEP WQ+ MA GL++GWIEW+G+RY+F  AP+YSEKNWG  FP 
Sbjct  165   GAAQQSTAGWLSFLPIFEPGWQILMAHGLASGWIEWNGQRYDFTCAPAYSEKNWGGAFPE  224

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFWV CN FE  + +++LT+GGG R     G     E+ A++ +HY G FYEFVPWN  
Sbjct  225   KWFWVNCNSFE-DEPDLALTAGGGRR-----GVLTWMESVAMVGLHYRGKFYEFVPWNAR  278

Query  878   VTWEISPWGHWYITAENATHKSQV  807
             V+W I PWG+W I AEN     +V
Sbjct  279   VSWHIKPWGYWQIRAENERFAVEV  302



>ref|WP_023068270.1| tocopherol cyclase family protein [Lyngbya aestuarii]
 gb|ERT05448.1| tocopherol cyclase family protein [Lyngbya aestuarii BL J]
Length=355

 Score =   308 bits (789),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 199/307 (65%), Gaps = 26/307 (8%)
 Frame = -1

Query  1748  SNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQ  1569
                PL+TPHS YH+DG+  +FFEGW+F+V++PE RQ+F +MYS+E+P             
Sbjct  3     QQNPLQTPHSHYHWDGSEHRFFEGWYFRVTLPEARQTFAFMYSIEDPVG-----------  51

Query  1568  YGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQE  1389
              G   +G GAQIL  DD Y+C+  P+ K FW     L LG+      ++ P   E  PQ 
Sbjct  52    -GNLHSGGGAQILCPDDGYLCRTFPDVKKFWASPEALELGHWGQTDLSSAPGYLE--PQL  108

Query  1388  FNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGW  1209
             FN+ + +G+QVT  WHQG + D G      T +T RWEYST+PIYGWGN    Q+STAGW
Sbjct  109   FNNHIQQGYQVTTTWHQGILHDPG------TQQTCRWEYSTQPIYGWGNADQPQQSTAGW  162

Query  1208  LAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVF  1029
             L+  P+FEP WQ+ MA GL+TGWIEW+   YEF +AP+YSEKNWG  FP+KWFW+ CN F
Sbjct  163   LSFLPIFEPGWQILMAHGLATGWIEWNDTIYEFNHAPAYSEKNWGGAFPQKWFWINCNCF  222

Query  1028  EGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGH  849
             E  + +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V+W+I PWG 
Sbjct  223   EN-EPDLALTAGGGRR-----GVLTWMESVAMIGIHYQGRFYEFVPWNSQVSWQIEPWGK  276

Query  848   WYITAEN  828
             W + A+N
Sbjct  277   WQVQAKN  283


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 45/75 (60%), Gaps = 9/75 (12%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAI-LDVTSN  601
            QV L A T+ PGT LRAPTQ+ GL   CRDT  A++ L+L        KGK I L+  S+
Sbjct  287  QVTLTATTNQPGTPLRAPTQD-GLIFFCRDTMQAEVSLEL-------KKGKEIILEAKSD  338

Query  600  MAGVEVGGGPWFNTW  556
              GVEVGG PW   W
Sbjct  339  QCGVEVGGHPWTEVW  353



>ref|WP_015203162.1| tocopherol cyclase [Crinalium epipsammum]
 ref|YP_007142556.1| tocopherol cyclase [Crinalium epipsammum PCC 9333]
 gb|AFZ13046.1| tocopherol cyclase [Crinalium epipsammum PCC 9333]
Length=362

 Score =   307 bits (786),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 209/314 (67%), Gaps = 26/314 (8%)
 Frame = -1

Query  1748  SNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQ  1569
             S+  ++TPHSGYH+D T R+FFEGW+++V++P+   +F +MYS+E+P             
Sbjct  5     SSANIQTPHSGYHWDNTSRRFFEGWYYRVTLPDSGDTFAFMYSIEDPIG-----------  53

Query  1568  YGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQE  1389
              G+  +G  AQILGA+D+Y+C+  P+   FW     L+LG+    +T  +     + P +
Sbjct  54    -GKAHSGGAAQILGANDEYLCRSFPDVNKFWASGDRLALGH--WGKTDLQTLPSYLSPTD  110

Query  1388  FNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGW  1209
             F   V EG+Q T  WHQGF+ D G      T  TARW+Y  +PIYGWGN G+ Q+STAGW
Sbjct  111   FERHVQEGYQATATWHQGFLHDPG------TGSTARWQYEIKPIYGWGNQGAPQQSTAGW  164

Query  1208  LAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVF  1029
             L++  +FEP WQ+ MA GL+TGWIEW+G+RY+F NAP+YSEKNWG  FP+KWFW+ CN F
Sbjct  165   LSSLQIFEPGWQILMAHGLATGWIEWNGKRYDFTNAPAYSEKNWGGSFPQKWFWLNCNWF  224

Query  1028  EGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGH  849
             +G + +++LT+GGG R     G     E+ A++ VH+ G FYEFVPWN  V W+I PWG 
Sbjct  225   DG-EPDLALTAGGGRR-----GVLWWMESVAMVGVHHQGKFYEFVPWNAKVNWDIQPWGK  278

Query  848   WYITAENATHKSQV  807
             WY+ AENA ++ ++
Sbjct  279   WYMHAENAFYEMEL  292


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            ++EL   T  PGT LRAPT   G+   CRDT   +L LQL E+R    K K IL+  S++
Sbjct  289  EMELTGTTDLPGTLLRAPTNN-GMIFCCRDTMNGELHLQLREKRL--GKSKLILEAHSSL  345

Query  597  AGVEVGGGPWFNTWKGT  547
             G+EVGGG W  +W+ +
Sbjct  346  CGLEVGGGSWEESWRSS  362



>ref|XP_001689451.1| tocopherol cyclase [Chlamydomonas reinhardtii]
 gb|EDP09189.1| tocopherol cyclase [Chlamydomonas reinhardtii]
Length=442

 Score =   279 bits (713),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/340 (43%), Positives = 200/340 (59%), Gaps = 33/340 (10%)
 Frame = -1

Query  1730  TPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFT  1551
             TPHSGYHFDGT R+FFEGW++KV +PE  QSF  +YS+E+P    P +G+         +
Sbjct  1     TPHSGYHFDGTPRRFFEGWYWKVQLPETGQSFALIYSIEDPLGNTPQAGVGLQVRRATLS  60

Query  1550  GVGAQILGADDKYICQYTPESKNFWGERHELSLGNTF-----------------------  1440
                +Q++G DD YICQ+TP    FW ER+ L+LG TF                       
Sbjct  61    QSQSQVMGPDDGYICQFTPNVTGFWAERNRLALGATFKPANTTASSPSSTTSSGSSWSSG  120

Query  1439  -----IAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWE  1275
                   + TAA  P + +P   F ++V +GFQ +    QG +  DGR D +    T RW 
Sbjct  121   SSGSSRSGTAAGGPRRLLPADSFFAQVEQGFQASDSTQQGRMGSDGR-DGSGATCTKRWA  179

Query  1274  YSTRPIYGWGNV-GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAP  1098
             Y  R   GWG+  G  QK+TAGWL+  P+FEPHWQV MA G ++GW++W G+RYEF++AP
Sbjct  180   YGLRLGAGWGSTSGPTQKATAGWLSVLPIFEPHWQVMMAHGEASGWLQWGGQRYEFQDAP  239

Query  1097  SYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHY  918
             +Y+EKNWG GFP KW W+QCN F+G  G +S+T+ G  R +   G     E+  LI VH 
Sbjct  240   AYAEKNWGGGFPSKWHWIQCNSFDGWPG-LSVTAVGARRALL-LGLQGVEEDVGLIGVHL  297

Query  917   -GGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
              GG F E VPWN  + W++ PWG W++ A N  +++ VE 
Sbjct  298   PGGEFVELVPWNSELEWDVDPWGRWWLRAVNDRYEALVEA  337


 Score = 92.0 bits (227),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 62/101 (61%), Gaps = 1/101 (1%)
 Frame = -3

Query  750  DPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMAGVEVGGGP  571
            + G  LRAPT  MGLAP C+DT +   RL+LW R     +G+ ++D TS+ A +EVGGGP
Sbjct  342  EAGAVLRAPTTSMGLAPFCKDTFFGQCRLRLWRRAGGTKQGQPLVDATSSTAALEVGGGP  401

Query  570  WFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPL-FKPPGL  451
            W++ W+      E  +  +  P+D+ G+  LVP   +PPGL
Sbjct  402  WWSAWRARAEMKEPFRSLVTLPLDVAGLGQLVPEPLRPPGL  442



>ref|XP_005651298.1| tocopherol cyclase [Coccomyxa subellipsoidea C-169]
 gb|EIE26754.1| tocopherol cyclase [Coccomyxa subellipsoidea C-169]
Length=483

 Score =   281 bits (720),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 143/325 (44%), Positives = 196/325 (60%), Gaps = 19/325 (6%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGR-  1560
             + TPHSGYHFDG+R +FFEGW++KVS+    +SF ++YS+E+P       G+        
Sbjct  60    VTTPHSGYHFDGSRDRFFEGWYWKVSLGGPGESFAFIYSIEDPKGNTQTGGVGAQACTSV  119

Query  1559  ---RFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIA---QTAARPPNKEVP  1398
                      AQI+G  D Y+ QY+     FW ++H L+LG  F A   Q     P   +P
Sbjct  120   PWLTLLKAHAQIMGPGDSYLLQYSNNVGAFWADQHSLALGARFRAPNGQALRVAPQSILP  179

Query  1397  PQEFNSRVLEGFQVTPLWHQGFIRDD---GRTDYAKTVKTARWEYSTRPIYGWGNVGSKQ  1227
                F+  V +G+Q +  WHQG +  D    R D   TV +A+W +S  PI GWG    KQ
Sbjct  180   QDAFDRSVDQGYQASQTWHQGSLVADEAGARGDLRSTVPSAQWAFSVTPIDGWGPRAGKQ  239

Query  1226  KSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFW  1047
             ++TAGWLAA PVFEPHWQ+ MA G ++GW++W   RYEF +AP+Y+EKNWG GFP+KWFW
Sbjct  240   QATAGWLAALPVFEPHWQILMARGTASGWVQWGNRRYEFTDAPAYAEKNWGAGFPKKWFW  299

Query  1046  VQCNVFEGADGEVSLTSGG---GLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSV  876
             V    FEG + + SLT+ G   GL Q+PG       E+  ++ +H+ G F E VPWNG V
Sbjct  300   VVATGFEG-EPDASLTAVGARRGLLQLPGVE-----EDVGMVGIHWKGQFIEMVPWNGDV  353

Query  875   TWEISPWGHWYITAENATHKSQVEV  801
              WE+ PWG W I A+N+ +++ VE 
Sbjct  354   QWEVEPWGRWRIYAKNSQYEALVEA  378


 Score = 89.4 bits (220),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = -3

Query  768  LEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDG-SKGKAILDVTSNMAG  592
            +EA  S PGT LRAPT + GL   CRD+ + ++RL++W R   G  + + ++D+ +N   
Sbjct  376  VEAGCSSPGTPLRAPTADRGLDVFCRDSFHGEVRLRVWRRDSAGVRRTEPLIDLHTNDGA  435

Query  591  VEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVP-LFKPPGL  451
            VEVGGGPW++TW+      + LK  +  PVD+E +   +P   +PPGL
Sbjct  436  VEVGGGPWWSTWQAQAEMQQPLKSIVGLPVDVESVVAALPQALRPPGL  483



>ref|WP_015181879.1| tocopherol cyclase [Microcoleus sp. PCC 7113]
 ref|YP_007121133.1| tocopherol cyclase [Microcoleus sp. PCC 7113]
 gb|AFZ17727.1| tocopherol cyclase [Microcoleus sp. PCC 7113]
Length=367

 Score =   296 bits (758),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/312 (44%), Positives = 204/312 (65%), Gaps = 26/312 (8%)
 Frame = -1

Query  1742  RPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
              PL+TPHS YH+DG+  +FFEGW+++V++P C Q+F +MYS+++P              G
Sbjct  3     NPLQTPHSEYHWDGSDSRFFEGWYYRVTLPNCGQTFAFMYSIDDPVG------------G  50

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
             +  +G  AQILG +D+Y+C+  P  + FWG    L+LG+    +T    P + + P  F 
Sbjct  51    KHCSGGAAQILGPNDEYLCRTFPNVQQFWGSSKSLALGH--WGKTDLPSPPQYLDPATFE  108

Query  1382  SRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLA  1203
               + EG+Q T   +QG+I D   +         RW+Y  +P+YGW + G+ Q+STAGWL+
Sbjct  109   RHIQEGYQATATLNQGYIHDPASS------TDCRWQYEIKPVYGWADSGTPQQSTAGWLS  162

Query  1202  AFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEG  1023
               P+FEP WQ+ MA GL+TGW++W+G+RY+F +AP+YSEKNWG  FP+KWFW+ CN F+G
Sbjct  163   YLPIFEPGWQILMAHGLATGWVDWNGKRYDFTDAPAYSEKNWGHAFPKKWFWLNCNSFDG  222

Query  1022  ADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWY  843
              +  ++LT+GGG R++ G       E+AAL+ +HY G FYEFVPWN  V+W+I PWG W 
Sbjct  223   -ESNLALTAGGGNRKVLGWE-----ESAALVGIHYQGKFYEFVPWNSKVSWQIQPWGSWQ  276

Query  842   ITAENATHKSQV  807
             + AEN  ++ Q+
Sbjct  277   MQAENGEYEVQL  288


 Score = 72.8 bits (177),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V+L   T  PGT LRAPT E GL   CRDT Y  L L+L ERR    K K IL+ +S++
Sbjct  285  EVQLTGTTQYPGTPLRAPT-EQGLIFFCRDTMYGQLSLELRERR--SGKSKIILNASSSV  341

Query  597  AGVEVGGGPWFNTWKGTTNAPEIL  526
             G+E+GGGPW + W  +   P ++
Sbjct  342  CGLEIGGGPWQDAWVSSAKFPWVI  365



>ref|WP_036005526.1| tocopherol cyclase [Leptolyngbya sp. JSC-1]
Length=377

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/332 (45%), Positives = 212/332 (64%), Gaps = 44/332 (13%)
 Frame = -1

Query  1742  RPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
              PL+TPHSGYH+DG+ R+FFEGW+++V++PE RQ+F +MYS+E+P              G
Sbjct  2     HPLQTPHSGYHWDGSDRRFFEGWYYRVTLPEARQTFAFMYSIEDPTG------------G  49

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLG--------NTFIAQTAARPPN-  1410
             +  +G  AQILG +D+Y+C+  P+ ++FW  RH L LG        N     T + PP+ 
Sbjct  50    QVHSGGAAQILGPNDEYLCRTFPDVQSFWAWRHALGLGHWRRLNATNKSSKVTESSPPSP  109

Query  1409  -----------KEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTR  1263
                          +P  +F+ ++ EG+Q T  WHQG +RD G      +  TA W+Y+  
Sbjct  110   LVRRGSRAASPHHLPSAQFDHQIHEGYQATATWHQGILRDPG------SGFTAHWQYAIE  163

Query  1262  PIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEK  1083
             P+YGWG+V   Q+STAGWL+ + +FEP WQ+ MA GL+TGWIEW+ +RYEF NAP+Y EK
Sbjct  164   PVYGWGDVNESQQSTAGWLSQWQIFEPGWQILMAHGLATGWIEWNHKRYEFVNAPAYGEK  223

Query  1082  NWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFY  903
             NWG  FP+KWFW+ CN F   + +++LT+GGG R     G     E+ A++ +HY G FY
Sbjct  224   NWGGAFPQKWFWINCNCFAN-EPDLALTAGGGRR-----GVLWWMESVAMVGIHYKGKFY  277

Query  902   EFVPWNGSVTWEISPWGHWYITAENATHKSQV  807
             EFVPWN  VTWEI PWG W + A+N+ +++++
Sbjct  278   EFVPWNSQVTWEIQPWGDWRMRAQNSQYEAEL  309


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            + EL A T+ PGT LRAPTQ+ GL   CRDT    + LQL +R    +  K IL  TS++
Sbjct  306  EAELTATTNLPGTPLRAPTQQ-GLVFCCRDTMRGQIHLQLRQR----ATSKLILTATSDL  360

Query  597  AGVEVGGGPWFNTWK  553
             G+E GGGPW   WK
Sbjct  361  CGLETGGGPWDGVWK  375



>ref|WP_026796046.1| MULTISPECIES: tocopherol cyclase [Planktothrix]
Length=359

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/309 (47%), Positives = 204/309 (66%), Gaps = 26/309 (8%)
 Frame = -1

Query  1742  RPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
              PL+TPHSGYH+DG+ R+FFEGW+++V++P+ +Q+F +MYS+E+P   +P SG       
Sbjct  9     NPLQTPHSGYHWDGSDRRFFEGWYYRVTLPQEKQTFAFMYSIEDPIGNQPQSG-------  61

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
                   GAQILG DD Y+C+  P+ K FW    +L LG+       A P   E  P  F 
Sbjct  62    -----GGAQILGPDDGYLCRTFPDVKTFWATSDQLGLGHWGKTDLTAIPGYLE--PTIFE  114

Query  1382  SRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLA  1203
             + + +G+Q T   HQG + D G + Y        W+Y+ +PIYGWGN    Q+STAGWL+
Sbjct  115   NSIQQGYQGTATLHQGKLADSGSSQYCN------WQYNIQPIYGWGNPNQPQQSTAGWLS  168

Query  1202  AFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEG  1023
               P+FEP WQ+ MA GL+TGWI+W+G+ Y+FENAP+Y EKNWG  FP++WFWV CN F+G
Sbjct  169   FLPIFEPGWQILMAHGLATGWIDWNGQIYQFENAPAYGEKNWGGSFPKQWFWVNCNSFDG  228

Query  1022  ADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWY  843
              + +++LT+GGG+R +         E+ ALIA+HY G FYEFVPWN  V+W+I PWG W 
Sbjct  229   -ETDLALTAGGGIRDVLFWS-----ESVALIAIHYQGKFYEFVPWNSEVSWQIEPWGKWQ  282

Query  842   ITAENATHK  816
             +TA+N  ++
Sbjct  283   MTAKNNEYE  291


 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V L A T  PGT LRAPTQ  GL   CRDT    + LQL       +    IL+ TS++
Sbjct  291  EVCLTATTEHPGTLLRAPTQ-AGLIFRCRDTMQGKIHLQL------KAGNSIILEATSSL  343

Query  597  AGVEVGGGPWFNTWK  553
             GVEVGG  W  TWK
Sbjct  344  GGVEVGGDLWQETWK  358



>ref|WP_011611435.1| tocopherol cyclase [Trichodesmium erythraeum]
 ref|YP_721533.1| tocopherol cyclase [Trichodesmium erythraeum IMS101]
 gb|ABG51060.1| tocopherol cyclase [Trichodesmium erythraeum IMS101]
Length=358

 Score =   300 bits (768),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 201/311 (65%), Gaps = 26/311 (8%)
 Frame = -1

Query  1739  PLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGR  1560
             PL+TPHSGYH+DG+ R+FFEGW+++V++PE +Q+F +MYS+E+P   +P           
Sbjct  5     PLQTPHSGYHWDGSDRRFFEGWYYRVTLPEEKQTFAFMYSIEDPIGGQP-----------  53

Query  1559  RFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNS  1380
              ++G GAQILG +D+Y+C+  P+ K FW     L LG+    QT    P   + PQ F  
Sbjct  54    -YSGGGAQILGPNDEYLCRTFPDVKKFWATPEVLELGH--WGQTNLTSPVGYLDPQLFED  110

Query  1379  RVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAA  1200
             ++ EG+Q T  WHQG + D  R +Y       RW+Y T+PIYGWGN  + Q+STAGWL+ 
Sbjct  111   QIKEGYQATANWHQGVLWDPRRNNYC------RWQYKTQPIYGWGNPNAIQQSTAGWLSF  164

Query  1199  FPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGA  1020
               +FEP WQ+ MA GL+TGWIEW+G  Y+F NAP+YSEKNWG  FP+KWFW+ CN F   
Sbjct  165   LQIFEPGWQILMAHGLATGWIEWNGRIYKFTNAPAYSEKNWGGAFPKKWFWLNCNSFYDV  224

Query  1019  DGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYI  840
               +++LT+GGG R     G     E  A+I +HY G FYEFVPWN  V W+I PWG W +
Sbjct  225   S-DLTLTAGGGKR-----GVLWWMEKVAMIGIHYQGKFYEFVPWNSKVYWQIQPWGEWQM  278

Query  839   TAENATHKSQV  807
              A+N   + ++
Sbjct  279   QAKNDLFEVEL  289


 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL A T+  GT LRAP+ E GL  +CRDT    L L+L E R   S  K IL+  S++
Sbjct  286  EVELTATTNHSGTLLRAPS-EQGLIFLCRDTMRGHLTLKLKEVR--DSHSKLILEARSDL  342

Query  597  AGVEVGGGPWFNTW  556
             G+EVGGG W   W
Sbjct  343  CGLEVGGGSWEQAW  356



>ref|XP_002956377.1| hypothetical protein VOLCADRAFT_42287 [Volvox carteri f. nagariensis]
 gb|EFJ42521.1| hypothetical protein VOLCADRAFT_42287 [Volvox carteri f. nagariensis]
Length=411

 Score =   275 bits (702),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 191/317 (60%), Gaps = 20/317 (6%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             + TPHSGYHFDGT R+FFEGW++KV +PE  QSF  +YS+E+P    P            
Sbjct  2     VTTPHSGYHFDGTPRRFFEGWYWKVMMPESGQSFALIYSIEDPLGNTPQ-----------  50

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQE-FNS  1380
              TG+G Q++G +D YICQ+T +  +FW + H  +LG TF     AR   K++ PQ+ F  
Sbjct  51    -TGIGLQVMGPNDGYICQFTSDVSSFWADPHHPALGATFKTSNTARVAPKDILPQDQFLR  109

Query  1379  RVLEGFQVTPLWHQG---FIRDDGRTDYAKTVKTARWEYSTRPIYGWG-NVGSKQKSTAG  1212
              V  GFQ T + H G    +          TV TA W  + +P  GWG    + QK+TAG
Sbjct  110   DVEHGFQATDVMHVGRMVALETGAAGPPMSTVPTASWALTIKPKAGWGPTQAATQKATAG  169

Query  1211  WLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNV  1032
             WL+  P+FEPHWQV MA G ++GW++W G+RY+F  AP+Y+EKNWG GFP KW W+QCN 
Sbjct  170   WLSVLPIFEPHWQVLMAHGEASGWLQWGGQRYQFSGAPAYAEKNWGGGFPSKWHWIQCNS  229

Query  1031  FEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHY-GGVFYEFVPWNGSVTWEISPW  855
             F+G  G +S+T+ G  R +   G     E+  LI VH  GG F E VPWN  + W++ PW
Sbjct  230   FDGQPG-LSVTAVGARRALL-LGLQGVEEDVGLIGVHLPGGEFVEMVPWNSELEWDVDPW  287

Query  854   GHWYITAENATHKSQVE  804
             G W++ A N   ++ VE
Sbjct  288   GRWWLRAVNERFEALVE  304


 Score = 89.7 bits (221),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = -3

Query  744  GTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSK--GKAILDVTSNMAGVEVGGGP  571
            G  LRAPT  MGLAP C+DT     RL+LW RR  G+K  G A++D TS  A +EVGGGP
Sbjct  312  GAVLRAPTASMGLAPFCKDTFAGRCRLRLW-RRVGGAKQGGPALVDATSTTAALEVGGGP  370

Query  570  WFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPL-FKPPGL  451
            W+++W+      E  +  +  P+D+ G+  LVP   +PPGL
Sbjct  371  WWSSWRARAEMKEPFRSLIRLPLDVAGLGKLVPEPLRPPGL  411



>ref|WP_026785239.1| MULTISPECIES: tocopherol cyclase [Planktothrix]
Length=359

 Score =   298 bits (763),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 203/309 (66%), Gaps = 26/309 (8%)
 Frame = -1

Query  1742  RPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
              PL+TPHSGYH+DG+ R+FFEGW+++V++P+ +Q+F +MYS+E+P   +P SG       
Sbjct  9     NPLQTPHSGYHWDGSDRRFFEGWYYRVTLPQEKQTFAFMYSIEDPIGNQPQSG-------  61

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
                   GAQILG DD Y+C+  P+ K FW    +L LG+       A P   E  P  F 
Sbjct  62    -----GGAQILGPDDGYLCRTFPDVKTFWATSDQLGLGHWGKTDLTAIPGYLE--PTIFE  114

Query  1382  SRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLA  1203
             + + +G+Q T   HQG + D G + Y        W+Y+ +PIYGWGN    Q+STAGWL+
Sbjct  115   NSIQQGYQGTATLHQGKLADSGSSQYCN------WQYNIQPIYGWGNPNQPQQSTAGWLS  168

Query  1202  AFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEG  1023
                +FEP WQ+ MA GL+TGWI+W+G+ Y+FENAP+Y EKNWG  FP++WFWV CN F+G
Sbjct  169   FLQIFEPGWQILMAHGLATGWIDWNGQIYQFENAPAYGEKNWGGSFPKQWFWVNCNSFDG  228

Query  1022  ADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWY  843
              + +++LT+GGG+R +         E+ ALIA+HY G FYEFVPWN  V+W+I PWG W 
Sbjct  229   -ETDLALTAGGGIRDVLFWS-----ESVALIAIHYQGKFYEFVPWNSEVSWQIEPWGKWQ  282

Query  842   ITAENATHK  816
             +TA+N  ++
Sbjct  283   MTAKNNEYE  291


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 7/75 (9%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V L A T  PGT LRAPTQ  GL   CRDT    + LQL       ++   IL+ TS++
Sbjct  291  EVCLTATTEHPGTLLRAPTQ-AGLIFRCRDTMQGKINLQL------KARNSIILEATSSL  343

Query  597  AGVEVGGGPWFNTWK  553
             GVEVGG  W  TWK
Sbjct  344  GGVEVGGDLWQETWK  358



>gb|KEI67078.1| tocopherol cyclase [Planktothrix agardhii NIVA-CYA 126/8]
Length=363

 Score =   298 bits (763),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 203/309 (66%), Gaps = 26/309 (8%)
 Frame = -1

Query  1742  RPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
              PL+TPHSGYH+DG+ R+FFEGW+++V++P+ +Q+F +MYS+E+P   +P SG       
Sbjct  13    NPLQTPHSGYHWDGSDRRFFEGWYYRVTLPQEKQTFAFMYSIEDPIGNQPQSG-------  65

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
                   GAQILG DD Y+C+  P+ K FW    +L LG+       A P   E  P  F 
Sbjct  66    -----GGAQILGPDDGYLCRTFPDVKTFWATSDQLGLGHWGKTDLTAIPGYLE--PTIFE  118

Query  1382  SRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLA  1203
             + + +G+Q T   HQG + D G + Y        W+Y+ +PIYGWGN    Q+STAGWL+
Sbjct  119   NSIQQGYQGTATLHQGKLADSGSSQYCN------WQYNIQPIYGWGNPNQPQQSTAGWLS  172

Query  1202  AFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEG  1023
                +FEP WQ+ MA GL+TGWI+W+G+ Y+FENAP+Y EKNWG  FP++WFWV CN F+G
Sbjct  173   FLQIFEPGWQILMAHGLATGWIDWNGQIYQFENAPAYGEKNWGGSFPKQWFWVNCNSFDG  232

Query  1022  ADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWY  843
              + +++LT+GGG+R +         E+ ALIA+HY G FYEFVPWN  V+W+I PWG W 
Sbjct  233   -ETDLALTAGGGIRDVLFWS-----ESVALIAIHYQGKFYEFVPWNSEVSWQIEPWGKWQ  286

Query  842   ITAENATHK  816
             +TA+N  ++
Sbjct  287   MTAKNNEYE  295


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 7/75 (9%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V L A T  PGT LRAPTQ  GL   CRDT    + LQL       ++   IL+ TS++
Sbjct  295  EVCLTATTEHPGTLLRAPTQ-AGLIFRCRDTMQGKINLQL------KARNSIILEATSSL  347

Query  597  AGVEVGGGPWFNTWK  553
             GVEVGG  W  TWK
Sbjct  348  GGVEVGGDLWQETWK  362



>ref|WP_017742923.1| hypothetical protein [Scytonema hofmanni]
Length=383

 Score =   294 bits (753),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/326 (45%), Positives = 208/326 (64%), Gaps = 40/326 (12%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             ++TPHSGYH+D T R+FFEGW+++V++P+  Q+F +MYS+E+P  ++P SG         
Sbjct  12    IQTPHSGYHWDSTSRRFFEGWYYRVTLPQEGQTFAFMYSIEDPKGSQPHSG---------  62

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGN-TFIAQTAARPPNKE--------  1404
                  AQILG +D+Y+ +  P++  FW  R  L LG+   I + +   PN +        
Sbjct  63    ---GAAQILGPNDEYLWRTFPDTSKFWASRDVLGLGHWGKIGRGSKEKPNPQSKIQNPKS  119

Query  1403  -------VPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWG  1245
                    + PQEF   +LEG+Q T   +QG I+D     Y       RW+Y  +PIYGWG
Sbjct  120   KIQNPHYLHPQEFEREILEGYQATATLNQGVIKDPATGQYC------RWQYEIQPIYGWG  173

Query  1244  NVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGF  1065
             + GS Q+STAGWL+   +FEP WQ+ MA GL++GWI+W+G+RYEF NAP+YSEKNWG  F
Sbjct  174   DRGSIQQSTAGWLSFLQIFEPGWQILMAHGLASGWIDWNGKRYEFTNAPAYSEKNWGGAF  233

Query  1064  PRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWN  885
             P+KWFWV CN FEG + +++LT+GGG R     G     E+ A++ +HY G FYEFVPWN
Sbjct  234   PQKWFWVNCNSFEG-ESDLALTAGGGRR-----GVLWWMESVAMVGLHYQGKFYEFVPWN  287

Query  884   GSVTWEISPWGHWYITAENATHKSQV  807
               V+W ISPWG W I A+N+ ++ +V
Sbjct  288   SQVSWNISPWGKWQIQAKNSRYEVEV  313


 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VE+   T+ PG  LRAPT E GL   CRDT    L L+L  R     KGK IL  +S +
Sbjct  310  EVEVIGTTNLPGIPLRAPTSE-GLIFCCRDTMQGQLNLEL--RDNSTEKGKIILRASSFL  366

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GG  W N+W+
Sbjct  367  CGLEIGGKAWENSWQ  381



>ref|WP_012597428.1| hypothetical protein [Cyanothece sp. PCC 7424]
 ref|YP_002375345.1| hypothetical protein PCC7424_0003 [Cyanothece sp. PCC 7424]
 gb|ACK68477.1| conserved hypothetical protein [Cyanothece sp. PCC 7424]
Length=368

 Score =   294 bits (752),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/303 (49%), Positives = 197/303 (65%), Gaps = 26/303 (9%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L+TPHSGYH+DG  ++FFEGW+F+V++P+   +F +MYS+E+P   +P+SG         
Sbjct  10    LQTPHSGYHWDGWTKRFFEGWYFRVTLPDTNDTFAFMYSIEDPIGGQPVSG---------  60

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
                  AQIL  +D+Y+C+  P+ K FW  R  L LG+    +T  R   + + P EFN  
Sbjct  61    ---GAAQILALEDEYLCRTFPDVKKFWASRDYLGLGH--WGKTDLRMSPQLLTPTEFNEH  115

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + +G+QVT  +HQG I+D GR       K+ RW+Y T+PIYGWGN    Q+STAGWL+ F
Sbjct  116   IEQGYQVTATFHQGIIKDIGRN------KSCRWQYETKPIYGWGNPQKPQQSTAGWLSYF  169

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             P+FEP WQ+ MA GL++GWIEW+ + YEF+NAP+YSEKNWG  FP KWFW  CN F   +
Sbjct  170   PIFEPGWQILMAHGLASGWIEWNEKMYEFKNAPAYSEKNWGSSFPEKWFWFNCNNFIN-E  228

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG R     G     E  ALI  HY G FYEFVPWN  V+W+I PWG W + 
Sbjct  229   PDLALTAGGGKR-----GVLWWSEEVALICFHYRGKFYEFVPWNSQVSWQIHPWGRWEMQ  283

Query  836   AEN  828
             A N
Sbjct  284   ALN  286



>ref|WP_017315776.1| tocopherol cyclase [Mastigocladopsis repens]
Length=365

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 202/320 (63%), Gaps = 26/320 (8%)
 Frame = -1

Query  1766  VYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLS  1587
             +  P  S+  ++TPHS YH+DG+ R+FFEGW+++V++P   Q+F +MYS+E+P   KP S
Sbjct  2     LTIPINSHHSIQTPHSAYHWDGSSRRFFEGWYYRVTLPTEGQTFAFMYSMEDPIGGKPHS  61

Query  1586  GIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNK  1407
             G              AQILG +D+Y+C+  P+   FW  R  LSLG+        +P   
Sbjct  62    G------------GAAQILGPNDEYLCRTFPDISKFWASRDVLSLGHWGKTDLQIQP--L  107

Query  1406  EVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQ  1227
              + P EF   V EG+Q T   +QG I D        T +  RW+Y   PIYGWG+ GS Q
Sbjct  108   YLLPPEFERHVQEGYQATATLNQGAIHD------PATGRYCRWQYEIHPIYGWGDKGSIQ  161

Query  1226  KSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFW  1047
             +STAGWL+   +FEP WQ+ MA GL++GWI+W+G+RYEF NAP+YSEKNWG  FP+KWFW
Sbjct  162   QSTAGWLSFLQIFEPGWQILMAHGLASGWIDWNGKRYEFTNAPAYSEKNWGGAFPQKWFW  221

Query  1046  VQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWE  867
             + CN FEG +G+++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V W+
Sbjct  222   MNCNSFEG-EGDLALTAGGGRR-----GVLWWMESVAMIGIHYQGKFYEFVPWNSEVHWD  275

Query  866   ISPWGHWYITAENATHKSQV  807
             I PWG W + A N  ++ +V
Sbjct  276   IQPWGRWQMKARNLQYEVEV  295



>ref|WP_013320167.1| hypothetical protein [Cyanothece sp. PCC 7822]
 ref|YP_003885332.1| hypothetical protein Cyan7822_0003 [Cyanothece sp. PCC 7822]
 gb|ADN12057.1| conserved hypothetical protein [Cyanothece sp. PCC 7822]
Length=359

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 201/318 (63%), Gaps = 26/318 (8%)
 Frame = -1

Query  1760  TPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGI  1581
             T    N PL+TPHSGYH+DG  ++FFEGW+F+V++P+  Q+F +MYS+E+P         
Sbjct  2     TNLTKNNPLQTPHSGYHWDGWSQRFFEGWYFRVTLPDTAQTFAFMYSIEDPIG-------  54

Query  1580  EEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEV  1401
                  G+  +G  AQIL  DD+Y+C+  P+ K FW  +  L LG+    +T  +   + +
Sbjct  55    -----GQAVSGGAAQILALDDEYLCRTFPDVKKFWAAKDYLGLGH--WGKTDLKMAPQLL  107

Query  1400  PPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKS  1221
              P +F   + +G+QVT  +HQG I+D G   Y       RW+Y T+PIYGWGN    Q+S
Sbjct  108   NPTQFEQHIQQGYQVTATFHQGLIKDSGSNKYC------RWQYETKPIYGWGNPEKPQQS  161

