BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20270_g1_i1 len=666 path=[1908:0-54 1398:55-59 1713:60-97
196:98-112 211:113-136 235:137-208 307:209-247 346:248-271
370:272-313 5428:314-335 5450:336-353 850:354-364 861:365-387
884:388-413 5491:414-449 612:450-665]

Length=666
                                                                      Score     E

ref|XP_009401439.1|  PREDICTED: SKP1-like protein 1B                    149   3e-41   
ref|XP_003605515.1|  SKP1-like protein                                  145   4e-40   
ref|XP_006422586.1|  hypothetical protein CICLE_v10029465mg             142   2e-38   
gb|ACP20181.1|  SKP1-like protein                                       140   4e-38   Citrus maxima [buntan]
gb|EMT03939.1|  SKP1-like protein 1B                                    140   5e-38   
ref|XP_002279232.1|  PREDICTED: SKP1-like protein 1A isoform X5         139   1e-37   Vitis vinifera
ref|XP_011046062.1|  PREDICTED: SKP1-like protein 1B                    139   2e-37   
ref|XP_009624361.1|  PREDICTED: SKP1-like protein 1A isoform X1         139   2e-37   
ref|XP_009620406.1|  PREDICTED: SKP1-like protein 1A                    139   2e-37   
gb|EMT05501.1|  SKP1-like protein 1B                                    139   3e-37   
ref|XP_003605516.1|  SKP1-like protein                                  136   2e-36   
ref|XP_009373027.1|  PREDICTED: SKP1-like protein 1A                    136   3e-36   
ref|XP_009372999.1|  PREDICTED: SKP1-like protein 1A                    135   4e-36   
gb|EMT33027.1|  SKP1-like protein 1B                                    136   5e-36   
gb|EMT15375.1|  SKP1-like protein 4                                     135   8e-36   
ref|XP_002313704.1|  E3 ubiquitin ligase SCF complex subunit SKP1...    135   8e-36   Populus trichocarpa [western balsam poplar]
ref|XP_003636464.1|  SKP1-like protein                                  135   9e-36   
ref|XP_008382316.1|  PREDICTED: SKP1-like protein 1A                    135   1e-35   
ref|XP_004299943.1|  PREDICTED: SKP1-like protein 4-like                134   1e-35   
ref|XP_009372996.1|  PREDICTED: SKP1-like protein 1A                    134   2e-35   
gb|EMT03937.1|  SKP1-like protein 1A                                    134   2e-35   
ref|XP_008382314.1|  PREDICTED: SKP1-like protein 1A isoform X1         134   3e-35   
gb|EMS35771.1|  SKP1-like protein 1B                                    134   3e-35   
ref|XP_008232108.1|  PREDICTED: SKP1-like protein 1A                    133   3e-35   
gb|EMS59755.1|  SKP1-like protein 4                                     133   4e-35   
ref|XP_006304273.1|  hypothetical protein CARUB_v10010505mg             133   4e-35   
gb|EMT23721.1|  SKP1-like protein 1A                                    133   5e-35   
gb|AII79402.1|  S-phase kinase-associated protein 1-like protein 5      132   7e-35   
ref|XP_007219396.1|  hypothetical protein PRUPE_ppa020403mg             132   7e-35   
gb|EMT01680.1|  SKP1-like protein 1B                                    132   9e-35   
ref|XP_003628375.1|  SKP1-like protein                                  132   1e-34   
gb|KDO67761.1|  hypothetical protein CISIN_1g044292mg                   132   1e-34   
ref|XP_006436098.1|  hypothetical protein CICLE_v10033809mg             132   1e-34   
ref|XP_010683700.1|  PREDICTED: SKP1-like protein 1B isoform X3         131   2e-34   
ref|XP_008393845.1|  PREDICTED: SKP1-like protein 1A                    131   2e-34   
gb|AFM75900.1|  GSK1                                                    131   2e-34   
ref|XP_008337985.1|  PREDICTED: SKP1-like protein 1A                    130   3e-34   
ref|XP_002880415.1|  hypothetical protein ARALYDRAFT_481069             130   3e-34   
ref|XP_010935123.1|  PREDICTED: SKP1-like protein 1B                    130   4e-34   
ref|XP_003621661.1|  SKP1-like protein                                  130   4e-34   
ref|XP_008232155.1|  PREDICTED: SKP1-like protein 11                    130   5e-34   
ref|XP_010935122.1|  PREDICTED: SKP1-like protein 1A                    129   9e-34   
ref|XP_008382315.1|  PREDICTED: SKP1-like protein 1A isoform X2         129   1e-33   
ref|XP_003605505.1|  SKP1-like protein                                  129   1e-33   
ref|XP_007046627.1|  S phase kinase-associated protein 1                129   1e-33   
ref|NP_564105.1|  SKP1-like protein 4                                   129   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAT12490.1|  Skp1/Ask1-like protein                                  129   1e-33   Zantedeschia hybrid cultivar
ref|XP_004287783.1|  PREDICTED: SKP1-like protein 1A-like               129   1e-33   
ref|XP_003605510.1|  SKP1-like protein                                  129   1e-33   
ref|XP_006847969.1|  hypothetical protein AMTR_s00029p00153350          129   2e-33   
gb|KDP23982.1|  hypothetical protein JCGZ_25370                         129   2e-33   
ref|XP_007221090.1|  hypothetical protein PRUPE_ppa017105mg             129   2e-33   
ref|XP_002531150.1|  skp1, putative                                     129   2e-33   Ricinus communis
ref|XP_008806600.1|  PREDICTED: SKP1-like protein 1A                    129   2e-33   
ref|XP_007156190.1|  hypothetical protein PHAVU_003G265900g             128   2e-33   
ref|XP_010690359.1|  PREDICTED: SKP1-like protein 1B                    129   3e-33   
ref|XP_002305525.2|  E3 ubiquitin ligase SCF complex subunit SKP1...    128   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_007202708.1|  hypothetical protein PRUPE_ppa012752mg             128   3e-33   
ref|XP_008232104.1|  PREDICTED: SKP1-like protein 1B                    128   3e-33   
ref|XP_009334694.1|  PREDICTED: SKP1-like protein 1B                    128   3e-33   
ref|XP_008806601.1|  PREDICTED: SKP1-like protein 1A                    128   3e-33   
gb|KEH23694.1|  SCF ubiquitin ligase, SKP1 component                    127   5e-33   
ref|XP_006281119.1|  hypothetical protein CARUB_v10027150mg             129   5e-33   
gb|KHN41877.1|  SKP1-like protein 1A                                    127   5e-33   
gb|EMT15207.1|  SKP1-like protein 1B                                    127   6e-33   
ref|XP_009147940.1|  PREDICTED: SKP1-like protein 1A                    127   7e-33   
emb|CAA75117.1|  fimbriata-associated protein                           127   7e-33   Antirrhinum majus [garden snapdragon]
gb|AII79401.1|  S-phase kinase-associated protein 1-like protein 4      127   8e-33   
ref|XP_008357122.1|  PREDICTED: SKP1-like protein 1B                    127   8e-33   
ref|XP_010941328.1|  PREDICTED: SKP1-like protein 1A                    127   9e-33   
ref|XP_009379340.1|  PREDICTED: SKP1-like protein 1A                    127   1e-32   
ref|XP_007225985.1|  hypothetical protein PRUPE_ppa012755mg             127   1e-32   
ref|XP_010536422.1|  PREDICTED: SKP1-like protein 1A                    127   1e-32   
ref|XP_010683792.1|  PREDICTED: SKP1-like protein 1B                    127   1e-32   
ref|XP_007041813.1|  S phase kinase-associated protein 1                126   1e-32   
ref|XP_009363460.1|  PREDICTED: SKP1-like protein 1A                    126   1e-32   
gb|EYU17579.1|  hypothetical protein MIMGU_mgv1a015014mg                127   1e-32   
ref|XP_009414442.1|  PREDICTED: SKP1-like protein 1A                    126   2e-32   
gb|EMT01771.1|  SKP1-like protein 1B                                    129   2e-32   
ref|XP_009420815.1|  PREDICTED: SKP1-like protein 1A                    126   2e-32   
ref|XP_003605511.1|  SKP1                                               126   2e-32   
ref|XP_010683699.1|  PREDICTED: SKP1-like protein 1B isoform X2         126   2e-32   
ref|XP_007202707.1|  hypothetical protein PRUPE_ppa012732mg             126   2e-32   
ref|XP_002510576.1|  skp1, putative                                     126   2e-32   Ricinus communis
ref|XP_004512164.1|  PREDICTED: SKP1-like protein 1A-like               126   2e-32   
ref|XP_008811458.1|  PREDICTED: SKP1-like protein 1A                    126   2e-32   
gb|ABK96569.1|  unknown                                                 126   2e-32   Populus trichocarpa x Populus deltoides
gb|AAX83944.1|  Skp1                                                    126   2e-32   Capsicum annuum
ref|XP_003517160.1|  PREDICTED: SKP1-like protein 1A-like               126   2e-32   
ref|XP_002890373.1|  hypothetical protein ARALYDRAFT_889462             126   2e-32   
ref|NP_565604.1|  putative E3 ubiquitin ligase ASK3                     126   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|ABK92723.1|  unknown                                                 126   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002510577.1|  skp1, putative                                     125   2e-32   Ricinus communis
ref|XP_004512165.1|  PREDICTED: SKP1-like protein 1A-like               125   3e-32   
ref|XP_003612227.1|  SKP1-like protein                                  125   3e-32   
gb|KHG30151.1|  SKP1-like protein 1A                                    125   3e-32   