Query  1220  TAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQ  1041
             TAGWL+ FP+FEP WQ+ MA GL++GWI+W+G+ YEF +AP+YSEKNWG  FP KWFW  
Sbjct  162   TAGWLSYFPIFEPGWQILMAHGLASGWIDWNGKVYEFIDAPAYSEKNWGASFPEKWFWFN  221

Query  1040  CNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEIS  861
             CN F   + +++LT+GGG R++       + E  ALI  HY G FYEFVPWN  V W+I 
Sbjct  222   CNSFID-EPDLALTAGGGRRKVLW-----STEEVALICFHYRGKFYEFVPWNSQVNWQIQ  275

Query  860   PWGHWYITAENATHKSQV  807
             PWG W + A N   + ++
Sbjct  276   PWGKWQMQAVNGEFEVRL  293


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 42/74 (57%), Gaps = 6/74 (8%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V L   T  PGT LRAPT + GL   CRDT    +RL+L  RR     G+ IL   S  
Sbjct  290  EVRLIGTTDLPGTVLRAPTNQ-GLIFCCRDTTKGYVRLEL-SRR----NGEVILTAESLA  343

Query  597  AGVEVGGGPWFNTW  556
             G+EVGGGPW + W
Sbjct  344  CGLEVGGGPWDDAW  357



>ref|WP_015139661.1| hypothetical protein [Nostoc sp. PCC 7524]
 ref|YP_007076828.1| hypothetical protein Nos7524_3438 [Nostoc sp. PCC 7524]
 gb|AFY49231.1| hypothetical protein Nos7524_3438 [Nostoc sp. PCC 7524]
Length=365

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 204/317 (64%), Gaps = 26/317 (8%)
 Frame = -1

Query  1757  PTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIE  1578
             P  S +  +TPHSGYH+DG+ R+FFEGW+++V++P+C Q+F +MYS+E+P          
Sbjct  5     PVNSLQSTQTPHSGYHWDGSNRRFFEGWYYRVTLPDCGQTFAFMYSIEDPIG--------  56

Query  1577  EVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVP  1398
                 G+  +G  AQ+LG DD+Y+C+  P+   FW  +  L+LG+         P    + 
Sbjct  57    ----GKSHSGGAAQVLGPDDEYVCRTFPDVTKFWASQDVLALGHWGKTHLNIEP--IYLL  110

Query  1397  PQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKST  1218
             P+EF   V EG+Q T   +QGFI+D     Y       RW+Y  +PIYGWGN  S Q+ST
Sbjct  111   PKEFTRHVSEGYQATAKLNQGFIQDPATGFYC------RWQYEIQPIYGWGNQNSLQQST  164

Query  1217  AGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQC  1038
             AGWL+   +FEP WQ+ MA GL++GWI+W+G+ Y+F+NAP+Y EKNWG  FP+KWFW+ C
Sbjct  165   AGWLSFLQIFEPGWQILMAHGLASGWIDWNGKIYQFQNAPAYGEKNWGGAFPQKWFWLNC  224

Query  1037  NVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISP  858
             N F+G + +++LT+GGG R     G     E+ A++ +HY G FYEFVPWN  VTW+I P
Sbjct  225   NSFDG-EPDLALTAGGGRR-----GVLWWMESVAMVGLHYQGKFYEFVPWNSKVTWDIQP  278

Query  857   WGHWYITAENATHKSQV  807
             WG W +TA N  ++ ++
Sbjct  279   WGRWQMTATNLEYEVEL  295


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (56%), Gaps = 3/77 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT   GL   CRDT    L L+L  R+  G     IL   S +
Sbjct  292  EVELTGTTHLPGTPLRAPTAN-GLQFCCRDTMQGKLNLEL--RQIRGKYPLVILQAHSYL  348

Query  597  AGVEVGGGPWFNTWKGT  547
             G+E+GGG W N+W+ +
Sbjct  349  CGLEIGGGSWHNSWQSS  365



>ref|WP_037216494.1| tocopherol cyclase [Richelia intracellularis]
 emb|CDN10345.1| 2-methyl-6-phytyl-1,4-benzoquinone cyclase [Richelia intracellularis]
Length=365

 Score =   293 bits (749),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 203/314 (65%), Gaps = 29/314 (9%)
 Frame = -1

Query  1742  RP-LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
             RP ++TPHSGYH+D + R+FFEGW+++V++P  +Q+F +MYS+E+P   +P         
Sbjct  9     RPTIQTPHSGYHWDRSDRRFFEGWYYRVTLPAEKQTFAFMYSIEDPIGDQP---------  59

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEF  1386
                ++G  AQ+LGA D+Y+C+  P+ KNFW ++  L+LG+         P  + + PQEF
Sbjct  60    ---YSGGAAQVLGAKDEYLCRTFPDVKNFWAQKDTLALGHWRENNLQIAP--QYLTPQEF  114

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
                 +EG+Q T   +QG IRD G      T    RW+Y  +PIYGWG+    Q+STAGWL
Sbjct  115   EHHNIEGYQATDTLNQGMIRDPG------TGFDCRWKYEIQPIYGWGDRKKWQQSTAGWL  168

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             +   +FEP WQ+ MA GL+TGWI W+G  YEF NAP+Y EKNWG GFP+KWFW+ CN FE
Sbjct  169   SQMQIFEPGWQILMAHGLATGWIHWNGRLYEFNNAPAYGEKNWGGGFPKKWFWLNCNSFE  228

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
                 +++LT+GGG R     G     E+ A++ +HY G FYEFVPWN  V+W+I PWG W
Sbjct  229   -QHSDLALTAGGGRR-----GVLCWMESVAMVGIHYQGKFYEFVPWNSQVSWDIKPWGKW  282

Query  845   YITAENATHKSQVE  804
             ++ A N  HK +VE
Sbjct  283   HMQARN--HKYEVE  294


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T+ PGT LRAPT E GL   CRDT   +L LQL  R + G++ K IL   S +
Sbjct  292  EVELTGTTTLPGTPLRAPT-EKGLTFCCRDTMQGELNLQL--REFSGTQQKIILKAQSFL  348

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GGG W N+W+
Sbjct  349  CGLEIGGGSWENSWQ  363



>ref|WP_011319489.1| tocopherol cyclase [Anabaena variabilis]
 ref|YP_323243.1| tocopherol cyclase [Anabaena variabilis ATCC 29413]
 gb|ABA22348.1| tocopherol cyclase [Anabaena variabilis ATCC 29413]
Length=358

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/312 (46%), Positives = 199/312 (64%), Gaps = 26/312 (8%)
 Frame = -1

Query  1742  RPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
             + L+TPHSGYH+DG+ R+FFEGW+++V++P+C Q+F +MYS+E+P   KP          
Sbjct  3     KTLQTPHSGYHWDGSSRRFFEGWYYRVTLPDCGQTFAFMYSIEDPIGGKP----------  52

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
               ++G  AQ+LGADD+YIC+  P    FW     L+LG+        +P    + P EF 
Sbjct  53    --YSGGAAQVLGADDEYICRTFPNVNKFWASSDVLALGHWGETNLNTKP--IYLLPAEFE  108

Query  1382  SRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLA  1203
               V +G+Q T   +QG I D    +Y       RW Y  +PIYGWGN  S Q+STAGWL+
Sbjct  109   RHVQQGYQATATLNQGVITDPATGNYC------RWRYEIQPIYGWGNQNSIQQSTAGWLS  162

Query  1202  AFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEG  1023
                +FEP WQ+ MA GL+TGWI+W+G+ Y+F+NAP+Y EKNWG  FP KWFW+ CN F+G
Sbjct  163   FLQIFEPGWQILMAHGLATGWIDWNGKIYQFQNAPAYGEKNWGGAFPEKWFWLNCNSFDG  222

Query  1022  ADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWY  843
              + +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V W I PWG W 
Sbjct  223   -EPDLALTAGGGRR-----GVLWWMESVAMIGLHYQGKFYEFVPWNSKVEWNIQPWGRWQ  276

Query  842   ITAENATHKSQV  807
             + A+N+ ++ ++
Sbjct  277   MKAKNSDYEVEL  288


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 43/77 (56%), Gaps = 3/77 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT + GL   CRDT    L ++L  R+  G     IL   S +
Sbjct  285  EVELTGTTHLPGTDLRAPTVQ-GLQYCCRDTMQGKLNVEL--RQIRGKNPLVILKAHSYL  341

Query  597  AGVEVGGGPWFNTWKGT  547
             G+E+GG  W N+W+ +
Sbjct  342  CGLEIGGDSWSNSWQSS  358



>ref|WP_015178838.1| tocopherol cyclase [Oscillatoria nigro-viridis]
 ref|YP_007118046.1| tocopherol cyclase [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ09630.1| tocopherol cyclase [Oscillatoria nigro-viridis PCC 7112]
Length=372

 Score =   293 bits (749),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/314 (47%), Positives = 201/314 (64%), Gaps = 30/314 (10%)
 Frame = -1

Query  1742  RPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
             + + TPHSGYH+DG+ R+FFEGW++++++P   QSF +MYS+E+P   +P          
Sbjct  9     KTIETPHSGYHWDGSSRRFFEGWYYRITLPIHGQSFAFMYSIEDPRGGQP----------  58

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
               ++G  AQILG  D Y+C+  P+   FW  R  L LG+        +P  + + PQ F+
Sbjct  59    --YSGGAAQILGPKDSYLCRTFPDVNKFWAHRESLGLGHWGRTDLQIKP--QYLEPQVFD  114

Query  1382  SRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLA  1203
             SRV EG+Q T   +QG++ D G + +        W+Y  +PIYGWGN    QKSTAG L+
Sbjct  115   SRVEEGYQATATLNQGYLHDPGSSSHC------FWQYEIQPIYGWGNSEEIQKSTAGMLS  168

Query  1202  AFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEG  1023
               PVFEP WQ+ MA GL+TGWI+W+G+RYEF+NAP+YSEKNWG  FP+KWFW+ CN F+G
Sbjct  169   FLPVFEPGWQILMAHGLATGWIDWNGQRYEFKNAPAYSEKNWGGAFPQKWFWINCNCFQG  228

Query  1022  ADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWY  843
              + +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V+W I PWG W 
Sbjct  229   EN-DLALTAGGGKR-----GVLWWMESVAMICLHYRGKFYEFVPWNSQVSWNIEPWGSWK  282

Query  842   ITAENATHKSQVEV  801
             + A N    SQ EV
Sbjct  283   MQARN----SQFEV  292



>ref|WP_017716220.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=360

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 197/312 (63%), Gaps = 24/312 (8%)
 Frame = -1

Query  1739  PLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGR  1560
             PL+TPHSGYH+D + R+FFEGW+++V++P    +F +MYS            IE+   G 
Sbjct  4     PLQTPHSGYHWDKSSRRFFEGWYYRVTLPAHGSTFAFMYS------------IEDPGGGS  51

Query  1559  RFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNS  1380
              ++G  AQILG  D Y+C+  P+ + FW  RH L LG+    Q         +PP  F+ 
Sbjct  52    PYSGGAAQILGPKDSYLCRTFPDVRRFWAWRHALGLGHWGRCQGGELRSPGFLPPAVFDR  111

Query  1379  RVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAA  1200
              V EG+Q T  WHQG +RD        T   ARW+YS  P+YGWG+ GS Q+STAGWL+ 
Sbjct  112   HVPEGYQATATWHQGVLRD------PATGMKARWQYSIAPVYGWGSTGSFQQSTAGWLSF  165

Query  1199  FPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGA  1020
               +FEP WQ+ MA GL+TGWIEW G+RYEF +AP+Y EKNWG  FP+KWFW+ CN F+G 
Sbjct  166   LQIFEPGWQILMAHGLATGWIEWGGQRYEFTDAPAYGEKNWGGAFPKKWFWLNCNCFDG-  224

Query  1019  DGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYI  840
             + +++LT+GGG R     G     E  A+I +HYGG FYEFVPWN  VTW+I PWG W +
Sbjct  225   EPDLALTAGGGRR-----GVLCWEEEVAMIGLHYGGRFYEFVPWNSRVTWDIQPWGLWRM  279

Query  839   TAENATHKSQVE  804
              A N+    ++E
Sbjct  280   QASNSQFAIELE  291


 Score = 62.8 bits (151),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            +ELE RT  PGT L AP Q+ GLA VCRDT    L ++L  RR  G +   +L+ TS++ 
Sbjct  288  IELEGRTDLPGTPLLAPAQK-GLAQVCRDTMGGHLSVRL--RRTAGGQSSTLLNATSSLC  344

Query  594  GVEVGGGPWFNTWK  553
            G+E GGG W + W+
Sbjct  345  GLETGGGAWDSPWQ  358



>ref|WP_008181943.1| tocopherol cyclase [Moorea producens]
 gb|EGJ33543.1| tocopherol cyclase [Moorea producens 3L]
Length=365

 Score =   292 bits (747),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 139/311 (45%), Positives = 197/311 (63%), Gaps = 26/311 (8%)
 Frame = -1

Query  1739  PLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGR  1560
             P +TPHSGYH+DG   +FFEGW+++V++P C Q+F +MYS+E+P   +P           
Sbjct  4     PFQTPHSGYHWDGKSGRFFEGWYYRVTLPNCGQTFAFMYSIEDPIGGQP-----------  52

Query  1559  RFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNS  1380
              ++G  AQILG DD+Y+C+  P  + FWG    L LG+    +T  +   + + P +F  
Sbjct  53    -YSGGSAQILGPDDQYLCRTFPHPEEFWGSSESLGLGH--WGKTKLQITPQYLNPDKFEY  109

Query  1379  RVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAA  1200
             ++ EG+Q T   +QGFIRD     Y        W Y  +PIYGWG++G  Q+STAGWL+ 
Sbjct  110   QIKEGYQATATLNQGFIRDPASGGYCD------WRYEIKPIYGWGDLGKAQQSTAGWLSF  163

Query  1199  FPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGA  1020
               +FEP WQ+ MA GL+TGWI+W+G+ Y+F N P+Y EKNWG  FP+KWFW+ CN F   
Sbjct  164   LQIFEPGWQILMAHGLATGWIDWNGKLYDFTNVPAYGEKNWGRAFPKKWFWLNCNSFTDQ  223

Query  1019  DGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYI  840
               +++LT+GGG R++ G       E AALI +HY G FYEFVPWN  VTW+I PWG+W +
Sbjct  224   P-DLALTAGGGRREVVGLA-----EAAALIGIHYEGKFYEFVPWNSEVTWQIQPWGNWQM  277

Query  839   TAENATHKSQV  807
                N  ++ ++
Sbjct  278   QGRNGEYEVEL  288


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 47/84 (56%), Gaps = 3/84 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT E GL  +CRDT    L+L+L +RR  G   + IL   S +
Sbjct  285  EVELTGTTDLPGTLLRAPT-EKGLNFICRDTMQGQLKLELKQRR--GDNVEPILIAESKL  341

Query  597  AGVEVGGGPWFNTWKGTTNAPEIL  526
             G+EVGG  W   W  +   P +L
Sbjct  342  CGLEVGGDSWEKPWNSSAKLPWVL  365



>ref|WP_015200244.1| tocopherol cyclase [Calothrix parietina]
 ref|YP_007139602.1| tocopherol cyclase [Calothrix sp. PCC 6303]
 gb|AFZ03630.1| tocopherol cyclase [Calothrix sp. PCC 6303]
Length=365

 Score =   292 bits (747),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 143/307 (47%), Positives = 199/307 (65%), Gaps = 26/307 (8%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L+TPHSGYH+D + R+FFEGW+++V++P+ RQ+F +MYS+E+P   KP SG         
Sbjct  12    LQTPHSGYHWDQSERRFFEGWYYRVTLPQLRQTFAFMYSIEDPIDGKPHSG---------  62

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
                  AQ+LG DD+YIC+  P+ K FW     L+LG+    +T  +   K + PQEF S 
Sbjct  63    ---GAAQVLGIDDEYICRTFPDVKKFWASPEVLALGH--WGKTNLQTKAKYLIPQEFTSH  117

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + EG+Q T   +QG I +    +Y       RWEY  +PIYGWGN  + Q+STAGWL++ 
Sbjct  118   IQEGYQATATLNQGIITNPHNGNYC------RWEYEIKPIYGWGNPNNYQQSTAGWLSSL  171

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
              +FEP WQ+ MA GL+TGWI+W+G+ YEF NAP+Y EKNWG  FP+KWFW+ CN F    
Sbjct  172   QIFEPGWQILMAHGLATGWIDWNGKIYEFTNAPAYGEKNWGGAFPKKWFWLNCNSFTDKP  231

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG R     G     E+ A++ +H+ G FYEFVPWN  V+W I PWG W I 
Sbjct  232   -DLALTAGGGRR-----GVLWWMESVAMVGIHHQGKFYEFVPWNSQVSWNIHPWGRWEIV  285

Query  836   AENATHK  816
             A+N+ ++
Sbjct  286   AKNSNYE  292


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V L   T+  GT LRAPT+E GLA  CRDT    L L+L  R   G K K IL   S++
Sbjct  292  EVLLTGTTNFQGTPLRAPTEE-GLAFCCRDTMQGQLDLEL--RELSGGKIKTILTAHSDL  348

Query  597  AGVEVGGGPWFNTWKG  550
             G+EVGG  W N+W+G
Sbjct  349  CGLEVGGENWNNSWQG  364



>ref|WP_017300145.1| hypothetical protein [Nodosilinea nodulosa]
Length=357

 Score =   291 bits (746),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 199/314 (63%), Gaps = 28/314 (9%)
 Frame = -1

Query  1748  SNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQ  1569
             S  PL+TPHSGYH+DG   +FFEGW+F++++PE RQ+F +MYS+E+P   +P SG     
Sbjct  2     SLHPLQTPHSGYHWDGKGNRFFEGWYFRLTLPETRQTFAFMYSIEDPIGGQPHSGGT---  58

Query  1568  YGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQE  1389
                      AQILG DD Y C+  P+   FW     L LG+ +  +T   P  + +P  +
Sbjct  59    ---------AQILGPDDSYFCRTFPDIGQFWAWPEGLGLGH-WRGKTKIEP--RLLPSSD  106

Query  1388  FNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGW  1209
             F   + EG+QVT  WHQG + D         +    W+Y T P YGWG+ G  Q+STAG 
Sbjct  107   FEKDIPEGYQVTATWHQGHLND-------PVLGAVAWQYHTDPAYGWGSRGQSQQSTAGL  159

Query  1208  LAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVF  1029
             L++  +FEP WQ+ MA G +TGW+EW G+RYEF NAP+YSEKNWG  FP+KWFW+ CN F
Sbjct  160   LSSLQIFEPGWQILMAHGHATGWVEWQGQRYEFINAPTYSEKNWGRSFPQKWFWLNCNAF  219

Query  1028  EGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGH  849
             EG   +++LT+GGG RQ+         E+ A++ VH+GG FYEFVPWN  VTW I+PWG+
Sbjct  220   EGVP-DLALTAGGGRRQVLA-----WMESVAMVGVHHGGKFYEFVPWNAHVTWHITPWGY  273

Query  848   WYITAENATHKSQV  807
             W++  E + +  +V
Sbjct  274   WHMRCERSDYVVEV  287


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+   T   G  LRAPT E G+A  CRDT   DL L+LW+R   GS    ++  TS  A
Sbjct  285  VEVTGATRLSGIPLRAPTHE-GMAFCCRDTALGDLSLKLWQRW--GSALDLVVAATSPQA  341

Query  594  GVEVGGGPWFNTW  556
            G+EVGGGPW   W
Sbjct  342  GLEVGGGPWDEPW  354



>ref|WP_015189813.1| tocopherol cyclase [Gloeocapsa sp. PCC 7428]
 ref|YP_007129104.1| tocopherol cyclase [Gloeocapsa sp. PCC 7428]
 gb|AFZ31944.1| tocopherol cyclase [Gloeocapsa sp. PCC 7428]
Length=362

 Score =   291 bits (746),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 203/309 (66%), Gaps = 27/309 (9%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DG+ R+FFEGW+++V++P+C Q+F +MYS+E+P   KP            +
Sbjct  13    QTPHSGYHWDGSDRRFFEGWYYRVTLPDCGQTFAFMYSIEDPIGGKP------------Y  60

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQILG DD+Y+ +  P+ K FW    +L LG+    +T  R     + P EF+  V
Sbjct  61    SGGAAQILGPDDEYLWRTFPDVKGFWANPAKLELGH--WGKTDLRTQPNLLLPAEFDHYV  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG + D   T Y       RW+Y  +PIYGWG+ G  Q+STAG+L++ P
Sbjct  119   KEGYQATATLNQGILHDPA-TGYC------RWQYEIQPIYGWGDKGEPQQSTAGFLSSLP  171

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W+G+RYEF NAP+Y EKNWG  FP+KWFWV CN FEG + 
Sbjct  172   IFEPGWQILMAHGLASGWIDWNGKRYEFTNAPAYGEKNWGGAFPKKWFWVNCNCFEG-EP  230

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I VHY G FYEFVPWN  V+W+I PWG W + A
Sbjct  231   DLALTAGGGRR-----GVLWWMESVAMIGVHYQGKFYEFVPWNSQVSWQIQPWGSWQMQA  285

Query  833   ENATHKSQV  807
              N+ ++  +
Sbjct  286   TNSEYEVTI  294



>ref|WP_019491661.1| tocopherol cyclase [Calothrix sp. PCC 7103]
Length=369

 Score =   290 bits (741),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/310 (46%), Positives = 199/310 (64%), Gaps = 26/310 (8%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             ++TPHSGYH  G+ R+FFEGW+++V+IPE RQ+F +MYS+E+P   KP SG         
Sbjct  12    IQTPHSGYHHQGSDRRFFEGWYYRVTIPEVRQTFAFMYSIEDPVGGKPHSG---------  62

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
                  AQILG +D+Y+ +       FW  R  L+LG+   +  + +P    + P EF   
Sbjct  63    ---GAAQILGPNDEYLWRTFSNVNKFWASRDVLALGHWGKSNLSTQP--LYLLPSEFEHH  117

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             V  G+Q T   +QG IRD    +Y+      RW+Y   PIYGWG+ G  Q+STAG+L++ 
Sbjct  118   VQSGYQATATLNQGIIRDPATGNYS------RWQYEIEPIYGWGSTGKPQQSTAGFLSSL  171

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
              +FEP WQ+ MA GL+TGWI+W+G+RYEF NAP+Y EKNWG  FP++WFWV CN F+  +
Sbjct  172   QIFEPGWQILMAHGLATGWIDWNGQRYEFTNAPAYGEKNWGGAFPKRWFWVNCNCFDN-E  230

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG R     G     E+ A++ +HY G FYEFVPWN  VTW+ISPWG W I 
Sbjct  231   PDLALTAGGGRR-----GVLWWMESVAMVGIHYKGKFYEFVPWNSKVTWDISPWGRWVIR  285

Query  836   AENATHKSQV  807
             A N+ ++ ++
Sbjct  286   ARNSEYEVEL  295


 Score = 64.3 bits (155),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 49/84 (58%), Gaps = 6/84 (7%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT + GL   C DT    L L+L  R    S+ K IL  TSN+
Sbjct  292  EVELIGTTDLPGTRLRAPT-DNGLVFCCSDTMQGMLSLEL--RELGSSEAKIILKATSNL  348

Query  597  AGVEVGGGPWFNTWKGTTNAPEIL  526
             G+EVGG PW N WK   + PE+L
Sbjct  349  CGLEVGGNPWDNAWK---SHPELL  369



>ref|WP_038081215.1| tocopherol cyclase [Tolypothrix bouteillei]
 gb|KIE07857.1| tocopherol cyclase [Tolypothrix bouteillei VB521301]
Length=365

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 203/310 (65%), Gaps = 26/310 (8%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             ++TPHSGYH+DG  R+FFEGW+++V++P+  Q+F +MYS+E+P   +P SG         
Sbjct  12    VQTPHSGYHWDGMSRRFFEGWYYRVTLPQEGQTFAFMYSIEDPKGNQPHSG---------  62

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
                  AQILG +D+Y+ +  P++  FWG    L LG+    +T  +     + P+EF   
Sbjct  63    ---GAAQILGPNDEYLWRTFPDTSKFWGSPQRLGLGH--WGKTNRKTQPTYLHPEEFERD  117

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             +LEG+Q T   +QGFI+D     Y       RW+Y  +PIYGWG+  S Q+STAGWL+  
Sbjct  118   ILEGYQATATLNQGFIKDPASGQYC------RWQYEIQPIYGWGDRFSIQQSTAGWLSFL  171

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
              +FEP WQ+ MA GL++GWI+W+G+RYEF NAP+Y EKNWG  FP+KWFWV CN FEG +
Sbjct  172   QIFEPGWQILMAHGLASGWIDWNGKRYEFTNAPAYGEKNWGGAFPQKWFWVNCNSFEG-E  230

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG R     G     E+ A++ +HY G FYEFVPWN  V+W ISPWG W I 
Sbjct  231   PDLALTAGGGRR-----GVLWWMESVAMVGLHYQGKFYEFVPWNSQVSWNISPWGKWQIQ  285

Query  836   AENATHKSQV  807
             A+N+ ++ +V
Sbjct  286   AKNSRYEVEV  295


 Score = 55.5 bits (132),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VE+   T+ PGT LRAPT + GL   CRDT   +L L+L  R  +  KGK IL  ++ +
Sbjct  292  EVEVIGTTNLPGTPLRAPTTD-GLIFCCRDTMQGELNLEL--RDNNTEKGKTILRASTFL  348

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GG  W N+W+
Sbjct  349  CGLEIGGRGWENSWQ  363



>ref|WP_012628024.1| tocopherol cyclase [Cyanothece sp. PCC 7425]
 ref|YP_002483312.1| tocopherol cyclase [Cyanothece sp. PCC 7425]
 gb|ACL44951.1| tocopherol cyclase [Cyanothece sp. PCC 7425]
Length=358

 Score =   290 bits (743),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 204/314 (65%), Gaps = 29/314 (9%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             ++TPHSGYH+DG+ R+FFEGW+++V++PE +++F +MYS+E+P   +P            
Sbjct  1     MQTPHSGYHWDGSSRRFFEGWYYRVTLPEIKETFAFMYSIEDPIAGQP------------  48

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLG----NTFIAQTAARPPNKEVPPQE  1389
             ++G  AQILG  D+Y C+  P+ + FWG + +L LG    N          P + +PP++
Sbjct  49    YSGGAAQILGPQDQYFCRTFPDVRQFWGWKEQLGLGHWGGNVDGGNVDGMSP-QYLPPEQ  107

Query  1388  FNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGW  1209
             F  ++ +G+Q T   +QG + D G      +    RW Y   P+YGWGN+G  Q+STAGW
Sbjct  108   FEQQIQQGYQATATLNQGHLFDPG------SGAIVRWCYQIEPVYGWGNLGEVQQSTAGW  161

Query  1208  LAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVF  1029
             L+ F +FEP WQ+ MA G +TGWIEW G+ Y F++AP+Y EKNWG  FP+KWFW+ CN F
Sbjct  162   LSQFQIFEPGWQILMAHGWATGWIEWQGQCYTFDHAPAYGEKNWGGAFPQKWFWINCNCF  221

Query  1028  EGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGH  849
               A+ +++LT+GGG R + G       E+ A++ +HY   FYEFVPWNGSV WEI+PWG+
Sbjct  222   -AAEPDLALTAGGGRRSVLG-----WMESVAMVGIHYRSKFYEFVPWNGSVNWEIAPWGN  275

Query  848   WYITAENATHKSQV  807
             W + AEN  +K ++
Sbjct  276   WQMQAENEHYKVEL  289


 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 5/75 (7%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKA-ILDVTSN  601
            +VEL A +  PGT LRAPT   GL   C+DT    + ++LW+RR   S G A I+   S 
Sbjct  286  KVELRAVSHRPGTPLRAPT-ATGLQFCCQDTMQGWVEIKLWQRR---SWGLALIVKAQST  341

Query  600  MAGVEVGGGPWFNTW  556
            + G+E GGGPW   W
Sbjct  342  LCGLETGGGPWEQVW  356



>ref|WP_006634000.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK86385.1| hypothetical protein MicvaDRAFT_0911 [Microcoleus vaginatus FGP-2]
Length=372

 Score =   287 bits (735),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/314 (46%), Positives = 200/314 (64%), Gaps = 30/314 (10%)
 Frame = -1

Query  1742  RPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
             + + TPHSGYH+DG+ R+FFEGW++++++P   QSF +MYS+E+P   +P          
Sbjct  9     KNIETPHSGYHWDGSSRRFFEGWYYRITLPIHGQSFAFMYSIEDPRGGQP----------  58

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
               ++G  AQ+LG +D Y+C+  P+   FW  R  L  G+        +P  + + PQ F+
Sbjct  59    --YSGGAAQVLGPEDSYLCRTFPDVNKFWAHRESLGFGHWGKTDLQIKP--QYLEPQVFD  114

Query  1382  SRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLA  1203
             SRV EG+Q T   +QG++ D G      +     W+Y  +PIYGWGN    QKSTAG L+
Sbjct  115   SRVEEGYQATATLNQGYLHDPG------SGSRCFWQYEIQPIYGWGNSEEIQKSTAGMLS  168

Query  1202  AFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEG  1023
               PVFEP WQ+ MA GL+TGWI+W+G+RYEF++AP+YSEKNWG  FP+KWFW+ CN F+G
Sbjct  169   FLPVFEPGWQILMAHGLATGWIDWNGQRYEFKDAPAYSEKNWGGAFPQKWFWINCNCFQG  228

Query  1022  ADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWY  843
              + +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V+W I PWG W 
Sbjct  229   -EKDLALTAGGGKR-----GVLWWMESVAMICLHYRGKFYEFVPWNSQVSWNIEPWGSWK  282

Query  842   ITAENATHKSQVEV  801
             + A N    SQ EV
Sbjct  283   MQARN----SQFEV  292


 Score = 65.5 bits (158),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 51/83 (61%), Gaps = 11/83 (13%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSK--------GKA  622
            +VEL   T+ PGT +R PT E G+A  CRDT + +LRLQL  R + G K         + 
Sbjct  291  EVELIGTTNSPGTYVRTPT-EKGMAFCCRDTTHGELRLQL--REFLGGKVENNGKQRSRI  347

Query  621  ILDVTSNMAGVEVGGGPWFNTWK  553
            IL+  S+++G+EVGGGPW   W+
Sbjct  348  ILEAQSSLSGLEVGGGPWDEVWR  370



>ref|WP_006097816.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX78361.1| hypothetical protein MC7420_7014 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=366

 Score =   284 bits (726),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 197/310 (64%), Gaps = 26/310 (8%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L+TPHSGYH+DG+  +FFEGW+++V++P+  Q+F +MYS+E+P   +P SG         
Sbjct  6     LQTPHSGYHWDGSSSRFFEGWYYRVTLPDWGQTFGFMYSIEDPIGGQPHSG---------  56

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
                  AQ+LG +D Y+C+  P+ + FW     L+LG+    +T    P K + P  F++ 
Sbjct  57    ---GSAQVLGLEDGYLCRTFPDVEQFWASASSLALGH--WGKTDLAIPAKYLDPLTFDNH  111

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + +G+Q T  W+QG I D    DY        W Y  +PIYGW +    Q+STAGWL++F
Sbjct  112   IQQGYQATATWNQGKISDPATGDYCN------WRYQIQPIYGWASRDEPQQSTAGWLSSF  165

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
              +FEP WQ+ MA G +TGWIEW G+RYEF NAP+Y EKNWG  FP+KWFW+ CN F+  +
Sbjct  166   QIFEPGWQILMAHGWATGWIEWKGQRYEFTNAPAYGEKNWGRSFPQKWFWLNCNSFD-HE  224

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG R     G     E+AALI +HY G FYEFVPWN  V W+I PWG W + 
Sbjct  225   PDLALTAGGGRR-----GVLWWMESAALIGIHYQGKFYEFVPWNSEVRWQIQPWGSWQMQ  279

Query  836   AENATHKSQV  807
             A NA ++ ++
Sbjct  280   ARNADYEVEL  289


 Score = 67.8 bits (164),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL + T+ PGT LRAPT E GL  +CRDT   +L L+L +RR  G   K IL+  S++
Sbjct  286  EVELTSTTNLPGTPLRAPT-EQGLIFICRDTMQGELTLELRDRR--GGTTKTILNAHSSV  342

Query  597  AGVEVGGGPWFNTWKGTTNAPEI  529
             G+EVGG PW   W G    P I
Sbjct  343  CGLEVGGEPWDQVWTGEAKLPWI  365



>ref|WP_033375481.1| tocopherol cyclase [Spirulina subsalsa]
Length=355

 Score =   289 bits (740),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 204/313 (65%), Gaps = 26/313 (8%)
 Frame = -1

Query  1745  NRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
             + PL+TPHSGYH++G+  +FFEGW+F+V++P   Q+F +MYS+E+P              
Sbjct  2     SNPLQTPHSGYHWNGSSERFFEGWYFRVTLPTIEQTFAFMYSIEDPLG------------  49

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEF  1386
             G+ ++G  AQ+LGA+D+Y+C+  P+   FW    EL LG+         P  + +  ++F
Sbjct  50    GQAYSGGAAQVLGANDEYLCRTFPDVTQFWATPDELGLGHWGKTNLTQNP--QLLDSKDF  107

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
              + V EG+Q T   +QG I D        T K  RW+Y  +PIYGWGN    Q+STAGWL
Sbjct  108   ETHVQEGYQSTAYLNQGVIGDRA------TKKYCRWQYEIKPIYGWGNPNQTQQSTAGWL  161

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             ++FP+FEP WQ+ MA GL+TGWI+W G+ Y F++AP+Y EKNWG  FP++WFWV CNVF+
Sbjct  162   SSFPIFEPGWQILMAHGLATGWIDWSGQLYYFDDAPAYHEKNWGRAFPQRWFWVNCNVFK  221

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
              ++ ++++T+GGG R     G     E+ ALI +HY G FYEFVPWN  V+W I PWG+W
Sbjct  222   -SESDLAITAGGGKR-----GVLWWMESVALICLHYRGKFYEFVPWNSEVSWVIEPWGYW  275

Query  845   YITAENATHKSQV  807
              + A+NA ++ ++
Sbjct  276   KMQAKNAQYEVEL  288


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 6/74 (8%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL  +T   GT LRAPT E GLA  CRDT    LRL+L E+     +G+ I+   S++
Sbjct  285  EVELVGKTQHLGTPLRAPTSE-GLAFCCRDTMRGHLRLELREK-----QGQVIVRAESSV  338

Query  597  AGVEVGGGPWFNTW  556
             G+EVGGGPW   W
Sbjct  339  CGLEVGGGPWDKPW  352



>ref|WP_017652428.1| tocopherol cyclase [Microchaete sp. PCC 7126]
Length=365

 Score =   288 bits (738),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 197/309 (64%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPH+GYH+DG+ R+FFEGW+++V++PE  Q+F +MYS+E+P   KP SG          
Sbjct  13    QTPHAGYHWDGSNRRFFEGWYYRVTLPENGQTFAFMYSIEDPIGGKPHSG----------  62