gb|ADQ00179.1|  E3 ubiquitin ligase                                     125   3e-32   
ref|XP_007157884.1|  hypothetical protein PHAVU_002G106100g             125   4e-32   
ref|XP_009395355.1|  PREDICTED: SKP1-like protein 1B                    125   4e-32   
ref|XP_010941330.1|  PREDICTED: SKP1-like protein 1B                    125   4e-32   
ref|XP_010683698.1|  PREDICTED: SKP1-like protein 1B isoform X1         125   4e-32   
gb|AAD34458.1|  Skp1                                                    125   4e-32   Medicago sativa [alfalfa]
ref|XP_010033522.1|  PREDICTED: SKP1-like protein 1B                    125   4e-32   
ref|XP_003612225.1|  SKP1-like protein                                  125   4e-32   
ref|XP_011083455.1|  PREDICTED: SKP1-like protein 1A                    125   4e-32   
ref|NP_001241052.1|  uncharacterized protein LOC100798104               125   5e-32   
ref|XP_006435227.1|  hypothetical protein CICLE_v10002751mg             125   5e-32   
gb|EMS52877.1|  SKP1-like protein 1B                                    125   5e-32   
ref|XP_003574990.1|  PREDICTED: SKP1-like protein 1A                    125   5e-32   
ref|XP_009395385.1|  PREDICTED: SKP1-like protein 1B                    125   5e-32   
ref|XP_011046673.1|  PREDICTED: SKP1-like protein 1A                    125   5e-32   
ref|XP_010266012.1|  PREDICTED: SKP1-like protein 1B                    125   5e-32   
ref|NP_001235349.1|  uncharacterized protein LOC100306458               125   6e-32   
ref|XP_002863814.1|  hypothetical protein ARALYDRAFT_917589             125   6e-32   
emb|CAA75118.1|  fimbriata-associated protein                           125   7e-32   Antirrhinum majus [garden snapdragon]
gb|ACU13236.1|  unknown                                                 124   8e-32   Glycine max [soybeans]
ref|NP_001235929.1|  uncharacterized protein LOC100527683               124   9e-32   
gb|KFK35110.1|  hypothetical protein AALP_AA5G237300                    124   1e-31   
gb|KDP36889.1|  hypothetical protein JCGZ_08180                         124   1e-31   
gb|KEH23692.1|  SCF ubiquitin ligase, SKP1 component                    124   1e-31   
gb|KFK36059.1|  hypothetical protein AALP_AA4G072500                    124   1e-31   
ref|XP_008811446.1|  PREDICTED: SKP1-like protein 1A                    124   1e-31   
ref|XP_009149503.1|  PREDICTED: SKP1-like protein 4                     124   1e-31   
ref|XP_010494151.1|  PREDICTED: SKP1-like protein 1B                    124   1e-31   
ref|XP_004287067.1|  PREDICTED: SKP1-like protein 4-like                124   1e-31   
gb|ACJ86090.1|  unknown                                                 123   2e-31   Medicago truncatula
ref|NP_565296.1|  SKP1-like protein 14                                  123   2e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44209.1|  BnaC05g15660D                                          123   3e-31   
ref|XP_009624363.1|  PREDICTED: SKP1-like protein 1A isoform X2         123   3e-31   
ref|XP_008445323.1|  PREDICTED: SKP1-like protein 1B                    123   3e-31   
gb|KDP29669.1|  hypothetical protein JCGZ_18831                         123   3e-31   
ref|XP_002537506.1|  skp1, putative                                     123   3e-31   Ricinus communis
gb|EPS66410.1|  hypothetical protein M569_08366                         123   4e-31   
ref|XP_009779583.1|  PREDICTED: SKP1-like protein 1A                    122   4e-31   
ref|XP_009783395.1|  PREDICTED: SKP1-like protein 1A                    122   4e-31   
ref|XP_006286731.1|  hypothetical protein CARUB_v10002974mg             122   4e-31   
ref|XP_010442189.1|  PREDICTED: SKP1-like protein 1B                    123   4e-31   
ref|XP_002270061.1|  PREDICTED: SKP1-like protein 1B                    122   4e-31   Vitis vinifera
ref|XP_010550803.1|  PREDICTED: SKP1-like protein 1B                    122   4e-31   
gb|AFK44762.1|  unknown                                                 122   4e-31   
ref|XP_002301954.1|  hypothetical protein POPTR_0002s02020g             122   4e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006362720.1|  PREDICTED: SKP1-like protein 1B-like               122   4e-31   
emb|CDP16774.1|  unnamed protein product                                122   5e-31   
ref|XP_002306950.1|  hypothetical protein POPTR_0005s26450g             122   5e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011043147.1|  PREDICTED: SKP1-like protein 1B                    122   6e-31   
gb|KHG24597.1|  SKP1-like protein 1B                                    122   6e-31   
gb|AAO85510.1|  SKP1                                                    122   6e-31   Nicotiana benthamiana
ref|XP_004146156.1|  PREDICTED: SKP1-like protein 1B-like               122   7e-31   
gb|ABS17589.1|  SKP1 component-like 1                                   122   7e-31   Humulus lupulus [common hop]
gb|ABB77425.1|  Skp1-like protein 3                                     122   8e-31   Petunia integrifolia subsp. inflata
gb|ACA61785.1|  SKP1-like protein 3                                     122   8e-31   Petunia x hybrida [garden petunia]
gb|ABB77426.1|  Skp1-like protein 1                                     122   9e-31   Petunia integrifolia subsp. inflata
emb|CDX85931.1|  BnaC06g22030D                                          121   1e-30   
ref|XP_004250723.1|  PREDICTED: SKP1-like protein 1A                    121   1e-30   
gb|EMT17500.1|  hypothetical protein F775_42820                         121   1e-30   
gb|AAT99735.1|  SKP1                                                    121   1e-30   Nicotiana tabacum [American tobacco]
ref|XP_010680409.1|  PREDICTED: SKP1-like protein 1B                    121   1e-30   
ref|XP_004291337.1|  PREDICTED: SKP1-like protein 1B-like               121   1e-30   
ref|XP_010095548.1|  SKP1-like protein 1B                               121   1e-30   
emb|CDP14555.1|  unnamed protein product                                121   1e-30   
gb|AFB18000.1|  SKP1 protein                                            121   2e-30   
ref|XP_004143010.1|  PREDICTED: SKP1-like protein 1B-like               121   2e-30   
ref|XP_010471746.1|  PREDICTED: SKP1-like protein 1A                    121   2e-30   
ref|XP_004289997.1|  PREDICTED: SKP1-like protein 4-like                120   2e-30   
ref|XP_006359705.1|  PREDICTED: SKP1-like protein 1B-like               121   2e-30   
ref|XP_008448523.1|  PREDICTED: SKP1-like protein 1B                    120   2e-30   
ref|XP_010539092.1|  PREDICTED: SKP1-like protein 1B                    120   2e-30   
ref|XP_004231049.1|  PREDICTED: SKP1-like protein 1B                    120   2e-30   
ref|XP_011003066.1|  PREDICTED: SKP1-like protein 1B                    120   3e-30   
ref|XP_004306259.1|  PREDICTED: SKP1-like protein 4-like                121   3e-30   
emb|CDY40610.1|  BnaC06g02260D                                          120   3e-30   
gb|ABB69022.1|  SKP1                                                    120   3e-30   Brassica napus [oilseed rape]
ref|XP_006285109.1|  hypothetical protein CARUB_v10006442mg             120   3e-30   
gb|ACA61784.1|  SKP1-like protein 2                                     120   3e-30   Petunia x hybrida [garden petunia]
ref|XP_004301672.1|  PREDICTED: SKP1-like protein 4-like                120   4e-30   
ref|XP_011092967.1|  PREDICTED: SKP1-like protein 1A                    120   4e-30   
ref|XP_004159727.1|  PREDICTED: SKP1-like protein 1A-like               120   4e-30   
ref|NP_568603.1|  SKP1-like protein 1B                                  120   4e-30   Arabidopsis thaliana [mouse-ear cress]
gb|EPS61104.1|  hypothetical protein M569_13700                         120   5e-30   
gb|AAC63110.1|  UIP2                                                    120   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009591491.1|  PREDICTED: SKP1-like protein 1A                    119   7e-30   
dbj|BAB85606.1|  kinetochore protein                                    119   7e-30   Brassica juncea [brown mustard]
gb|AFK43118.1|  unknown                                                 119   7e-30   
ref|XP_006360903.1|  PREDICTED: SKP1-like protein 1B-like               119   9e-30   
ref|XP_006292236.1|  hypothetical protein CARUB_v10018443mg             119   9e-30   
ref|XP_008245788.1|  PREDICTED: SKP1-like protein 11                    119   1e-29   
ref|XP_010266846.1|  PREDICTED: SKP1-like protein 1B isoform X1         119   1e-29   
ref|XP_007201294.1|  hypothetical protein PRUPE_ppa012728mg             119   1e-29   
ref|XP_010266848.1|  PREDICTED: SKP1-like protein 1B isoform X2         118   1e-29   
gb|ABB77427.1|  Skp1-like protein 2                                     118   2e-29   Petunia integrifolia subsp. inflata
ref|XP_011088616.1|  PREDICTED: SKP1-like protein 1A                    118   2e-29   
gb|ACA61783.1|  SKP1-like protein 1                                     118   2e-29   Petunia x hybrida [garden petunia]
ref|XP_009372997.1|  PREDICTED: SKP1-like protein 1A isoform X1         118   2e-29   
ref|XP_006390250.1|  hypothetical protein EUTSA_v10019260mg             118   2e-29   
emb|CDX73212.1|  BnaC06g36600D                                          118   2e-29   
ref|XP_008236029.1|  PREDICTED: SKP1-like protein 1A                    118   2e-29   
ref|XP_010416502.1|  PREDICTED: SKP1-like protein 1A                    118   3e-29   
dbj|BAE72121.1|  SKP1-like protein                                      118   3e-29   Silene latifolia
dbj|BAB85607.1|  kinetochore protein                                    117   3e-29   Brassica juncea [brown mustard]
ref|XP_006425391.1|  hypothetical protein CICLE_v10026642mg             118   3e-29   
gb|KDO71310.1|  hypothetical protein CISIN_1g030962mg                   118   3e-29   
ref|NP_567959.1|  SKP1-like protein 11                                  117   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28664.1|  unknown                                                 117   4e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CDM86749.1|  unnamed protein product                                117   4e-29   
ref|XP_004248654.1|  PREDICTED: SKP1-like protein 1B                    117   5e-29   
gb|KEH23696.1|  SCF ubiquitin ligase, SKP1 component                    117   5e-29   
ref|XP_009418685.1|  PREDICTED: SKP1-like protein 1A                    117   5e-29   
gb|KEH19789.1|  SCF ubiquitin ligase, SKP1 component                    117   5e-29   
ref|NP_565467.1|  SKP1-like protein 17                                  117   5e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ91150.1|  predicted protein                                      117   7e-29   
gb|KEH23706.1|  SCF ubiquitin ligase, SKP1 component                    117   7e-29   
emb|CDP16772.1|  unnamed protein product                                117   7e-29   
ref|XP_006359704.1|  PREDICTED: SKP1-like protein 1B-like               116   8e-29   
ref|XP_004248653.2|  PREDICTED: SKP1-like protein 1B                    116   1e-28   
ref|XP_010450797.1|  PREDICTED: SKP1-like protein 11                    116   1e-28   
ref|XP_009372998.1|  PREDICTED: SKP1-like protein 1A isoform X2         116   1e-28   
ref|XP_010448526.1|  PREDICTED: SKP1-like protein 4                     116   1e-28   
ref|XP_010477249.1|  PREDICTED: SKP1-like protein 4                     116   1e-28   
ref|XP_004144851.1|  PREDICTED: SKP1-like protein 1B-like               115   1e-28   
gb|EMT01637.1|  SKP1-like protein 1B                                    115   2e-28   
ref|XP_009104691.1|  PREDICTED: SKP1-like protein 1A                    115   2e-28   
ref|XP_010447075.1|  PREDICTED: SKP1-like protein 11 isoform X1         115   2e-28   
dbj|BAB85605.1|  kinetochore protein                                    115   2e-28   Brassica juncea [brown mustard]
gb|KFK42033.1|  hypothetical protein AALP_AA2G203200                    115   2e-28   
ref|XP_010425103.1|  PREDICTED: SKP1-like protein 16                    115   2e-28   
ref|XP_003573486.1|  PREDICTED: SKP1-like protein 1A                    115   2e-28   
ref|XP_008357536.1|  PREDICTED: SKP1-like protein 1A                    116   3e-28   
ref|XP_010669692.1|  PREDICTED: SKP1-like protein 1B                    115   3e-28   
ref|XP_010438976.1|  PREDICTED: SKP1-like protein 4                     115   3e-28   
ref|NP_567967.1|  SKP1-like protein 12                                  115   3e-28   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE72119.1|  SKP1-like protein                                      115   3e-28   Silene latifolia
ref|XP_002885471.1|  hypothetical protein ARALYDRAFT_898637             115   3e-28   
ref|XP_008447950.1|  PREDICTED: SKP1-like protein 1B                    115   4e-28   
ref|XP_010433736.1|  PREDICTED: SKP1-like protein 4                     115   4e-28   
gb|AII79406.1|  S-phase kinase-associated protein 1-like protein 6      115   4e-28   
ref|NP_565123.1|  S-phase kinase-associated protein 1                   114   5e-28   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE72118.1|  SKP1-like protein                                      115   5e-28   Silene latifolia
ref|XP_006302938.1|  hypothetical protein CARUB_v10021077mg             114   5e-28   
dbj|BAB85603.1|  kinetochore protein                                    114   5e-28   Brassica juncea [brown mustard]
ref|XP_002878309.1|  hypothetical protein ARALYDRAFT_907521             114   5e-28   
ref|XP_009106248.1|  PREDICTED: SKP1-like protein 1A                    114   5e-28   
ref|XP_001690964.1|  E3 ubiquitin ligase                                114   5e-28   Chlamydomonas reinhardtii
ref|XP_002453117.1|  hypothetical protein SORBIDRAFT_04g000330          115   5e-28   Sorghum bicolor [broomcorn]
ref|XP_009128146.1|  PREDICTED: SKP1-like protein 1A                    114   5e-28   
emb|CDY13521.1|  BnaC02g23320D                                          114   6e-28   
gb|EMS45381.1|  SKP1-like protein 1B                                    115   6e-28   
ref|XP_010061081.1|  PREDICTED: SKP1-like protein 1B isoform X1         114   8e-28   
ref|XP_002885472.1|  hypothetical protein ARALYDRAFT_898638             114   8e-28   
emb|CCG34083.1|  SCF ubiquitin ligase                                   114   8e-28   
ref|XP_008347749.1|  PREDICTED: SKP1-like protein 1A                    115   8e-28   
ref|XP_009362142.1|  PREDICTED: SKP1-like protein 1A                    114   9e-28   
ref|XP_006393304.1|  hypothetical protein EUTSA_v10012168mg             114   9e-28   
ref|XP_010441003.1|  PREDICTED: SKP1-like protein 11                    114   1e-27   
ref|XP_010441072.1|  PREDICTED: SKP1-like protein 11                    113   1e-27   
ref|XP_010113308.1|  SKP1-like protein 1A                               114   1e-27   
ref|XP_004289877.1|  PREDICTED: SKP1-like protein 4-like                113   1e-27   
dbj|BAB85604.1|  kinetochore protein                                    113   1e-27   Brassica juncea [brown mustard]
ref|XP_010440828.1|  PREDICTED: SKP1-like protein 1A                    113   1e-27   
ref|XP_009355656.1|  PREDICTED: SKP1-like protein 1A                    113   1e-27   
gb|KFK35210.1|  hypothetical protein AALP_AA5G254700                    113   1e-27   
ref|XP_010646804.1|  PREDICTED: SKP1-like protein 1A isoform X3         117   1e-27   
ref|XP_010646801.1|  PREDICTED: SKP1-like protein 1A isoform X2         117   1e-27   
ref|XP_009382729.1|  PREDICTED: SKP1-like protein 1A                    113   2e-27   
gb|EAZ06798.1|  hypothetical protein OsI_29042                          113   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_010437611.1|  PREDICTED: SKP1-like protein 11                    113   2e-27   
gb|EMT30556.1|  SKP1-like protein 4                                     114   2e-27   
ref|XP_010459699.1|  PREDICTED: SKP1-like protein 4                     113   2e-27   
ref|XP_003577587.1|  PREDICTED: SKP1-like protein 1A                    114   2e-27   
emb|CBI37863.3|  unnamed protein product                                112   2e-27   
ref|XP_002462746.1|  hypothetical protein SORBIDRAFT_02g031280          113   3e-27   Sorghum bicolor [broomcorn]
gb|AAT37114.1|  skp1-like protein                                       113   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004304041.1|  PREDICTED: SKP1-like protein 4-like                112   3e-27   
ref|XP_010428644.1|  PREDICTED: SKP1-like protein 1A                    112   3e-27   
ref|XP_010029647.1|  PREDICTED: SKP1-like protein 1B isoform X1         112   3e-27   
gb|AGT16907.1|  SKP1-like protein                                       113   3e-27   
emb|CDY40611.1|  BnaC06g02270D                                          112   4e-27   
ref|XP_009147939.1|  PREDICTED: SKP1-like protein 13                    112   4e-27   
ref|XP_002277864.1|  PREDICTED: uncharacterized protein LOC100257...    117   4e-27   Vitis vinifera
emb|CDX93699.1|  BnaA06g03490D                                          112   4e-27   
gb|AGU28415.1|  S phase kinase-associated protein 1                     112   4e-27   
gb|EAZ06800.1|  hypothetical protein OsI_29044                          112   5e-27   
gb|EMT23720.1|  SKP1-like protein 1A                                    111   5e-27   
ref|XP_003616859.1|  SKP1-like protein                                  112   5e-27   
ref|XP_002889795.1|  hypothetical protein ARALYDRAFT_471136             112   5e-27   
ref|XP_008791979.1|  PREDICTED: SKP1-like protein 1A                    112   5e-27   
ref|XP_006393346.1|  hypothetical protein EUTSA_v10012186mg             112   6e-27   
ref|XP_006393344.1|  hypothetical protein EUTSA_v10012032mg             112   6e-27   
ref|XP_006393342.1|  hypothetical protein EUTSA_v10012113mg             111   6e-27   
gb|ABK28567.1|  unknown                                                 111   6e-27   
ref|XP_002947872.1|  hypothetical protein VOLCADRAFT_73445              111   6e-27   
ref|NP_566694.1|  SKP1-like protein 9                                   111   6e-27   