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
                 AQILG +D+Y+C+  P+ + FWG R  L LG+        +P    +   EF   V
Sbjct  63    --GAAQILGPNDEYLCRTFPDVQKFWGSRDVLGLGHWGKTDLQIQP--LYLLRAEFERHV  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG I D    +Y       RW+Y  +P+YGWGN GS Q+S AGWL+   
Sbjct  119   QEGYQATATLNQGAIHDPATGNYC------RWQYEIKPVYGWGNQGSLQQSAAGWLSYLQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W+G+ YEF NAPSY EKNWG  FP+KWFW+ CN FEG + 
Sbjct  173   IFEPGWQILMAHGLASGWIDWNGKIYEFTNAPSYGEKNWGGAFPQKWFWINCNCFEG-EP  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V W+I PWG W + A
Sbjct  232   DLALTAGGGRR-----GVLWWMESVAMIGLHYQGKFYEFVPWNSQVDWQIQPWGRWQMQA  286

Query  833   ENATHKSQV  807
              NA ++ ++
Sbjct  287   RNAKYEIEL  295


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 41/75 (55%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            ++EL   T  PGT LRAPT   GL   CRDT    L L L  +     K + IL   SN+
Sbjct  292  EIELTGTTHHPGTLLRAPTAN-GLIFCCRDTMQGKLNLSL--KELSSGKSQIILKAESNL  348

Query  597  AGVEVGGGPWFNTWK  553
             G+EVGGG W N+W 
Sbjct  349  CGLEVGGGAWDNSWH  363



>ref|WP_009633747.1| hypothetical protein [Synechocystis sp. PCC 7509]
Length=363

 Score =   288 bits (738),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/312 (47%), Positives = 202/312 (65%), Gaps = 26/312 (8%)
 Frame = -1

Query  1751  PSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEV  1572
             P+    +TPHSGY +D + R+FFEGW+++V++PE  Q+F +MYS+E+P   KP SG    
Sbjct  5     PNKLLQQTPHSGYQWDNSSRRFFEGWYYRVTLPEIEQTFAFMYSIEDPKGGKPHSG----  60

Query  1571  QYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQ  1392
                       AQ+LG DD+YIC+  P+ + F+ +   L LG+    +T   P    + PQ
Sbjct  61    --------GAAQVLGIDDEYICRTFPDVERFFAKSDRLELGH--WGKTDLPPQPLWLLPQ  110

Query  1391  EFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAG  1212
             EF+  + EG+Q +  W+QG I+D G  +      T  W+Y   PIYGWG+V + Q+STAG
Sbjct  111   EFDHHIQEGYQASATWNQGTIKDPGSNN------TCSWQYKIEPIYGWGDVDAPQQSTAG  164

Query  1211  WLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNV  1032
              ++  P+FEP WQ+ MA GL+TGWIEW+G+RYEF NAP+YSEKNWG  FP+KWFW+ CN 
Sbjct  165   LISFLPIFEPGWQILMAHGLATGWIEWNGKRYEFANAPAYSEKNWGGAFPQKWFWLNCNS  224

Query  1031  FEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWG  852
             F+G + +++LT+GGG R     G     E+ A+I VHY G FYEFVPWN  VTW I PWG
Sbjct  225   FDG-ETDLALTAGGGKR-----GVLWWMESVAMIGVHYQGKFYEFVPWNSKVTWNIQPWG  278

Query  851   HWYITAENATHK  816
              W + A NA ++
Sbjct  279   KWEMQATNAEYE  290



>ref|WP_015150098.1| hypothetical protein [Oscillatoria acuminata]
 ref|YP_007087393.1| hypothetical protein Oscil6304_3929 [Oscillatoria acuminata PCC 
6304]
 gb|AFY83473.1| hypothetical protein Oscil6304_3929 [Oscillatoria acuminata PCC 
6304]
Length=366

 Score =   280 bits (716),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 195/310 (63%), Gaps = 26/310 (8%)
 Frame = -1

Query  1757  PTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIE  1578
             P+ +     TPHSGYH++ + R+FFEGW+++V++P  RQ+F +MYS+E+P    P     
Sbjct  6     PSMTRLERETPHSGYHWNSSPRRFFEGWYYRVTLPTDRQTFAFMYSIEDPTGGSP-----  60

Query  1577  EVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVP  1398
                    ++G GAQILG DD Y+C+  P+ K FW     L+LG+    +T    P   + 
Sbjct  61    -------YSGGGAQILGPDDGYLCRTFPDVKGFWAWSSSLALGH--WGKTELPYPPNYLS  111

Query  1397  PQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKST  1218
             P EF+  + +G+Q T  WHQG + D G      T +   W+Y+  P+YGWG+    Q +T
Sbjct  112   PHEFDHYIEQGYQGTATWHQGKLCDPG------TGQRCEWQYAISPVYGWGDRQRGQLAT  165

Query  1217  AGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQC  1038
             AG L+  P+FEP WQ+ MA GL+TGWI+W+G+RYEF NAP+Y+EKNWG  FP KWFWV C
Sbjct  166   AGLLSFLPMFEPGWQILMAHGLATGWIDWNGKRYEFANAPAYAEKNWGGAFPEKWFWVNC  225

Query  1037  NVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISP  858
             N F+  + +++LT+GGG R     G     E+ ALI +HY G FYEFVPWN  V+WEI P
Sbjct  226   NCFD-DEPDLALTAGGGRR-----GVLWWMESVALICIHYRGEFYEFVPWNAQVSWEIDP  279

Query  857   WGHWYITAEN  828
             WG W + A N
Sbjct  280   WGRWQMQASN  289


 Score = 70.1 bits (170),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VEL A T  PGT LRAPTQE GL  VCRDT    L L L  R   G+ G+ I   TS++ 
Sbjct  294  VELTATTDQPGTRLRAPTQE-GLTFVCRDTMQGHLTLTL--RSRLGNPGEIIFQATSSLC  350

Query  594  GVEVGGGPWFNTWK  553
            GVE GGGPW  TW+
Sbjct  351  GVETGGGPWTETWR  364



>ref|WP_010994422.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_484289.1| hypothetical protein all0245 [Nostoc sp. PCC 7120]
 dbj|BAB77769.1| all0245 [Nostoc sp. PCC 7120]
Length=363

 Score =   288 bits (736),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/312 (45%), Positives = 198/312 (63%), Gaps = 26/312 (8%)
 Frame = -1

Query  1742  RPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
             + L+TPHSGYH+DG+ R+FFEGW+++V++P+C Q+F +MYS+E+P              G
Sbjct  8     KTLQTPHSGYHWDGSSRRFFEGWYYRVTLPDCGQTFAFMYSIEDPIG------------G  55

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
             + ++G  AQ+LGADD+YIC+  P+   FW     L+LG+        +P    + P EF 
Sbjct  56    KAYSGGAAQVLGADDEYICRTFPDVNKFWASPDVLALGHWGETNLNTKP--IYLLPAEFE  113

Query  1382  SRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLA  1203
               V +G+Q T   +QG I D    +Y       RW Y  +PIYGWGN    Q+STAGWL+
Sbjct  114   RHVQQGYQATATINQGIIADPATGNYC------RWRYEIQPIYGWGNQDGIQQSTAGWLS  167

Query  1202  AFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEG  1023
                +FEP WQ+ MA GL+TGWI+W+G+ Y+F+NAP+Y EKNWG  FP KWFW+ CN F+G
Sbjct  168   FLQIFEPGWQILMAHGLATGWIDWNGKIYQFQNAPAYGEKNWGGAFPEKWFWLNCNSFDG  227

Query  1022  ADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWY  843
              + +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V W I PWG W 
Sbjct  228   -EPDLALTAGGGRR-----GVLWWMESVAMIGLHYQGKFYEFVPWNSKVEWNIQPWGRWQ  281

Query  842   ITAENATHKSQV  807
             + A+N  ++ ++
Sbjct  282   MKAKNLDYEVEL  293


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 43/77 (56%), Gaps = 3/77 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT + GL   CRDT    L ++L  R+  G     IL   S +
Sbjct  290  EVELTGTTHLPGTDLRAPTVQ-GLQYCCRDTMQGKLDVEL--RQIRGKNPLVILKAHSYL  346

Query  597  AGVEVGGGPWFNTWKGT  547
             G+E+GG  W N+W+ +
Sbjct  347  CGLEIGGDSWSNSWQSS  363



>ref|WP_017322824.1| tocopherol cyclase [cyanobacterium PCC 7702]
Length=365

 Score =   287 bits (735),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 199/308 (65%), Gaps = 26/308 (8%)
 Frame = -1

Query  1730  TPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFT  1551
             TPHSGYH++G+ R+FFEGW+++V++P   QSF +MYS+E+P   KP SG           
Sbjct  14    TPHSGYHWNGSNRRFFEGWYYRVTLPLENQSFAFMYSIEDPIGGKPHSG-----------  62

Query  1550  GVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVL  1371
                AQILG DD+Y+C+  P    FW +R  L+LG+   A+   +P    + P +F   V 
Sbjct  63    -GAAQILGPDDEYLCRTFPNVNTFWAQRQVLALGHWGKAKAGIKP--GYLLPTDFEHYVQ  119

Query  1370  EGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPV  1191
             +G+Q T   +QG I D G   Y       RW+Y  +P+YGWGN GS Q+STAGWL+   +
Sbjct  120   QGYQATATLNQGAIFDPGSGKYC------RWQYEIQPLYGWGNKGSIQQSTAGWLSFLQI  173

Query  1190  FEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGE  1011
             FEP WQ+ MA+GL+ GWI+W+G+RYEF NAP+YSEKNWG  FP+KWFWV CN F G + E
Sbjct  174   FEPGWQILMASGLACGWIDWNGKRYEFTNAPAYSEKNWGGAFPQKWFWVNCNSFPG-EPE  232

Query  1010  VSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAE  831
             +++T+GGG R++         E  A+I +HY G FYEFVPWN  V+W I PWG W + A+
Sbjct  233   LAITAGGGKRKVLWWT-----EAVAMIGLHYRGKFYEFVPWNSQVSWNIQPWGRWEMQAK  287

Query  830   NATHKSQV  807
             N  ++ ++
Sbjct  288   NQHYEVEL  295


 Score = 62.4 bits (150),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL A T  PGT LRAPT E GL   CRDT    L L+L  R+ +G++ K IL   S +
Sbjct  292  EVELLATTDLPGTFLRAPT-ESGLIFCCRDTLQGQLNLEL--RKINGTERKTILKAHSCL  348

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GG PW  +W+
Sbjct  349  CGLEIGGSPWERSWQ  363



>ref|WP_015129484.1| tocopherol cyclase [Calothrix sp. PCC 7507]
 ref|YP_007066509.1| tocopherol cyclase [Calothrix sp. PCC 7507]
 gb|AFY33675.1| tocopherol cyclase [Calothrix sp. PCC 7507]
Length=365

 Score =   288 bits (736),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 198/309 (64%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPH+GYH+DG+ R+FFEGW+++V++P+C Q+F +MYS+E+P   KP SG          
Sbjct  13    QTPHAGYHWDGSSRRFFEGWYYRVTLPDCGQTFAFMYSIEDPIGGKPHSG----------  62

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
                 +Q+LG +D+Y+C+  P+ + FWG R  L LG+        +P    + P EF   +
Sbjct  63    --GASQVLGPNDEYLCRTFPDVQKFWGSRDVLGLGHWGKTDLHTQP--FYLLPAEFEHHI  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG IRD    +Y       RW+Y  +P+YGWGN  S Q+STAGWL+   
Sbjct  119   QEGYQATATLNQGVIRDPATGNYC------RWQYEIKPVYGWGNQSSLQQSTAGWLSFLQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W+G+ YEF NAP+YSEKNWG  FP+KWFW+ CN F G + 
Sbjct  173   LFEPGWQILMAHGLASGWIDWNGKIYEFTNAPAYSEKNWGGAFPQKWFWINCNDFAG-EP  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V W I PWG W + A
Sbjct  232   DLALTAGGGRR-----GVLWWMESVAMIGLHYQGKFYEFVPWNSQVEWHIQPWGRWQMLA  286

Query  833   ENATHKSQV  807
              N  ++ ++
Sbjct  287   RNLHYEVEL  295


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT   GL   CRDT    L L+L  R  +G K + IL   S +
Sbjct  292  EVELTGTTHLPGTPLRAPTAN-GLTFCCRDTMQGKLNLEL--RELNGEKSQIILKAQSFL  348

Query  597  AGVEVGGGPWFNTWK  553
             G+EVGGG W ++W+
Sbjct  349  CGLEVGGGSWDDSWQ  363



>ref|WP_012406978.1| hypothetical protein [Nostoc punctiforme]
 ref|YP_001863892.1| hypothetical protein Npun_R0149 [Nostoc punctiforme PCC 73102]
 gb|ACC78949.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=365

 Score =   287 bits (735),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/309 (47%), Positives = 196/309 (63%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DGT R+FFEGW++++++PE  Q+F +MYS+E+P   KP SG          
Sbjct  13    QTPHSGYHWDGTSRRFFEGWYYRITLPEIEQTFAFMYSIEDPIGGKPHSG----------  62

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
                 AQILG DD+Y+C+  P+ K FWG R  L LG+    +T  +     + P EF   V
Sbjct  63    --GAAQILGPDDEYLCRTFPDVKKFWGSRDVLGLGHW--GKTDLQIAPLYLLPAEFEHHV  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG IR+    +Y       RWEY  +PIYGWGN  S Q+STAGWL+   
Sbjct  119   QEGYQATATLNQGIIRELATNNYC------RWEYEIQPIYGWGNKNSIQQSTAGWLSFSQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++G I+W+G+ YEF N P+Y EKNWG  FP+KWFW+ CN FEG + 
Sbjct  173   IFEPGWQILMAHGLASGKIDWNGKIYEFTNVPAYGEKNWGGAFPQKWFWINCNCFEG-EP  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY   FYEFVPWN  V WEI PW  W + A
Sbjct  232   DLALTAGGGRR-----GVLWWMESVAMIGLHYQDKFYEFVPWNSQVDWEIQPWARWQMKA  286

Query  833   ENATHKSQV  807
              N+ ++ ++
Sbjct  287   TNSNYEIEL  295


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            ++EL   T   GT LRAPT E GL   CRDT    L L+L  R  +G K + IL   S +
Sbjct  292  EIELTGTTDLAGTPLRAPTAE-GLRYCCRDTMQGKLTLEL--REINGRKSQIILKAESFL  348

Query  597  AGVEVGGGPWFNTWK  553
             G+EVGGG W N W+
Sbjct  349  CGLEVGGGSWHNVWQ  363



>ref|WP_015112619.1| tocopherol cyclase [Nostoc sp. PCC 7107]
 ref|YP_007049549.1| tocopherol cyclase [Nostoc sp. PCC 7107]
 gb|AFY42399.1| tocopherol cyclase [Nostoc sp. PCC 7107]
Length=361

 Score =   287 bits (734),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/309 (45%), Positives = 198/309 (64%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPH GYH+DG+ R+FFEGW+++V++P+C Q+F +MYS+E+P   +P            +
Sbjct  9     QTPHIGYHWDGSSRRFFEGWYYRVTLPDCGQTFAFMYSIEDPIGGQP------------Y  56

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQILG DD+Y+C+  P+ + FW  R  L+LG+        +P    +   EF   +
Sbjct  57    SGGAAQILGPDDQYLCRTFPDVETFWASRDVLALGHWGKTNLNTQP--LYLLSAEFEQHI  114

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG IRD     Y       RW Y  +P+YGWGN  S Q+STAGWL+   
Sbjct  115   QEGYQATATLNQGIIRDPATGFYC------RWLYEIQPVYGWGNQNSLQQSTAGWLSFLQ  168

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W+G+ Y+F NAP+Y+EKNWG  FP+KWFW+ CN F+G + 
Sbjct  169   IFEPGWQILMAHGLASGWIDWNGKIYQFTNAPAYAEKNWGGAFPQKWFWLNCNCFDG-EP  227

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I VHY G FYEFVPWN  V W+I PWG W + A
Sbjct  228   DLALTAGGGRR-----GVLWWMESVAMIGVHYQGKFYEFVPWNSQVKWQIQPWGRWQMQA  282

Query  833   ENATHKSQV  807
             +N  ++ ++
Sbjct  283   KNLNYEVEL  291


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 43/77 (56%), Gaps = 3/77 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T   GT LRAPT   GL   CRDT    L L+L  R+    + + IL   S++
Sbjct  288  EVELAGTTHLSGTPLRAPTTN-GLEFCCRDTMQGKLNLEL--RKVSDKQSQVILKSQSSL  344

Query  597  AGVEVGGGPWFNTWKGT  547
             G+E+GGG W N+W  +
Sbjct  345  CGLEIGGGSWDNSWHSS  361



>ref|WP_028082234.1| tocopherol cyclase [Dolichospermum circinale]
Length=365

 Score =   285 bits (728),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 195/306 (64%), Gaps = 26/306 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DG+ R+FFEGW+++V+IPE RQ+  +MYS+E+P   +P            +
Sbjct  13    QTPHSGYHWDGSNRRFFEGWYYRVTIPEIRQTIAFMYSIEDPKGNQP------------Y  60

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQILG +D+Y+C+  P+   FW  R  L LG+    +T  +     + P EF   +
Sbjct  61    SGGAAQILGINDEYLCRTFPDVNKFWASRDVLGLGH--WGKTNLQVSPLYLTPSEFTQHI  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG I D    +Y +      WEY+ +PIYGWGN  S Q+STAGWL+   
Sbjct  119   SEGYQATATLNQGIITDPATGNYCQ------WEYTIKPIYGWGNQNSFQQSTAGWLSFSQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W G+ YEF NAP+Y+EKNWG  FP+KWFW+ CN F     
Sbjct  173   IFEPGWQILMAHGLASGWIDWHGKIYEFTNAPAYAEKNWGGAFPQKWFWLNCNSFINQP-  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V W+I PWG W + A
Sbjct  232   DLALTAGGGKR-----GVLWWMESVAMIGIHYQGKFYEFVPWNSEVKWQIQPWGRWQMQA  286

Query  833   ENATHK  816
             +N +++
Sbjct  287   KNLSYE  292


 Score = 63.2 bits (152),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = -3

Query  786  ICEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVT  607
            +  +V L   T  PGT LRAPT   GL   CRDT   +L L+L  R  +GSK + IL+ +
Sbjct  289  LSYEVTLTGTTQLPGTPLRAPTTN-GLTFCCRDTMQGELNLEL--REVNGSKSQVILNAS  345

Query  606  SNMAGVEVGGGPWFNTWK  553
            SN+ G+E+GG  W N W+
Sbjct  346  SNLCGLEIGGHDWDNYWQ  363



>ref|WP_022604526.1| tocopherol cyclase [Rubidibacter lacunae]
 gb|ERN42735.1| tocopherol cyclase [Rubidibacter lacunae KORDI 51-2]
Length=374

 Score =   286 bits (733),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 200/319 (63%), Gaps = 29/319 (9%)
 Frame = -1

Query  1751  PSNR----PLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSG  1584
             PS R    PL+TPHSGYH+ G+  +FFEGW+++V++PE  Q+F +MYS+E+PA  +P SG
Sbjct  2     PSERSLAVPLQTPHSGYHWTGSSERFFEGWYYRVTLPERAQTFAFMYSIEDPAGGRPHSG  61

Query  1583  IEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKE  1404
                           AQILG DD Y+C+  P  + FW +R  L+LG+   A T      +E
Sbjct  62    ------------GAAQILGPDDGYLCRTFPNPRGFWADRDRLALGH-IAADTVRDDLLRE  108

Query  1403  VPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQK  1224
             + P+ F + V  G+Q T   +QG IRD G      + +  RW Y+ +P+YGWGN    Q+
Sbjct  109   LDPETFFTEVRSGYQATAQLNQGAIRDPG------SGRWCRWHYTIQPVYGWGNPQRSQQ  162

Query  1223  STAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWV  1044
             STAGWL+  P+FEP WQ+ +A G +TGWI+W+G RYEF  AP+YSEKNWG  FPR WFW+
Sbjct  163   STAGWLSFLPIFEPGWQILLAHGRATGWIDWNGVRYEFAGAPAYSEKNWGRAFPRTWFWL  222

Query  1043  QCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEI  864
              CN F   + +++LT+GGG R+I         E+ ALI +HY G+FYEFVPWN  V W++
Sbjct  223   NCNSFHD-EPDLALTAGGGRREILWWD-----EDVALICLHYRGMFYEFVPWNAEVHWQV  276

Query  863   SPWGHWYITAENATHKSQV  807
              PWG W + A N  +   +
Sbjct  277   QPWGEWKMQARNTDYTVSL  295



>ref|WP_035985926.1| tocopherol cyclase [Leptolyngbya sp. KIOST-1]
Length=369

 Score =   286 bits (731),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 195/323 (60%), Gaps = 34/323 (11%)
 Frame = -1

Query  1748  SNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQ  1569
             S   L+TPHSGYH+DG   +FFEGW+F+V++PE  Q+F +MYS+E+      L+G     
Sbjct  2     SLHSLQTPHSGYHWDGQTNRFFEGWYFRVTLPETGQTFAFMYSIED------LAG-----  50

Query  1568  YGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGN--TFIAQTAARPPNKEVPP  1395
              GR  +G  AQILG DD Y C+  P+   FW     L LG+  T  A    R P     P
Sbjct  51    -GRPHSGGTAQILGPDDGYFCRTFPDPSLFWAWPEGLGLGHWRTLKAAATGRTPGYPAQP  109

Query  1394  -------QEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVG  1236
                     EF + V EG+QVT  WHQG + D              W+Y T P+YGWG   
Sbjct  110   APRLLSASEFEAYVTEGYQVTATWHQGQLED-------PVAGRVAWQYHTAPVYGWGRPD  162

Query  1235  SKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRK  1056
               Q+STAG+L++ P+FEP WQ+ MA G STGWIEW G+RYEF NAP+YSEKNWG  FP+K
Sbjct  163   QPQQSTAGFLSSLPIFEPGWQILMAHGHSTGWIEWQGKRYEFTNAPAYSEKNWGRAFPKK  222

Query  1055  WFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSV  876
             WFW+ CN F+G   + +LT+GGG RQ+ G       E+ A++ VH+ G FYEFVPWN  V
Sbjct  223   WFWLNCNAFDGM-ADFALTAGGGRRQVLG-----WMESVAMVGVHHRGQFYEFVPWNARV  276

Query  875   TWEISPWGHWYITAENATHKSQV  807
             TW I PWG+W++  E   +  +V
Sbjct  277   TWHIDPWGYWHMRGERPDYVVEV  299


 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+   T  PG  LRAPT + G+   CRDT    + ++LW RR  G K + I   +S  A
Sbjct  297  VEVIGTTPLPGILLRAPTHQ-GMVYCCRDTALGQVSVRLWRRR--GDKLEPIAAASSTQA  353

Query  594  GVEVGGGPWFNTW  556
            G+EVGG PW   W
Sbjct  354  GLEVGGRPWNQPW  366



>ref|WP_028089255.1| tocopherol cyclase [Dolichospermum circinale]
Length=365

 Score =   285 bits (728),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 195/306 (64%), Gaps = 26/306 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DG+ R+FFEGW+++V+IPE RQ+  +MYS+E+P   +P            +
Sbjct  13    QTPHSGYHWDGSNRRFFEGWYYRVTIPEIRQTIAFMYSIEDPKGNQP------------Y  60

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQILG +D+Y+C+  P+   FW  R  L LG+    +T  +     + P EF   +
Sbjct  61    SGGAAQILGINDEYLCRTFPDVNKFWASRDVLGLGH--WGKTNLQVSPLYLTPSEFTQHI  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG I D    +Y +      WEY+ +PIYGWGN  S Q+STAGWL+   
Sbjct  119   SEGYQATATLNQGIITDPATGNYCQ------WEYTIKPIYGWGNQNSFQQSTAGWLSFSQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W G+ YEF NAP+Y+EKNWG  FP+KWFW+ CN F     
Sbjct  173   IFEPGWQILMAHGLASGWIDWHGKIYEFTNAPAYAEKNWGGAFPQKWFWLNCNSFINQP-  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V W+I PWG W + A
Sbjct  232   DLALTAGGGKR-----GVLWWMESVAMIGIHYQGKFYEFVPWNSEVKWQIQPWGRWQMQA  286

Query  833   ENATHK  816
             +N +++
Sbjct  287   KNLSYE  292


 Score = 61.2 bits (147),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = -3

Query  786  ICEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVT  607
            +  +V L   T  PGT LRAPT   GL   CRDT   +L L+L  R  + SK + IL+ +
Sbjct  289  LSYEVTLTGTTQLPGTPLRAPTTN-GLTFCCRDTMQGELNLEL--REVNASKSQVILNAS  345

Query  606  SNMAGVEVGGGPWFNTWK  553
            SN+ G+E+GG  W N W+
Sbjct  346  SNLCGLEIGGHDWDNYWQ  363



>ref|WP_006197743.1| hypothetical protein [Nodularia spumigena]
 gb|EAW44101.1| hypothetical protein N9414_13595 [Nodularia spumigena CCY9414]
 gb|AHJ29258.1| 2-methyl-6-phytyl-1,4-benzoquinone cyclase [Nodularia spumigena 
CCY9414]
Length=365

 Score =   285 bits (729),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/309 (46%), Positives = 197/309 (64%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DG+ R FFEGW+++V++P C Q+F +MYS+E+P  +KP            +
Sbjct  13    QTPHSGYHWDGSSRSFFEGWYYRVTLPHCGQTFAFMYSIEDPIGSKP------------Y  60

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQILGA+D+YIC+  P+ K FWG    L LG+    +T    P   + P EF   +
Sbjct  61    SGGAAQILGANDEYICRTFPDVKKFWGSPDVLGLGH--WGKTDLHTPPLYLLPNEFERHI  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
               G+Q T   +QG I D    +Y       RW Y  +PIY WGN  S Q+STAGW+++  
Sbjct  119   QSGYQATATLNQGEIHDPATGNYC------RWLYEIQPIYYWGNQNSIQQSTAGWVSSLQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++G I+W+G+ YEF NAP+YSEKNWG  FP+KWFW+ CN F+G + 
Sbjct  173   IFEPGWQILMAHGLASGSIDWNGKIYEFTNAPAYSEKNWGGAFPQKWFWLNCNSFDG-EP  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V W+I PWG W + A
Sbjct  232   DLALTAGGGRR-----GVLWWMESVAMIGLHYQGKFYEFVPWNAKVEWDIQPWGRWQMRA  286

Query  833   ENATHKSQV  807
              N  ++ ++
Sbjct  287   RNLDYEIEL  295


 Score = 58.9 bits (141),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 42/75 (56%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            ++EL   T  PGT LRAPT   GL   CRDT    L L+L  R+    K   IL   S++
Sbjct  292  EIELTGTTHLPGTPLRAPTAN-GLVFCCRDTMQGKLDLEL--RKLSSGKSSTILKAESSL  348

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GGG W N+W 
Sbjct  349  CGLEIGGGSWDNSWH  363



>ref|WP_015153712.1| tocopherol cyclase [Chroococcidiopsis thermalis]
 ref|YP_007091033.1| tocopherol cyclase [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY87164.1| tocopherol cyclase [Chroococcidiopsis thermalis PCC 7203]
Length=367

 Score =   285 bits (728),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 145/315 (46%), Positives = 201/315 (64%), Gaps = 30/315 (10%)
 Frame = -1

Query  1760  TPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGI  1581
             T TPS +   TPHSGYH+DG+ R+FFEGW+++V++P   ++F +MYS+E+P         
Sbjct  12    TQTPSTQ---TPHSGYHWDGSDRRFFEGWYYRVTLP-TGETFAFMYSIEDPIG-------  60

Query  1580  EEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEV  1401
                  G+  +G  AQILG DDKY+ +  P+ K FW    +L+LG+    QT      K +
Sbjct  61    -----GKTHSGGAAQILGPDDKYLWRTYPDVKRFWASPTQLALGH--WGQTDLETQAKWL  113

Query  1400  PPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKS  1221
              P EF+  + +G+Q T  W+QG IRD             RW+Y  +PIYGWG+ G  Q+S
Sbjct  114   SPDEFDRHIQQGYQATATWNQGIIRDPANN------GDCRWQYEIQPIYGWGDRGRIQQS  167

Query  1220  TAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQ  1041
             TAGWL++  +FEP WQ+ MA GL+TGWI+W G+RYEF NAP+YSEKNWG  FP++WFW+ 
Sbjct  168   TAGWLSSLQIFEPGWQILMAHGLATGWIDWYGKRYEFTNAPAYSEKNWGGAFPQRWFWLN  227

Query  1040  CNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEIS  861
             CN F+  + +++LT+GGG R     G     E+ A++ +HY G FYEFVPWN  VTW I 
Sbjct  228   CNSFD-DEPDLALTAGGGRR-----GVLWWMESVAMVGLHYRGKFYEFVPWNSEVTWNIQ  281

Query  860   PWGHWYITAENATHK  816
             PWG W + A NA ++
Sbjct  282   PWGCWQMQARNADYE  296


 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V L   T  PGT LRAPTQ  GL   C+DT    + LQL+  R  G K K+IL+ TS++
Sbjct  296  EVVLTGTTDLPGTPLRAPTQN-GLVFCCKDTMRGQVSLQLYSCR--GGK-KSILEATSSV  351

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GG PW + W+
Sbjct  352  CGLEIGGNPWDSAWQ  366



>ref|WP_015217110.1| tocopherol cyclase [Anabaena cylindrica]
 ref|YP_007159405.1| tocopherol cyclase [Anabaena cylindrica PCC 7122]
 gb|AFZ60495.1| tocopherol cyclase [Anabaena cylindrica PCC 7122]
Length=365

 Score =   284 bits (727),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/309 (46%), Positives = 198/309 (64%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DGT R+FFEGW+++V++PE RQ+F +MYS+E+P   KP            +
Sbjct  13    QTPHSGYHWDGTNRRFFEGWYYRVTLPEIRQTFAFMYSIEDPVGGKP------------Y  60

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQILG +D+Y+ +  P+   FW  R  L+LG+    +T  +     + P EF   V
Sbjct  61    SGGAAQILGINDEYLFRTFPDVNKFWASRDVLALGH--WGKTNVQVSPLYLLPTEFEHHV  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG I D    +Y       RW+Y  +P+Y WGN  S Q+STAGWL+   
Sbjct  119   QEGYQATATLNQGIITDPATGNYC------RWQYEIKPVYAWGNQNSIQQSTAGWLSFSQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL+TG I+W+G+ YEF NAP+YSEKNWG  FP+KWFW+ CN F+  + 
Sbjct  173   IFEPGWQILMAHGLATGSIDWNGKIYEFTNAPAYSEKNWGGAFPQKWFWLNCNYFDN-EP  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V WEI PWG W + A
Sbjct  232   DLALTAGGGKR-----GVLWWMESVAMIGIHYQGKFYEFVPWNSQVNWEIQPWGKWQMQA  286

Query  833   ENATHKSQV  807
             +N+ ++ ++
Sbjct  287   KNSKYEVEL  295


 Score = 58.9 bits (141),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT + GL   CRDT    L L+L  R   G K K IL   S++
Sbjct  292  EVELTGITDLPGTPLRAPTTD-GLTFCCRDTMQGKLDLEL--REITGGKSKIILKAQSHL  348

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GG  W N W+
Sbjct  349  CGLEIGGDGWENIWQ  363



>gb|AFK37256.1| unknown [Lotus japonicus]
Length=225

 Score =   186 bits (473),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 4/124 (3%)
 Frame = -1

Query  1166  MAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVF--EGADGEVSLTSG  993
             M  GLSTGWIEWDGER EFENAPSYSEKNWG GFPRKWFWVQCNV   EGA GE++LT+ 
Sbjct  1     MGGGLSTGWIEWDGERIEFENAPSYSEKNWGGGFPRKWFWVQCNVLEGEGASGEIALTAA  60

Query  992   GGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKS  813
             GGLRQI  PG ++ FENAALI VHYGG FYEFVPWNG V WE++PWG+W+++A+N ++  
Sbjct  61    GGLRQI--PGITETFENAALIGVHYGGKFYEFVPWNGFVNWEVTPWGYWFMSADNGSYLV  118

Query  812   QVEV  801
             ++E 
Sbjct  119   ELEA  122


 Score =   157 bits (398),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA+T DPGT LRAPT E GL+  C+DTC+  L L++WERRYDGSKGK ILDV+S+MA
Sbjct  118  VELEAKTDDPGTPLRAPTSEAGLSQACKDTCFGILTLKIWERRYDGSKGKIILDVSSDMA  177

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWF+TWKG T  P ++  AL  PVD++GIF  VPLFKPPGL
Sbjct  178  ALEVGGGPWFSTWKGKTTMPPVIGPALGLPVDLDGIFNAVPLFKPPGL  225



>ref|WP_015211029.1| tocopherol cyclase [Cylindrospermum stagnale]
 ref|YP_007150475.1| tocopherol cyclase [Cylindrospermum stagnale PCC 7417]
 gb|AFZ27795.1| tocopherol cyclase [Cylindrospermum stagnale PCC 7417]
Length=390

 Score =   285 bits (728),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 141/309 (46%), Positives = 196/309 (63%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DG+ R+FFEGW+++V++PE  Q+F +MYS+E+P   KP SG          
Sbjct  38    QTPHSGYHWDGSSRRFFEGWYYRVTLPEIGQTFAFMYSIEDPIGGKPHSG----------  87

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
                 AQ+LG DD+Y+C+  P+ + FWG R  L LG+    +T  +     + P EF   V
Sbjct  88    --GAAQVLGLDDEYLCRTFPDVQKFWGSRDVLGLGH--WGKTDLQVSPIYLLPAEFEHHV  143

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG I D    +Y       RW Y  +PIY WGN  S Q+STAGWL+   
Sbjct  144   QEGYQATATLNQGIITDPATGNYC------RWHYQIQPIYAWGNQNSLQQSTAGWLSFLQ  197

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W+G+ Y+F NAP+Y EKNWG  FP+KWFW+ CN FEG + 
Sbjct  198   IFEPGWQILMAHGLASGWIDWNGKIYQFSNAPAYGEKNWGGAFPQKWFWLNCNSFEG-EP  256

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +H  G FYEFVPWN  V W+I PWG W++ A
Sbjct  257   DLALTAGGGRR-----GVLWWMESVAMIGLHSQGKFYEFVPWNSQVEWQIQPWGGWHMRA  311

Query  833   ENATHKSQV  807
              N  ++ ++
Sbjct  312   RNLEYEVEL  320


 Score = 59.3 bits (142),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T   GT LRAPT   GLA  CRDT    L ++L  R   G K K IL   S +
Sbjct  317  EVELTGTTHLKGTELRAPTTN-GLAFCCRDTMQGQLDIEL--REIGGGKSKTILKAHSYL  373

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GGG W N+W+
Sbjct  374  CGLEIGGGTWNNSWQ  388



>ref|WP_016950282.1| tocopherol cyclase [Anabaena sp. PCC 7108]
Length=365

 Score =   279 bits (714),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/309 (44%), Positives = 199/309 (64%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DG+ R+FFEGW+++V++PE RQ+  +MYS+E+P   +P            +
Sbjct  13    QTPHSGYHWDGSSRRFFEGWYYRVTLPEIRQTIAFMYSIEDPIGNQP------------Y  60

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQILG +D+Y+C+  P+   FW     L+LG+    +T  +     + P EF   +
Sbjct  61    SGGAAQILGINDEYLCRTFPDVNKFWASPDVLALGHW--GKTDLQISPLYLIPTEFEHHI  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              +G+Q T   +QG I D G  +Y       RW+Y  +P+Y WGN  + Q+STAGWL+   
Sbjct  119   QQGYQATATLNQGIITDPGTGNYC------RWQYEIKPVYAWGNQNNIQQSTAGWLSFSQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL+TG+I+W+G+ YEF NAP+Y EKNWG  FP+KWFW+ CN F+  + 
Sbjct  173   IFEPGWQILMAHGLATGFIDWNGKIYEFTNAPAYGEKNWGGAFPQKWFWLNCNSFD-EEP  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V+WEI PWG W + A
Sbjct  232   DLALTAGGGRR-----GVLWWMESVAMIGIHYQGKFYEFVPWNSQVSWEIHPWGKWQMQA  286