ref|XP_009363144.1|  PREDICTED: uncharacterized protein LOC103953139    114   7e-27   
ref|XP_006360901.1|  PREDICTED: SKP1-like protein 1B-like               111   8e-27   
gb|EMS57884.1|  SKP1-like protein 4                                     112   9e-27   
ref|XP_007024458.1|  SKP1-like 4                                        111   1e-26   
dbj|BAD46569.1|  putative UIP2                                          111   1e-26   
ref|XP_002883942.1|  hypothetical protein ARALYDRAFT_899849             111   1e-26   
ref|NP_001061672.1|  Os08g0375700                                       111   1e-26   
gb|AGF33287.1|  SKP1 1A-like protein                                    110   1e-26   
ref|XP_008372868.1|  PREDICTED: SKP1-like protein 1B                    110   2e-26   
ref|NP_566695.1|  SKP1-like protein 10                                  110   2e-26   
emb|CDP16773.1|  unnamed protein product                                110   2e-26   
ref|XP_004965641.1|  PREDICTED: SKP1-like protein 1B-like               111   2e-26   
ref|XP_002976912.1|  hypothetical protein SELMODRAFT_271223             110   2e-26   
gb|EMT28670.1|  SKP1-like protein 4                                     114   2e-26   
ref|XP_006395735.1|  hypothetical protein EUTSA_v10005053mg             110   2e-26   
gb|KFK33482.1|  hypothetical protein AALP_AA5G019000                    110   2e-26   
ref|XP_001422389.1|  predicted protein                                  110   2e-26   
emb|CCG34069.1|  SCF ubiquitin ligase                                   110   2e-26   
gb|ABK21374.1|  unknown                                                 110   3e-26   
dbj|BAE72120.1|  SKP1-like protein                                      111   3e-26   
ref|XP_010539834.1|  PREDICTED: SKP1-like protein 1A                    110   3e-26   
emb|CCG34078.1|  SCF ubiquitin ligase                                   110   3e-26   
ref|XP_006291986.1|  hypothetical protein CARUB_v10018174mg             110   3e-26   
ref|XP_007897164.1|  PREDICTED: S-phase kinase-associated protein...    110   4e-26   
gb|ABK25195.1|  unknown                                                 109   4e-26   
ref|XP_010514085.1|  PREDICTED: SKP1-like protein 14                    109   4e-26   
emb|CCG34082.1|  SCF ubiquitin ligase                                   109   4e-26   
gb|EMT17797.1|  SKP1-like protein 1B                                    109   4e-26   
ref|XP_010463461.1|  PREDICTED: uncharacterized protein LOC104744147    113   5e-26   
gb|ERZ98523.1|  hypothetical protein GLOINDRAFT_339581                  109   5e-26   
ref|XP_004248652.1|  PREDICTED: SKP1-like protein 1B                    109   5e-26   
ref|XP_001753554.1|  predicted protein                                  109   6e-26   
ref|XP_006393343.1|  hypothetical protein EUTSA_v10012026mg             108   7e-26   
ref|XP_006393341.1|  hypothetical protein EUTSA_v10012272mg             108   8e-26   
gb|ACR38888.1|  SKP1                                                    108   9e-26   
emb|CAB87834.1|  putative kinetochore protein                           107   9e-26   
gb|KEH29322.1|  SCF ubiquitin ligase, SKP1 component                    108   9e-26   
ref|XP_001753031.1|  predicted protein                                  108   9e-26   
ref|XP_006360899.1|  PREDICTED: SKP1-like protein 1B-like isoform X1    108   9e-26   
ref|XP_008242039.1|  PREDICTED: SKP1-like protein 1A                    108   1e-25   
ref|NP_001056599.1|  Os06g0113800                                       108   1e-25   
pdb|3L2O|A  Chain A, Structure-Based Mechanism Of Dimerization-De...    108   1e-25   
ref|XP_002887622.1|  hypothetical protein ARALYDRAFT_339769             115   1e-25   
ref|XP_006393347.1|  hypothetical protein EUTSA_v10011957mg             108   1e-25   
pdb|1FQV|B  Chain B, Insights Into Scf Ubiquitin Ligases From The...    108   1e-25   
emb|CCG34081.1|  SCF ubiquitin ligase                                   108   1e-25   
emb|CCG34080.1|  SCF ubiquitin ligase                                   108   1e-25   
ref|XP_010502325.1|  PREDICTED: SKP1-like protein 14                    108   1e-25   
emb|CCG34070.1|  SCF ubiquitin ligase                                   108   2e-25   
ref|XP_010430688.1|  PREDICTED: SKP1-like protein 14                    108   2e-25   
ref|XP_006660908.1|  PREDICTED: SKP1-like protein 1B-like               108   2e-25   
ref|XP_010107659.1|  SKP1-like protein 4                                108   2e-25   
ref|XP_008382346.1|  PREDICTED: SKP1-like protein 1A                    107   2e-25   
gb|AEQ39057.1|  putative SKP1-like protein 1                            108   2e-25   
ref|XP_009413024.1|  PREDICTED: SKP1-like protein 1A                    108   2e-25   
ref|XP_010510863.1|  PREDICTED: SKP1-like protein 14                    108   2e-25   
ref|XP_002444405.1|  hypothetical protein SORBIDRAFT_07g021450          107   3e-25   
gb|EMS53773.1|  SKP1-like protein 1B                                    108   3e-25   
gb|AAX92710.1|  SCF ubiquitin ligase                                    108   3e-25   
ref|XP_004957494.1|  PREDICTED: SKP1-like protein 1B-like               107   3e-25   
pdb|1P22|B  Chain B, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin ...    107   3e-25   
ref|XP_009623472.1|  PREDICTED: SKP1-like protein 1B                    107   3e-25   
emb|CCG34079.1|  SCF ubiquitin ligase                                   107   4e-25   
ref|XP_010447073.1|  PREDICTED: SKP1-like protein 11                    107   4e-25   
dbj|BAC37220.1|  unnamed protein product                                107   4e-25   
emb|CDM80524.1|  unnamed protein product                                107   4e-25   
gb|KFK33484.1|  hypothetical protein AALP_AA5G019200                    107   4e-25   
ref|NP_001176525.1|  Os11g0456300                                       107   4e-25   
ref|XP_005682996.1|  PREDICTED: S-phase kinase-associated protein 1     107   4e-25   
ref|XP_008670886.1|  PREDICTED: SKP1-like protein 1A                    107   4e-25   
ref|XP_010514081.1|  PREDICTED: SKP1-like protein 14                    107   4e-25   
ref|XP_004231048.1|  PREDICTED: SKP1-like protein 1A                    107   5e-25   
ref|NP_001131741.1|  SKP1-like protein 1A                               107   5e-25   
emb|CCG34073.1|  SCF ubiquitin ligase                                   107   5e-25   
ref|XP_010507115.1|  PREDICTED: SKP1-like protein 14                    107   5e-25   
ref|XP_010028740.1|  PREDICTED: SKP1-like protein 1A                    107   5e-25   
ref|XP_010327537.1|  PREDICTED: SKP1-like protein 11                    107   6e-25   
ref|XP_010918206.1|  PREDICTED: SKP1-like protein 1A                    106   6e-25   
emb|CAE53885.1|  putative SKP1 protein                                  107   6e-25   
ref|XP_006661910.1|  PREDICTED: SKP1-like protein 1B-like               107   6e-25   
ref|XP_006646753.1|  PREDICTED: SKP1-like protein 1B-like               106   6e-25   
ref|XP_007219120.1|  hypothetical protein PRUPE_ppa015805mg             105   7e-25   
ref|XP_002867118.1|  hypothetical protein ARALYDRAFT_912943             106   8e-25   
ref|XP_010241289.1|  PREDICTED: SKP1-like protein 11                    106   8e-25   
ref|XP_002878310.1|  hypothetical protein ARALYDRAFT_907522             106   8e-25   
ref|XP_003621659.1|  SKP1-like protein                                  106   8e-25   
ref|XP_006077385.1|  PREDICTED: S-phase kinase-associated protein...    106   1e-24   
gb|AAT37113.1|  skp1-like protein                                       106   1e-24   
ref|XP_006416426.1|  hypothetical protein EUTSA_v10008964mg             106   1e-24   
ref|XP_005989408.1|  PREDICTED: S-phase kinase-associated protein 1     106   1e-24   
gb|ADO28170.1|  s-phase kinase-associated protein 1                     105   1e-24   
ref|NP_565297.1|  SKP1-like protein 16                                  106   1e-24   
gb|KCW55544.1|  hypothetical protein EUGRSUZ_I01426                     105   1e-24   
gb|ELK03088.1|  S-phase kinase-associated protein 1                     107   1e-24   
ref|XP_010514084.1|  PREDICTED: SKP1-like protein 14                    106   1e-24   
dbj|BAE38934.1|  unnamed protein product                                105   1e-24   
ref|XP_007626762.1|  PREDICTED: S-phase kinase-associated protein...    105   1e-24   
ref|XP_010502326.1|  PREDICTED: SKP1-like protein 14                    105   1e-24   
ref|XP_007899481.1|  PREDICTED: S-phase kinase-associated protein 1     105   1e-24   
ref|XP_011018424.1|  PREDICTED: SKP1-like protein 1A                    106   1e-24   
gb|EMT17502.1|  hypothetical protein F775_42821                         107   1e-24   
tpg|DAA31900.1|  TPA: S-phase kinase-associated protein 1A (p19A)...    105   1e-24   
ref|XP_003063597.1|  predicted protein                                  105   1e-24   
ref|NP_001271685.1|  S-phase kinase-associated protein 1                105   2e-24   