Query  833   ENATHKSQV  807
             +N+ ++ ++
Sbjct  287   KNSHYEVEL  295


 Score = 65.1 bits (157),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT   GLA  CRDT    L L+L  R  +GSK K IL   S++
Sbjct  292  EVELTGTTDLPGTPLRAPTTN-GLAYCCRDTMQGKLDLEL--RELNGSKSKIILKAQSHL  348

Query  597  AGVEVGGGPWFNTWKGT  547
             G+EVGG  W N W+ +
Sbjct  349  CGLEVGGATWENIWQSS  365



>ref|WP_015078334.1| hypothetical protein [Anabaena sp. 90]
 ref|YP_006994983.1| hypothetical protein ANA_C10369 [Anabaena sp. 90]
 gb|AFW93170.1| hypothetical protein ANA_C10369 [Anabaena sp. 90]
Length=365

 Score =   276 bits (707),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 192/309 (62%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+D + R+FFEGW+++V++PE +Q+  +MYS+E+P+  +P            +
Sbjct  13    QTPHSGYHWDCSHRRFFEGWYYRVTLPEIKQTIAFMYSIEDPSGNQP------------Y  60

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQILG +D+Y+C+  P+   FW  R  L LG+         P    + P EF   +
Sbjct  61    SGGAAQILGINDEYLCRTFPDVNKFWASRDVLGLGHWGKTNLQVSP--LYLIPSEFTHHI  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG I D    +Y       RWEY  +P+Y WGN  S Q+STAGWL+   
Sbjct  119   QEGYQATATLNQGIITDPATGNYC------RWEYEIKPVYAWGNQNSLQQSTAGWLSFSQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W G+ YEF NAP+Y+EKNWG  FP+KWFW+ CN F     
Sbjct  173   IFEPGWQILMAHGLASGWIDWHGKIYEFTNAPAYAEKNWGGAFPQKWFWLNCNSFINQP-  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +H+ G FYEFVPWN  V W+I PWG W + A
Sbjct  232   DLALTAGGGKR-----GVLWWMESVAMIGIHHQGKFYEFVPWNSEVKWQIQPWGRWQMQA  286

Query  833   ENATHKSQV  807
             +N  ++ ++
Sbjct  287   KNLNYEIEL  295


 Score = 66.6 bits (161),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            ++EL   T  PGT+LRAPT   GL   CRDT   +L L+L  R  +GSK + IL+ +SN+
Sbjct  292  EIELTGTTQLPGTSLRAPTSN-GLKFCCRDTMQGELNLEL--RELNGSKSQVILNASSNL  348

Query  597  AGVEVGGGPWFNTWK  553
             G+EVGG  W N W+
Sbjct  349  CGLEVGGDDWDNYWQ  363



>ref|WP_026732195.1| tocopherol cyclase [Fischerella sp. PCC 9605]
Length=365

 Score =   283 bits (723),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 196/309 (63%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DG+ R+FFEGW+++V++P   QSF +MYS+E+P   KP SG          
Sbjct  13    QTPHSGYHWDGSNRRFFEGWYYRVTLPWEGQSFAFMYSIEDPIGGKPHSG----------  62

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
                 AQILG DD+Y+C+  PE   FW  +  L+LG+        +P  + + P EF   V
Sbjct  63    --GAAQILGPDDEYLCRTFPEVSKFWARQDVLALGHWGKTDLNIQP--RYLQPAEFELHV  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              +G+Q T   +QG I D G      T K  RW+Y  +P+YGWGN  S Q+STAGWL+   
Sbjct  119   KQGYQATTTLNQGEISDPG------TGKYCRWQYQIQPVYGWGNQNSVQQSTAGWLSFLQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W+G+RYEF NAP+YSEKNWG  FP+KWFW  CN F   + 
Sbjct  173   IFEPGWQILMAHGLASGWIDWNGKRYEFTNAPAYSEKNWGGAFPKKWFWANCNSFL-DEP  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A++ +HY G FYEFVPWN  V W I PWG W + A
Sbjct  232   DLALTAGGGKR-----GVLWWMESVAMVGLHYQGKFYEFVPWNSQVRWNIEPWGRWQMQA  286

Query  833   ENATHKSQV  807
              N+ ++ ++
Sbjct  287   RNSHYEVEL  295


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT E GL   CRDT    L L+L  R     +GK IL   S +
Sbjct  292  EVELLGTTHLPGTPLRAPT-ENGLMFCCRDTLQGQLNLEL--RELSNGQGKIILKAHSYV  348

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GGG W N W+
Sbjct  349  CGLEIGGGAWNNCWQ  363



>ref|WP_039715919.1| tocopherol cyclase [Scytonema millei]
 gb|KIF18394.1| tocopherol cyclase [Scytonema millei VB511283]
Length=362

 Score =   281 bits (719),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 198/317 (62%), Gaps = 27/317 (9%)
 Frame = -1

Query  1766  VYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLS  1587
             V  P   +   +TPHSGYH+DG+ R+FFEGW+++V++ +   +F +MYS+E+P   KP S
Sbjct  2     VSIPKNFSFSTQTPHSGYHWDGSDRRFFEGWYYRVTL-DTGDTFAFMYSIEDPIGGKPHS  60

Query  1586  GIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNK  1407
             G              AQILG DD+Y+ +  P+ K FW    +L+LG+    QT    P  
Sbjct  61    G------------GAAQILGPDDRYLWRTYPDVKRFWASPTQLALGH--WGQTDLDTPAN  106

Query  1406  EVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQ  1227
              + P EF+  + +G+Q T  W+QG I D G           RW+Y  +PIYGWG+ G  Q
Sbjct  107   WLSPDEFDRHIQQGYQATATWNQGIILDPGNN------GVCRWQYEIQPIYGWGDRGRIQ  160

Query  1226  KSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFW  1047
             +STAGWL++  +FEP WQ+ MA GL+TGWI+W G+RYEF  AP+YSEKNWG  FP++WFW
Sbjct  161   QSTAGWLSSLQIFEPGWQILMAHGLATGWIDWHGKRYEFTKAPAYSEKNWGGAFPQRWFW  220

Query  1046  VQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWE  867
             + CN F+  + +++LT+GGG R     G     E+ A++ +HY G FYEFVPWN  VTW 
Sbjct  221   LNCNSFD-DEPDLALTAGGGRR-----GVLWWMESVAMVGLHYRGKFYEFVPWNSEVTWN  274

Query  866   ISPWGHWYITAENATHK  816
             I PWG W + A NA ++
Sbjct  275   IQPWGCWQMQARNADYE  291


 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V L   T  PGT LRAPTQ  GL   C+DT    + LQL+  R  G K K IL+  S++
Sbjct  291  EVVLTGTTDLPGTPLRAPTQN-GLVFCCKDTMRGQVSLQLYSWR--GGK-KLILEAKSSV  346

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GG PW +TW+
Sbjct  347  CGLEIGGSPWDSTWQ  361



>ref|WP_026097521.1| tocopherol cyclase [Geitlerinema sp. PCC 7105]
Length=357

 Score =   281 bits (718),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 139/302 (46%), Positives = 194/302 (64%), Gaps = 30/302 (10%)
 Frame = -1

Query  1730  TPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFT  1551
             TPHSGYH+DG   +FFEGW+++V++PE  Q+F +MYS+E+P   +P SG           
Sbjct  7     TPHSGYHWDGISPRFFEGWYYRVTLPEANQTFAFMYSIEDPIGGRPNSG-----------  55

Query  1550  GVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVL  1371
               GAQILG DD Y+C+  PE   FW  ++ L LG+      +  P   E  PQ F+  V 
Sbjct  56    -GGAQILGPDDDYLCRTFPEVTTFWAWKNALGLGHWGKTDLSGTPMFLE--PQIFDRHVE  112

Query  1370  EGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPV  1191
             EG+Q T  WHQG + D G      T    +W+Y   P+YGWG+    ++STAG L++  +
Sbjct  113   EGYQGTATWHQGKLYDPG------TRSRCQWQYRIEPVYGWGD----RQSTAGLLSSLQI  162

Query  1190  FEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGE  1011
             FEP WQ+ MA GL+TGWI+W+G RYEF+ AP+Y EKNWG  FP+ WFW+ CN F+G + +
Sbjct  163   FEPGWQILMAHGLATGWIDWNGTRYEFDRAPAYGEKNWGRSFPQSWFWLNCNSFDG-ESD  221

Query  1010  VSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAE  831
             ++LT+GGG RQ+         E+ A++ +HY G FYEFVPWNG+VTW++SPWG W + A+
Sbjct  222   LALTAGGGRRQV-----LTWMESVAMVGIHYRGQFYEFVPWNGTVTWDVSPWGSWKMQAK  276

Query  830   NA  825
             + 
Sbjct  277   SG  278


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 10/81 (12%)
 Frame = -3

Query  819  QVTSGSITEIIICEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYD  640
            Q  SG +T       VEL   T +PGT LRAPT   GL   CRDT Y  ++L+L + R  
Sbjct  274  QAKSGDLT-------VELLGTTDEPGTPLRAPTHR-GLVFACRDTMYGKVKLRLTQHR--  323

Query  639  GSKGKAILDVTSNMAGVEVGG  577
                + I++ TS+  G+EVGG
Sbjct  324  NGNVRTIVEATSSQCGLEVGG  344



>gb|AFK40450.1| unknown [Lotus japonicus]
Length=225

 Score =   182 bits (463),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 4/124 (3%)
 Frame = -1

Query  1166  MAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVF--EGADGEVSLTSG  993
             M  GLSTGWIEWDGER EFENAPSYSEKNWG GFPRKWFWVQCNV   EGA GE++LT+ 
Sbjct  1     MGGGLSTGWIEWDGERIEFENAPSYSEKNWGGGFPRKWFWVQCNVLEGEGASGEIALTAA  60

Query  992   GGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKS  813
             GGLRQI  PG ++ FENAALI VHYGG FYEFVPWNG V WE++PWG+ +++A+N ++  
Sbjct  61    GGLRQI--PGITETFENAALIGVHYGGKFYEFVPWNGFVNWEVTPWGYRFMSADNGSYLV  118

Query  812   QVEV  801
             ++E 
Sbjct  119   ELEA  122


 Score =   157 bits (398),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VELEA+T DPGT LRAPT E GL+  C+DTC+  L L++WERRYDGSKGK ILDV+S+MA
Sbjct  118  VELEAKTDDPGTPLRAPTSEAGLSQACKDTCFGILTLKIWERRYDGSKGKIILDVSSDMA  177

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             +EVGGGPWF+TWKG T  P ++  AL  PVD++GIF  VPLFKPPGL
Sbjct  178  ALEVGGGPWFSTWKGKTTMPPVIGPALGLPVDLDGIFNAVPLFKPPGL  225



>ref|WP_016874874.1| tocopherol cyclase [Chlorogloeopsis fritschii]
Length=365

 Score =   281 bits (718),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/309 (46%), Positives = 196/309 (63%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             RTPHSGYH+DGT R+FFEGW+++V++P   QSF +MYS+E+P   KP SG          
Sbjct  13    RTPHSGYHWDGTSRRFFEGWYYRVTLPGEAQSFAFMYSIEDPIGGKPHSG----------  62

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
                 AQIL  +D+Y+C+  P+   FW ++ EL+LG+   A    +P    +   +F   V
Sbjct  63    --GAAQILAPNDEYLCRTFPDVSKFWAKQEELALGHWGEADLDIKP--GYLLSADFERYV  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              +G+Q T   +QG I D G   Y       RW+Y  +P+YGWGN GS Q+STAGWL+   
Sbjct  119   QQGYQATATLNQGAIYDPGSGKYC------RWQYEIQPVYGWGNKGSIQQSTAGWLSFLQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W+G RYEF NAP+Y EKNWG  FP++WFW  CN F   + 
Sbjct  173   IFEPGWQILMAHGLASGWIDWNGRRYEFTNAPAYGEKNWGGAFPQRWFWANCNSFI-DEP  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V+W I PWG W + A
Sbjct  232   DLALTAGGGRR-----GVLWWMESVAMIGLHYRGNFYEFVPWNSQVSWNIQPWGSWQMQA  286

Query  833   ENATHKSQV  807
             +N+ ++ ++
Sbjct  287   KNSQYEVEL  295


 Score = 59.3 bits (142),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT E GL   CRDT    L L+L  R   GS  + IL   S++
Sbjct  292  EVELLGATDLPGTPLRAPT-ENGLIFCCRDTLQGQLNLEL--REISGSHRRTILKARSSL  348

Query  597  AGVEVGGGPWFNTW  556
             G+E+GG PW + W
Sbjct  349  CGLEIGGSPWSDRW  362



>ref|WP_018397956.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=354

 Score =   279 bits (713),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/311 (45%), Positives = 193/311 (62%), Gaps = 26/311 (8%)
 Frame = -1

Query  1739  PLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGR  1560
             PL+TPHSGYHF G R +FFEGW+++V++    Q+F +MYS+E+P              G+
Sbjct  4     PLQTPHSGYHFRGGRDRFFEGWYYRVTLESIAQTFAFMYSIEDPIG------------GQ  51

Query  1559  RFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNS  1380
               +G  AQILG DD+Y C+  P++  FW    EL+LG+   +     P  + + P  F  
Sbjct  52    SHSGGAAQILGPDDQYFCRTFPDTTAFWASPDELALGHWRTSNPDITP--ELLDPDTFEQ  109

Query  1379  RVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAA  1200
             + +EG+Q T   +QG++ D GR          RW Y  +P+YGWG     QKSTAGWL+ 
Sbjct  110   QNIEGYQATATLNQGYLHDPGRG------IDCRWCYEIKPVYGWGKPDEDQKSTAGWLSY  163

Query  1199  FPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGA  1020
             FP+FEP WQ+ MA GL+TGWI+W G+RY F++AP+YSEKNWG  FP KWFW+ CN FE  
Sbjct  164   FPIFEPGWQILMAHGLATGWIDWQGKRYFFQDAPAYSEKNWGKSFPNKWFWLNCNSFE-Q  222

Query  1019  DGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYI  840
             + +++LT+GGG R     G     E+ ALI  HY G FYEFVPWN  V+W+I PWG W +
Sbjct  223   EPDLALTAGGGKR-----GILWWMESVALICFHYQGEFYEFVPWNSRVSWQIDPWGKWQM  277

Query  839   TAENATHKSQV  807
              A    ++ ++
Sbjct  278   QAIKDDYEVEL  288


 Score = 61.6 bits (148),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 44/74 (59%), Gaps = 6/74 (8%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT E GL   CRDT    +RL L +R      GK +LD TS++
Sbjct  285  EVELIGTTDQPGTPLRAPTAE-GLQFCCRDTMRGAVRLILRDR-----AGKTLLDATSHL  338

Query  597  AGVEVGGGPWFNTW  556
             G+EVGG PW   W
Sbjct  339  CGLEVGGSPWDEVW  352



>ref|WP_039743255.1| tocopherol cyclase [Hassallia byssoidea]
 gb|KIF35717.1| tocopherol cyclase [Hassallia byssoidea VB512170]
Length=365

 Score =   277 bits (708),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/312 (44%), Positives = 196/312 (63%), Gaps = 26/312 (8%)
 Frame = -1

Query  1742  RPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
             +  +TPHSGYH+D + R+FFEGW+++V++PE  Q+F +MYS+E+P   KP SG       
Sbjct  10    KSTQTPHSGYHWDRSSRRFFEGWYYRVTLPEIEQTFAFMYSIEDPIGGKPHSG-------  62

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
                    AQILG +D+YI +  P+   FW +   L+LG+       ++P     P  EF+
Sbjct  63    -----GAAQILGPNDEYIWRTFPDVNKFWAKNDVLALGHWGKTDLQSQPLYLLSP--EFD  115

Query  1382  SRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLA  1203
               + EG+Q T   +QG IRD    +Y       RW+Y  +PIYGWGN G  Q+STAG ++
Sbjct  116   RHIQEGYQATATLNQGIIRDPATGNYC------RWQYEIKPIYGWGNKGQLQQSTAGIVS  169

Query  1202  AFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEG  1023
               P+FEP WQ+ MA GL++GWI+W+G+ YEF +AP+Y EKNWG  FP+KWFW+ CN FEG
Sbjct  170   FLPIFEPGWQILMAHGLASGWIDWNGKIYEFTDAPAYGEKNWGGAFPQKWFWLNCNSFEG  229

Query  1022  ADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWY  843
              + +++LT+GGG R     G     E+ A+I +HY   FYEFVPWN  V+W I PWG W 
Sbjct  230   -EPDLALTAGGGRR-----GVLWWMESVAMIGLHYQDKFYEFVPWNSQVSWNIQPWGRWQ  283

Query  842   ITAENATHKSQV  807
             + A N  ++ ++
Sbjct  284   MQARNLNYEIEL  295


 Score = 62.0 bits (149),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 3/77 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            ++EL   T  PGT LRAPT   GL   CRDT    L L+L  R   G+K K IL   S +
Sbjct  292  EIELTGTTHLPGTPLRAPTAN-GLIFCCRDTMQGKLDLEL--REVSGTKSKTILKAHSFL  348

Query  597  AGVEVGGGPWFNTWKGT  547
             G+EVGGG W N+W+ +
Sbjct  349  CGLEVGGGSWDNSWQSS  365



>ref|WP_017310725.1| tocopherol cyclase [Fischerella sp. PCC 9339]
Length=365

 Score =   278 bits (712),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/309 (45%), Positives = 196/309 (63%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+D + R+FFEGW+++V++P+  QSF +MYS+E+P              G+  
Sbjct  13    QTPHSGYHWDHSSRRFFEGWYYRVTLPDEDQSFAFMYSIEDPIG------------GKAH  60

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQ+LG +D+Y+C+  PE KNFW +   L+LG+   +    +P    + P+EF   V
Sbjct  61    SGGAAQVLGPNDEYLCRTFPEVKNFWAKPDVLALGHWGQSNLDIQP--LYLLPEEFELHV  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              +G+Q T   +QG I D     Y       RW+Y  +P+YGWGN  S Q+STAGWL+   
Sbjct  119   QQGYQATATLNQGIISDPSTGQYC------RWQYKIQPVYGWGNHRSIQQSTAGWLSFLQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W+G+RYEF NAP+Y EKNWG  FP+KWFW  CN F     
Sbjct  173   IFEPGWQILMAYGLASGWIDWNGKRYEFTNAPAYGEKNWGGAFPQKWFWANCNSFSEIP-  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V+W I PWG W + A
Sbjct  232   DLALTAGGGRR-----GVLWWMESVAMIGIHYQGKFYEFVPWNSQVSWNIQPWGKWQMQA  286

Query  833   ENATHKSQV  807
              N+ ++ ++
Sbjct  287   RNSHYEVEL  295


 Score = 59.3 bits (142),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT E GL   CRDT    L ++L E++++ ++   IL   S+ 
Sbjct  292  EVELTGITDLPGTPLRAPT-ENGLLFCCRDTLQGQLHIELREKKHNHTE--IILKADSSA  348

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GGGPW + W+
Sbjct  349  CGLEIGGGPWNDAWQ  363



>ref|WP_026721705.1| tocopherol cyclase [Fischerella sp. PCC 9431]
Length=365

 Score =   278 bits (711),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 195/309 (63%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+D + R+FFEGW+++V++P+  QSF +MYS+E+P   KP SG          
Sbjct  13    QTPHSGYHWDHSSRRFFEGWYYRVTLPDENQSFAFMYSIEDPIGGKPHSG----------  62

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
                 AQ+LG +D+Y+C+  PE KNFW +   L+LG+   +    +P   E  P++F   V
Sbjct  63    --GAAQVLGPNDEYLCRTFPEVKNFWAKPDVLALGHWGQSNLNIQPCYLE--PEKFEGHV  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              +G+Q T   +QG I D     Y       RW Y  +P+YGWGN  S Q+STAGWL+   
Sbjct  119   QQGYQATATLNQGIISDPSTGQYC------RWRYDIQPVYGWGNRSSIQQSTAGWLSFLQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W+G+RYEF +AP+Y EKNWG  FP+KWFW  CN F     
Sbjct  173   IFEPGWQILMAHGLASGWIDWNGKRYEFTHAPAYGEKNWGGAFPQKWFWANCNSFSEIP-  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V+W I PWG W + A
Sbjct  232   DLALTAGGGRR-----GVLWWMESVAMIGIHYQGKFYEFVPWNSQVSWNIQPWGKWQMQA  286

Query  833   ENATHKSQV  807
              N+ ++ ++
Sbjct  287   SNSDYEVEL  295


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT E GL   CRDT    L ++L  R  + +  + IL   S+ 
Sbjct  292  EVELTGITDLPGTPLRAPT-ENGLLFCCRDTLQGQLHIEL--REKNNNHQEIILKAHSSA  348

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GGGPW + W+
Sbjct  349  CGLEIGGGPWNDAWQ  363



>ref|WP_015116287.1| tocopherol cyclase [Rivularia sp. PCC 7116]
 ref|YP_007053256.1| tocopherol cyclase [Rivularia sp. PCC 7116]
 gb|AFY52709.1| tocopherol cyclase [Rivularia sp. PCC 7116]
Length=365

 Score =   277 bits (708),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/306 (45%), Positives = 196/306 (64%), Gaps = 26/306 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DG  R+FFEGW+++V++P   Q+F +MYS+E+P   KP SG          
Sbjct  13    QTPHSGYHWDGGERRFFEGWYYRVTLPRENQTFAFMYSIEDPVGRKPHSG----------  62

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
                 AQILG +D+Y+ +  P+   FW +   L+LG+       ++P    + P EF S +
Sbjct  63    --GAAQILGPNDEYLWRTFPDVNKFWAKSDVLALGHWGKTNIESQP--LYLLPVEFESYI  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG I +    DY +      W+Y  +P+Y WGN GS Q+STAGW++   
Sbjct  119   KEGYQATATLNQGTIHNPSNGDYCQ------WQYEIQPVYYWGNRGSIQQSTAGWISFLQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W+G+RYEF NAP+YSEKNWG  FP+KWFW+ CN F+ ++ 
Sbjct  173   IFEPGWQILMAHGLASGWIDWNGKRYEFTNAPAYSEKNWGGAFPQKWFWLNCNSFD-SEA  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V+W I PWG W + A
Sbjct  232   DLALTAGGGRR-----GVLWWMESVAMIGLHYQGKFYEFVPWNSEVSWNIEPWGKWEMHA  286

Query  833   ENATHK  816
              N+ ++
Sbjct  287   RNSQYE  292


 Score = 59.7 bits (143),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V L   T  PGT LRAPT E GL   CRDT    L L+L  R  +  + K IL  TS++
Sbjct  292  EVTLIGTTDLPGTPLRAPT-ENGLIFACRDTMQGKLTLEL--RELNAVESKTILKATSDL  348

Query  597  AGVEVGGGPWFNTW  556
             G+E GGGPW ++W
Sbjct  349  CGLETGGGPWDSSW  362



>ref|WP_016863050.1| tocopherol cyclase [Fischerella muscicola]
Length=365

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 195/309 (63%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+D + R+FFEGW+++V++P+  QSF +MYS+E+P              G+  
Sbjct  13    QTPHSGYHWDHSSRRFFEGWYYRVTLPDENQSFAFMYSIEDPIG------------GKAH  60

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQ+LG +D+Y+C+  PE+ NFW +   L+LG+   +    +P    + P+EF   V
Sbjct  61    SGGAAQVLGPNDEYLCRTFPEANNFWAKPDVLALGHWGQSNIDIQP--LYLLPEEFELHV  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              +G+Q T   +QG I D     Y       RW+Y  +P+YGWGN  S Q+STAGWL+   
Sbjct  119   QQGYQATATLNQGIISDPSTGQYC------RWQYEIQPVYGWGNRSSIQQSTAGWLSFLQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W+ +RYEF NAP+Y EKNWG  FP+KWFW  CN F     
Sbjct  173   IFEPGWQILMAHGLASGWIDWNSKRYEFTNAPAYGEKNWGGAFPQKWFWANCNSFSEIT-  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V+W I PWG W + A
Sbjct  232   DLALTAGGGRR-----GVLWWMESVAMIGIHYQGKFYEFVPWNSQVSWNIQPWGKWQMRA  286

Query  833   ENATHKSQV  807
              N+ ++ ++
Sbjct  287   RNSHYEVEL  295


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT E GL   CRDT    L ++L E++ + ++   IL   S+ 
Sbjct  292  EVELTGITDLPGTPLRAPT-ENGLLFCCRDTLQGQLHIELREKKNNHTE--IILKADSSA  348

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GGGPW + W+
Sbjct  349  CGLEIGGGPWNDAWQ  363



>ref|WP_027402929.1| tocopherol cyclase [Aphanizomenon flos-aquae]
Length=365

 Score =   277 bits (708),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 196/309 (63%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DG+ R+FFEGW+++V++ E RQ+  +MYS+E+P   +P            +
Sbjct  13    QTPHSGYHWDGSDRRFFEGWYYRVTLTEIRQTIAFMYSIEDPRGNQP------------Y  60

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQILG +D+Y+C+  P+   FW  R  L LG+    +T  +     + P+EF   +
Sbjct  61    SGGAAQILGINDEYLCRTFPDINKFWASRDILGLGH--WGKTNLQVSPLYLIPREFAHHI  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG I D    +Y       RWEY+ +P+Y WGN  S Q+STAGWL+   
Sbjct  119   QEGYQATATLNQGIITDPTTGNYC------RWEYAIQPMYAWGNQNSPQQSTAGWLSFSQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++GWI+W G+ YEF NAP+Y+EKNWG  FP+KWFW+ CN F     
Sbjct  173   IFEPGWQILMAHGLASGWIDWHGKIYEFTNAPAYAEKNWGGAFPQKWFWLNCNAFINQP-  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+ A+I +H+ G FYEFVPWN  VTW+I PWG W + A
Sbjct  232   DLALTAGGGKR-----GVLWWMESVAMIGIHHQGKFYEFVPWNSEVTWQIQPWGRWQMQA  286

Query  833   ENATHKSQV  807
             +N  ++ ++
Sbjct  287   KNLNYEIEL  295


 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            ++EL   T  PGT LRAPT   GL   CRDT   ++ L+L  R  +  K + IL  +SN+
Sbjct  292  EIELTGTTHLPGTPLRAPTTN-GLTFCCRDTMQGEITLEL--RELNSGKSQVILTASSNL  348

Query  597  AGVEVGGGPWFNTWK  553
             G+EVGG  W   W+
Sbjct  349  CGLEVGGDDWDYCWR  363



>ref|WP_006276485.1| hypothetical protein [Cylindrospermopsis raciborskii]
 gb|EFA70570.1| conserved hypothetical protein [Cylindrospermopsis raciborskii 
CS-505]
Length=365

 Score =   277 bits (708),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 194/309 (63%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DGT R+FFEGW+ +V++PE  Q+F +MYS+E+P   +P SG          
Sbjct  13    QTPHSGYHWDGTSRRFFEGWYNRVTLPEIGQTFAFMYSIEDPISNQPHSG----------  62

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
                 AQ+LG DD Y+ +  P+ K FW  R  L+LG+    +T  +   + + P +F + +
Sbjct  63    --GAAQVLGPDDSYLLRTFPDIKAFWASRDVLALGH--WGKTDLQITPQYLTPHKFTTHI  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              +G+Q T   +QG I D G  +Y       RW+Y  +PIYGWG     Q+STAGWL+   
Sbjct  119   QQGYQATATLNQGIITDPGTGNYC------RWQYEIKPIYGWGQPNYPQQSTAGWLSFLQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++G+I+W+G+ Y+F NAP+Y EKNWG  FP+KWFW+ CN F+  + 
Sbjct  173   IFEPGWQILMAHGLASGYIDWNGKIYQFTNAPAYGEKNWGGAFPQKWFWINCNCFD-YET  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+  +I +HY G FYEFVPWN  VTW+I PWG W + A
Sbjct  232   DLALTAGGGKR-----GVLWWMESVGMIGIHYQGHFYEFVPWNSQVTWQIEPWGSWQMQA  286

Query  833   ENATHKSQV  807
              N  ++  V
Sbjct  287   RNYKYEVTV  295


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V +   T  PGT LRAPT + GLA  CRDT    + L+L  RR   +    I+  +S++
Sbjct  292  EVTVTGTTDLPGTLLRAPTNQ-GLAICCRDTMQGKVSLEL--RRLHQNYSTVIVKASSDV  348

Query  597  AGVEVGGGPWFNTWK  553
             G+EVGG  W N+W+
Sbjct  349  CGLEVGGDSWENSWQ  363



>ref|WP_029634470.1| tocopherol cyclase [[Scytonema hofmanni] UTEX B 1581]
Length=365

 Score =   272 bits (696),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 196/312 (63%), Gaps = 26/312 (8%)
 Frame = -1

Query  1742  RPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
             +  +TPHSGYH+D   R+FFEGW+++V+IPE  Q+F +MYS+E+P   KP SG       
Sbjct  10    KSTQTPHSGYHWDRGSRRFFEGWYYRVTIPEIEQTFAFMYSIEDPIGGKPHSG-------  62

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
                    AQ+LG +D+Y+ +  P+   FW +   L+LG+       ++P    + P EF+
Sbjct  63    -----GAAQVLGPNDEYLLRTFPDVNKFWAKNDVLALGHWGRTDLQSQP--LYLFPAEFD  115

Query  1382  SRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLA  1203
               + EG+Q T   +QG IRD    +Y       RW+Y  +P+YGWGN G  Q+STAG ++
Sbjct  116   RYIQEGYQATATLNQGIIRDPATGNYC------RWQYEIKPVYGWGNKGQLQQSTAGIIS  169

Query  1202  AFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEG  1023
               P+FEP WQ+ MA G ++GWI+W+G+ YEF +AP+YSEKNWG  FP+KWFW+ CN F+ 
Sbjct  170   FLPIFEPGWQILMAHGKASGWIDWNGKIYEFTDAPAYSEKNWGGAFPQKWFWLNCNSFD-  228

Query  1022  ADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWY  843
             ++ +++LT+GGG R     G     E+ A+I +HY   FYEFVPWN  V+W I PWG W 
Sbjct  229   SEPDLALTAGGGRR-----GVLWWMESVAMIGLHYQDKFYEFVPWNSQVSWNIQPWGRWQ  283

Query  842   ITAENATHKSQV  807
             + A N  ++ ++
Sbjct  284   MQARNLNYEIEL  295


 Score = 61.6 bits (148),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 3/77 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            ++EL   T  PGT LRAPT   GL   CRDT    L L+L  R   G+K K IL   S +
Sbjct  292  EIELTGTTHLPGTPLRAPTAN-GLIFCCRDTMQGKLDLEL--REVSGTKSKTILKAHSFL  348

Query  597  AGVEVGGGPWFNTWKGT  547
             G+EVGGG W N+W+ +
Sbjct  349  CGLEVGGGSWDNSWQSS  365



>ref|WP_006621065.1| MULTISPECIES: hypothetical protein [Arthrospira]
 gb|EDZ91816.1| conserved hypothetical protein [Arthrospira maxima CS-328]
 emb|CCE15195.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
 gb|EKD11127.1| hypothetical protein SPLC1_S041240 [Arthrospira platensis C1]
 emb|CDM93660.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
Length=355

 Score =   271 bits (693),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 193/312 (62%), Gaps = 32/312 (10%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L TPH+GYH++G  R+FFEGW+++V++PE RQ+F +MYS+E+P+  +P SG         
Sbjct  13    LSTPHNGYHWEGGDRRFFEGWYYRVTLPEPRQTFAFMYSIEDPSGGQPHSG---------  63

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
                  AQILG DD+Y+C+  P+   FW     L+LG+     T  +     +  Q F+  
Sbjct  64    ---GAAQILGPDDQYLCRTFPDVNKFWASTDTLALGH--WGDTDLKSAPGYLDSQLFDRF  118

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + +G+Q T   HQG ++D  R           WEY+  P+YGWG    +Q+STAGWL+  
Sbjct  119   IRQGYQGTDTHHQGRLKDGTRN--------CSWEYTITPVYGWG----QQQSTAGWLSFL  166

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             P+FEP WQ+ MA G +TGWI+W+G  Y+F NAP+Y EKNWG  FPRKWFWV CN F+   
Sbjct  167   PIFEPGWQILMAHGSATGWIDWNGTLYQFTNAPAYGEKNWGGAFPRKWFWVNCNCFDHIP  226

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG R +         E+ A++ +HY G FYEFVPWN  V W+I+PWG W+I 
Sbjct  227   -DLALTAGGGKRSVLW-----WLESVAMVGIHYRGQFYEFVPWNAQVHWQIAPWGDWHIQ  280

Query  836   AENATHKSQVEV  801
             A+N   +  ++ 
Sbjct  281   ADNGRFQVSLQA  292


 Score = 61.6 bits (148),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 45/74 (61%), Gaps = 7/74 (9%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            QV L+A T+ PGT LRAPT   GL   CRDT   ++ LQL        +G+ IL+  S++
Sbjct  287  QVSLQATTTYPGTPLRAPTHH-GLQFCCRDTMKGEVTLQL------RQQGRLILEAHSSL  339

Query  597  AGVEVGGGPWFNTW  556
             G+E GGGPW  TW
Sbjct  340  CGLETGGGPWDETW  353



>ref|WP_027844634.1| tocopherol cyclase [Mastigocoleus testarum]
Length=386

 Score =   275 bits (703),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/334 (43%), Positives = 204/334 (61%), Gaps = 42/334 (13%)
 Frame = -1

Query  1754  TPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEE  1575
             T S    +TPHSGYH+DGT R+FFEGW+++V++P  +Q+F +MYS+E+P       G +E
Sbjct  6     TASLLSTQTPHSGYHWDGTARRFFEGWYYRVTLPTEKQTFAFMYSIEDPI------GDQE  59

Query  1574  VQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGN--------------TFI  1437
                    +G GAQILG +D+Y+ +  P    FWG    L+LG+              T  
Sbjct  60    ------HSGGGAQILGPNDEYLVRTFPNVNQFWGSPDVLALGHWGKTDFYPSNTGFRTMG  113

Query  1436  AQTAARPPNKEVP----PQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYS  1269
             ++      N   P    P+EF + + EG+Q T   +QG IRD    +Y        WEY 
Sbjct  114   SRNITSKNNSSKPCYLSPEEFKNHIKEGYQATATLNQGLIRDRSTNNYC------YWEYE  167

Query  1268  TRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYS  1089
              +P+YGWGN G+ Q+STAGWL+   +FEP WQ+ MA GL++G I+W+G+ YEF +AP+Y 
Sbjct  168   IKPVYGWGNQGNIQQSTAGWLSFLQIFEPGWQILMAHGLASGVIDWNGKLYEFTDAPAYG  227

Query  1088  EKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGV  909
             EKNWG  FP+KWFW+ CN F+  + +++LT+GGG R     G     E+ A+I +HY G 
Sbjct  228   EKNWGGAFPQKWFWLNCNSFDN-ESDLALTAGGGKR-----GVLWWMESVAMIGLHYQGK  281

Query  908   FYEFVPWNGSVTWEISPWGHWYITAENATHKSQV  807
             FYEFVPWN  VTW+I PWG W ++A+N  ++ ++
Sbjct  282   FYEFVPWNSHVTWDIQPWGKWEMSAKNDNYEIKL  315