emb|CCG34071.1|  SCF ubiquitin ligase                                   105   2e-24   
pdb|2ASS|A  Chain A, Crystal Structure Of The Skp1-Skp2-Cks1 Complex    105   2e-24   
ref|XP_011075000.1|  PREDICTED: SKP1-like protein 1A                    105   2e-24   
gb|KFK44141.1|  hypothetical protein AALP_AA1G220400                    104   2e-24   
ref|XP_006050644.1|  PREDICTED: S-phase kinase-associated protein...    105   2e-24   
ref|NP_733779.1|  S-phase kinase-associated protein 1 isoform b         105   2e-24   
emb|CAH92499.1|  hypothetical protein                                   105   2e-24   
ref|XP_001094634.1|  PREDICTED: s-phase kinase-associated protein...    105   2e-24   
ref|XP_004951176.1|  PREDICTED: SKP1-like protein 1B-like               105   2e-24   
ref|XP_006246306.1|  PREDICTED: S-phase kinase-associated protein...    105   2e-24   
gb|EMT30811.1|  SKP1-like protein 10                                    106   2e-24   
ref|NP_001007609.1|  S-phase kinase-associated protein 1                105   2e-24   
pdb|2E31|B  Chain B, Structural Basis For Selection Of Glycosylat...    105   2e-24   
ref|XP_009089617.1|  PREDICTED: S-phase kinase-associated protein...    105   2e-24   
ref|XP_010430692.1|  PREDICTED: SKP1-like protein 14                    105   2e-24   
gb|ACM09794.1|  S-phase kinase-associated protein 1                     105   2e-24   
gb|ACO07792.1|  S-phase kinase-associated protein 1A                    105   2e-24   
ref|XP_010782933.1|  PREDICTED: S-phase kinase-associated protein...    105   2e-24   
ref|XP_006050645.1|  PREDICTED: S-phase kinase-associated protein...    105   2e-24   
ref|XP_001634923.1|  predicted protein                                  105   2e-24   
ref|XP_005626457.1|  PREDICTED: S-phase kinase-associated protein...    105   2e-24   
ref|XP_007626771.1|  PREDICTED: S-phase kinase-associated protein...    105   2e-24   
gb|ERE68924.1|  S-phase kinase-associated protein 1                     105   2e-24   
ref|XP_004042556.1|  PREDICTED: S-phase kinase-associated protein 1     105   2e-24   
ref|NP_001187838.1|  S-phase kinase-associated protein 1                105   2e-24   
gb|ACM09656.1|  S-phase kinase-associated protein 1                     105   2e-24   
ref|XP_009926678.1|  PREDICTED: S-phase kinase-associated protein 1     105   2e-24   
ref|XP_010432410.1|  PREDICTED: SKP1-like protein 11                    104   3e-24   
gb|EAW62274.1|  S-phase kinase-associated protein 1A (p19A), isof...    105   3e-24   
ref|XP_007072799.1|  PREDICTED: LOW QUALITY PROTEIN: S-phase kina...    105   3e-24   
ref|NP_001279160.1|  S-phase kinase-associated protein 1                105   3e-24   
ref|XP_004287435.1|  PREDICTED: SKP1-like protein 1A-like               104   3e-24   
gb|KFO26595.1|  S-phase kinase-associated protein 1                     105   3e-24   
gb|KEH29323.1|  SCF ubiquitin ligase, SKP1 component                    107   3e-24   
ref|XP_004659400.1|  PREDICTED: S-phase kinase-associated protein...    104   3e-24   
ref|NP_957037.1|  S-phase kinase-associated protein 1                   104   4e-24   
ref|XP_006281512.1|  hypothetical protein CARUB_v10027610mg             104   4e-24   
gb|AAK26104.1|AF132729_1  SKP1-like protein ASK10                       104   4e-24   
gb|AAP79890.1|  SKP1/ASK1-like protein                                  105   4e-24   
ref|XP_009138886.1|  PREDICTED: SKP1-like protein 1A                    104   4e-24   
ref|XP_008330539.1|  PREDICTED: S-phase kinase-associated protein 1     104   4e-24   
ref|XP_008670859.1|  PREDICTED: SKP1-like protein 1A                    105   4e-24   
ref|XP_009786816.1|  PREDICTED: SKP1-like protein 1A                    104   4e-24   
emb|CEG00859.1|  E3 ubiquitin ligase, SCF complex, Skp subunit          104   4e-24   
ref|XP_002318669.2|  hypothetical protein POPTR_0012s08710g             104   4e-24   
ref|XP_009627980.1|  PREDICTED: SKP1-like protein 1B                    103   4e-24   
gb|EYU37961.1|  hypothetical protein MIMGU_mgv1a019768mg                104   4e-24   
ref|XP_005694913.1|  PREDICTED: S-phase kinase-associated protein...    104   5e-24   
ref|XP_006753615.1|  PREDICTED: S-phase kinase-associated protein...    104   5e-24   
ref|XP_005686366.1|  PREDICTED: S-phase kinase-associated protein...    104   5e-24   
emb|CDX96963.1|  BnaC02g31010D                                          105   5e-24   
emb|CAA75119.1|  fimbriata-associated protein                           103   5e-24   
ref|XP_008671925.1|  PREDICTED: SKP1-like protein 1A                    104   5e-24   
ref|XP_004401227.1|  PREDICTED: S-phase kinase-associated protein...    104   5e-24   
ref|NP_567090.1|  SKP1-like protein 13                                  103   5e-24   
ref|XP_010028736.1|  PREDICTED: SKP1-like protein 1A                    104   6e-24   
gb|ACS69067.1|  pollen specific SKP1-like protein LSK3                  103   6e-24   
ref|XP_004629415.1|  PREDICTED: S-phase kinase-associated protein 1     103   6e-24   
ref|XP_002875194.1|  hypothetical protein ARALYDRAFT_904588             103   6e-24   
ref|XP_005901162.1|  PREDICTED: S-phase kinase-associated protein...    103   6e-24   
ref|XP_007472287.1|  PREDICTED: LOW QUALITY PROTEIN: S-phase kina...    103   6e-24   
ref|XP_010435879.1|  PREDICTED: SKP1-like protein 11                    103   7e-24   
ref|XP_010254888.1|  PREDICTED: SKP1-like protein 1A                    104   7e-24   
gb|EMT14444.1|  SKP1-like protein 1B                                    103   7e-24   
emb|CAB85491.1|  putative kinetochore protein                           104   7e-24   
ref|XP_006293215.1|  hypothetical protein CARUB_v10019539mg             103   8e-24   
ref|XP_009376944.1|  PREDICTED: SKP1-like protein 1B                    103   8e-24   
ref|XP_010056210.1|  PREDICTED: SKP1-like protein 1B                    103   9e-24   
ref|XP_004407998.1|  PREDICTED: S-phase kinase-associated protein...    103   9e-24   
emb|CCG34074.1|  SCF ubiquitin ligase                                   103   9e-24   
ref|XP_011047805.1|  PREDICTED: SKP1-like protein 1B                    103   1e-23   
ref|XP_002504623.1|  predicted protein                                  103   1e-23   
ref|XP_006292823.1|  hypothetical protein CARUB_v10019075mg             103   1e-23   
tpg|DAA42254.1|  TPA: SKP1-like protein 1A                              103   1e-23   
ref|XP_008800182.1|  PREDICTED: SKP1-like protein 1A                    103   1e-23   
emb|CDX89042.1|  BnaA04g01440D                                          103   1e-23   
ref|XP_002875195.1|  hypothetical protein ARALYDRAFT_484224             103   1e-23   
ref|XP_006292400.1|  hypothetical protein CARUB_v10018613mg             103   1e-23   
ref|NP_001161649.1|  S-phase kinase associated protein 1-like pro...    103   1e-23   
ref|XP_010029649.1|  PREDICTED: SKP1-like protein 1B                    102   1e-23   
ref|XP_004339218.1|  Sphase kinase-associated protein, putative         102   1e-23   
emb|CAJ38400.1|  fimbriata-associated protein                           103   1e-23   
gb|ACE87228.1|  S-phase kinase-associated protein 1 protein             103   1e-23   
ref|XP_006648624.1|  PREDICTED: SKP1-like protein 4-like                102   2e-23   
ref|XP_008669236.1|  PREDICTED: SKP1-like protein 1A                    103   2e-23   
ref|XP_003383138.1|  PREDICTED: s-phase kinase-associated protein...    102   2e-23   
emb|CDY14922.1|  BnaA02g22640D                                          103   2e-23   
ref|NP_001290896.1|  S-phase kinase-associated protein 1                102   2e-23   
ref|XP_003920635.1|  PREDICTED: S-phase kinase-associated protein 1     102   2e-23   
emb|CAN73673.1|  hypothetical protein VITISV_031861                     102   2e-23   
emb|CAN81017.1|  hypothetical protein VITISV_028248                     102   2e-23   
ref|XP_008807154.1|  PREDICTED: SKP1-like protein 1A                    104   2e-23   
gb|EYU37960.1|  hypothetical protein MIMGU_mgv1a015408mg                102   2e-23   
ref|XP_009123589.1|  PREDICTED: SKP1-like protein 14                    102   2e-23   
ref|XP_008670860.1|  PREDICTED: SKP1-like protein 1A                    103   2e-23   
ref|NP_001152391.1|  SKP1-like protein 1A                               103   3e-23   
ref|XP_010028739.1|  PREDICTED: SKP1-like protein 1A                    102   3e-23   
gb|ACM09779.1|  S-phase kinase-associated protein 1                     102   3e-23   
ref|XP_004006162.1|  PREDICTED: S-phase kinase-associated protein...    102   3e-23   
tpg|DAA56608.1|  TPA: hypothetical protein ZEAMMB73_397176              103   4e-23   
gb|KCW55546.1|  hypothetical protein EUGRSUZ_I01426                     101   4e-23   
gb|AAF82795.1|AF274864_1  SKP1gamma1 protein                            101   4e-23   
ref|XP_010028738.1|  PREDICTED: SKP1-like protein 4                     101   5e-23   
ref|XP_005330878.1|  PREDICTED: S-phase kinase-associated protein...    101   5e-23   
ref|XP_010490823.1|  PREDICTED: SKP1-like protein 18                    102   5e-23   