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +++L   T  PGT LRAPTQ+ GL   CRDT    L L+L  R  +  K K IL   S++
Sbjct  312  EIKLIGTTDLPGTPLRAPTQD-GLIFCCRDTMQGKLGLEL--REINSKKIKTILTARSSL  368

Query  597  AGVEVGGGPWFNTWKGTT  544
             G+E+GGG W + W  ++
Sbjct  369  CGLEIGGGSWNDPWSSSS  386



>ref|WP_009556716.1| tocopherol cyclase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ69809.1| tocopherol cyclase [Oscillatoriales cyanobacterium JSC-12]
Length=374

 Score =   274 bits (701),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 198/324 (61%), Gaps = 43/324 (13%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             + PHSGYH+ G RR+FFEGW+F+V++ EC+QSF +MYS+E+P+ +              +
Sbjct  12    QVPHSGYHWSGDRRRFFEGWYFRVTLSECQQSFAFMYSIEDPSGSSI------------Y  59

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKE----------  1404
             +G  AQILG DD Y+C+  P+ K+FW  ++ L LG+    +  + P N +          
Sbjct  60    SGGAAQILGPDDCYLCRTFPDVKHFWAWKNGLGLGH---WRRRSHPSNDDRSPSVWSPSS  116

Query  1403  -----VPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV  1239
                  +P Q  N    EG+QVT  WHQG+++         T  +ARW +  +PIY WG  
Sbjct  117   FPINYLPVQSINPVTSEGYQVTDRWHQGYLQ-------TPTGDSARWAFQVQPIYRWGTP  169

Query  1238  GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPR  1059
              +  ++TAGWL+  P+FEP WQ+ +A G +TGWIEW+G RY F  +P Y+EKNWG  FP+
Sbjct  170   FTLPQATAGWLSFLPIFEPGWQILVAHGFATGWIEWNGTRYIFHRSPFYAEKNWGGSFPQ  229

Query  1058  KWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGS  879
             KWFW+QCN F+    +++LT+ GG RQ+ G       E+  +I +H  G FYEFVPWN S
Sbjct  230   KWFWIQCNAFDTMP-DLTLTAVGGRRQVLG-----QMESVGMIGIHCHGKFYEFVPWNAS  283

Query  878   VTWEISPWGHWYITAENATHKSQV  807
             V WE++PWG W + AE+  H+ +V
Sbjct  284   VRWEVTPWGFWKMAAESDRHRVEV  307



>ref|WP_015229100.1| hypothetical protein [Dactylococcopsis salina]
 ref|YP_007171453.1| hypothetical protein Dacsa_1404 [Dactylococcopsis salina PCC 
8305]
 gb|AFZ50096.1| hypothetical protein Dacsa_1404 [Dactylococcopsis salina PCC 
8305]
Length=355

 Score =   273 bits (698),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 195/310 (63%), Gaps = 26/310 (8%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L+TPHS YH+ G   +FFEGW+++V++PE  Q+F +MYS+++PA             G  
Sbjct  4     LQTPHSAYHWAGETDRFFEGWYYRVTLPEINQTFAFMYSIDDPAG------------GTA  51

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
             ++G  AQILG DD+Y  +  P+ K FW +   L LG+       + P  +++ P +FN +
Sbjct  52    YSGGAAQILGPDDRYFWRTFPKVKGFWADYQRLGLGHWQKRPLGSFP--RQLTPNQFNQQ  109

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + EG+Q T   +QG + D        T +T  WEY  +PIYGWG+    QK+TAGWL+  
Sbjct  110   IEEGYQATATLNQGKLHD------PTTGETVSWEYEIQPIYGWGDPNRPQKATAGWLSFL  163

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             P+FEP WQ+ +A G +TG+I+W G+ Y+F NAP+YSEKNWG  FP KWFW+ CN F   +
Sbjct  164   PLFEPGWQILIAHGRATGYIQWQGKTYQFTNAPAYSEKNWGRAFPAKWFWLNCNAFI-DE  222

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG R++ G G     E  ALI  HY G FYEFVPW+  V+WEI PWG W +T
Sbjct  223   PDLALTAGGGRREVLGLG-----EEVALICFHYQGKFYEFVPWHAEVSWEIQPWGEWKMT  277

Query  836   AENATHKSQV  807
             A  A  K+++
Sbjct  278   AIGAELKAEI  287



>ref|WP_035153386.1| tocopherol cyclase [Calothrix sp. 336/3]
 gb|KFB83623.1| tocopherol cyclase [Calothrix sp. 336/3]
Length=356

 Score =   273 bits (698),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 196/302 (65%), Gaps = 26/302 (9%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DG++R+FFEGW+++V++P  R++F +MYS+++P   KP            +
Sbjct  4     QTPHSGYHWDGSQRRFFEGWYYRVTLPADRETFAFMYSIDDPWGQKP------------Y  51

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G   QILGA+++Y+C+  P  + FW ++ EL+LG+    +T  + P   + P  F S V
Sbjct  52    SGGAVQILGANEEYLCRSFPNVQQFWAKKDELALGH--WGKTQLQTPATYLEPSTFESVV  109

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
               G+Q T   +QG I + G   Y       RW Y  +PIYGWGN GS Q+STAGWL++  
Sbjct  110   KSGYQATANLNQGVIHNPGTGQYC------RWCYDIQPIYGWGNKGSWQQSTAGWLSSLQ  163

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA G+++GWI+W+G+ YEFE AP+Y+EKNWG  FP KWFW+ CN FE  + 
Sbjct  164   IFEPGWQILMAHGVASGWIDWNGKLYEFEYAPAYAEKNWGGAFPEKWFWINCNSFEN-EP  222

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             ++++T+  G R++         E+  ++ +H+ G FYEFVPWN  V WE++PWG W + A
Sbjct  223   DLAITAVAGKRKVLWW-----MESPGMVGIHHQGKFYEFVPWNSRVKWEVTPWGKWQMQA  277

Query  833   EN  828
              N
Sbjct  278   TN  279


 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            V+L   T  PGT +R PT E GL   CRDT    L LQL  R +   K + +L   S++ 
Sbjct  284  VDLMGTTDLPGTWVRVPT-EKGLVFSCRDTTKGLLSLQL--REFSAGKSQIVLTAHSSLC  340

Query  594  GVEVGGGPWFNTWK  553
            G+E+GG  W NTW+
Sbjct  341  GLEIGGNYWKNTWQ  354



>ref|WP_009343547.1| hypothetical protein [Raphidiopsis brookii]
 gb|EFA73009.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=365

 Score =   273 bits (698),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 193/309 (62%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DGT R+FFEGW+ +V++PE  Q+F +MYS+E+P   +P SG          
Sbjct  13    QTPHSGYHWDGTSRRFFEGWYNRVTLPEIGQTFAFMYSIEDPICNQPHSG----------  62

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
                 AQ+LG DD Y+ +  P+ K FW   H L+LG+    +T  +   + + P +F + +
Sbjct  63    --GAAQVLGPDDGYLLRTFPDVKGFWASPHVLALGH--WGKTNLQITPQYLTPDKFTTHI  118

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              +G+Q T   +QG I + G  +Y       RW+Y  +PIYGWG     Q+STAGWL+   
Sbjct  119   QQGYQTTATLNQGIITNPGTGNYC------RWQYEIKPIYGWGQPKCPQQSTAGWLSFLQ  172

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL++G+I+W+G+ Y+F NAP+Y EKNWG  FP+KWFW+ CN F+  + 
Sbjct  173   IFEPGWQILMAHGLASGYIDWNGKIYQFTNAPAYGEKNWGGAFPQKWFWINCNFFD-QET  231

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R     G     E+  ++ +HY G FYEFVPWN  V W+I PWG W + A
Sbjct  232   DLALTAGGGKR-----GVLWWMESVGMVGIHYQGHFYEFVPWNSQVMWQIEPWGSWQMQA  286

Query  833   ENATHKSQV  807
              N  ++  V
Sbjct  287   RNCEYEVTV  295


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 51/95 (54%), Gaps = 17/95 (18%)
 Frame = -3

Query  837  CRECDTQVTSGSITEIIICEQVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQL  658
             R C+ +VT   IT++              PGT LRAPT + GLA  CRDT    + L+L
Sbjct  286  ARNCEYEVTVTGITDL--------------PGTLLRAPTNQ-GLAICCRDTMQGKVSLEL  330

Query  657  WERRYDGSKGKAILDVTSNMAGVEVGGGPWFNTWK  553
              RR   +    I+  +S++ G+EVGGG W N+W+
Sbjct  331  --RRLHQNHSTVIVKASSDVCGLEVGGGSWENSWQ  363



>ref|WP_015141968.1| hypothetical protein [Pleurocapsa minor]
 ref|YP_007079217.1| hypothetical protein Ple7327_0186 [Pleurocapsa sp. PCC 7327]
 gb|AFY75660.1| hypothetical protein Ple7327_0186 [Pleurocapsa sp. PCC 7327]
Length=354

 Score =   272 bits (696),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 190/303 (63%), Gaps = 26/303 (9%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L+TPHSGYH+DG   +FFEGW+++V++PE  QSF +MYS+++P   KP SG         
Sbjct  5     LQTPHSGYHWDGNGDRFFEGWYYRVTLPEWGQSFGFMYSIDDPIGGKPHSG---------  55

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
                  AQILGA D+Y+ +  P+ ++FWG R  L LG+    +T  +   + + P  F   
Sbjct  56    ---GAAQILGAGDRYLWRTFPDVRSFWGARDYLGLGHA--RRTNGKHSCQRLAPASFERE  110

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + EG+Q T   +QG+I+D G   Y       RW Y  +PIYGWGN    Q++T G ++  
Sbjct  111   MHEGYQATATLNQGYIQDPGSQFYC------RWHYEIQPIYGWGNPNLPQQATGGLMSYL  164

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             P+FEP WQ+ MA GL+TGWI+W+G+RY F NAP+YSEKNWG  FP+KWFW+ CN F    
Sbjct  165   PIFEPGWQILMAHGLATGWIDWNGDRYNFTNAPAYSEKNWGRSFPQKWFWINCNSFI-CH  223

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG R++         E+  LI +HY G FYEFVPWN  V+W + PWG W + 
Sbjct  224   PDLALTAGGGRRKVLWW-----MESVGLICLHYQGKFYEFVPWNSQVSWRVQPWGRWEMQ  278

Query  836   AEN  828
             A N
Sbjct  279   ARN  281



>ref|WP_012162904.1| tocopherol cyclase [Acaryochloris marina]
 ref|YP_001516752.1| tocopherol cyclase [Acaryochloris marina MBIC11017]
 gb|ABW27438.1| tocopherol cyclase, putative [Acaryochloris marina MBIC11017]
Length=390

 Score =   273 bits (699),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 194/313 (62%), Gaps = 27/313 (9%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L TPHSGYH+DG++R+FFEGW+++V++PE  Q+F +MYS+E+P   +P            
Sbjct  15    LITPHSGYHWDGSQRRFFEGWYYRVTLPELDQTFAFMYSIEDPIGGQP------------  62

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPN---KEVPPQEF  1386
             ++G  AQILG +D Y C+   + + FW       +G   +   +   P+   + + P EF
Sbjct  63    YSGGAAQILGPEDTYFCRTFADVRQFWSWGAPAGMGPLGLGHWSRGIPSLKPQLLAPDEF  122

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
             + ++ +G+Q T  WHQG +RD G      T +TA W Y  +PIY WG VG   +STAG L
Sbjct  123   DRQINQGYQGTHTWHQGHLRDPG------TGQTAHWAYRIQPIYAWGEVGKTPRSTAGLL  176

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             +  P+FEP WQV MA G +TGW++W G+R+ FENAP+Y+EKNWG  FP+KWFW+ CN FE
Sbjct  177   SFLPIFEPGWQVMMAHGWATGWVDWQGQRFVFENAPAYAEKNWGGAFPQKWFWINCNCFE  236

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
                 +++LT+  G R     G     E+  LI +H+ G FYEF PWN  V+W ++PWG W
Sbjct  237   NQP-DLALTAAAGRR-----GVLWWMESVGLIGIHHRGQFYEFAPWNSEVSWSVTPWGEW  290

Query  845   YITAENATHKSQV  807
              +TA N+ +  ++
Sbjct  291   TMTARNSEYAVEI  303


 Score = 57.0 bits (136),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 11/92 (12%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+ A     GT LRAPTQ  GL  +C+DT +  + L L  +RY       +L   S++ 
Sbjct  301  VEIWASCDRNGTPLRAPTQN-GLIFICKDTMHGRVTLTL--KRYHQQGTTLLLKAHSHLC  357

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVD  499
            G+EVGGGPW   W        I ++A++ P+D
Sbjct  358  GLEVGGGPWQTAW--------IAEEAMSPPLD  381



>ref|WP_015227537.1| tocopherol cyclase [Halothece sp. PCC 7418]
 ref|YP_007169879.1| tocopherol cyclase [Halothece sp. PCC 7418]
 gb|AFZ45665.1| tocopherol cyclase [Halothece sp. PCC 7418]
Length=360

 Score =   272 bits (696),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/309 (45%), Positives = 191/309 (62%), Gaps = 26/309 (8%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+ G   +FFEGW+++V++PE  Q+F +MYS+++PA             G  +
Sbjct  11    QTPHSGYHWAGEETRFFEGWYYRVTLPEINQTFAFMYSIDDPAG------------GMSY  58

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G  AQILG DD+Y  +  P  K FW +   L LG+       + P  +E+ P +FN ++
Sbjct  59    SGGAAQILGPDDEYFWRTFPNVKGFWADYTRLGLGHWGKRPLGSFP--RELTPHQFNQQI  116

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG + D        T + A WEY  +PIYGWG+    QK+TAGWL+  P
Sbjct  117   KEGYQATATLNQGKLYD------PATGEAAIWEYQIKPIYGWGDSHRPQKATAGWLSFLP  170

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +FEP WQ+ MA GL+TG+I+W G+ Y+F NAP+YSEKNWG  FP KWFW+ CN F   + 
Sbjct  171   LFEPGWQILMAQGLATGYIQWQGKTYKFTNAPAYSEKNWGRAFPAKWFWLNCNAFS-EET  229

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG R++ G G     E  ALI  H+ G FYEFVPWN  V WEI PWG W + A
Sbjct  230   DLALTAGGGRREVLGIG-----EEVALICFHHQGKFYEFVPWNSDVFWEIQPWGEWKMRA  284

Query  833   ENATHKSQV  807
               A    ++
Sbjct  285   VGAELAVEI  293


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 41/73 (56%), Gaps = 6/73 (8%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+  +T   GT LRAPT E GL   CRDT   DL L+L +RR     G  I   +S   
Sbjct  291  VEIVGKTDKQGTLLRAPT-EQGLQFCCRDTMQGDLHLKLLDRR-----GNLICQASSTNC  344

Query  594  GVEVGGGPWFNTW  556
            G+EVGG PW + W
Sbjct  345  GLEVGGIPWSSPW  357



>ref|WP_006616677.1| tocopherol cyclase [Arthrospira platensis]
 ref|YP_005068835.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI90297.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR56569.1| tocopherol cyclase [Arthrospira platensis str. Paraca]
Length=354

 Score =   268 bits (685),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 192/312 (62%), Gaps = 32/312 (10%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L TPH+GYH++G  R+FFEGW+++V++PE RQ+F +MYS+E+P+  +P SG         
Sbjct  12    LSTPHNGYHWEGGDRRFFEGWYYRVTLPEPRQTFAFMYSIEDPSGGQPHSG---------  62

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
                  AQILG DD+Y+C+  P+   FW     L+LG+     T  +     +  Q F+  
Sbjct  63    ---GAAQILGPDDQYLCRTFPDVNKFWASTDTLALGH--WGDTDLKSAPGYLDSQLFDRH  117

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + +G+Q T   HQG ++D  R           WEY+  P+YGWG    KQ+STAGWL+  
Sbjct  118   IHQGYQGTDTHHQGSLKDGTRN--------CSWEYTITPVYGWG----KQQSTAGWLSFL  165

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             P+FEP WQ+ MA G +TG I+W+G  Y+F NAP+Y EKNWG  FPRKWFWV CN F+   
Sbjct  166   PIFEPGWQILMAHGWATGSIDWNGTLYQFTNAPAYGEKNWGGAFPRKWFWVNCNCFDHIP  225

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG R +         E+ A++ +HY G FYEFVPWN  V W+I+PWG W+I 
Sbjct  226   -DLALTAGGGKRSVLW-----WIESVAMVGIHYRGQFYEFVPWNAQVHWQIAPWGDWHIQ  279

Query  836   AENATHKSQVEV  801
             A+N   +  ++ 
Sbjct  280   ADNGQFQVSLQA  291


 Score = 61.6 bits (148),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 7/74 (9%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            QV L+A T+ PGT LRAPT   GL   CRDT   ++ LQL ++R      + IL+  S++
Sbjct  286  QVSLQATTTYPGTPLRAPTHH-GLQFCCRDTMKGEVTLQLRQQR------RLILEAHSSL  338

Query  597  AGVEVGGGPWFNTW  556
             G+E GGGPW  TW
Sbjct  339  CGLETGGGPWDETW  352



>gb|KFM23407.1| Tocopherol cyclase, chloroplastic [Auxenochlorella protothecoides]
Length=393

 Score =   248 bits (634),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 177/302 (59%), Gaps = 43/302 (14%)
 Frame = -1

Query  1694  RQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDK  1515
             R+FFEGW++++++P   QSF  +YSVE+P   +P SG            VGAQI+G +D 
Sbjct  23    RRFFEGWYWRLTLPGRGQSFAVIYSVEDPGSQRPTSG------------VGAQIMGPNDS  70

Query  1514  YICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQG  1335
             Y+ QY   +  FW + HEL+LG   ++                     EGFQV    HQG
Sbjct  71    YLLQYEEGTAGFWADPHELALGKALVS---------------------EGFQVQGGRHQG  109

Query  1334  FI--RDDGRT-DYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCM  1164
              I  R+ G     A +V +ARW++   P  GWG+ G +Q STAGWLAA P+FEPHWQV M
Sbjct  110   RIVSREAGVVPGPAPSVASARWDFQVTPRLGWGSPGQRQLSTAGWLAAVPIFEPHWQVLM  169

Query  1163  AAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGE--VSLTSGG  990
             A G ++GWIEW GERY F+  P+Y+EKNWG GFP +W WVQCN F+G  G    ++ +  
Sbjct  170   AHGSASGWIEWGGERYAFQGVPTYAEKNWGGGFPSRWCWVQCNSFDGHPGTSVTAVCARR  229

Query  989   GLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQ  810
             G+R +PG       E+  LI +H  G F+EFVP  G + WE+ PWG W I  ENA H + 
Sbjct  230   GVRLVPG-----LEEDVGLIGLHAAGDFHEFVPNKGDIGWEVEPWGTWRIHGENAEHTAL  284

Query  809   VE  804
             VE
Sbjct  285   VE  286


 Score = 80.9 bits (198),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 62/103 (60%), Gaps = 4/103 (4%)
 Frame = -3

Query  750  DPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTS--NMAGVEVGG  577
            + GT LRAPT ++GLAP CRD+    +R+++W R  +G +   ++D  S      VEVGG
Sbjct  292  EAGTVLRAPTADLGLAPFCRDSFSGRVRVRMWRRGEEG-RAPPVVDCVSLEETGAVEVGG  350

Query  576  GPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVP-LFKPPGL  451
            GPW++ WK        +K  LN PVD+EG+ G +P   +P GL
Sbjct  351  GPWWSGWKARAAMAGGVKALLNLPVDVEGLTGWLPGGLRPKGL  393



>ref|WP_039778778.1| tocopherol cyclase, partial [Acaryochloris sp. CCMEE 5410]
Length=370

 Score =   272 bits (695),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/313 (42%), Positives = 192/313 (61%), Gaps = 27/313 (9%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L TPHSGYH+DG++R+FFEGW+++V++PE  Q+F +MYS+E+P   +P SG         
Sbjct  8     LITPHSGYHWDGSQRRFFEGWYYRVTLPELDQTFAFMYSIEDPIGGQPHSG---------  58

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKE---VPPQEF  1386
                  AQILG +D Y C+   + + FW       +G   +   +   P  +   + P EF
Sbjct  59    ---GAAQILGPEDTYFCRTFADVRQFWSWGAPAGMGPLGLGHWSCGIPGLQPQWLAPDEF  115

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
             + ++++G+Q T  WHQG ++D G      T +TA W Y  +PIY WG  G  Q++TAG L
Sbjct  116   DRQIIQGYQGTHTWHQGHLQDPG------TGQTAHWAYRIQPIYAWGEAGKTQRATAGLL  169

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             +  P+FEP WQV MA G +TGW++W G+R+ FENAP+Y+EKNWG  FP+KWFW+ CN FE
Sbjct  170   SFLPIFEPGWQVMMAHGWATGWVDWQGQRFVFENAPAYAEKNWGGAFPQKWFWINCNCFE  229

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
                  ++LT+  G R     G     E+  LI +H+ G FYEF PWN  ++W ++PWG W
Sbjct  230   NQP-NLALTAAAGRR-----GVLWWMESVGLIGIHHQGQFYEFAPWNSEISWSVTPWGEW  283

Query  845   YITAENATHKSQV  807
              +TA N+ +  ++
Sbjct  284   TMTARNSEYAVEI  296


 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+ A     GT LRAPTQ  GL  +C+DT +  + L L  +RY       +L   S++ 
Sbjct  294  VEIWASCDRNGTPLRAPTQN-GLIFICKDTMHGCVTLTL--KRYHQQGTTLLLKAHSHLC  350

Query  594  GVEVGGGPWFNTW  556
            G+EVGGGPW   W
Sbjct  351  GLEVGGGPWQTAW  363



>ref|WP_010468944.1| tocopherol cyclase [Acaryochloris sp. CCMEE 5410]
Length=402

 Score =   272 bits (696),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 131/313 (42%), Positives = 192/313 (61%), Gaps = 27/313 (9%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L TPHSGYH+DG++R+FFEGW+++V++PE  Q+F +MYS+E+P   +P SG         
Sbjct  27    LITPHSGYHWDGSQRRFFEGWYYRVTLPELDQTFAFMYSIEDPIGGQPHSG---------  77

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKE---VPPQEF  1386
                  AQILG +D Y C+   + + FW       +G   +   +   P  +   + P EF
Sbjct  78    ---GAAQILGPEDTYFCRTFADVRQFWSWGAPAGMGPLGLGHWSCGIPGLQPQWLAPDEF  134

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
             + ++++G+Q T  WHQG ++D G      T +TA W Y  +PIY WG  G  Q++TAG L
Sbjct  135   DRQIIQGYQGTHTWHQGHLQDPG------TGQTAHWAYRIQPIYAWGEAGKTQRATAGLL  188

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             +  P+FEP WQV MA G +TGW++W G+R+ FENAP+Y+EKNWG  FP+KWFW+ CN FE
Sbjct  189   SFLPIFEPGWQVMMAHGWATGWVDWQGQRFVFENAPAYAEKNWGGAFPQKWFWINCNCFE  248

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
                  ++LT+  G R     G     E+  LI +H+ G FYEF PWN  ++W ++PWG W
Sbjct  249   NQP-NLALTAAAGRR-----GVLWWMESVGLIGIHHQGQFYEFAPWNSEISWSVTPWGEW  302

Query  845   YITAENATHKSQV  807
              +TA N+ +  ++
Sbjct  303   TMTARNSEYAVEI  315


 Score = 55.8 bits (133),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 11/92 (12%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            VE+ A     GT LRAPTQ  GL  +C+DT +  + L L  +RY       +L   S++ 
Sbjct  313  VEIWASCDRNGTPLRAPTQN-GLIFICKDTMHGCVTLTL--KRYHQQGTTLLLKAHSHLC  369

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVD  499
            G+EVGGGPW   W        I ++A++ P+D
Sbjct  370  GLEVGGGPWQTAW--------IAEEAMSQPLD  393



>ref|WP_013192134.1| hypothetical protein [Trichormus azollae]
 ref|YP_003722243.1| hypothetical protein Aazo_3505 ['Nostoc azollae' 0708]
 gb|ADI65120.1| conserved hypothetical protein ['Nostoc azollae' 0708]
Length=365

 Score =   270 bits (691),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 195/309 (63%), Gaps = 26/309 (8%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             ++TPHSGYH+DG+ R+FFEGW+++V++P+  Q+F +MYS+++P   KP            
Sbjct  12    IQTPHSGYHWDGSSRRFFEGWYYRVTLPDIGQTFAFMYSIQDPIGGKP------------  59

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
             ++G  AQ+LG +D+Y+C+  P+   FW  R  L+LG+    +T  +     + P EF   
Sbjct  60    YSGGAAQVLGPEDEYLCRTFPDVNKFWASRDMLALGHW--GKTNLQVTPFYLLPSEFEHH  117

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + +G+Q T   +QG I D    +Y       RW+Y  +PIYGWGN  S Q+STAG L+  
Sbjct  118   IQQGYQATDTLNQGIISDPATGNYC------RWQYEIKPIYGWGNQNSIQQSTAGCLSFL  171

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
              +FEP WQ+ MA GL++G+I+W+G+ YEF N P+Y EKNWG  FP+KWFW+ CN F+   
Sbjct  172   QIFEPGWQILMAHGLASGFIDWNGKIYEFINVPAYGEKNWGGAFPQKWFWLNCNYFDDTP  231

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V W+I  WG W + 
Sbjct  232   -DLALTAGGGKR-----GVLWWMESVAMIGIHYQGKFYEFVPWNSQVNWDIQSWGRWQMQ  285

Query  836   AENATHKSQ  810
             A+N+ ++ +
Sbjct  286   AKNSNYEVE  294


 Score = 57.0 bits (136),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 43/77 (56%), Gaps = 3/77 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VE    T+  GT LRAPT + G    CRDT    L L+L  R   GSK K +L   SN+
Sbjct  292  EVEFRGITNLSGTLLRAPTNQ-GFTFCCRDTMEGKLDLEL--RELTGSKSKILLKTQSNL  348

Query  597  AGVEVGGGPWFNTWKGT  547
             G+E+GG  W N W+ +
Sbjct  349  CGLEIGGDGWENIWQSS  365



>ref|WP_016871339.1| tocopherol cyclase [Fischerella thermalis]
Length=415

 Score =   267 bits (683),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/357 (39%), Positives = 199/357 (56%), Gaps = 72/357 (20%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+D + R+FFEGW+++V++P+  QSF +MYS+E+P              G+  
Sbjct  13    QTPHSGYHWDHSSRRFFEGWYYRVTLPDEDQSFAFMYSIEDPIG------------GKSH  60

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGN------------------------  1446
             +G  AQILG +D+Y+C+  PE KNFW +   L+LG+                        
Sbjct  61    SGGAAQILGPNDEYLCRTFPEVKNFWAKPDVLALGHWGQTNLEGRGQRESEVPMKNLTPS  120

Query  1445  ------------------------TFIAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQ  1338
                                       ++QT        + P+EF   + +G+Q T   +Q
Sbjct  121   PSPCQGEGEVTFYSKGRREESFFHKLLSQTVPDTQPCYLEPEEFERYIQQGYQATATLNQ  180

Query  1337  GFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAA  1158
             G I D   + Y       RW+Y  +P+YGWGN  S Q+STAGWL+   +FEP WQ+ MA 
Sbjct  181   GIISDPSTSQYC------RWQYEIQPVYGWGNQRSIQQSTAGWLSFLQIFEPGWQILMAH  234

Query  1157  GLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQ  978
             GL++GWI+W+G+RYEF NAP+Y EKNWG  FP+KWFW  CN F     +++LT+GGG R 
Sbjct  235   GLASGWIDWNGKRYEFTNAPAYGEKNWGGAFPQKWFWANCNSFSDTP-DLALTAGGGRR-  292

Query  977   IPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQV  807
                 G     E+ A+I +HY G FYEFVPWN  V+W I PWG W + A+N+ ++ ++
Sbjct  293   ----GVLWWMESVAMIGIHYQGKFYEFVPWNSQVSWNIQPWGKWQMQAQNSHYEVEL  345


 Score = 59.7 bits (143),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT E GL   CRDT    L ++L E++   ++ + IL   S+ 
Sbjct  342  EVELTGTTDLPGTLLRAPT-ENGLIFCCRDTLQGQLNIELREKK--NNQQEIILKAHSSA  398

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GGGPW N W+
Sbjct  399  CGLEIGGGPWNNAWQ  413



>ref|WP_015194825.1| tocopherol cyclase [Stanieria cyanosphaera]
 ref|YP_007134130.1| tocopherol cyclase [Stanieria cyanosphaera PCC 7437]
 gb|AFZ37164.1| tocopherol cyclase [Stanieria cyanosphaera PCC 7437]
Length=374

 Score =   269 bits (687),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 141/315 (45%), Positives = 192/315 (61%), Gaps = 33/315 (10%)
 Frame = -1

Query  1754  TPSNRPLRTPHSGYHFDGTR------RQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKP  1593
             T    PL TPHSGYH+          + FFEGW+F+V+IPE  Q+F +MYS+E+P+  + 
Sbjct  11    TNYGSPLPTPHSGYHWQKANNCLFKSQGFFEGWYFRVTIPEIAQTFAFMYSIEDPSGEQA  70

Query  1592  LSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPP  1413
              SG              AQILG D++YIC+  P  K FW  +  L LG+      A  P 
Sbjct  71    NSG------------GAAQILGIDEEYICRTFPNLKKFWAVKDYLGLGHWGKTTKAITP-  117

Query  1412  NKEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGS  1233
              + +   +F + + +G+QVT   +QG+I D G        K+ RW Y T+PIY WGN  +
Sbjct  118   -QLISADQFEACIKQGYQVTTTLNQGYICDPGSN------KSCRWLYQTKPIYSWGNPFN  170

Query  1232  KQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKW  1053
              Q +TAGWL+  P+FEP WQ+ MA GL+TGWIEW G+ Y+F +AP+YSEKNWG  FP+KW
Sbjct  171   PQ-ATAGWLSYLPIFEPGWQILMAHGLATGWIEWQGKVYQFTDAPAYSEKNWGRSFPQKW  229

Query  1052  FWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVT  873
             FW+ CN F    G ++LT+GGG+R++ G       E  A+I +HY G FYEFVPWN  ++
Sbjct  230   FWINCNSFNNQSG-LALTAGGGVRKVLGWQ-----EEVAMIGIHYQGEFYEFVPWNAQIS  283

Query  872   WEISPWGHWYITAEN  828
             W+I PWG W + A N
Sbjct  284   WQIEPWGTWQMQAVN  298


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V L  +T  PGT +R PT + GL   CRDT   +L + L +R+     GK I+  ++ +
Sbjct  302  EVTLVGKTDLPGTYVRTPTAK-GLVFNCRDTTRGELNVNLRQRQ-----GKTIVKASTEV  355

Query  597  AGVEVGGGPWFNTWKGTT  544
            AG+EVGG PW   WK  T
Sbjct  356  AGLEVGGFPWNQAWKVVT  373



>ref|WP_017286424.1| hypothetical protein [Leptolyngbya boryana]
Length=353

 Score =   266 bits (680),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/315 (43%), Positives = 195/315 (62%), Gaps = 38/315 (12%)
 Frame = -1

Query  1748  SNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQ  1569
             ++ PL TPHSGYH+DG+ R+FFEGW+++V++PE  Q+F +MYS+E+P   +P SG     
Sbjct  4     NSSPLPTPHSGYHWDGSSRRFFEGWYYRVTLPEIGQTFAFMYSIEDPQGGQPTSG-----  58

Query  1568  YGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQE  1389
                   G+ AQILG DD+++ +      +FW  +  L+LG+       AR P   + P +
Sbjct  59    ------GM-AQILGIDDEHLWRTFSNPHDFWAAKDCLALGH-------ARQPTGLLAPDQ  104

Query  1388  FNSRVLEGFQVTPLWHQGFIRD-DGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAG  1212
             F+  + EG+Q T  WHQG ++  DG        K A W+YS  PIYGWG+    ++STA 
Sbjct  105   FDRTISEGYQATNTWHQGRLKSPDG--------KFAEWQYSISPIYGWGD----RQSTAS  152

Query  1211  WLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNV  1032
             WL++  +FEP WQ+ MA G +TGWI W+G+ Y+F NAP+Y EKNWG  FP KWFW+ CN 
Sbjct  153   WLSSLQIFEPGWQILMAHGYATGWINWNGKDYKFVNAPAYGEKNWGGAFPSKWFWLNCNA  212

Query  1031  FEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWG  852
             F+  + +++LT+GGG R     G     E+ A++ +HY G FYEF PWN  V W I PWG
Sbjct  213   FDN-ELDLALTAGGGRR-----GVLWWMESVAMVGIHYRGQFYEFAPWNAEVNWVIRPWG  266

Query  851   HWYITAENATHKSQV  807
             +W + A    ++  V
Sbjct  267   YWRMDARTRDYRVTV  281


 Score = 57.0 bits (136),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 6/74 (8%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +V + A T  PGT LRAPT + G+  VCRDT    + + LW++       + IL+ TS++
Sbjct  278  RVTVIATTDLPGTPLRAPTID-GMQFVCRDTMRGQVTISLWDK-----SDRLILEATSSL  331

Query  597  AGVEVGGGPWFNTW  556
            AG+E GG PW  TW
Sbjct  332  AGLETGGSPWDETW  345



>ref|WP_006527820.1| hypothetical protein [Gloeocapsa sp. PCC 73106]
 gb|ELR99352.1| hypothetical protein GLO73106DRAFT_00032020 [Gloeocapsa sp. PCC 
73106]
Length=355

 Score =   265 bits (677),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 192/313 (61%), Gaps = 32/313 (10%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L TPHSGYH+ G R +FFEGW+++V++PE  ++F +MYS+E+P   KP            
Sbjct  5     LATPHSGYHWQGDRDRFFEGWYYRVTLPEIEETFAFMYSIEDPTGDKP------------  52

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
             ++G  AQILG  D+Y+C+  P  K FW ++ +L+LG+    +    P    + P+ F+  
Sbjct  53    YSGGAAQILGPLDEYLCRSFPNVKGFWAKQTKLALGHWGNTKLNISP--GLLDPELFSKY  110

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + +G+Q T  ++QG I D    +Y       RW Y   P YGWG+    Q ST G L+  
Sbjct  111   IHQGYQATADFNQGAIEDPATGNYC------RWYYQIEPRYGWGDPKRSQLSTGGVLSYL  164

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             P+FEP WQV MA GL+TGW++W+G+ YEF  AP+Y EKNWG  FP+KWFW+ CN F  A 
Sbjct  165   PIFEPGWQVLMAHGLATGWVDWNGKIYEFNRAPAYGEKNWGKAFPQKWFWLNCNHFSNAS  224

Query  1016  GEVSLTSGGGLRQI---PGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
              +++LT+GGG R++   P        E+ A+I +H+ G FYEFVPWN  +TWEI PWG W
Sbjct  225   -DLALTAGGGKREVLWWP--------ESVAMIGLHHQGNFYEFVPWNAKITWEIEPWGRW  275

Query  845   YITAENATHKSQV  807
              +  EN+ +  ++
Sbjct  276   QMQGENSKYLIEI  288



>ref|WP_009455785.1| tocopherol cyclase [Fischerella sp. JSC-11]
 gb|EHC15912.1| tocopherol cyclase [Fischerella sp. JSC-11]
Length=421

 Score =   261 bits (667),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 140/363 (39%), Positives = 198/363 (55%), Gaps = 78/363 (21%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+D + R+FFEGW+++V++P+  QSF +MYS+E+P              G+  
Sbjct  13    QTPHSGYHWDHSSRRFFEGWYYRVTLPDEDQSFAFMYSIEDPIG------------GKSH  60

Query  1553  TGVGAQILGADDKYICQYTPESKNF-----------WGE---------------------  1470
             +G  AQILG +D+Y+C+  PE KNF           WG+                     
Sbjct  61    SGGAAQILGPNDEYLCRTFPEVKNFWAKPDVLALGHWGQTNLEGRGQRESEVPMKNLTPS  120

Query  1469  ----------------------RHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGFQV  1356
                                   R E S  +  ++QT        + P+EF   + +G+Q 
Sbjct  121   PSPCQGEGCPIGRGEVTFNSKSRREESFFHKLLSQTLPDTQPCYLEPEEFERYIQQGYQA  180

Query  1355  TPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHW  1176
             T   +QG I D   + Y       RW+Y  +P+YGWGN  S Q+STAGWL+   +FEP W
Sbjct  181   TATLNQGIISDPSTSQYC------RWQYEIQPVYGWGNQRSIQQSTAGWLSFLQIFEPGW  234

Query  1175  QVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTS  996
             Q+ MA GL+ GWI+W+G+RYEF NAP+Y EKNWG  FP+KWFW  CN F     +++LT+
Sbjct  235   QILMAHGLARGWIDWNGKRYEFTNAPAYGEKNWGGAFPQKWFWANCNSFSDTP-DLALTA  293

Query  995   GGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHK  816
             GGG R     G     E+ A+I +HY G FYEFVPWN  V+W I PWG W + A+N+ ++
Sbjct  294   GGGRR-----GVLWWMESVAMIGIHYQGKFYEFVPWNSQVSWNIQPWGKWQMQAQNSHYE  348

Query  815   SQV  807
              ++
Sbjct  349   VEL  351


 Score = 59.7 bits (143),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT E GL   CRDT    L ++L E++   ++ + IL   S+ 
Sbjct  348  EVELTGTTDLPGTLLRAPT-ENGLIFCCRDTLQGQLNIELREKK--NNQQEIILKAHSSA  404

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GGGPW N W+
Sbjct  405  CGLEIGGGPWNNAWQ  419



>ref|WP_019505141.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=364

 Score =   262 bits (670),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/301 (43%), Positives = 184/301 (61%), Gaps = 26/301 (9%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L+TPHSGYH++    ++FEGW+F++++P+  Q+F +MYS+ +P   +P SG         
Sbjct  13    LQTPHSGYHWNQINPRYFEGWYFRLTLPKINQTFAFMYSITDPLGNQPQSG---------  63

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
                   QILG D+ Y+C+  P+ + F+  +  LSLG+        +P  + + P EF++ 
Sbjct  64    ---GAVQILGIDETYLCRIFPDVQKFFAAKDNLSLGHWGKNNLKIKP--QLLAPAEFSNC  118

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + EG+Q T   +QG I D  R +Y       RWEY  +P+YGWGN    Q+STAGWL+  
Sbjct  119   ITEGYQTTNNLNQGSIYDPVRNEYC------RWEYQIKPVYGWGNSQQLQQSTAGWLSYL  172

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             P+FEP WQ+ +A GL+TGWIEW G  Y F +AP+YSEKNWG  FP+KWFW+ CN F    
Sbjct  173   PIFEPGWQITLAHGLATGWIEWKGTLYRFTDAPAYSEKNWGSSFPQKWFWMNCNSFI-EQ  231

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+GGG+RQ+         E   L+ +H+ G FYEF PWN  V+W I  WG W + 
Sbjct  232   SDLALTAGGGIRQVLWWQ-----EEVGLVGIHHQGKFYEFAPWNSEVSWNIESWGQWQMQ  286

Query  836   A  834
             A
Sbjct  287   A  287


 Score = 57.0 bits (136),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 42/73 (58%), Gaps = 6/73 (8%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            V L  +T  PGT +R PT + GL   CRDT    L L+L   RY    G+ I+  TSN+A
Sbjct  294  VTLTGKTDLPGTYVRTPTAQ-GLVFNCRDTTKGKLNLEL---RY--RSGELIVKATSNLA  347

Query  594  GVEVGGGPWFNTW  556
            G+EVGG PW   W
Sbjct  348  GLEVGGAPWDEAW  360



>ref|WP_016868113.1| tocopherol cyclase [Fischerella muscicola]
Length=425

 Score =   259 bits (663),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 200/367 (54%), Gaps = 82/367 (22%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+D + R+FFEGW+++V++P+  QSF +MYS+E+P   KP SG          
Sbjct  13    QTPHSGYHWDHSSRRFFEGWYYRVTLPDEDQSFAFMYSIEDPIGGKPHSG----------  62

Query  1553  TGVGAQILGADDKYICQYTPESKNF-----------WGE---------------------  1470
                 AQILG +D+Y+C+  PE KNF           WG+                     
Sbjct  63    --GAAQILGPNDEYLCRTFPEVKNFWAKPDVLALGHWGQINLEGRGHDVNWHKPPYARRG  120

Query  1469  -----------------RHELSL---------GNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                              R E SL          + ++ QTA       + P+EF   + +
Sbjct  121   VEEAVFAKLRANKECCGRREESLFHKLFSPFQPDNYVHQTAPDTQPCYLEPEEFERYIQQ  180

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T   +QG I D     Y       RW+Y  +P+YGWGN  S Q+STAGWL+   +F
Sbjct  181   GYQATATLNQGVISDPSTGQYC------RWQYEIQPVYGWGNQRSIQQSTAGWLSFLQIF  234

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             EP WQ+ MA GL++GWI+W+G+RYEF NAP+Y EKNWG  FP+KWFW  CN F     ++
Sbjct  235   EPGWQILMAHGLASGWIDWNGKRYEFTNAPAYGEKNWGGAFPQKWFWANCNSFSDTP-DL  293

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+GGG R     G     E+ A+I +HY G FYEFVPWN  V+W I PWG W + A+N
Sbjct  294   ALTAGGGRR-----GVLWWMESVAMIGIHYQGKFYEFVPWNSQVSWNIQPWGKWQMQAQN  348

Query  827   ATHKSQV  807
             + ++ ++
Sbjct  349   SHYEVEL  355


 Score = 57.0 bits (136),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VEL   T  PGT LRAPT E GL   CRDT    L ++L E++   +  + IL   S+ 
Sbjct  352  EVELTGTTDLPGTPLRAPT-ENGLIFCCRDTLQGQLNIELREKK--DNHQEIILKAHSSA  408

Query  597  AGVEVGGGPWFNTWK  553
             G+E+GGGPW + W+
Sbjct  409  CGLEIGGGPWNDAWQ  423



>ref|WP_008274753.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ92244.1| hypothetical protein CY0110_25076 [Cyanothece sp. CCY0110]
Length=370

 Score =   256 bits (653),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/316 (40%), Positives = 193/316 (61%), Gaps = 26/316 (8%)
 Frame = -1

Query  1751  PSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEV  1572
             P+++  +TPHS YH+DG+ ++FFEGW+++V++P+  QSF +MYS+++P   K        
Sbjct  14    PNDQLWKTPHSSYHWDGSSQRFFEGWYYRVTLPQLGQSFAFMYSIDDPIGEK--------  65

Query  1571  QYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQ  1392
                  ++G  AQ+LG ++ Y+ +  P+ K FW  + EL+L +        +P  + + P 
Sbjct  66    ----YYSGGAAQVLGENNNYLYRIFPDVKRFWASQKELALCHWKQDILTQKP--QILDPI  119

Query  1391  EFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAG  1212
              F + V EG+Q T   +QG+I D    +Y       RW Y  +PI GWGN  S Q++TAG
Sbjct  120   IFEATVTEGYQATATLNQGYIEDPMTKNYC------RWYYDIKPIDGWGNRFSPQEATAG  173

Query  1211  WLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNV  1032
             WL+  P+F+P WQV MA G +TG+I+W+G++YEF   P+YSEKNWG  FP KWFW+ CN 
Sbjct  174   WLSFLPIFDPGWQVLMAHGWATGYIDWNGKKYEFNEVPAYSEKNWGHSFPSKWFWINCNS  233

Query  1031  FEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWG  852
             F+  + E+SLT+ GG+RQ+      +  E+  +I +HY G FYEF   N  ++W+I PWG
Sbjct  234   FQ-EESELSLTAAGGIRQV-----FNWQESVGIIGLHYQGKFYEFTRENSQLSWQIKPWG  287

Query  851   HWYITAENATHKSQVE  804
              W I   N     ++E
Sbjct  288   SWIIEGRNTEFSIKIE  303


 Score = 58.5 bits (140),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 6/73 (8%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            +++E +T D G  +R PT E GL  +CRDT   +L ++L+      ++GK IL  TS++ 
Sbjct  300  IKIEGKTDDIGNYVRVPTAE-GLKFLCRDTTQGNLVIELYN-----NEGKLILKATSSLG  353

Query  594  GVEVGGGPWFNTW  556
            G+E+GG PW   W
Sbjct  354  GLEIGGSPWVQDW  366



>ref|WP_036534715.1| tocopherol cyclase [Neosynechococcus sphagnicola]
 gb|KGF72131.1| tocopherol cyclase [Neosynechococcus sphagnicola sy1]
Length=358

 Score =   258 bits (659),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/314 (43%), Positives = 186/314 (59%), Gaps = 30/314 (10%)
 Frame = -1

Query  1736  LRTPHSGYHFDG--TRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYG  1563
             L+ PHSGYH  G    + +FEGW+F++++P    SF +MYS+EN A   P          
Sbjct  8     LQPPHSGYHDGGWLPHQPYFEGWYFRLTLPNQGASFAFMYSIENQAGAMP----------  57

Query  1562  RRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
                 G  AQILG    Y+C+  P+  NFW  RH L LG+   A+ A  P  + + P  F 
Sbjct  58    ----GGAAQILGPGHTYLCRTFPQIHNFWAWRHGLGLGHWGKAREAQVP--RYLKPAVFA  111

Query  1382  SRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLA  1203
              +VLEG+QVT   HQG + D G      +    RW+Y  +P+   G+ G   ++TAGWL+
Sbjct  112   QQVLEGYQVTAHGHQGQLADPG------SQAVVRWQYGVQPLDTCGDRGKLPQATAGWLS  165

Query  1202  AFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEG  1023
               P+FEP WQV MA G +TGWI+W G+RY F NAP+Y+EKNWG  FP+KWFW+ CN F  
Sbjct  166   LLPIFEPGWQVLMATGRATGWIDWYGQRYTFINAPAYAEKNWGGAFPQKWFWLHCNAFS-  224

Query  1022  ADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWY  843
                +++LT+GGG RQ+ G       E+  ++ +H+ G FYEF PWN  + W+I PWGHW 
Sbjct  225   QQPDLALTAGGGRRQVLG-----WHESVGMVGLHHQGRFYEFAPWNAQIHWQIQPWGHWR  279

Query  842   ITAENATHKSQVEV  801
             + AENA +   +E 
Sbjct  280   MQAENADYAIALEA  293


 Score = 54.7 bits (130),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            + LEA   +PGT +R PT + GL   CRDT    + L+L  R  D    + IL  TS++ 
Sbjct  289  IALEASCWEPGTWVRVPTAQ-GLQRWCRDTTQGHIHLKLRHRHTD----QLILAATSDLG  343

Query  594  GVEVGGGPWFNTWK  553
            G+EVGG PW   W+
Sbjct  344  GLEVGGAPWDTPWQ  357



>ref|WP_035823998.1| tocopherol cyclase [Crocosphaera watsonii]
Length=375

 Score =   254 bits (649),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/314 (40%), Positives = 194/314 (62%), Gaps = 26/314 (8%)
 Frame = -1

Query  1745  NRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
             N+P +TPHSGYH+DG+ R+FFEGW+++V++P+  QSF +MYS+++P   KP SG      
Sbjct  22    NKPWKTPHSGYHWDGSFRRFFEGWYYRVTLPQWGQSFAFMYSIDDPIGGKPHSG------  75

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEF  1386
                     AQ+LG +++Y+ +  P+ K FW    +L+L +        +P  + +    F
Sbjct  76    ------GAAQVLGENEEYLYRIFPDVKKFWASEQQLALCHWKKENLTLKP--QIIESTIF  127

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
                V EG+Q +   +QG+I D    +Y       RW Y  RP+ GWGN    Q++TAGWL
Sbjct  128   EEAVEEGYQASATLNQGYIEDPVTNNYC------RWCYDIRPVDGWGNRFYSQEATAGWL  181

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             +  P+F+P WQV MA G +TG+I+W+G++YEF N P+YSEKNWG  FP KWFW+ CN FE
Sbjct  182   SFLPIFDPGWQVLMAHGWATGYIDWNGKKYEFSNVPAYSEKNWGYSFPSKWFWINCNSFE  241

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
               + +++LT+ GG+RQ+      +  E+  +I +HY G FY+F   +  ++W+++PWG W
Sbjct  242   -QESDLALTAAGGIRQV-----FNWQESVGIIGLHYQGKFYKFFRDDSQLSWKVTPWGSW  295

Query  845   YITAENATHKSQVE  804
              +  +NA    ++E
Sbjct  296   IMQGKNADFLVKIE  309


 Score = 54.3 bits (129),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            V++E  T + GT +R PT E GL  +CRDT   +L L+L        +GK +L   S + 
Sbjct  306  VKIEGNTKESGTYVRVPTAE-GLQFLCRDTVKGNLTLEL-----ANHEGKILLKANSCLG  359

Query  594  GVEVGGGPWFNTW  556
            G+E+GG PW ++W
Sbjct  360  GLEIGGSPWDDSW  372



>ref|WP_007303288.1| hypothetical protein [Crocosphaera watsonii]
 gb|EAM52977.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
 emb|CCQ53308.1| 2-methyl-6-phytyl-1,4-benzoquinone cyclase [Crocosphaera watsonii 
WH 8502]
 emb|CCQ55099.1| 2-methyl-6-phytyl-1,4-benzoquinone cyclase [Crocosphaera watsonii 
WH 0005]
Length=366

 Score =   253 bits (647),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/314 (40%), Positives = 194/314 (62%), Gaps = 26/314 (8%)
 Frame = -1

Query  1745  NRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
             N+P +TPHSGYH+DG+ R+FFEGW+++V++P+  QSF +MYS+++P   KP SG      
Sbjct  13    NKPWKTPHSGYHWDGSFRRFFEGWYYRVTLPQWGQSFAFMYSIDDPIGGKPHSG------  66

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEF  1386
                     AQ+LG +++Y+ +  P+ K FW    +L+L +        +P  + +    F
Sbjct  67    ------GAAQVLGENEEYLYRIFPDVKKFWASEQQLALCHWKKENLTLKP--QIIESTIF  118

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
                V EG+Q +   +QG+I D    +Y       RW Y  RP+ GWGN    Q++TAGWL
Sbjct  119   EEAVEEGYQASATLNQGYIEDPVTNNYC------RWCYDIRPVDGWGNRFYSQEATAGWL  172

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             +  P+F+P WQV MA G +TG+I+W+G++YEF N P+YSEKNWG  FP KWFW+ CN FE
Sbjct  173   SFLPIFDPGWQVLMAHGWATGYIDWNGKKYEFSNVPAYSEKNWGYSFPSKWFWINCNSFE  232

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
               + +++LT+ GG+RQ+      +  E+  +I +HY G FY+F   +  ++W+++PWG W
Sbjct  233   -QESDLALTAAGGIRQV-----FNWQESVGIIGLHYQGKFYKFFRDDSQLSWKVTPWGSW  286

Query  845   YITAENATHKSQVE  804
              +  +NA    ++E
Sbjct  287   IMQGKNADFLVKIE  300


 Score = 54.7 bits (130),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            V++E  T + GT +R PT E GL  +CRDT   +L L+L        +GK +L   S + 
Sbjct  297  VKIEGNTKESGTYVRVPTAE-GLQFLCRDTVKGNLTLEL-----ANHEGKILLKANSCLG  350

Query  594  GVEVGGGPWFNTW  556
            G+E+GG PW ++W
Sbjct  351  GLEIGGSPWDDSW  363



>gb|EHJ15109.1| 2-methyl-6-phytyl-1,4-benzoquinone cyclase [Crocosphaera watsonii 
WH 0003]
 emb|CCQ65725.1| 2-methyl-6-phytyl-1,4-benzoquinone cyclase [Crocosphaera watsonii 
WH 0402]
Length=362

 Score =   253 bits (647),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/314 (40%), Positives = 194/314 (62%), Gaps = 26/314 (8%)
 Frame = -1

Query  1745  NRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
             N+P +TPHSGYH+DG+ R+FFEGW+++V++P+  QSF +MYS+++P   KP SG      
Sbjct  9     NKPWKTPHSGYHWDGSFRRFFEGWYYRVTLPQWGQSFAFMYSIDDPIGGKPHSG------  62

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEF  1386
                     AQ+LG +++Y+ +  P+ K FW    +L+L +        +P  + +    F
Sbjct  63    ------GAAQVLGENEEYLYRIFPDVKKFWASEQQLALCHWKKENLTLKP--QIIESTIF  114

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
                V EG+Q +   +QG+I D    +Y       RW Y  RP+ GWGN    Q++TAGWL
Sbjct  115   EEAVEEGYQASATLNQGYIEDPVTNNYC------RWCYDIRPVDGWGNRFYSQEATAGWL  168

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             +  P+F+P WQV MA G +TG+I+W+G++YEF N P+YSEKNWG  FP KWFW+ CN FE
Sbjct  169   SFLPIFDPGWQVLMAHGWATGYIDWNGKKYEFSNVPAYSEKNWGYSFPSKWFWINCNSFE  228

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
               + +++LT+ GG+RQ+      +  E+  +I +HY G FY+F   +  ++W+++PWG W
Sbjct  229   -QESDLALTAAGGIRQV-----FNWQESVGIIGLHYQGKFYKFFRDDSQLSWKVTPWGSW  282

Query  845   YITAENATHKSQVE  804
              +  +NA    ++E
Sbjct  283   IMQGKNADFLVKIE  296


 Score = 54.7 bits (130),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            V++E  T + GT +R PT E GL  +CRDT   +L L+L        +GK +L   S + 
Sbjct  293  VKIEGNTKESGTYVRVPTAE-GLQFLCRDTVKGNLTLEL-----ANHEGKILLKANSCLG  346

Query  594  GVEVGGGPWFNTW  556
            G+E+GG PW ++W
Sbjct  347  GLEIGGSPWDDSW  359



>ref|WP_012306299.1| hypothetical protein [Synechococcus sp. PCC 7002]
 ref|YP_001733931.1| hypothetical protein SYNPCC7002_A0670 [Synechococcus sp. PCC 
7002]
 gb|ACA98675.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
Length=350

 Score =   254 bits (649),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/298 (43%), Positives = 181/298 (61%), Gaps = 29/298 (10%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+D    +FFEGW+F+V++PE   +F +MYS+E+P   +P SG            
Sbjct  7     PHSGYHWDHHTPRFFEGWYFRVTLPELGDNFAFMYSIEDPLGDRPHSG------------  54

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                Q+LG  D+Y+ +  P  KNFW +   L+LG+        +P  + + P+ F  ++ E
Sbjct  55    GAVQVLGLQDEYLWRTLPNVKNFWADHQHLALGHWRHCPPHLKP--QFLAPRVFQDKIQE  112

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T   +QG I D G      T +  +W Y T+PIYGWG   +  K TA W +  P++
Sbjct  113   GYQATATLNQGRIIDPG------TGEICQWHYETKPIYGWG---TPAKPTANWYSFLPIY  163

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQV +A GLSTGWIEW G+RYEF +AP+YSEKNWG  FP+ WFW+ CN F+  + ++
Sbjct  164   DPGWQVLLAHGLSTGWIEWQGKRYEFRDAPAYSEKNWGKSFPKAWFWLNCNAFK-EEKDL  222

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +LT+ GG+RQI   G     E   LI +H+ G FYEF PW  ++TW  SPWG W +TA
Sbjct  223   ALTAAGGIRQILARG-----EEVGLIGIHHHGKFYEFAPWTSTLTWHFSPWGSWEMTA  275



>ref|WP_021834809.1| 2-methyl-6-phytyl-1,4-benzoquinone cyclase [Crocosphaera watsonii]
 emb|CCQ60532.1| 2-methyl-6-phytyl-1,4-benzoquinone cyclase [Crocosphaera watsonii 
WH 0401]
Length=366

 Score =   253 bits (646),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/314 (40%), Positives = 194/314 (62%), Gaps = 26/314 (8%)
 Frame = -1

Query  1745  NRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
             N+P +TPHSGYH+DG+ R+FFEGW+++V++P+  QSF +MYS+++P   KP SG      
Sbjct  13    NKPWKTPHSGYHWDGSFRRFFEGWYYRVTLPQWGQSFAFMYSIDDPIGGKPHSG------  66

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEF  1386
                     AQ+LG +++Y+ +  P+ K FW    +L+L +        +P  + +    F
Sbjct  67    ------GAAQVLGENEEYLYRIFPDVKKFWASEQQLALCHWKKENLTLKP--QIIESTIF  118

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
                V EG+Q +   +QG+I D    +Y       RW Y  RP+ GWGN    Q++TAGWL
Sbjct  119   EEAVEEGYQASATLNQGYIEDPVTNNYC------RWCYDIRPVDGWGNRFYSQEATAGWL  172

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFE  1026
             +  P+F+P WQV MA G +TG+I+W+G++YEF N P+YSEKNWG  FP KWFW+ CN FE
Sbjct  173   SFLPIFDPGWQVLMAHGWATGYIDWNGKKYEFSNVPAYSEKNWGYSFPSKWFWINCNSFE  232

Query  1025  GADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHW  846
               + +++LT+ GG+RQ+      +  E+  +I +HY G FY+F   +  ++W+++PWG W
Sbjct  233   -QESDLALTAAGGVRQV-----FNWQESVGIIGLHYQGKFYKFFRDDSQLSWKVTPWGSW  286

Query  845   YITAENATHKSQVE  804
              +  +NA    ++E
Sbjct  287   IMQGKNADFLVKIE  300


 Score = 54.7 bits (130),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            V++E  T + GT +R PT E GL  +CRDT   +L L+L        +GK +L   S + 
Sbjct  297  VKIEGNTKESGTYVRVPTAE-GLQFLCRDTVKGNLTLEL-----ANHEGKILLKANSCLG  350

Query  594  GVEVGGGPWFNTW  556
            G+E+GG PW ++W
Sbjct  351  GLEIGGSPWDDSW  363



>ref|WP_009545153.1| MULTISPECIES: hypothetical protein [Cyanothece]
 ref|YP_001805103.1| hypothetical protein cce_3689 [Cyanothece sp. ATCC 51142]
 gb|ACB53037.1| conserved hypothetical protein [Cyanothece sp. ATCC 51142]
Length=370

 Score =   248 bits (634),  Expect(2) = 9e-74, Method: Compositional matrix adjust.
 Identities = 126/311 (41%), Positives = 190/311 (61%), Gaps = 28/311 (9%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
             +TPHSGYH+DG+ R+FFEGW+++V++P   QSF +MYS+++P              G ++
Sbjct  20    KTPHSGYHWDGSSRRFFEGWYYRVTLPHSNQSFAFMYSMDDPI-------------GNQY  66

Query  1553  -TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
              +G  AQ+LGA++ Y+ +  P  K FW  + +L+L +  +     +P   E  P  F   
Sbjct  67    HSGGAAQVLGANESYLYRIFPNVKTFWASQKQLALCHWQLENFNLKPHILE--PILFEET  124

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             V EG+Q T   +QG+I D    +Y       RW Y+ +PI GWG+  S Q++TAGWL+  
Sbjct  125   VKEGYQATATLNQGYIEDPVTKNYC------RWCYTIKPIDGWGHRFSPQEATAGWLSFL  178

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             P+F+P WQV MA G + G+I+W+G  YEFENAP+YSEKNWG  FP KWFW+ CN F+  +
Sbjct  179   PIFDPGWQVLMAHGWARGYIDWNGNIYEFENAPAYSEKNWGHSFPNKWFWINCNSFK-EE  237

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              ++SLT+ GG+RQ+      +  E+  +I +HY G  Y+F   N  ++W I PWG W + 
Sbjct  238   SDLSLTAAGGIRQV-----FNWQESVGIIGLHYQGKLYQFARENSQLSWHIKPWGSWIMQ  292

Query  836   AENATHKSQVE  804
              +N+    ++E
Sbjct  293   GKNSDFAIKIE  303


 Score = 58.5 bits (140),  Expect(2) = 9e-74, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            +++E +T   GT +R PT + GL  +CRDT    L+++L       +KGK I   TS++ 
Sbjct  300  IKIEGKTKSIGTYVRVPTAD-GLQFLCRDTVQGTLKIEL-----QNNKGKTIFKATSSLG  353

Query  594  GVEVGGGPWFNTW  556
            G+E+GG PW   W
Sbjct  354  GLEIGGSPWHKDW  366



>ref|WP_015162192.1| hypothetical protein [Chamaesiphon minutus]
 ref|YP_007099635.1| hypothetical protein Cha6605_5219 [Chamaesiphon minutus PCC 6605]
 gb|AFY96108.1| hypothetical protein Cha6605_5219 [Chamaesiphon minutus PCC 6605]
Length=413

 Score =   256 bits (653),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/355 (39%), Positives = 202/355 (57%), Gaps = 48/355 (14%)
 Frame = -1

Query  1829  VSAPDSAVENP---APEIKEAIKPV-YTPTPSNRPL---RTPHSGYHFDGTRRQFFEGWF  1671
             +S P+  +  P    P I   +  + Y  +  N  L   + PH+GYH++G    FFEGW+
Sbjct  29    LSTPNYQLSTPNYQLPTINSQLSTINYQLSTINYQLLIMKVPHNGYHWNGVDPDFFEGWY  88

Query  1670  FKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPE  1491
             F++++P+ R+SF +MYS+E+P      SG              AQ+LG D++++    P+
Sbjct  89    FRLTLPKIRESFAFMYSIEDPLGKSERSG------------GAAQMLGIDERHLMCSFPD  136

Query  1490  SKNFWGERHELSLGNTFIAQTAARPPNKEVPPQ-----EFNSRVLEGFQVTPLWHQGFIR  1326
                FW  + EL+LG+        +  N ++ PQ     EF+  + EG+QVT   HQG   
Sbjct  137   PGKFWAAKDELALGH------WGKSNNLDIQPQLLSVAEFDRHITEGYQVTATLHQG---  187

Query  1325  DDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLST  1146
                    A  ++  RW Y T P+YGWG     Q++TAG L+   +FEP WQ+ MA GL+T
Sbjct  188   -------ALPLQDCRWCYHTVPVYGWGQPQQPQQATAGLLSYISIFEPGWQILMAHGLAT  240

Query  1145  GWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGP  966
             GWIEW G+RY+F N P+YSEKNWG  FP+KWFWV CN F+   G +++T+GGG R++   
Sbjct  241   GWIEWQGKRYDFTNTPAYSEKNWGRSFPQKWFWVNCNSFDETVG-LAITAGGGRRKVLW-  298

Query  965   GTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQVEV  801
                   E   +I +HY   FYEFVPWN  ++W+I PWG W I A N+  + QVE+
Sbjct  299   ----TTEEVGMIGIHYRDKFYEFVPWNSQMSWQIQPWGAWKIQASNS--EFQVEL  347



>ref|WP_015134317.1| tocopherol cyclase [Leptolyngbya sp. PCC 7376]
 ref|YP_007071389.1| tocopherol cyclase [Leptolyngbya sp. PCC 7376]
 gb|AFY38555.1| tocopherol cyclase [Leptolyngbya sp. PCC 7376]
Length=352

 Score =   253 bits (645),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 177/302 (59%), Gaps = 29/302 (10%)
 Frame = -1

Query  1733  RTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRF  1554
              TPHSGYH+D    +FFEGW+F++++PE + +F +MYS+E+P   +P            +
Sbjct  5     ETPHSGYHWDYRTARFFEGWYFRITLPEIQDNFAFMYSIEDPLGNQP------------Y  52

Query  1553  TGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRV  1374
             +G   QILG  D+Y  +  P  KNFW     L LG+         P  K + P+ F   +
Sbjct  53    SGGAVQILGLQDEYFWRTFPNMKNFWAAGDRLELGHWKTKPAHLTP--KLLAPEVFAETI  110

Query  1373  LEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFP  1194
              EG+Q T   +QG IR+        T +  RW Y T+PIYGWG       ++A W +  P
Sbjct  111   DEGYQATTTLNQGSIRNPA------TGEVCRWNYETKPIYGWG---IPSIASANWFSFLP  161

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             +++P WQ+ +A GLS+GWIEW G+ YEF NAP+YSEKNWG  FP++WFW+ CN F+  + 
Sbjct  162   IYDPGWQILLAHGLSSGWIEWQGDCYEFTNAPAYSEKNWGQSFPKQWFWLNCNAFD-QES  220

Query  1013  EVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +++LT+GGG+R I         E  ALI +H+ G FYEF PWN  V W I PWG W + A
Sbjct  221   DLALTAGGGIRDI-----FTQTEEVALIGLHHAGTFYEFAPWNAQVNWTIKPWGEWRMQA  275

Query  833   EN  828
              N
Sbjct  276   TN  277



>ref|WP_015783472.1| hypothetical protein [Cyanothece sp. PCC 8802]
 ref|YP_003136873.1| hypothetical protein Cyan8802_1107 [Cyanothece sp. PCC 8802]
 gb|ACV00038.1| conserved hypothetical protein [Cyanothece sp. PCC 8802]
Length=363

 Score =   251 bits (641),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 183/301 (61%), Gaps = 26/301 (9%)
 Frame = -1

Query  1730  TPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFT  1551
             TPHSGYH+D    +FFEGW+++V++PE  Q+F +MYS+++P   +P SG           
Sbjct  11    TPHSGYHWDQRSPRFFEGWYYRVTLPEIGQTFGFMYSIDDPLGDQPHSG-----------  59

Query  1550  GVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVL  1371
                 QILGA+D+Y+ +  P  + FW +R++L +G+    Q +   P + + PQ F   V 
Sbjct  60    -GAVQILGANDQYLYRIFPNIQQFWADRNQLGVGHWGSHQLSL--PPQLLDPQTFEKAVE  116

Query  1370  EGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPV  1191
             EG+Q T   +QGFI D        T ++ RW Y+  PIYGWG+    QK+T G L+  P+
Sbjct  117   EGYQATATVNQGFIGD------RATQQSCRWYYTINPIYGWGDKHRNQKATGGLLSYLPI  170

Query  1190  FEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGE  1011
             F+P WQV MA GL+TGWI+W+GE+YEF + P+YSEKNWG  FP+KWFW+ CN F  A+ +
Sbjct  171   FDPGWQVLMAHGLATGWIDWNGEKYEFSDVPAYSEKNWGRSFPKKWFWINCNSFL-AEPD  229

Query  1010  VSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAE  831
             ++LT  G +RQ+         E+  +I +HY G  Y+F    G + W + PWG W I  E
Sbjct  230   LALTVAGAIRQVLWWE-----ESVGIIGLHYQGKLYQFESTKGQLNWRVEPWGRWEIRGE  284

Query  830   N  828
             N
Sbjct  285   N  285



>ref|WP_006509396.1| hypothetical protein [Xenococcus sp. PCC 7305]
 gb|ELS03487.1| hypothetical protein Xen7305DRAFT_00032110 [Xenococcus sp. PCC 
7305]
Length=370

 Score =   250 bits (638),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 184/318 (58%), Gaps = 46/318 (14%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L+TPHSGYH++G  + +FEGW+F+V++PE  Q+F +MYS+E+P              GR+
Sbjct  7     LQTPHSGYHWNGITKSYFEGWYFRVTLPEIAQTFAFMYSIEDPI-------------GRQ  53

Query  1556  FTGVGA-QILGADDKYICQYTPESKNFWGERHELSLG---NTFIAQTAARP---------  1416
                 GA QILG D+ Y+ +  P+ + FW  R+ L L    N    Q A            
Sbjct  54    ANSGGAVQILGIDEAYLSRTFPDVQQFWASRNSLELKHWKNPENNQPAKSSSPIPHPSSL  113

Query  1415  ---PNKEVP-PQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGW  1248
                P+  +P P  FN    EG+QVT   +QG I D     Y       RWEY  +P+YGW
Sbjct  114   IPYPSSLIPHPSSFN----EGYQVTANLNQGCIYDPRNQQYC------RWEYQIQPLYGW  163

Query  1247  GNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDG  1068
             GN    Q++TAGWL+  PVF+P WQ+ MA GL+TGWIEW G +Y+F  AP+YSEKNWG  
Sbjct  164   GNPNLTQQATAGWLSYLPVFDPGWQILMAHGLATGWIEWQGTKYQFTEAPAYSEKNWGTS  223

Query  1067  FPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPW  888
             FP+KWFW+ CN F      ++LT+ GG+RQ+         E+  +I +H+ G F EFVP 
Sbjct  224   FPKKWFWINCNSFTD-QYNLALTAAGGVRQVLW-----GEESVGMIGIHFQGYFVEFVPE  277

Query  887   NGSVTWEISPWGHWYITA  834
             N  +TW++ PWG W + A
Sbjct  278   NSQITWQVKPWGEWLMQA  295


 Score = 52.8 bits (125),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 7/72 (10%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            V L   T  PGT +R PT + GL   CRDT    L L+L   +Y   KGK I++  S++A
Sbjct  302  VTLIGTTDLPGTYVRTPTAQ-GLVLNCRDTTQGKLLLKL---QY---KGKTIVEANSSLA  354

Query  594  GVEVGGGPWFNT  559
            G+EVGG PW  T
Sbjct  355  GLEVGGAPWHET  366



>ref|WP_036485872.1| tocopherol cyclase [Myxosarcina sp. GI1]
Length=357

 Score =   249 bits (637),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 187/307 (61%), Gaps = 27/307 (9%)
 Frame = -1

Query  1736  LRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             L+TPHSGYH+D    ++FEGW++++++PE  Q+F +MYS+E+P        I E    R 
Sbjct  7     LQTPHSGYHWDRFAPRYFEGWYYRLTLPEIGQTFAFMYSIEDP--------IGE----RA  54

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
              +G   QILG D++Y+C+  P+ + F+  +  LS G+ +  + +  P  + +   EF S 
Sbjct  55    NSGGAVQILGIDEQYLCRTFPDVRGFFAAKDSLSFGH-WGNKLSIAP--QLLSTSEFESG  111

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + +G+Q T   +QG I       Y    K  RW+Y  +P+YGWGN    Q++TAGWL+  
Sbjct  112   IEQGYQATATLNQGCIY------YPDKQKYCRWQYQIKPVYGWGNPSQLQQATAGWLSYL  165

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             PVFEP WQV MA GL+TGWI+W G+ Y F +AP+YSEKNWG  FP+KWFW+ CN F   +
Sbjct  166   PVFEPGWQVLMAHGLATGWIDWQGQVYNFTDAPAYSEKNWGSSFPQKWFWINCNSFNNTN  225

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              ++++T+ GG+R +         E   LI +HY G FYEF P N  ++W++ PWG W I 
Sbjct  226   -DLAVTAVGGIRDVLWWQ-----EEVGLIGIHYQGQFYEFAPGNSQISWQVQPWGKWQIQ  279