>ref|XP_009401439.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
 ref|XP_009401447.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=157

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 109/159 (69%), Gaps = 13/159 (8%)
 Frame = -3

Query  556  LEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYC  377
            +EKK+T+ SSDGEVFE+ + VA +SQT+  MIEDD CA ++ IPLP +  KILA V+EYC
Sbjct  1    MEKKITLRSSDGEVFEVDVAVAMESQTIKHMIEDD-CA-ENGIPLPNVNAKILAKVIEYC  58

Query  376  KKHALTSSLR----------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            +KH   ++ +          ELK +D EF+KVD  TL DLILAA+YL IKGL  LT  ++
Sbjct  59   RKHVDAAASKSSDDASKVDEELKPWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTV  118

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE +++RREN  AFE
Sbjct  119  ADMIKGKTPEEIRKTFNIKNDFTPEEEDEVRRENQWAFE  157



>ref|XP_003605515.1| SKP1-like protein [Medicago truncatula]
 gb|AES87712.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=152

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 103/151 (68%), Gaps = 2/151 (1%)
 Frame = -3

Query  562  SSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVE  383
            SS  KK+ + SS+GE FE+   VA QSQT+  +I  D CAN   IP+  +TGKILAMV+E
Sbjct  3    SSSMKKIILKSSEGETFEIEEAVAVQSQTIKHLI-GDQCANDTEIPISNVTGKILAMVIE  61

Query  382  YCKKHALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKT  203
            YCKKH    S  EL+ +D EF++VD DTL  LILAA YL IK L  L  ++ +++I +KT
Sbjct  62   YCKKHVDAVSSDELRKWDAEFVQVDQDTLLKLILAARYLDIKSLYDLGCMTTANNIKDKT  121

Query  202  LPELCQTFNI-DNLTPEEFEQIRRENH*AFE  113
              E+C+ FNI D  TPEE E++RREN  AFE
Sbjct  122  PEEICKIFNIKDEYTPEEKEEVRRENSWAFE  152



>ref|XP_006422586.1| hypothetical protein CICLE_v10029465mg [Citrus clementina]
 ref|XP_006486726.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR35826.1| hypothetical protein CICLE_v10029465mg [Citrus clementina]
 gb|KDO68088.1| hypothetical protein CISIN_1g031498mg [Citrus sinensis]
Length=158

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 109/161 (68%), Gaps = 13/161 (8%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS EKK+T+ SSDGE FE+  TVA +SQT+  M+EDD CA+   IPLP +T  IL+ V+
Sbjct  1    MSS-EKKITLKSSDGETFEVEETVALESQTIKHMVEDD-CADT-VIPLPNVTSTILSKVI  57

Query  385  EYCKKHALT---------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            EYCKKH            S+  +LK +D +F+KVD +TL DLILAA+YL IKGL  LT  
Sbjct  58   EYCKKHVEAGSGDKKDDKSTEDDLKTWDADFVKVDQNTLFDLILAANYLNIKGLLDLTCQ  117

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT  E+ +TFNI N  +P+E E++RREN  AFE
Sbjct  118  TVADMIKGKTPEEIRKTFNIKNDFSPDEEEEVRRENQWAFE  158



>gb|ACP20181.1| SKP1-like protein [Citrus maxima]
Length=158

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 109/161 (68%), Gaps = 13/161 (8%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS EKK+T+ SSDGE FE+  TVA +SQT+   +EDD CA+   IPLP +T  IL+ V+
Sbjct  1    MSS-EKKITLKSSDGETFEVEETVALESQTIKHTVEDD-CADT-VIPLPNVTSTILSKVI  57

Query  385  EYCKKHALT---------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            EYCKKH            S++ +LK +D +F+KVD +TL DLILAA+YL IKGL  LT  
Sbjct  58   EYCKKHVEAGSGDKKDDKSTVDDLKTWDADFVKVDQNTLFDLILAANYLNIKGLLDLTCQ  117

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT  E+ +TFNI N  +P+E E++RREN  AFE
Sbjct  118  TVADMIKGKTPEEIRKTFNIKNDFSPDEEEEVRRENQWAFE  158



>gb|EMT03939.1| SKP1-like protein 1B [Aegilops tauschii]
Length=164

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 107/166 (64%), Gaps = 14/166 (8%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A     +K +T+ SSDGE F++ + VA +SQT+  MIEDD CA+ + IPLP +  KIL+
Sbjct  1    MAAEEGEKKMITLKSSDGEEFQVEVAVAMESQTIRHMIEDD-CAD-NGIPLPNVDSKILS  58

Query  394  MVVEYCKKHA-----------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLA  248
             V+EYCKKHA             +   +LK+FD EF+KVD  TL DLILAA+YL IKGL 
Sbjct  59   KVIEYCKKHAPKPADSSDFTAAAAPAEDLKSFDAEFVKVDQATLFDLILAANYLNIKGLL  118

Query  247  VLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             LT  +++  I  KT  E+ +TFNI N  TPEE  +IRREN  AFE
Sbjct  119  DLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEAEIRRENQWAFE  164



>ref|XP_002279232.1| PREDICTED: SKP1-like protein 1A isoform X5 [Vitis vinifera]
 emb|CAN73136.1| hypothetical protein VITISV_023042 [Vitis vinifera]
Length=155

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 101/153 (66%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K +T+ SSDGE F+L   VA +SQT+  MIED  CA+ + IPLP +T KILA V+EYCKK
Sbjct  5    KTITLRSSDGEAFDLEEVVAVESQTIKHMIEDG-CAD-NAIPLPNVTSKILAKVIEYCKK  62

Query  370  HALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H  T    E      LKA+D +F+KVD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  63   HVETPKAEEHAVNDELKAWDADFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIKG  122

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  TPEE E +RREN  AFE
Sbjct  123  KTPEEIRKTFNIKNDFTPEEEEDVRRENQWAFE  155



>ref|XP_011046062.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=158

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 102/156 (65%), Gaps = 12/156 (8%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGE F +   VA +SQT+  MIEDD CA  D IPLP +TGKILA V+EYCKK
Sbjct  5    KKITLKSSDGETFVVEEAVAVESQTIKHMIEDD-CAESD-IPLPNVTGKILAKVIEYCKK  62

Query  370  HA---------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            H          +T     LK++D EF+KVD +TL DLILAA+YL IK L  LT  + +  
Sbjct  63   HVEADADKDAIITGKDEFLKSWDSEFVKVDKNTLFDLILAANYLNIKDLLDLTCQAAADM  122

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  E+ + FNI N  TPEE +QIRR+N  AF+
Sbjct  123  IKGKTPDEIRKIFNIKNDFTPEEEQQIRRDNQWAFK  158



>ref|XP_009624361.1| PREDICTED: SKP1-like protein 1A isoform X1 [Nicotiana tomentosiformis]
Length=153

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 103/154 (67%), Gaps = 10/154 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + + SSDGE FE+  +VA +SQT+  MIEDD CA+   IPLP +T KILA V+EYCK+
Sbjct  2    KMIVLKSSDGETFEVEESVAVESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVIEYCKR  59

Query  370  HALTSSLRE-------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSII  212
            H   +S  E       LKAFD +F+KVD  TL DLILAA+YL IK L  LT  +++  I 
Sbjct  60   HVDAASKTEDKSVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  119

Query  211  NKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             KT  E+ +TFNI N  TP+E E++RREN  AFE
Sbjct  120  GKTPEEIRKTFNIKNDFTPDEEEEVRRENAWAFE  153



>ref|XP_009620406.1| PREDICTED: SKP1-like protein 1A [Nicotiana tomentosiformis]
Length=153

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 103/154 (67%), Gaps = 10/154 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + + SSDGE FE+  +VA +SQT+  MIEDD CA+   IPLP +T KILA V+EYCK+
Sbjct  2    KMIVLKSSDGETFEVEESVAVESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVIEYCKR  59

Query  370  HALTSSLRE-------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSII  212
            H   +S  E       LKAFD +F+KVD  TL DLILAA+YL IK L  LT  +++  I 
Sbjct  60   HVDAASKTEDKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  119

Query  211  NKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             KT  E+ +TFNI N  TP+E E++RREN  AFE
Sbjct  120  GKTPEEIRKTFNIKNDFTPDEEEEVRRENAWAFE  153



>gb|EMT05501.1| SKP1-like protein 1B [Aegilops tauschii]
Length=175

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 109/177 (62%), Gaps = 25/177 (14%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A     +K +T+ SSDGE F++   +A +SQT+  MIEDD CA+ + IPLP +  KIL+
Sbjct  1    MAAEEGEKKMITLKSSDGEEFQVEEAIAMESQTIRHMIEDD-CAD-NGIPLPNVDSKILS  58

Query  394  MVVEYCKKH----------------------ALTSSLRELKAFDDEFIKVDMDTLCDLIL  281
             V+EYCKKH                      A+ +S  +LK+FD EFIKVD +TL DLIL
Sbjct  59   KVIEYCKKHVQASPKPANSGAAVDASSSTSTAVAASAEDLKSFDAEFIKVDQNTLFDLIL  118

Query  280  AADYLCIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            AA+YL IKGL  LT  +++  I  KT  E+ +TFNI N  TPEE  +IRREN  AFE
Sbjct  119  AANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEAEIRRENQWAFE  175



>ref|XP_003605516.1| SKP1-like protein [Medicago truncatula]
 gb|AES87713.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=153

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 106/156 (68%), Gaps = 5/156 (3%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A++SS  KK+ + S +GE FE+   VA QSQT+  +I+DD CAN   IP+  +T KILA
Sbjct  1    MASLSS--KKIILKSYEGETFEIEEAVAMQSQTIKLLIDDD-CANDTGIPISNVTSKILA  57

Query  394  MVVEYCKKHALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSI  215
            MV+EYCKKHA   S  EL+ +D EF++VD DTL +LI AA+YL IK L  LT ++ + +I
Sbjct  58   MVIEYCKKHADDVSSDELRKWDAEFVQVDQDTLFNLISAANYLNIKSLLDLTCMTAADNI  117

Query  214  INKTLPELCQTFNI--DNLTPEEFEQIRRENH*AFE  113
             +KT  E+ + FNI  D+ TPEE E  R EN  AFE
Sbjct  118  KDKTPEEIRKIFNIKNDDYTPEEEEAARCENSWAFE  153



>ref|XP_009373027.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=161

 Score =   136 bits (342),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 104/162 (64%), Gaps = 9/162 (6%)
 Frame = -3