Query  836   AENATHK  816
               N  ++
Sbjct  280   TSNRDYQ  286



>gb|ACY66884.1| tocopherol cyclase [Linum usitatissimum]
Length=139

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  1541  AQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLEGF  1362
             AQILGA DKYICQY+ ES NFWG RHEL LG+TF+AQ   RPP KEVPP+EF+ RV+EGF
Sbjct  1     AQILGAYDKYICQYSEESNNFWGSRHELVLGSTFVAQKGIRPPTKEVPPEEFDRRVVEGF  60

Query  1361  QVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEP  1182
             Q TP+WHQG I D+GRTDYA+TVKTARWEYSTRP+YGWG+VGSKQKSTA W AAFPVFEP
Sbjct  61    QTTPVWHQGSITDNGRTDYAETVKTARWEYSTRPVYGWGDVGSKQKSTASWPAAFPVFEP  120

Query  1181  HWQVCMAAGLSTGWIEWDG  1125
             HWQ+CMA GLSTGWIEW G
Sbjct  121   HWQICMAGGLSTGWIEWGG  139



>ref|WP_012594427.1| tocopherol cyclase [Cyanothece sp. PCC 8801]
 ref|YP_002371308.1| tocopherol cyclase [Cyanothece sp. PCC 8801]
 gb|ACK65152.1| tocopherol cyclase [Cyanothece sp. PCC 8801]
Length=363

 Score =   248 bits (632),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/301 (42%), Positives = 182/301 (60%), Gaps = 26/301 (9%)
 Frame = -1

Query  1730  TPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFT  1551
             TPHSGYH+D    +FFEGW+++V++PE  Q+F +MYS+++P   +P SG           
Sbjct  11    TPHSGYHWDQRSPRFFEGWYYRVTLPEIGQTFGFMYSIDDPLGDQPHSG-----------  59

Query  1550  GVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVL  1371
                 QILGA+D+Y+ +  P  + FW +R++L +G+    Q +   P + + PQ F   V 
Sbjct  60    -GAVQILGANDQYLYRIFPNIQQFWADRNQLGVGHWGSHQLSL--PPQLLDPQTFEKAVE  116

Query  1370  EGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPV  1191
             EG+Q T   +QGFI D        T ++  W Y+  PIYGWG+    QK+T G L+  P+
Sbjct  117   EGYQATATVNQGFIGD------RATQQSCCWYYTINPIYGWGDKHRNQKATGGLLSYLPI  170

Query  1190  FEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGE  1011
             F+P WQV MA GL+TGWI+W+GE+YEF + P+YSEKNWG  FP+KWFW+ CN F  A+ +
Sbjct  171   FDPGWQVLMAHGLATGWIDWNGEKYEFSDVPAYSEKNWGRSFPKKWFWINCNSFL-AEPD  229

Query  1010  VSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAE  831
             ++LT  G +RQ+         E+  +I +HY G  Y+F    G + W + PWG W I  E
Sbjct  230   LALTVAGAIRQVLWWE-----ESVGIIGLHYQGKLYQFESTKGQLNWRVEPWGRWEIRGE  284

Query  830   N  828
             N
Sbjct  285   N  285



>ref|WP_030005917.1| tocopherol cyclase [Synechococcus sp. NKBG042902]
Length=350

 Score =   246 bits (629),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 177/298 (59%), Gaps = 29/298 (10%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+D    +FFEGW+F+V++PE   +F +MYS+E+P   +P SG            
Sbjct  7     PHSGYHWDHHTPRFFEGWYFRVTLPELGDNFAFMYSIEDPLGDRPHSG------------  54

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                Q+LG  D+Y+ +     KNFW +   L+LG+        +P  + + P+ F  ++ E
Sbjct  55    GAVQVLGLQDEYLWRTLLNVKNFWADHQRLALGHWRHCPPNLKP--QPLAPRVFQEKIHE  112

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T   +QG I D G      T +  +W Y T+PIYGWG      K TA W +  P++
Sbjct  113   GYQATATLNQGRIIDPG------TGEICQWHYETKPIYGWGR---PAKPTANWYSFLPIY  163

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQV +A GLSTGWIEW G+RYEF +AP+YSEKNWG  FP+ WFW+ CN F+  + ++
Sbjct  164   DPGWQVLLAHGLSTGWIEWQGKRYEFRDAPAYSEKNWGKSFPKAWFWLNCNAFK-EEKDL  222

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITA  834
             +LT+ GG+RQI         E   LI +H+ G FYEF PW  ++ W  SPWG W +TA
Sbjct  223   ALTAAGGIRQILA-----REEEVGLIGIHHHGKFYEFAPWTSTLIWHFSPWGSWEMTA  275



>ref|WP_029681977.1| tocopherol cyclase [Synechococcus sp. NKBG15041c]
Length=350

 Score =   245 bits (625),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 181/303 (60%), Gaps = 35/303 (12%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+D    +FFEGW+F++++P  R +F +MYS+E+P   +P SG            
Sbjct  7     PHSGYHWDHRTPRFFEGWYFRITLPGLRDNFAFMYSLEDPLGDRPHSG------------  54

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPN---KEVPPQEFNSR  1377
                QILG  D+Y+ +  P  + FW +   L+LG+         PPN   + + P+ F+  
Sbjct  55    GAVQILGLQDEYLWRTLPNVEYFWADHQRLALGHW-----QHCPPNLSPQLLAPRVFHDN  109

Query  1376  VLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAF  1197
             + EG+Q T   +QG I D        T    +W Y T+PIYGWG     +K TA W A  
Sbjct  110   IAEGYQATATLNQGKIID------PVTGDICQWCYETQPIYGWG---IPKKPTAHWYAFL  160

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             P+++P WQV +A GLS+GWIEW G+RYEF +AP+YSEKNWG  FP+ WFW+ CN F+  +
Sbjct  161   PIYDPGWQVLLAHGLSSGWIEWRGQRYEFTDAPAYSEKNWGKSFPKAWFWLNCNAFQ-EE  219

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              +++LT+ GG+RQI         E   LI +H+ G FYEF PWN +V W++SPWG W +T
Sbjct  220   QDLALTAAGGIRQILA-----TEEEVGLIGIHHRGTFYEFAPWNSTVHWQVSPWGSWEMT  274

Query  836   AEN  828
             A +
Sbjct  275   AGD  277



>ref|WP_023076966.1| tocopherol cyclase [Leptolyngbya sp. Heron Island J]
 gb|ESA32374.1| tocopherol cyclase [Leptolyngbya sp. Heron Island J]
Length=348

 Score =   244 bits (622),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/319 (40%), Positives = 188/319 (59%), Gaps = 51/319 (16%)
 Frame = -1

Query  1739  PLRTPHSGYHFDGTRRQFFEGWFFKVSIP--ECRQSFCYMYSVENPAFTKPLSGIEEVQY  1566
             P  TPHSGYH++G +  FFEGW++++++P  +  Q+  +MYS+++PA   P SG      
Sbjct  2     PRPTPHSGYHWNGRQHPFFEGWYYRLTLPPEQGNQTIAFMYSLQDPARPTPASG------  55

Query  1565  GRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEF  1386
                      QILG D++Y C+  P+   FW  +H L  G++                   
Sbjct  56    ------GAVQILGPDEQYFCRSLPDLSRFWAWQHRLGHGHSR------------------  91

Query  1385  NSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWL  1206
             N  ++E ++VT   H+G   +          +T RW YS  P+Y WG    + +STAGWL
Sbjct  92    NGPIVESYRVTATSHEGQFWNPA------LARTVRWHYSLEPVYSWG-APQQPQSTAGWL  144

Query  1205  AAFPVFEPHWQVCMAAGLSTGWIEWDG------ERYEFENAPSYSEKNWGDGFPRKWFWV  1044
             + F +FEP WQ+ MA GL+TGW EW        +R++FE AP+Y+EKNWG  FP+KWFW+
Sbjct  145   SQFQIFEPGWQILMAHGLATGWFEWVDAAGQVVDRFDFEQAPAYAEKNWGGAFPKKWFWI  204

Query  1043  QCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEI  864
             QCN FE  + ++SLTSGGG+RQ+ G       E+  ++ +H+ G FYEFVPWNG V+W++
Sbjct  205   QCNAFE-HEPDLSLTSGGGIRQMLG-----QQESVGMVGIHHRGQFYEFVPWNGQVSWQV  258

Query  863   SPWGHWYITAENATHKSQV  807
             SPWG W + AEN  ++ ++
Sbjct  259   SPWGCWQVWAENPDYRVEL  277



>ref|WP_039725362.1| tocopherol cyclase [Lyngbya confervoides]
 gb|KIF13693.1| tocopherol cyclase [Aphanocapsa montana BDHKU210001]
 gb|KIF38633.1| tocopherol cyclase [Lyngbya confervoides BDU141951]
Length=365

 Score =   240 bits (613),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/309 (40%), Positives = 180/309 (58%), Gaps = 26/309 (8%)
 Frame = -1

Query  1730  TPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFT  1551
             TPHSGYH+DG+ R+FFEGW+ ++++P   ++F +MYS+++PA    LSG           
Sbjct  7     TPHSGYHWDGSARRFFEGWYVRLTLPTLGETFAFMYSIDDPAGQSTLSG-----------  55

Query  1550  GVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVL  1371
                AQILG +++Y   + PE + FW   H L +G+    +TA       +P  EF     
Sbjct  56    -GAAQILGPEEQYHLTWLPELRGFWAWPHRLGVGH--WQRTADGQRGGYLPSAEFWDIAQ  112

Query  1370  EGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPV  1191
             +G+Q+T   HQG + D      A T   ARW Y   P+YGWG      ++TAGWL+  P+
Sbjct  113   QGYQLTATQHQGCLVD------AATGAIARWHYDIDPVYGWGAANQTAQATAGWLSYLPI  166

Query  1190  FEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGE  1011
             FEP WQV MA GL+TGW EW G RYEFE AP+Y EKNWG  FP++WFWVQ N F  A  +
Sbjct  167   FEPGWQVLMAHGLATGWAEWQGRRYEFEQAPTYMEKNWGGAFPQRWFWVQANAF-AALPD  225

Query  1010  VSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAE  831
             +++T+ GG RQ+ G       E   L+ +H+ G          +VTW+++PWGHW +T  
Sbjct  226   LTITAVGGKRQVLG-----REETVGLVGLHWAGQCISMTSLRAAVTWQVAPWGHWQMTIA  280

Query  830   NATHKSQVE  804
             +  ++  ++
Sbjct  281   DHRYRIVLQ  289



>ref|XP_002291625.1| tocopherol cyclase [Thalassiosira pseudonana CCMP1335]
 gb|EED91732.1| tocopherol cyclase, partial [Thalassiosira pseudonana CCMP1335]
Length=448

 Score =   220 bits (560),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/352 (36%), Positives = 181/352 (51%), Gaps = 41/352 (12%)
 Frame = -1

Query  1736  LRTPHSG--YHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPA--------FTKPLS  1587
             L+TPH+G    F    R+F EGW++++++PE  +SF +++S+E+              L 
Sbjct  2     LQTPHAGRKMLFSRNSRRFTEGWYYRLTLPEHNESFVFIFSIEDAGRWIRSKRRMRHILQ  61

Query  1586  GIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNK  1407
              +         T    Q+LG  D Y+ Q   +   FWG ++   LG TF      +  N 
Sbjct  62    SLRSSYVKSPLTLACFQLLGPQDTYLVQSDEDDTKFWGWKYSQGLGCTFQWNDEGKDDNH  121

Query  1406  E-----VPPQEFNSRVLEGFQVTPLWHQGFIR-DDGRTDYAKTVK----TARWEYSTRPI  1257
                   + P E+  RV  GFQ+ P   QG +   DG     K  +    +A ++ S +P+
Sbjct  122   TAHIAAMQPDEWRKRVQTGFQILPFHFQGRLNGHDGTLGGVKANQGIPGSAEYDISLKPV  181

Query  1256  YGWGNV--------------GSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGER  1119
              GWGN                 +Q STAGWLAAFPVFEPHWQ+ MA   ++G + W+G  
Sbjct  182   AGWGNYPPLSSATNSTTTNNNYRQYSTAGWLAAFPVFEPHWQITMAHARASGSLNWNGTV  241

Query  1118  YEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGT--SDNFE  945
             YEFE+AP Y EKNWG  FP KW+W QCN F+    ++S T+GGG+R++P          E
Sbjct  242   YEFEDAPFYGEKNWGGAFPTKWYWAQCNSFDDHQ-DLSFTAGGGIRELPFSFLMGKKMTE  300

Query  944   NAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYI----TAENATHKSQVEV  801
                LI +HY G FYE VPW G + WE++PWG W      T +N   + + EV
Sbjct  301   TLGLIGIHYQGTFYEIVPWTGEMQWEVAPWGRWEFRGRCTDKNGNCQFEAEV  352


 Score = 64.7 bits (156),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 2/99 (2%)
 Frame = -3

Query  777  QVELEARTSD--PGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTS  604
            + E+ A T D   G  LRAPT++ G+   CRD+    + L LW   +D  +G  +    S
Sbjct  349  EAEVVATTKDGVEGVLLRAPTKDEGMQYFCRDSGAGKVTLSLWLLEWDDDEGDYVRSSQS  408

Query  603  NMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGI  487
            +   VEVGGGPW++ W+ ++     LK  +  P  + GI
Sbjct  409  SQCTVEVGGGPWWDVWRVSSKMSRPLKFMIRLPYILRGI  447



>ref|WP_008316235.1| hypothetical protein [Leptolyngbya sp. PCC 6406]
Length=377

 Score =   236 bits (603),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 178/313 (57%), Gaps = 22/313 (7%)
 Frame = -1

Query  1730  TPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFT  1551
             TPHSGYH+DG   +FFEGW+ ++++P   QSF +MYS+++PA    L            +
Sbjct  7     TPHSGYHWDGAPGRFFEGWYCRLTLPAVAQSFAFMYSIDDPAGASILDSSSTPD----LS  62

Query  1550  GVGAQILGADDKYICQYTPESKNFWGERHELSLGN---TFIAQTAARPPNKEVPPQEFNS  1380
             G  AQILG D+ Y+    P    FW  R  L LG+      + T   PP + +    F +
Sbjct  63    GGAAQILGPDETYLYCPFPNVAGFWAWRGHLGLGHWGQVAGSGTVVYPP-RYLEADRFRA  121

Query  1379  RVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAA  1200
              V +G+Q+T   HQG ++D       +T   ARW+Y+  P YGWG      + TAGWL+ 
Sbjct  122   GVSQGYQLTATHHQGQVQD------PQTGLQARWDYTVVPRYGWGGDHEPPRPTAGWLSY  175

Query  1199  FPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGA  1020
              P+FEP WQV MA G  TGWIEW  +RY+F  AP Y EKNWG  FP KWFW+QCN F   
Sbjct  176   LPIFEPGWQVLMAHGWGTGWIEWGRDRYDFHQAPVYCEKNWGHAFPEKWFWIQCNAF-AD  234

Query  1019  DGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYI  840
             + ++SLT  G  RQ+       + E   L+ +HY G F+E     G + W+++PWG W++
Sbjct  235   EPDLSLTMAGARRQV-----LTHQETVGLVGLHYRGQFFELSSLRGQIQWQVTPWGDWWV  289

Query  839   TAENATHKSQVEV  801
             +A   TH+ ++E+
Sbjct  290   SA--LTHRYRLEL  300



>ref|WP_006456241.1| hypothetical protein [Synechococcus sp. PCC 7335]
 gb|EDX86476.1| hypothetical protein S7335_4180 [Synechococcus sp. PCC 7335]
Length=338

 Score =   216 bits (549),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 120/308 (39%), Positives = 168/308 (55%), Gaps = 41/308 (13%)
 Frame = -1

Query  1730  TPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFT  1551
             TPHSGYH+ G   +FFEGW+ +V++    Q+F +MYS+++PA   P SG           
Sbjct  4     TPHSGYHWRGQSERFFEGWYLRVTLSAIAQTFAFMYSIDDPAGDSPHSG-----------  52

Query  1550  GVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVL  1371
                AQILG D+ Y C+  P    F      LS+G+    Q A  P + E           
Sbjct  53    -GAAQILGPDESYYCRTFPNVHRFKASLQYLSVGH----QRAVNPASDE-----------  96

Query  1370  EGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPV  1191
              G+Q T   H+G +              A WEY+  PI  WG    + K+TAGWL+   V
Sbjct  97    -GYQFTAYSHRGKLLT------PSGAAQAEWEYAIEPISTWGE-SERPKATAGWLSYPSV  148

Query  1190  FEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGE  1011
             FEP WQV MA GL++G I W G+ Y+F++ P+Y+EKNWG  FP KWFW+QCN F  A G 
Sbjct  149   FEPGWQVLMAHGLASGQIHWQGKTYDFKDMPAYAEKNWGGAFPSKWFWLQCNAFTDAPG-  207

Query  1010  VSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAE  831
             +S+T+ GG+R +         EN  LI +HY G FYEF+    + TW I PWG+W++ A 
Sbjct  208   LSVTAAGGIRNVLFLK-----ENVGLIGIHYQGKFYEFLSTKIAFTWTIDPWGYWHLVAR  262

Query  830   NATHKSQV  807
             +  ++ ++
Sbjct  263   DYRYRVEI  270


 Score = 68.6 bits (166),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 6/74 (8%)
 Frame = -3

Query  777  QVELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNM  598
            +VE+  R SD G  +R PT+E GL  +CRDT + +LR+QLW      + G+ I+D  S++
Sbjct  267  RVEITGRASDEGAYVRVPTRE-GLQWLCRDTTHGELRVQLWL-----ANGQVIVDTFSDL  320

Query  597  AGVEVGGGPWFNTW  556
            AG+EVGG PW   W
Sbjct  321  AGLEVGGAPWKEAW  334



>ref|WP_023172101.1| tocopherol cyclase [Gloeobacter kilaueensis]
 ref|YP_008710758.1| tocopherol cyclase [Gloeobacter kilaueensis JS1]
 gb|AGY57051.1| tocopherol cyclase [Gloeobacter kilaueensis JS1]
Length=358

 Score =   223 bits (569),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 176/315 (56%), Gaps = 40/315 (13%)
 Frame = -1

Query  1736  LRTPHSGYHFDG-----TRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEV  1572
             L TPH+GYH+ G       R FFEGW+++VS+PE  +SF +MY++  PA           
Sbjct  8     LTTPHAGYHWPGGLLLSRARPFFEGWYYRVSLPEVGESFAFMYAIAEPA-----------  56

Query  1571  QYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQ  1392
               G   +G  AQIL   D+ +     E + FW E   L+LG++      A P    + P 
Sbjct  57    -GGGATSGGFAQILAPGDERLYHLFDEVRGFWAEPDRLALGHS----EPALPQPGLIDPA  111

Query  1391  EFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAG  1212
              F S V  G+Q T   +QG ++D            A W Y   P+ GWG  G + ++T G
Sbjct  112   RFASEVQLGYQATATLNQGVLKD------------AAWCYRIEPVAGWGRPG-RPEATMG  158

Query  1211  WLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNV  1032
             WL+  PVFEP WQ+ MA G +TGWIEW G RY FE+AP+Y EKNWG  FP+KWFWVQ N 
Sbjct  159   WLSYLPVFEPGWQILMAHGRATGWIEWRGARYSFEDAPAYGEKNWGGAFPKKWFWVQANA  218

Query  1031  FEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWG  852
             FE AD E +L +GGG R     G     E+ A++ +++GG FY F+P +G +   ++PWG
Sbjct  219   FE-ADPEAALIAGGGRR-----GFLWREESVAMVGLYHGGRFYRFLPEDGHLRCAVTPWG  272

Query  851   HWYITAENATHKSQV  807
              W I A +  ++ +V
Sbjct  273   RWQIEAVSERYRIEV  287



>ref|XP_002500102.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61360.1| predicted protein, partial [Micromonas sp. RCC299]
Length=399

 Score =   197 bits (501),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 126/325 (39%), Positives = 173/325 (53%), Gaps = 44/325 (14%)
 Frame = -1

Query  1733  RTPHSGYH-FDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRR  1557
             RTPHSGYH  +G  R FFEGW+F+V++PE R +   +Y V +P   +           RR
Sbjct  1     RTPHSGYHRIEGFPRPFFEGWYFRVTLPEIRDNLSLIYHVYDPDLRRSE---------RR  51

Query  1556  FTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSR  1377
               G GAQ+     KYI + + + + F    HEL+L   +         + E  P+ +   
Sbjct  52    --GAGAQVCTPGGKYIWRESRDVERFTAAPHELALRMDYA--------HAEGGPEFYE--  99

Query  1376  VLEGFQVTPLWHQGFIR-DDGRTDYA-----KTVKTARWEYSTRPIYGWGNVGSKQKSTA  1215
             V  G  V    H+G +R  D   D +     K     RW++S  P+ G+G+ G +  STA
Sbjct  100   VAAGGSV----HRGRLRLGDEVNDPSVWPPEKLASEVRWDFSIEPVAGYGDRG-RATSTA  154

Query  1214  GWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGD-GFPRKWFWVQC  1038
             GWL++ PVFEPH+Q+ MA GL+TGWIE +G R EF  AP+YSEKNWG  GFP +WFW+QC
Sbjct  155   GWLSSLPVFEPHYQITMAHGLATGWIETNGARVEFAKAPAYSEKNWGGAGFPSRWFWLQC  214

Query  1037  NVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHY-GGVFYEFVPWNG------S  879
             N F    G     +GG    +  PG     E  A I +H  GG F+ FVP  G       
Sbjct  215   NSFSAQPGLSVTATGGNRGVVILPGVR---EEVAAITIHAPGGDFFPFVPVAGEGVEAAD  271

Query  878   VTWEISPWGHWYITAENATHKSQVE  804
             +TW +SPWG W +     TH+ ++E
Sbjct  272   LTWSVSPWGRWTVRGVTPTHEVEIE  296


 Score = 70.1 bits (170),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 5/90 (6%)
 Frame = -3

Query  741  TTLRAPTQEMG--LAPVCRDTCYADLRLQLWERRYDGSKGKA--ILD-VTSNMAGVEVGG  577
            T LRAP  + G  +AP+CR++    +++ LWER    +KG+   ILD V S+ A VEVGG
Sbjct  310  TVLRAPMDDAGAGMAPLCRESFRGSMKVSLWERDVAATKGRGRCILDGVQSDTAAVEVGG  369

Query  576  GPWFNTWKGTTNAPEILKQALNAPVDIEGI  487
            GPW   W G+    E L     APVD++ +
Sbjct  370  GPWTEAWVGSAEMREPLGTLAGAPVDVDAV  399



>ref|WP_011143082.1| hypothetical protein [Gloeobacter violaceus]
 ref|NP_926035.1| hypothetical protein glr3089 [Gloeobacter violaceus PCC 7421]
 dbj|BAC91030.1| glr3089 [Gloeobacter violaceus PCC 7421]
Length=363

 Score =   221 bits (564),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 177/315 (56%), Gaps = 35/315 (11%)
 Frame = -1

Query  1736  LRTPHSGYHFDGT-----RRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEV  1572
             L TPHSGYH+ G+      R+FFEGW+++VS+ E  +SF +MY++E+PA   P SG    
Sbjct  8     LTTPHSGYHWPGSLLSPRNRRFFEGWYYRVSLAEEGESFAFMYAIEDPAGGAPTSGGF--  65

Query  1571  QYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQ  1392
                       AQ+LG +D    Q     + FW     L+LG+    +     P   + P+
Sbjct  66    ----------AQVLGPEDGRTYQLFGGVEGFWATPDRLALGH----RQDPPGPAGYLEPE  111

Query  1391  EFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAG  1212
             +F ++V  G+Q T   +QG I D+       T +  RW Y  RP++GWG  G +  +T G
Sbjct  112   DFEAKVRRGYQATDSLNQGCIEDE-------TGEITRWCYRLRPVHGWGAPG-RPVATMG  163

Query  1211  WLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNV  1032
             WL+  PVFEP WQ+ MA GL+ GWIEW G RY F  AP+Y EKNWG  FP +WFWVQ N 
Sbjct  164   WLSYLPVFEPGWQILMADGLAEGWIEWRGRRYTFTGAPAYGEKNWGGAFPTQWFWVQANA  223

Query  1031  FEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWG  852
             FEG+ G  +L +GGG R     G     E+ A++  ++ G FY F      +T  ++PWG
Sbjct  224   FEGSPG-AALVAGGGRR-----GVLWWEESVAMVGFYWAGRFYRFTAGQEKLTCTVTPWG  277

Query  851   HWYITAENATHKSQV  807
             HW+I A +  H+ +V
Sbjct  278   HWHIEALSERHRIEV  292



>ref|WP_017323971.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=367

 Score =   219 bits (558),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 116/307 (38%), Positives = 169/307 (55%), Gaps = 26/307 (8%)
 Frame = -1

Query  1754  TPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEE  1575
              PS  P + PH+GYH     + FFEGW+F+V++P+  QSF +MYS+E+P           
Sbjct  7     APSASPRQVPHAGYHGTNRSQHFFEGWYFRVTLPQEGQSFAFMYSIEDPGG---------  57

Query  1574  VQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPP  1395
                G   +G   Q+LG  D+   +  P    FWG+R  L+LG+         PP++ +P 
Sbjct  58    ---GSDRSGGTVQVLGPQDELAWRSLPNVNGFWGDRDRLALGHWGQVVAGMVPPHQLLPA  114

Query  1394  QEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTA  1215
              EF  RV  G+QV+   +QG   +  R ++       RW Y   P+Y +G  G + ++T 
Sbjct  115   GEFFRRVRSGYQVSDRLNQGCFWEPQRGEWV------RWLYRVEPLYSYG--GLQPEATM  166

Query  1214  GWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCN  1035
             GWL+   VFEP WQ+ MA G +TGW+EW G R+EFE AP+Y+EKNWG  FP KWFW+ CN
Sbjct  167   GWLSYLSVFEPGWQILMAMGRATGWVEWRGRRHEFERAPAYAEKNWGGAFPLKWFWLHCN  226

Query  1034  VFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPW  855
              FE    +++LT  GGLR++         E     ++ +G   Y F+P +  + W ++PW
Sbjct  227   AFEDQP-QIALTCAGGLRKLLW-----QTEAVGTASLSWGDRCYRFMPKDSQIRWSVAPW  280

Query  854   GHWYITA  834
             G W   A
Sbjct  281   GRWEFEA  287



>ref|XP_002176411.1| tocopherol cyclase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC42647.1| tocopherol cyclase [Phaeodactylum tricornutum CCAP 1055/1]
Length=515

 Score =   194 bits (492),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 119/340 (35%), Positives = 177/340 (52%), Gaps = 48/340 (14%)
 Frame = -1

Query  1739  PLRTPHSGYHFD---------------GTRRQFFEGWFFKVSIPECRQSFCYMYSVENPA  1605
             P +TPHSG HF+                 RR+F EGWF+++++ E   SF  + S+E+  
Sbjct  66    PQQTPHSGRHFEPNHPAYRRRWLARIRARRRRFMEGWFYRLTLSEG-VSFSIIVSIED--  122

Query  1604  FTKPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTA  1425
              + P SG+  V           QILG D  Y+ Q   +   FW  +    LGN F  Q  
Sbjct  123   VSNPKSGLGLV---------CVQILGPDGGYLIQADKDDSKFWAHKSRQGLGNVFDYQRQ  173

Query  1424  ARPPN-----KEVPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTV----------K  1290
                 N      E+   E+ + V  GFQ++P    G +R    +    T+           
Sbjct  174   YTEDNGIRVRTELTQDEWYNAVESGFQISPTEFVGRLRGYNGSIQNLTLGESFADTDPNM  233

Query  1289  TARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEF  1110
                + ++  P+ GWG+    QKST GWL+++ VF+PHWQV +A   ++G I W+G+ Y F
Sbjct  234   MCDFNFTVVPLCGWGDADGIQKSTGGWLSSYRVFDPHWQVTLADARASGQIMWNGKVYHF  293

Query  1109  ENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALI  930
               AP Y+EKNWG   P KWFW QCN F+G + ++S+T+GGG+R IP        E   +I
Sbjct  294   AQAPFYAEKNWGAALPPKWFWTQCNSFDGYN-QLSVTAGGGIRSIPW----GRKEALGMI  348

Query  929   AVHYGGVFYEFVPWNGSVTWEISPWGHWYITAENATHKSQ  810
              VH+ G+F+E VPW+G + W++S WG W ++  N+T  S+
Sbjct  349   CVHFDGMFFEAVPWSGHMEWQVSTWGIWKLSG-NSTFGSR  387


 Score = 66.6 bits (161),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 8/93 (9%)
 Frame = -3

Query  747  PGTTLRAPTQEMGLAPVCRDTCYADLRLQLWE-------RRYDGSKGKAILD-VTSNMAG  592
            PG   RAPT + G+   CRDT  A+  L LWE       + Y    G  ++D  TS+  G
Sbjct  403  PGLDFRAPTPDEGMVFFCRDTFVANTTLTLWELDWNVTTKSYFRKPGPPLIDRATSSQGG  462

Query  591  VEVGGGPWFNTWKGTTNAPEILKQALNAPVDIE  493
             E+GGGPW++TW+ T+   + LK  L  P  ++
Sbjct  463  AEIGGGPWWSTWEATSVVKQPLKALLQIPARVQ  495



>ref|XP_006382056.1| hypothetical protein POPTR_0006s25680g [Populus trichocarpa]
 gb|ERP59853.1| hypothetical protein POPTR_0006s25680g [Populus trichocarpa]
Length=278

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  1316  RTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVFEPHWQVCMAAGLSTGWI  1137
             RTDY KTVK ARWEY TRPIYGWG+VGSKQ STAGWLAAFPVFEPHWQ+C A+GLSTGWI
Sbjct  8     RTDYVKTVKIARWEYRTRPIYGWGSVGSKQNSTAGWLAAFPVFEPHWQICTASGLSTGWI  67

Query  1136  EWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEVSLTSGGGLRQIPGPGTS  957
             EW+GER+EF++ PS SEKNWG  F RK FW+QCNVFEG  GEV+LT+ GG+RQ+PGP  S
Sbjct  68    EWEGERFEFKDDPSCSEKNWGGAFSRKLFWLQCNVFEGTKGEVTLTAAGGVRQLPGPAGS  127

Query  956   DNFENAALIAVH  921
             +  ENAAL+ + 
Sbjct  128   EIHENAALVKLE  139


 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 77/108 (71%), Gaps = 8/108 (7%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            V+LEAR  D GT +        LAP C DTC   L+LQ+WE R DG++GK IL VTS+MA
Sbjct  136  VKLEARAKDLGTPI--------LAPACIDTCSGVLKLQMWEWRQDGTRGKVILKVTSDMA  187

Query  594  GVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIFGLVPLFKPPGL  451
             VEVGGGPWF  WKG T+APE+L++AL  P+D++ ++  VP FKPPGL
Sbjct  188  AVEVGGGPWFTNWKGKTSAPELLRRALRVPIDLDAVYNSVPFFKPPGL  235



>ref|WP_002765023.1| putative tocopherol cyclase [Microcystis aeruginosa]
 emb|CCI03432.1| putative tocopherol cyclase [Microcystis aeruginosa PCC 9443]
Length=352

 Score =   213 bits (543),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 168/303 (55%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P            + G+  +G
Sbjct  6     PHSGYHWDGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------------RGGQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FWG R EL++ +        RP  + + P +F   + E
Sbjct  54    GAVQILAIESNYLCRTFPDTDQFWGSRQELAIIHWGKTNLKIRP--RLLSPSDFFESIRE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATAHQQQGRIYD------PVTGEICQWDYRIETRYTWGDNKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I + G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITYRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++         E+  +I +H+   FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----LHWTESVGIIGIHWQNRFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   EDY  282



>ref|WP_004160609.1| Similar to tr|Q8Z056|Q8Z056 [Microcystis aeruginosa]
 emb|CCI13161.1| Similar to tr|Q8Z056|Q8Z056 [Microcystis aeruginosa PCC 9806]
Length=352

 Score =   213 bits (542),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 167/303 (55%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P            + G+  +G
Sbjct  6     PHSGYHWDGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------------RGGQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R EL++ +        RP  + + P +F   + E
Sbjct  54    GAVQILAIESDYLCRTFPDTDQFWASRQELAIIHWGKTNLKTRP--RLLSPSDFFESIRE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATAHQQQGRIYD------PVTGEICQWDYCVETRYSWGDNKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I + G+ Y FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITYGGKNYSFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++      +  E+  +I +H+   FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGATRKV-----LNWTESVGIIGIHWQNRFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>gb|AIE74217.1| 2-methyl-6-phytyl-1,4-benzoquinone cyclase / 2,3-dimethyl-6-phytyl-1,4-benzoquinone 
cyclase / Tocopherol cyclase [Synechocystis 
sp. PCC 6714]
Length=360

 Score =   213 bits (541),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/312 (40%), Positives = 174/312 (56%), Gaps = 37/312 (12%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPA--FTKPLSGIEEVQYGRRF  1554
             PH GYH+ G +  FFEGW+ ++ +P   +SF +MYS+ENPA  F +  S +      R +
Sbjct  5     PHCGYHWQG-QSPFFEGWYVRLLLPHSGESFAFMYSIENPAGDFAEIRSAV------RHY  57

Query  1553  TGVGAQILG--------ADDKYICQYTPESKNFWGERHELSLGN--TFIAQTAARPPNKE  1404
             +G   QILG         DD+ I +  P  KNFW      +LG+   +  +   RP    
Sbjct  58    SGGAVQILGPTRGTKENQDDQLIWRTFPSVKNFWASPCHFALGHWGKYNGEVGPRP----  113

Query  1403  VPPQEFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQK  1224
             +P  EF + V EG+Q+    HQG I        A   +  RW ++  P   WG+     K
Sbjct  114   IPAGEFFTTVEEGYQIYQHQHQGQI--------ALPDRHCRWHFTVEPEITWGSPQCFPK  165

Query  1223  STAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWV  1044
             +TAGWL+  P+F+P WQ+ +A G   GW+EW GERYEF+ A  Y+EKNWG  FP +WFW+
Sbjct  166   ATAGWLSFLPLFDPGWQILLAQGRGQGWLEWQGERYEFDQALVYAEKNWGHSFPSRWFWL  225

Query  1043  QCNVFEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEI  864
             Q N F G  G +S+T+ GG R + G     + E  ALI VH+ G FYEF P N ++TW++
Sbjct  226   QANHFPGHPG-LSVTAAGGERIVLG-----HPEEVALIGVHFQGNFYEFGPGNSTITWQV  279

Query  863   SPWGHWYITAEN  828
             + WG W + A N
Sbjct  280   ARWGRWQLKASN  291



>ref|WP_002801708.1| putative tocopherol cyclase [Microcystis aeruginosa]
 emb|CCI35428.1| putative tocopherol cyclase [Microcystis aeruginosa PCC 9701]
Length=352

 Score =   211 bits (537),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 167/303 (55%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P      SG      G+  +G
Sbjct  6     PHSGYHWDGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------SG------GQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R EL++ +        RP    + P +F   V E
Sbjct  54    GAVQILAIESNYLCRTFPDTDKFWASRQELAIIHWGKTNLKIRPC--LLSPSDFFESVQE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATANQQQGRIYD------PVTGEICQWDYRIETRYSWGDKKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I   G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITHRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++      +  E+  +I +H+   FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----LNWTESVGIIGIHWQNRFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>ref|WP_015125967.1| tocopherol cyclase [Synechococcus sp. PCC 6312]
 ref|YP_007062973.1| tocopherol cyclase [Synechococcus sp. PCC 6312]
 gb|AFY62430.1| tocopherol cyclase [Synechococcus sp. PCC 6312]
Length=354