Query  577  AIATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKIL  398
            A ++ + L+KK+T+ SSD E+FE+   VA +SQT+  M+ED    N   IPLP +T  IL
Sbjct  2    ASSSSADLKKKITLKSSDDEMFEVEEAVAIESQTIKHMVEDGCAGN--AIPLPNVTSAIL  59

Query  397  AMVVEYCKKH------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTS  236
            A V+EYC+KH            + +K +D EF+K+D +TL DLI+AA+YL IKGL  LT 
Sbjct  60   AKVIEYCRKHREDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTC  119

Query  235  LSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             +++  I  KT  ++  TFNI N  TPEE E+IRREN  AFE
Sbjct  120  QTVADMIKGKTPEQIRTTFNIKNDFTPEEEEKIRRENQWAFE  161



>ref|XP_009372999.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=161

 Score =   135 bits (341),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 103/162 (64%), Gaps = 9/162 (6%)
 Frame = -3

Query  577  AIATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKIL  398
            A ++ + L+KK+T+ SSD E+FE+   VA QSQT+  M+ED    N   IPLP +T  IL
Sbjct  2    ASSSSADLKKKITLKSSDDEMFEVEEAVAMQSQTIKHMVEDGCAGN--AIPLPNVTSAIL  59

Query  397  AMVVEYCKKH------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTS  236
            A V+EYC+KH            + +K +D EF+K+D +TL DLI+AA+YL IKGL  LT 
Sbjct  60   AKVIEYCRKHREDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTC  119

Query  235  LSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             +++  I  KT  ++  TFNI N  TPEE E+I REN  AFE
Sbjct  120  QTVADMIKGKTPEQIRTTFNIKNDFTPEEEEKISRENQWAFE  161



>gb|EMT33027.1| SKP1-like protein 1B [Aegilops tauschii]
Length=175

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 106/177 (60%), Gaps = 25/177 (14%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A     +K +T+ SSDGE F++   VA +SQT+  MIEDD CA+ D IPLP +  KIL+
Sbjct  1    MAAEEGEKKMITLKSSDGEEFQIEEAVAMESQTIRHMIEDD-CAD-DGIPLPNVDSKILS  58

Query  394  MVVEYCKKH----------------------ALTSSLRELKAFDDEFIKVDMDTLCDLIL  281
             V+EYCKKH                      A  +   +LK+FD EF+KVD  TL DLIL
Sbjct  59   KVIEYCKKHVQASPKPADSGAAADASSFTSTAAAAPAEDLKSFDAEFVKVDQATLFDLIL  118

Query  280  AADYLCIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            AA+YL IKGL  LT  +++  I  KT  E+ +TFNI N  TPEE  +IRREN  AFE
Sbjct  119  AANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEAEIRRENPWAFE  175



>gb|EMT15375.1| SKP1-like protein 4 [Aegilops tauschii]
Length=172

 Score =   135 bits (340),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 22/174 (13%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A  + ++K + + SS+GE F++   VA +SQT+  MIEDD CA+ + IPLP +  KILA
Sbjct  1    MAAEAGVKKMILLKSSNGEGFQVEAAVAIESQTIRHMIEDD-CAD-NGIPLPNVDSKILA  58

Query  394  MVVEYCKKHALTS-------------------SLRELKAFDDEFIKVDMDTLCDLILAAD  272
             V+EYCKKH   S                   +  +LK+FD EF+KVD  TL DLILAA+
Sbjct  59   KVIEYCKKHVQASPNPADSSAADANSSTSTAAAAEDLKSFDAEFVKVDQATLFDLILAAN  118

Query  271  YLCIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            YL IKGL  LT  +++  I  KT  E+ +TFNI N  TPEE  +IRREN  AFE
Sbjct  119  YLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEAEIRRENQWAFE  172



>ref|XP_002313704.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
 gb|EEE87659.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
Length=158

 Score =   135 bits (339),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 101/156 (65%), Gaps = 12/156 (8%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGE F +   VA +SQT+  MIEDD CA  D IPLP +T KILA V+EYCKK
Sbjct  5    KKITLKSSDGETFVVEEAVAVESQTIKHMIEDD-CAEND-IPLPNVTSKILAKVIEYCKK  62

Query  370  H---------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            H          +T     +K++D EF+KVD +TL DLILAA+YL IK L  LT  + +  
Sbjct  63   HVEADADKDATITGKDEFMKSWDAEFVKVDKNTLFDLILAANYLNIKDLLDLTCQAAADM  122

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  E+ + FNI N  TPEE E+IRR+N  AF+
Sbjct  123  IKGKTPDEIRKIFNIKNDFTPEEEEEIRRDNQWAFK  158



>ref|XP_003636464.1| SKP1-like protein [Medicago truncatula]
 gb|KEH36015.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=158

 Score =   135 bits (339),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 109/160 (68%), Gaps = 11/160 (7%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T++SSDGE F++S  VA++SQ +  MIE+D CAN + IPL  +T  ILAMV+
Sbjct  1    MSSYTKKITLNSSDGETFKVSKMVARESQVIKHMIEED-CAN-EAIPLQDVTANILAMVI  58

Query  385  EYCKKH----ALTS----SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            EYCKKH    A +S    S  +L+ +D EF+KVD  TL +LI AA+YL IK L  LT  +
Sbjct  59   EYCKKHVDAAAASSDGKPSEDDLEDWDAEFVKVDKGTLFNLIDAANYLEIKSLLDLTCQT  118

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  +  KT  E+  TFNI+N  TP+E E++RREN  AFE
Sbjct  119  VADMMKGKTPEEIRNTFNIENDFTPQEEEEVRRENQWAFE  158



>ref|XP_008382316.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
 gb|AII79403.1| S-phase kinase-associated protein 1-like protein 3 [Malus hupehensis]
Length=161

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 105/162 (65%), Gaps = 9/162 (6%)
 Frame = -3

Query  577  AIATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKIL  398
            A ++ + L+KK+ + SSD E+FE+   VA +SQT+  M+ED    N   IPLP +T  IL
Sbjct  2    ASSSSADLKKKINLKSSDDEMFEVEEAVAMKSQTIKHMVEDGCAGN--AIPLPNVTSAIL  59

Query  397  AMVVEYCKKHA------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTS  236
            A V+EYC+KH+         S + +K +D EF+K+D + L DLI+AA+YL IKGL  LT 
Sbjct  60   AKVIEYCRKHSEDEGATAADSEKNVKEWDAEFMKIDQNILYDLIMAANYLDIKGLLDLTC  119

Query  235  LSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             ++++ I  KT  ++  TFNI N  TPEE E+IRREN  AFE
Sbjct  120  QTVANMIKGKTPEQIRTTFNITNDFTPEEEEKIRRENQWAFE  161



>ref|XP_004299943.1| PREDICTED: SKP1-like protein 4-like [Fragaria vesca subsp. vesca]
Length=159

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 105/161 (65%), Gaps = 12/161 (7%)
 Frame = -3

Query  565  MSSLEKKV-TVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMV  389
            MS+  KK+ T+ S DGEVFE+   VA QSQT+  M+EDD CA+ + IPLP + G ILA V
Sbjct  1    MSTENKKMLTLKSEDGEVFEIEEAVAVQSQTIKHMVEDD-CAD-NAIPLPNVKGPILARV  58

Query  388  VEYCKKHALTS-----SLRE---LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            +EY KKH   +     S +E   LK FD+EF+KVD   L DLILAA+YL IK L  LT  
Sbjct  59   IEYLKKHVADAEENKESKKEDVGLKEFDEEFLKVDQSVLFDLILAANYLNIKELLDLTCQ  118

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT  ++ +TFNI N  TPEE E +RREN  AFE
Sbjct  119  AVADMIKGKTPEQIRKTFNIKNDFTPEEEEAVRRENQWAFE  159



>ref|XP_009372996.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=160

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 102/160 (64%), Gaps = 9/160 (6%)
 Frame = -3

Query  571  ATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAM  392
            ++ + L+KK+T+ SSD E+FE+   VA +SQT+  M+ED    N   IPLP +T  ILA 
Sbjct  3    SSSADLKKKITLKSSDDEMFEVEEAVAMESQTIKHMVEDGCAGN--AIPLPNVTSAILAK  60

Query  391  VVEYCKKH------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            V+EYC+KH            + +  +D EF+K+D +TL DLI+AA+YL IKGL  LT  +
Sbjct  61   VIEYCRKHHEDEGATAADGEKNVNEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQT  120

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  ++  TFNI N  TPEE E+IRREN  AFE
Sbjct  121  VADMIKGKTPEQIRTTFNIKNDFTPEEEEKIRRENQWAFE  160



>gb|EMT03937.1| SKP1-like protein 1A [Aegilops tauschii]
Length=164

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 14/158 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K +T+ SSDGE F++   VA +SQT+  MIEDD CA+ + IPLP +  KIL+ V+EYCKK
Sbjct  9    KMITLKSSDGEEFQVEEAVAMESQTIRHMIEDD-CAD-NGIPLPNVDSKILSKVIEYCKK  66

Query  370  H-----------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            H           A  +   +LK+FD +F+KVD  TL  LILAA+YL IKGL  LT  +++
Sbjct  67   HVQADASSSTSTAAPAPAEDLKSFDADFVKVDQATLFALILAANYLNIKGLLDLTCQTVA  126

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE  +IRREN  AFE
Sbjct  127  DMIKGKTPEEIRKTFNIKNDFTPEEEAEIRRENQWAFE  164



>ref|XP_008382314.1| PREDICTED: SKP1-like protein 1A isoform X1 [Malus domestica]
 gb|AII79404.1| S-phase kinase-associated protein 1-like protein 1 [Malus hupehensis]
Length=160

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 103/160 (64%), Gaps = 9/160 (6%)
 Frame = -3