 Score =   211 bits (536),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 112/310 (36%), Positives = 171/310 (55%), Gaps = 41/310 (13%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PH GYH+DG  + FFEGW++++++P+   SF +MYS++ P                   G
Sbjct  5     PHGGYHWDGLHQPFFEGWYYRITLPD-PASFAFMYSIQQPG------------------G  45

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
               AQ+ G  + Y C+  P+   FW       LG+T             + P +F   V +
Sbjct  46    GSAQVYGPGESYFCRSFPDVNTFWAWSDACGLGHTDTVNF-----RTLLNPSQFFREVNQ  100

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T  ++QG ++      +      ARW+Y  +PI  WG+    Q++TAGWL+  P++
Sbjct  101   GYQATGSFNQGQLK------HPNGDVVARWQYDIKPIQTWGH----QQATAGWLSYLPLY  150

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQV +A GL++GWI+W G+ YEF+ AP+Y+EKNWG  FP +WFW+Q N F     ++
Sbjct  151   DPGWQVLLAHGLASGWIQWQGKTYEFDQAPAYAEKNWGQSFPSQWFWLQANAFANHP-DL  209

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWN-GSVTWEISPWGHWYITAE  831
             SLT+ GG+RQI         E A LI +HY   FYEF PW    + WE+ PWG W +T  
Sbjct  210   SLTAAGGVRQILAWQ-----EPAGLIGIHYQNQFYEFAPWTEARLAWEVLPWGAWSMTGI  264

Query  830   NATHKSQVEV  801
                ++++++ 
Sbjct  265   VKNYRAEIKA  274



>ref|WP_002787665.1| putative tocopherol cyclase [Microcystis aeruginosa]
 emb|CCI17792.1| putative tocopherol cyclase [Microcystis aeruginosa PCC 9807]
Length=352

 Score =   211 bits (536),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/303 (37%), Positives = 168/303 (55%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P      SG      G+  +G
Sbjct  6     PHSGYHWDGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------SG------GQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R EL++ +        RP    + P +F   + E
Sbjct  54    GAVQILAIESNYLCRTFPDTDQFWASRQELAIIHWGKTNLKTRP--CLLSPSDFFESIRE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATAHQQQGRIYD------PVTGEICQWDYRIETRYTWGDNKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I + G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITYRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++      +  E+  +I +H+   FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----FNWTESVGIIGIHWQNRFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   EDY  282



>ref|WP_002756744.1| putative tocopherol cyclase [Microcystis aeruginosa]
 emb|CCH96284.1| putative tocopherol cyclase [Microcystis aeruginosa PCC 9717]
Length=352

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 165/303 (54%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P            + G+  +G
Sbjct  6     PHSGYHWDGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------------RGGQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R EL++ +        RP  + + P  F   V E
Sbjct  54    GSVQILAIESNYLCRTFPDTDKFWASRQELAIIHWGKTNLKIRP--RLLSPSAFFESVRE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATAHQQQGRIYD------PVTGEICQWDYCVETRYTWGDNKRLPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I + G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITYRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++         E+  +I +H    FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----LHWTESVGIIGIHCQNRFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   EDY  282



>ref|WP_002731633.1| tocopherol cyclase [Microcystis aeruginosa]
 gb|ELP55477.1| tocopherol cyclase [Microcystis aeruginosa TAIHU98]
Length=352

 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 167/303 (55%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P      SG      G+  +G
Sbjct  6     PHSGYHWDGITSRFFEGWYFRVMIPQLADGFAFMYSIQDP------SG------GQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW    EL++ +        RP  + + P +F   + E
Sbjct  54    GAVQILAIESNYLCRTFPDTDKFWASHQELAIIHWGKTNLKIRP--RLLSPLDFFESIRE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATAHQQQGRIYD------PVTGEICQWDYRIETRYTWGDNKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I   G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITHRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++      +  E+  +I +H+   FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----LNWTESVGIIGIHWQNRFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>ref|WP_002777500.1| putative tocopherol cyclase [Microcystis aeruginosa]
 emb|CCI07807.1| putative tocopherol cyclase [Microcystis aeruginosa PCC 7941]
Length=352

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 166/303 (55%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P      SG      G+  +G
Sbjct  6     PHSGYHWDGITSRFFEGWYFRVMIPQLADGFAFMYSIQDP------SG------GQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R EL++ +        RP    + P  F   + E
Sbjct  54    GAVQILAIESNYLCRTFPDTDKFWASRQELAIIHWGKTNLKIRPC--LLSPSAFFESIQE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATANQQQGRIYD------PVTGEICQWDYRVETRYSWGDKKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I   G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITHRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++      +  E+  +I +H+   FY+F  WN  ++W + PWG+W + A N
Sbjct  225   TLTAVGATRKV-----INWTESVGIIGIHWQNRFYKFDIWNSQLSWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>dbj|GAL91741.1| 2-methyl-6-phytyl-1,4-benzoquinone cyclase [Microcystis aeruginosa 
NIES-44]
Length=352

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/303 (37%), Positives = 166/303 (55%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P      SG      G+  +G
Sbjct  6     PHSGYHWDGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------SG------GQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R EL++ +        RP    + P  F   + E
Sbjct  54    GAVQILAIESNYLCRTFPDTDKFWASRQELAIIHWGKTNLKIRP--CLLSPSAFFESIQE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATANQQQGRIYD------PVTGEICQWDYRIETRYTWGDNKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I + G+ Y FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITYGGKNYPFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++      +  E+  +I +H+   FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----LNWTESVGIIGIHWQNRFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>ref|WP_002796597.1| putative tocopherol cyclase [Microcystis aeruginosa]
 emb|CCI23791.1| putative tocopherol cyclase [Microcystis aeruginosa PCC 9809]
Length=353

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/303 (37%), Positives = 166/303 (55%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P      SG      G+  +G
Sbjct  6     PHSGYHWDGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------SG------GQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R +L++ +        RP    + P  F   V E
Sbjct  54    GAVQILAIESNYLCRTFPDTDKFWASRQQLAIIHWGKTNLKIRPC--LLSPSAFFESVQE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATANQQQGRIYD------PVTGEICQWDYRVETRYSWGDNKRLPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I + G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITYGGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++         E+  +I +H+   FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----LHWTESVGIIGIHWQNRFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>ref|WP_002794494.1| putative tocopherol cyclase [Microcystis aeruginosa]
 emb|CCI26194.1| putative tocopherol cyclase [Microcystis aeruginosa PCC 9808]
Length=352

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 166/303 (55%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P            + G+  +G
Sbjct  6     PHSGYHWDGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------------RGGQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R EL++ +        RP  + + P +F   + E
Sbjct  54    GAVQILARESNYLCRTFPDTDKFWASRQELAIIHWGKTNLKIRP--RLLSPSDFFESIQE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I +        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATANQQQGRIYN------PVTGEICQWDYRIETRYSWGDKKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I   G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITHRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++         E+  +I +H+   FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----LHWTESVGIIGIHWQNRFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>gb|KHN10210.1| Tocopherol cyclase, chloroplastic [Glycine soja]
Length=203

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -1

Query  1778  AIKPVYTPTPSNRPLRTPHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFT  1599
             ++KP Y+ TP NR LRTPHSGYHFDGT R+FFEGW+FKVSIPE +QSFC+MY+VE+P F 
Sbjct  53    SVKPTYSSTPPNRGLRTPHSGYHFDGTTRKFFEGWYFKVSIPERKQSFCFMYTVESPLFR  112

Query  1598  KPLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAAR  1419
             KPL+ +E  QYG RFTGVGAQILGADDKY+CQ++P+S  FWG RHEL LGNTF     ++
Sbjct  113   KPLTQLELAQYGPRFTGVGAQILGADDKYVCQHSPQSHFFWGSRHELMLGNTFEPNQNSK  172

Query  1418  PPNKEVPPQEF  1386
             PPNKEVPPQ F
Sbjct  173   PPNKEVPPQVF  183



>ref|WP_016515207.1| hypothetical protein [Microcystis aeruginosa]
 gb|EPF22622.1| hypothetical protein MAESPC_01581 [Microcystis aeruginosa SPC777]
Length=352

 Score =   208 bits (529),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 165/303 (54%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P            + G+  +G
Sbjct  6     PHSGYHWDGITSRFFEGWYFRVMIPQLADGFAFMYSIQDP------------RGGQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R EL++ +        RP    +   +F   + E
Sbjct  54    GAVQILAIESNYLCRTFPDTDKFWASRQELAIIHWGKTNLKTRPC--LLSSSDFFESIRE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATANQQQGRIYD------PVTGEICQWDYCVETRYSWGDNKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I   G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITHRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++      +  E+  +I +H+   FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----LNWTESVGIIGIHWQNRFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>ref|WP_002745745.1| tocopherol cyclase [Microcystis aeruginosa]
 emb|CAO87765.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS46886.1| tocopherol cyclase [Microcystis aeruginosa DIANCHI905]
Length=352

 Score =   208 bits (529),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 166/303 (55%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH++G   +FFEGW+F+V IP+    F +MYS+++P            + G+  +G
Sbjct  6     PHSGYHWNGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------------RGGQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R EL++ +        RP  + + P +F   + E
Sbjct  54    GAVQILAIESNYLCRTFPDTDQFWASRQELAIIHWGKTNLKTRP--RLLSPSDFFESIQE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T   HQ      GR     T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATA--HQ----QQGRIYNPVTGEICQWDYCVETRYSWGDNKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I + G+ Y+F+N P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITYRGKNYQFQNVPFYSEKNWGYSFPEKWFWISCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++         E+  +I +H    FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----LHWTESVGIIGIHCQNCFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>ref|WP_024968777.1| tocopherol cyclase [Microcystis aeruginosa]
Length=352

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 166/303 (55%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P      SG      G+  +G
Sbjct  6     PHSGYHWDGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------SG------GQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R +L++ +        RP    + P  F   + E
Sbjct  54    GAVQILAIESNYLCRTFPDTDKFWASRQQLAIIHWGKTNLKIRPC--LLSPSAFFESIQE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATANQQQGRIYD------PVTGEICQWDYRVETRYSWGDKKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I   G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITHRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++      +  E+  +I +H+   FY+F  WN  ++W + PWG+W + A N
Sbjct  225   TLTAVGATRKV-----LNWTESVGIIGIHWQNRFYKFDIWNSQLSWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>ref|WP_008199571.1| putative tocopherol cyclase [Microcystis sp. T1-4]
 emb|CCI31636.1| putative tocopherol cyclase [Microcystis sp. T1-4]
Length=352

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 165/303 (54%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P      SG      G+  +G
Sbjct  6     PHSGYHWDGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------SG------GQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R +L++ +        RP    + P +F   + E
Sbjct  54    GAVQILAIESDYLCRTFPDTDKFWASRQQLAIIHWGKTNLKTRPC--LLSPSDFFESIRE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATAHQQQGRIYD------PVTGEICQWDYHVETRYSWGDKKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A  L+TG I   G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHALATGMITHRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++         E+  +I +H+   FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----LKWTESVGIIGIHWQNRFYKFDIWNSQLTWTVQPWGYWEMRASN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>ref|WP_004158859.1| putative tocopherol cyclase [Microcystis aeruginosa]
 emb|CCH94095.1| putative tocopherol cyclase [Microcystis aeruginosa PCC 9432]
Length=352

 Score =   207 bits (527),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 165/303 (54%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P            + G+  +G
Sbjct  6     PHSGYHWDGITSRFFEGWYFRVMIPQLADGFAFMYSIQDP------------RGGQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R +L++ +        RP    +   +F   + E
Sbjct  54    GAVQILAIESNYLCRTFPDTDKFWASRQQLAIIHWGKTNLKTRPC--LLSSSDFFESIQE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATANQQQGRIYD------PVTGEICQWDYRIETRYSWGDNKRPPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I   G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITHRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++      +  E+  +I +H+   FY+F  WN  +TW + PWG+W + A N
Sbjct  225   TLTAVGATRKV-----LNWTESVGIIGIHWQNRFYKFDIWNSQLTWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>ref|WP_012268147.1| tocopherol cyclase [Microcystis aeruginosa]
 ref|YP_001660989.1| tocopherol cyclase [Microcystis aeruginosa NIES-843]
 dbj|BAG05797.1| probable tocopherol cyclase [Microcystis aeruginosa NIES-843]
Length=352

 Score =   207 bits (526),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 165/303 (54%), Gaps = 26/303 (9%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+DG   +FFEGW+F+V IP+    F +MYS+++P      SG      G+  +G
Sbjct  6     PHSGYHWDGITPRFFEGWYFRVMIPQLADGFAFMYSIQDP------SG------GQVNSG  53

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                QIL  +  Y+C+  P++  FW  R +L++ +        RP    + P  F   V E
Sbjct  54    GAVQILAIESNYLCRTFPDTDKFWASRQQLAIIHWGKTNLKIRPC--LLSPSAFFESVQE  111

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPVF  1188
             G+Q T    QG I D        T +  +W+Y     Y WG+     ++TAG L+  P+F
Sbjct  112   GYQATANQQQGRIYD------PVTGEICQWDYRVETRYSWGDNKRLPQATAGILSYLPIF  165

Query  1187  EPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGEV  1008
             +P WQ+  A GL+TG I + G+ Y+FEN P YSEKNWG  FP KWFW+ CN F   + ++
Sbjct  166   DPGWQILTAHGLATGMITYRGKNYQFENVPFYSEKNWGYSFPEKWFWINCNAFP-ENPDL  224

Query  1007  SLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYITAEN  828
             +LT+ G  R++         E+  +I +H    FY+F  WN  ++W + PWG+W + A N
Sbjct  225   TLTAVGSTRKV-----LHWTESVGIIGIHCQNRFYKFDIWNSQLSWTVQPWGYWEMRATN  279

Query  827   ATH  819
               +
Sbjct  280   ENY  282



>gb|EJK48105.1| hypothetical protein THAOC_33130 [Thalassiosira oceanica]
Length=539

 Score =   200 bits (508),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 136/388 (35%), Positives = 187/388 (48%), Gaps = 94/388 (24%)
 Frame = -1

Query  1745  NRPLRTPHSGYHFD-------GTR------------RQFFEGWFFKVSIPECRQSFCYMY  1623
             N  L+TPH+G  F        G R            R+F EGW++++++PE  +SF +++
Sbjct  63    NLQLQTPHAGRKFRPSSQAQRGGRANWRRRWMSRGNRRFTEGWYYRLTLPEYGESFVFIF  122

Query  1622  SVENPA-FTK----PLSGIEEVQYGRRFTGVGAQILGADDKYICQYTPESKNFWGERHEL  1458
             S+E+   + K    PLS                Q+LG  D Y+ Q   +   FWG    L
Sbjct  123   SIEDAGRYVKGRPSPLSL------------ACMQLLGPGDTYLVQSDEDDTKFWGWDDAL  170

Query  1457  SLGNTF---------------IAQTAARPPNKEVPPQEFNSRVLEGFQVTPLWHQGFIRD  1323
             + G TF               I    A   N    P+E+  +V  GFQV P   QG  R 
Sbjct  171   AFGCTFEWSDEDAGDAESTRGIEANVAAAMN----PKEWREKVKTGFQVLPFGFQG--RL  224

Query  1322  DGRTDYAKTVK-------TARWEYSTRPIYGWGNVG--------------------SKQK  1224
             DG       VK       TA ++++ +P+ GWGN                       +Q+
Sbjct  225   DGHDGTLGGVKAGQGVSGTAYFDFAVKPLAGWGNYPPLTRYQNASDHASVLEHGGIHRQR  284

Query  1223  STAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWV  1044
             STAGWLA++PVFEPHWQV MA   +TG + W+G  Y FE+AP Y EKNWG  FP KW+W 
Sbjct  285   STAGWLASYPVFEPHWQVNMANARATGSLNWNGTVYRFEDAPFYGEKNWGGAFPTKWYWS  344

Query  1043  QCNVFEGADGEVSLTSGGGLRQIP---GPGTSDNFENAALIAVHYGGVFYEFVPWNGSVT  873
             QCN F+    ++S T+GGG+RQ+P    PG     E   L+ +HY G FYE VPW G   
Sbjct  345   QCNSFDDHP-DLSFTAGGGIRQLPFSFLPGKRT--EVLGLVGIHYNGRFYELVPWTGDSE  401

Query  872   WEISPWGHWYI----TAENATHKSQVEV  801
             W + PWG W      T   A ++ +VE+
Sbjct  402   WAVWPWGRWEFRGKCTDRRADNQFEVEI  429


 Score = 48.9 bits (115),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 55/108 (51%), Gaps = 11/108 (10%)
 Frame = -3

Query  777  QVELEARTSD--PGTTLRAPTQEMGLAPVCRDTCYADLRLQLW-------ERRYDGSKGK  625
            +VE+ A T +   G  LRAPT++ G+   C+D+ +  + L LW        ++Y  S  K
Sbjct  426  EVEIVAVTEEGVDGVPLRAPTKDRGMQYYCQDSGFGHVTLSLWGLEWDDTAQKYCRSHDK  485

Query  624  AILD-VTSNMAGVEVGGGPWFNTWKGTTNAPEILKQALNAPVDIEGIF  484
             I+D  TS    VEV GG +   W+  +N    +K+ +  P+ I  IF
Sbjct  486  PIIDKATSQQCAVEV-GGEYDGVWRVKSNMSATMKRLIRLPMVIGKIF  532



>emb|CEF96598.1| Tocopherol cyclase [Ostreococcus tauri]
Length=483

 Score =   188 bits (477),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/340 (36%), Positives = 174/340 (51%), Gaps = 65/340 (19%)
 Frame = -1

Query  1736  LRTPHSGYHFD-GTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGR  1560
             ++TPHSGYH   GT R FFEGW+F+ ++P   QS   +Y V +P          +V+   
Sbjct  69    VKTPHSGYHRQVGTSRAFFEGWYFRFTLPRSAQSASLIYHVYDP----------DVETSA  118

Query  1559  RFTGVGAQILGADDKYI-CQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
             R  G GAQ+     KY+  + +  S +F G  H L LG T                 +F 
Sbjct  119   R-AGAGAQVCAPGGKYLYSETSAGSGSFEGASHALELGMTR--------------GDDFF  163

Query  1382  SRVLEGFQVTPLWHQGFI-----RDDGRTDYAKTVKTARWEYSTRPIYGWGNV-GSKQKS  1221
                 EG +     H+G +     R+DG     +  ++ +W+ +  P+ GWG   G++ +S
Sbjct  164   EVSSEGTR-----HRGSLTSAGEREDGPWGAGRAARSVKWDIAVTPLRGWGGGPGARMQS  218

Query  1220  TAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGD-GFPRKWFWV  1044
              AGWL A PVFEPHWQV MA GL++GWIE DGER EF + P+YSEKNWG  GFP KWFW 
Sbjct  219   PAGWLTALPVFEPHWQVTMAHGLASGWIETDGERVEFSDCPAYSEKNWGGAGFPLKWFWA  278

Query  1043  QCNVF-EGADGEVSLTSGG-GLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPW------  888
             QCN F +  D  V++T G  G+  +P     +  E+  LI +H+G  F++F P       
Sbjct  279   QCNSFPDYPDLSVTVTGGNRGVVVLP-----NVREDVGLIGIHFGDRFFQFTPAVQVEIA  333

Query  887   ------------NGSVTWEISPWGHWYITAENATHKSQVE  804
                           +V W++  WG W ++A    ++  +E
Sbjct  334   ADAKYGAGQALEAAAVRWDVE-WGRWSVSAVGKRYECSIE  372


 Score = 54.3 bits (129),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 49/91 (54%), Gaps = 3/91 (3%)
 Frame = -3

Query  750  DPGTTLRAPTQEM--GLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVT-SNMAGVEVG  580
            D  T +RAPT  +  G+AP+CR+T    + + LW     G++ + I+D   S+ A +E+G
Sbjct  379  DKSTVIRAPTDSLEDGMAPLCRETFTGVIVVSLWRLDDRGARVETIIDAAMSSTACLEIG  438

Query  579  GGPWFNTWKGTTNAPEILKQALNAPVDIEGI  487
            GGPW + ++        L   +  PVD+  +
Sbjct  439  GGPWVSPYRAVAEIRTPLGPLMGLPVDVNAV  469



>ref|WP_010872405.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_441095.1| hypothetical protein slr1737 [Synechocystis sp. PCC 6803]
 ref|YP_005382961.1| hypothetical protein SYNGTI_1199 [Synechocystis sp. PCC 6803 
substr. GT-I]
 ref|YP_005386130.1| hypothetical protein SYNPCCP_1198 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 ref|YP_005408837.1| hypothetical protein SYNPCCN_1198 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 ref|YP_005651152.1| hypothetical protein SYNGTS_1199 [Synechocystis sp. PCC 6803]
 ref|YP_007450977.1| hypothetical protein MYO_112090 [Synechocystis sp. PCC 6803]
 dbj|BAA17775.1| slr1737 [Synechocystis sp. PCC 6803]
 dbj|BAK49947.1| hypothetical protein SYNGTS_1199 [Synechocystis sp. PCC 6803]
 dbj|BAL28946.1| hypothetical protein SYNGTI_1199 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL32115.1| hypothetical protein SYNPCCN_1198 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL35284.1| hypothetical protein SYNPCCP_1198 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 gb|AFQ99312.1| tocopherol cyclase [Chloroplast transformation vector pSyTCY]
 gb|AFQ99321.1| tocopherol cyclase [Chloroplast transformation vector pTop1]
 gb|AFQ99327.1| tocopherol cyclase [Chloroplast transformation vector pTop2]
 gb|AGF51463.1| hypothetical protein MYO_112090 [Synechocystis sp. PCC 6803]
Length=363

 Score =   200 bits (509),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 115/308 (37%), Positives = 171/308 (56%), Gaps = 37/308 (12%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+ G +  FFEGW+ ++ +P+  +SF +MYS+ENPA         +  YG    G
Sbjct  5     PHSGYHWQG-QSPFFEGWYVRLLLPQSGESFAFMYSIENPA--------SDHHYG----G  51

Query  1547  VGAQILG--------ADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQ  1392
                QILG         +D+ + +  P  K FW    + +LG+    +       K +  +
Sbjct  52    GAVQILGPATKKQENQEDQLVWRTFPSVKKFWASPRQFALGH--WGKCRDNRQAKPLLSE  109

Query  1391  EFNSRVLEGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAG  1212
             EF + V EG+Q+    HQG I    R          RW+++  P   WG+     ++TAG
Sbjct  110   EFFATVKEGYQIHQNQHQGQIIHGDRH--------CRWQFTVEPEVTWGSPNRFPRATAG  161

Query  1211  WLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNV  1032
             WL+  P+F+P WQ+ +A G + GW++W  E+YEF++A  Y+EKNWG  FP +WFW+Q N 
Sbjct  162   WLSFLPLFDPGWQILLAQGRAHGWLKWQREQYEFDHALVYAEKNWGHSFPSRWFWLQANY  221

Query  1031  FEGADGEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWG  852
             F    G +S+T+ GG R + G       E  ALI +H+ G FYEF P +G+VTW+++PWG
Sbjct  222   FPDHPG-LSVTAAGGERIVLG-----RPEEVALIGLHHQGNFYEFGPGHGTVTWQVAPWG  275

Query  851   HWYITAEN  828
              W + A N
Sbjct  276   RWQLKASN  283



>ref|XP_003074244.1| RNA methyltransferase family protein (ISS) [Ostreococcus tauri]
Length=1009

 Score =   191 bits (484),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 121/340 (36%), Positives = 174/340 (51%), Gaps = 65/340 (19%)
 Frame = -1

Query  1736  LRTPHSGYHFD-GTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGR  1560
             ++TPHSGYH   GT R FFEGW+F+ ++P   QS   +Y V +P          +V+   
Sbjct  69    VKTPHSGYHRQVGTSRAFFEGWYFRFTLPRSAQSASLIYHVYDP----------DVETSA  118

Query  1559  RFTGVGAQILGADDKYI-CQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFN  1383
             R  G GAQ+     KY+  + +  S +F G  H L LG T                 +F 
Sbjct  119   R-AGAGAQVCAPGGKYLYSETSAGSGSFEGASHALELGMTR--------------GDDFF  163

Query  1382  SRVLEGFQVTPLWHQGFI-----RDDGRTDYAKTVKTARWEYSTRPIYGWGNV-GSKQKS  1221
                 EG +     H+G +     R+DG     +  ++ +W+ +  P+ GWG   G++ +S
Sbjct  164   EVSSEGTR-----HRGSLTSAGEREDGPWGAGRAARSVKWDIAVTPLRGWGGGPGARMQS  218

Query  1220  TAGWLAAFPVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGD-GFPRKWFWV  1044
              AGWL A PVFEPHWQV MA GL++GWIE DGER EF + P+YSEKNWG  GFP KWFW 
Sbjct  219   PAGWLTALPVFEPHWQVTMAHGLASGWIETDGERVEFSDCPAYSEKNWGGAGFPLKWFWA  278

Query  1043  QCNVF-EGADGEVSLTSGG-GLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPW------  888
             QCN F +  D  V++T G  G+  +P     +  E+  LI +H+G  F++F P       
Sbjct  279   QCNSFPDYPDLSVTVTGGNRGVVVLP-----NVREDVGLIGIHFGDRFFQFTPAVQVEIA  333

Query  887   ------------NGSVTWEISPWGHWYITAENATHKSQVE  804
                           +V W++  WG W ++A    ++  +E
Sbjct  334   ADAKYGAGQALEAAAVRWDVE-WGRWSVSAVGKRYECSIE  372


 Score = 48.1 bits (113),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = -3

Query  750  DPGTTLRAPTQEM--GLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVT-SNMAGVEVG  580
            D  T +RAPT  +  G+AP+CR+T    + + LW     G++ + I+D   S+ A +E+G
Sbjct  379  DKSTVIRAPTDSLEDGMAPLCRETFTGVIVVSLWRLDDRGARVETIIDAAMSSTACLEIG  438

Query  579  GGPW  568
            GGPW
Sbjct  439  GGPW  442



>ref|WP_019499269.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=340

 Score =   196 bits (499),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 109/312 (35%), Positives = 160/312 (51%), Gaps = 47/312 (15%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFTG  1548
             PHSGYH+ G   +FFEGW++++++P   QSF +MY++++P            Q G   +G
Sbjct  3     PHSGYHWRGGSDRFFEGWYYRLTLPRIGQSFAFMYAIDDP------------QGGTACSG  50

Query  1547  VGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVLE  1368
                Q+LG DD ++ +  P  + F   R  L L                    E      +
Sbjct  51    GSLQVLGIDDLHLWRTIPNPRTFHASRDRLML--------------------EHWGAAGQ  90

Query  1367  GFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNV---GSKQKSTAGWLAAF  1197
             G+  +   ++G I D        T  + RW+Y   PIY WGNV     +   T G+L+  
Sbjct  91    GYSASDRHNKGAISD------PVTSMSCRWDYHIEPIYTWGNVRDNAGQAIPTMGYLSYL  144

Query  1196  PVFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGAD  1017
             PVFEP WQ+ MA GL+TG I W+   YEF+ AP+Y EKNWG  FP++WFW+QCN F    
Sbjct  145   PVFEPGWQILMAHGLATGAIAWNDRVYEFDRAPAYCEKNWGRSFPQQWFWLQCNAFSEYP  204

Query  1016  GEVSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGVFYEFVPWNGSVTWEISPWGHWYIT  837
              ++++T  GG+R+  G   S      A++ +HY G  Y F+P N  +   I+PWG W I 
Sbjct  205   -DLTITVAGGIREFLGAARS-----VAMVGIHYNGKLYSFMPENSDIYCRIAPWGDWQIE  258

Query  836   AENATHKSQVEV  801
             A    + S  +V
Sbjct  259   AHKQEYGSPQDV  270



>ref|WP_011432254.1| tocopherol cyclase [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_476858.1| tocopherol cyclase [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD01595.1| putative tocopherol cyclase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=365

 Score =   183 bits (464),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/311 (35%), Positives = 163/311 (52%), Gaps = 39/311 (13%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIP-ECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFT  1551
             PH+GYH+DG   +FFEGW+ +V++P +   SF +MY+++                     
Sbjct  22    PHAGYHWDGCTERFFEGWYSRVTLPGDPPISFAFMYAIDPK------------------R  63

Query  1550  GVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVL  1371
             G  AQ+LG +++   +  P  + FW     L+LG++ I     R       P  F  R  
Sbjct  64    GGMAQVLGPEEELHWRTFPNPRRFWASSTHLALGHSGIPGPGCRGLQD---PFTFFQRTA  120

Query  1370  EGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPV  1191
              G+Q T   +QG + D   ++        RW Y  +P + +G      ++T G  +  P+
Sbjct  121   SGYQYTAHLNQGILPDPLGSE------PIRWLYRIQPRFAYG---IPPRATMGAWSYLPI  171

Query  1190  FEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGE  1011
             FEP WQ+ M+ GL+TGW+EW G RY F+ AP+Y+EKNWG  FPR+WFW+QCN F    G 
Sbjct  172   FEPGWQILMSHGLATGWVEWRGRRYAFQQAPAYAEKNWGQSFPRRWFWIQCNAFPQHPG-  230

Query  1010  VSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGV--FYEFVPWNGSVTWEISPWGHWYIT  837
             +SLT  G  RQ+         E  ALI++H  G   F E+ P +  +TW++ PWG W I 
Sbjct  231   LSLTCAGAERQV-----LTRPEEVALISLHGWGSQPFLEWRPGSARLTWQVDPWGSWRIR  285

Query  836   AENATHKSQVE  804
              E+A    Q+E
Sbjct  286   GESALWCIQLE  296


 Score = 51.6 bits (122),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            ++LE  T  PG T+ AP  E G+   CRDT    L LQLW+R  +G     ++  TS  A
Sbjct  293  IQLEGHTRRPGQTVFAPGPE-GMQRNCRDTLAGHLHLQLWQR--NGQVWTPVIKATSPQA  349

Query  594  GVEVGG  577
            G+EVGG
Sbjct  350  GLEVGG  355



>ref|WP_011429551.1| tocopherol cyclase [Synechococcus sp. JA-3-3Ab]
 ref|YP_474131.1| tocopherol cyclase [Synechococcus sp. JA-3-3Ab]
 gb|ABC98868.1| putative tocopherol cyclase [Synechococcus sp. JA-3-3Ab]
Length=360

 Score =   177 bits (450),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 110/311 (35%), Positives = 161/311 (52%), Gaps = 39/311 (13%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIP-ECRQSFCYMYSVENPAFTKPLSGIEEVQYGRRFT  1551
             PH GYH+DG    FFEGW+ +V++P +   SF +MY+++                 RR  
Sbjct  17    PHGGYHWDGCAEPFFEGWYSRVTLPGDPPLSFAFMYAIDP----------------RR--  58

Query  1550  GVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVL  1371
             G  AQ+LG +++   +  P  + FW     L+LG+      + R   +   P  F     
Sbjct  59    GGMAQVLGPEEELHWRTFPNPQRFWASWRHLALGHAGGPGESWRGLQE---PLTFFQHTA  115

Query  1370  EGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGNVGSKQKSTAGWLAAFPV  1191
              G+Q T   +QG + D  R +        RW Y  +    +G      ++T G  +  P+
Sbjct  116   SGYQYTARLNQGILPDPVRGE------AIRWLYRIQLCSAYG---IPPRATMGAWSYLPI  166

Query  1190  FEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADGE  1011
             FEP WQ+ M+ GL++GW+EW G R+EFE AP+Y+EKNWG  FPR+WFW+QCN F    G 
Sbjct  167   FEPGWQILMSHGLASGWVEWRGRRFEFEQAPAYAEKNWGQSFPRRWFWIQCNAFPNHSG-  225

Query  1010  VSLTSGGGLRQIPGPGTSDNFENAALIAVHYGGV--FYEFVPWNGSVTWEISPWGHWYIT  837
             +SLT  G  RQ+         E  ALI++H GG   F E+ P    +TW++ PWG W + 
Sbjct  226   LSLTCAGAERQV-----LTRPEEVALISLHGGGSQPFLEWRPGQARLTWQVDPWGSWQVR  280

Query  836   AENATHKSQVE  804
              E+A    Q+E
Sbjct  281   GEDARWCIQLE  291


 Score = 47.0 bits (110),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 3/66 (5%)
 Frame = -3

Query  774  VELEARTSDPGTTLRAPTQEMGLAPVCRDTCYADLRLQLWERRYDGSKGKAILDVTSNMA  595
            ++LE  T  PG T+  P  E G+   CRDT    L+++LW+R  +G     +L  +S+ A
Sbjct  288  IQLEGHTQRPGQTVFTPGPE-GMRRNCRDTLAGHLQVRLWQR--NGQVWTQVLAASSSQA  344

Query  594  GVEVGG  577
            G+EVGG
Sbjct  345  GLEVGG  350



>ref|XP_005789624.1| hypothetical protein EMIHUDRAFT_54133, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD37195.1| hypothetical protein EMIHUDRAFT_54133, partial [Emiliania huxleyi 
CCMP1516]
Length=337

 Score =   184 bits (467),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 122/314 (39%), Positives = 164/314 (52%), Gaps = 46/314 (15%)
 Frame = -1

Query  1727  PHSGYHFDGTRRQFFEGWFFKVSIPECRQSFCYMYSVENPAF-TKPLSGIEEVQYGRRFT  1551
             PHSGYH  G R   FEGW+ ++++ +   SF  +YS+ + A  T P  G           
Sbjct  1     PHSGYHLSG-RASGFEGWYHRLTVDDASLSF--IYSIFDAADETSPRHGCH---------  48

Query  1550  GVGAQILGADDKYICQYTPESKNFWGERHELSLGNTFIAQTAARPPNKEVPPQEFNSRVL  1371
                 Q+ G D     Q  P + +FW +  +L+LG +F         +K   P  F   V 
Sbjct  49    ---MQVCGPDGAVTWQEGP-AASFWADDRKLALGKSFRGVAF----SKMASPAAFGRFVQ  100

Query  1370  EGFQVTPLWHQGFIRDDGRTDYAKTVKTARWEYSTRPIYGWGN-VGSKQKSTAGWLAAFP  1194
             +GFQ++   HQG +RD           TARW Y      GWG  +G KQ STAGWLAAFP
Sbjct  101   DGFQLSSTRHQGVLRD----------GTARWSYEV----GWGGRLGDKQYSTAGWLAAFP  146

Query  1193  VFEPHWQVCMAAGLSTGWIEWDGERYEFENAPSYSEKNWGDGFPRKWFWVQCNVFEGADG  1014
             VFEP +QV MA GL++GW+EW GER EF +AP Y+EKNWG  FPR+W+WVQCN FE    
Sbjct  147   VFEPMYQVVMAHGLASGWVEWRGERREFRDAPCYTEKNWGGAFPRRWWWVQCNAFEARG-  205

Query  1013  EVSLTSGGGLRQIP--GPGTSDNFENAALIAVH-YGGVFYEFVPWNGSVTWEISPWGHWY  843
              ++LT   G R  P   P      E+A ++A+H   G FY F     +  W++  WG W 
Sbjct  206   -LTLTCACGERSNPLLEPLLPGRTEDACMVALHDESGKFYPFP----NCEWDVE-WGRWT  259

Query  842   ITAENATHKSQVEV  801
             +       + +VE 
Sbjct  260   VRGALDDLRVRVEA  273



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6388251163432