Query  571  ATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAM  392
            ++ + L+KK+T+ SSD E+FE+   +A +SQT+  M+ED    N   IPLP +T  ILA 
Sbjct  3    SSSADLKKKITLKSSDDEMFEVEEAIAMESQTIKHMVEDGCAGN--AIPLPNVTSAILAK  60

Query  391  VVEYCKKHA------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            V+EYC+KH+           + +K +D EF+K+D +TL DLI+AA+YL IKGL  LT  +
Sbjct  61   VIEYCRKHSEDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQT  120

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  ++  T NI N  TPEE E+IRREN  AFE
Sbjct  121  VADMIKGKTPEQIRTTLNIKNDFTPEEEEKIRRENQWAFE  160



>gb|EMS35771.1| SKP1-like protein 1B [Triticum urartu]
Length=167

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 104/169 (62%), Gaps = 17/169 (10%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A     +K +T+ SSDGE F++   VA +SQT+  MIEDD CA+ + IPLP +  KIL+
Sbjct  1    MAAEEGEKKMITLKSSDGEEFQVEEAVAMESQTIRHMIEDD-CAD-NGIPLPNVDSKILS  58

Query  394  MVVEYCKKHA--------------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIK  257
             V+EYCKKH                 +   +LK FD EF+KVD  TL DLILAA+YL IK
Sbjct  59   KVIEYCKKHVQADSTDASSSTSTAAAAPAEDLKIFDAEFVKVDQATLFDLILAANYLNIK  118

Query  256  GLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            GL  LT  +++  I  KT  E+ +TFNI N  TPEE  +IRREN  AFE
Sbjct  119  GLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEAEIRRENQWAFE  167



>ref|XP_008232108.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
Length=156

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 105/158 (66%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLE-KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMV  389
            M+S+E KK+T+ S DGE+FE+   VA QSQT+  M+EDD CA+   IPLP +T  ILA V
Sbjct  1    MASVEMKKITLKSDDGEIFEVEEAVAMQSQTIRHMMEDD-CAD-GAIPLPNVTSNILAKV  58

Query  388  VEYCKKHALTSSLRE-----LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            +EYC+KH   ++  E     LK +D EF+K+D  TL  LI+ A+YL IK L  LT+ +++
Sbjct  59   IEYCRKHKEEAADGENKKDILKEWDAEFVKLDQVTLFHLIMTANYLNIKSLLDLTAQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE ++IR EN  AFE
Sbjct  119  EMIKGKTPEEIRETFNIKNDFTPEEEKKIREENRWAFE  156



>gb|EMS59755.1| SKP1-like protein 4 [Triticum urartu]
Length=164

 Score =   133 bits (334),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 105/166 (63%), Gaps = 14/166 (8%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A     +K +T+ SSD E F+++  VA +SQT+  MIEDD CA+ + IPLP +  KIL+
Sbjct  1    MAAEEGEKKMITLKSSDREEFQVAEAVAMESQTIRHMIEDD-CAD-NGIPLPNVDSKILS  58

Query  394  MVVEYCKKHA-----------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLA  248
             V+EYCKKH              +   +LK+FD EF+KVD  TL DLILAA+YL IKGL 
Sbjct  59   KVIEYCKKHVQVDAGSSTSTAAAAPAEDLKSFDAEFVKVDQATLFDLILAANYLNIKGLL  118

Query  247  VLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             LT  +++  I  KT  E+ +TFNI N  TPEE  +IRREN  AFE
Sbjct  119  DLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEAEIRRENQWAFE  164



>ref|XP_006304273.1| hypothetical protein CARUB_v10010505mg [Capsella rubella]
 gb|EOA37171.1| hypothetical protein CARUB_v10010505mg [Capsella rubella]
Length=162

 Score =   133 bits (334),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 99/160 (62%), Gaps = 16/160 (10%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  MIEDD   N   IPLP +TG ILA V+EYCKK
Sbjct  5    KKIILKSSDGESFEVDEVVAVESQTIKHMIEDDCTGNG--IPLPNVTGTILAKVIEYCKK  62

Query  370  HALTSS-------------LRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            HA  ++               ELKA+D EF+KVD +TL DLILAA+YL I GL  LT  +
Sbjct  63   HAEAAADDGGDKDFCGSTENDELKAWDTEFVKVDQNTLFDLILAANYLNISGLLDLTCKA  122

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  +  KT  E+   FNI N  +PEE  ++R EN  AFE
Sbjct  123  VADQMKGKTPEEMRAHFNIKNDYSPEEEAEVRNENKWAFE  162



>gb|EMT23721.1| SKP1-like protein 1A [Aegilops tauschii]
Length=164

 Score =   133 bits (334),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 105/166 (63%), Gaps = 14/166 (8%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A     +K +T+ SSDGE F++   VA +SQT+  MIEDD CA+ + IPLP +  KIL+
Sbjct  1    MAAEEGEKKMITLKSSDGEEFQVEEAVAMESQTIRHMIEDD-CAD-NGIPLPNVDSKILS  58

Query  394  MVVEYCKKHALTSSL-----------RELKAFDDEFIKVDMDTLCDLILAADYLCIKGLA  248
             ++EYCKKH    +             +LK++D +F+KVD  TL DLILAA+YL IKGL 
Sbjct  59   KIIEYCKKHVQADASSSTSTTAAAPAEDLKSYDADFVKVDQATLFDLILAANYLNIKGLL  118

Query  247  VLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             LT  +++  I  KT  E+ +TFNI N  TPEE  +IRREN  AFE
Sbjct  119  DLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEAEIRRENQWAFE  164



>gb|AII79402.1| S-phase kinase-associated protein 1-like protein 5 [Malus hupehensis]
Length=156

 Score =   132 bits (332),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 109/158 (69%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSSSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  58

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCK+H   +      S  +LKA+D EF+KVD  TL DLILAA+YL IKGL  LT  +++
Sbjct  59   EYCKRHVDAAKPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  +T  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  DMIKGRTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_007219396.1| hypothetical protein PRUPE_ppa020403mg [Prunus persica]
 gb|EMJ20595.1| hypothetical protein PRUPE_ppa020403mg [Prunus persica]
Length=156

 Score =   132 bits (332),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 104/158 (66%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLE-KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMV  389
            M+S+E KK+T+ S DGE+FE+   VA QSQT+  M+EDD CA+   IPLP +T  I+A V
Sbjct  1    MASVEMKKITLKSDDGEIFEVEEAVAMQSQTIKHMVEDD-CADG-PIPLPNVTSNIVAKV  58

Query  388  VEYCKKHALTSSLRE-----LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            +EYCKKH    +  E     +K +D EF+KVD  T+ DLILAA+YL +K L  LT  +++
Sbjct  59   IEYCKKHHEEDADGEKNKEDIKKWDVEFVKVDQSTMFDLILAANYLNVKSLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ + FNI N  TPEE +++R EN  AFE
Sbjct  119  DMINGKTPEEIREIFNIKNDFTPEEEKEVRNENQWAFE  156



>gb|EMT01680.1| SKP1-like protein 1B [Aegilops tauschii]
Length=172

 Score =   132 bits (333),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 104/174 (60%), Gaps = 22/174 (13%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +AT    +K +T+ SSDGE F++   VA +SQT+  MIEDD CA+ + IPLP +  KIL+
Sbjct  1    MATEEGEKKMITLKSSDGEEFQVEEAVAMESQTIRHMIEDD-CAD-NGIPLPNVDSKILS  58

Query  394  MVVEYCKKHALTSS-------------------LRELKAFDDEFIKVDMDTLCDLILAAD  272
             V+EYCKKH   S                      +LK+FD EF+KVD  TL DLILA +
Sbjct  59   KVIEYCKKHVQASPKLADSTDASSSISTAAAAPAEDLKSFDAEFVKVDQATLFDLILATN  118

Query  271  YLCIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            YL IKGL  LT  +++  I  KT  E+ +TFNI N  TPEE  +I REN  AFE
Sbjct  119  YLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEAEIHRENQWAFE  172



>ref|XP_003628375.1| SKP1-like protein [Medicago truncatula]
 gb|AET02851.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=157

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 109/159 (69%), Gaps = 10/159 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +KVT+ SSD E FE+   VA +SQT+  MIEDD CA  + IPLP +T KILA V+
Sbjct  1    MSSSARKVTLKSSDDETFEVEEAVALKSQTIKHMIEDD-CAKTE-IPLPNVTSKILAKVI  58

Query  385  EYCKKH--ALTSSLR-----ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            EYCKKH  A TSS       ++KA+D EF+KVD++T  +LILAA+YL IK L  LT   +
Sbjct  59   EYCKKHVEATTSSEGKPSEDDVKAWDAEFVKVDLNTRFELILAANYLDIKSLLELTCQDV  118

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            + +I +KT+ E+ + FN++N  +PEE+ ++ +E   AFE
Sbjct  119  AETIKDKTVEEIRKIFNVENDFSPEEYAELLKEVGWAFE  157



>gb|KDO67761.1| hypothetical protein CISIN_1g044292mg [Citrus sinensis]
Length=160

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 101/150 (67%), Gaps = 8/150 (5%)
 Frame = -3

Query  544  VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKHA  365
            + + SSDGE FE+  TVA QSQT+  M+EDD CA+   IPLP +TG IL+MVVEYCKKH 
Sbjct  13   IILKSSDGETFEVEETVALQSQTIRHMVEDD-CADS-VIPLPNVTGTILSMVVEYCKKHV  70

Query  364  -----LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKTL  200
                       ++K +D +F+KVD +TL DL+LAA+YL IK L  LT  + +  I +K+ 
Sbjct  71   EAAAAAAGGDNDVKNWDRDFVKVDQETLLDLLLAANYLNIKDLLELTCQATADVIKDKSP  130

Query  199  PELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             E+ + F+I+N  TP+E ++IRREN  AFE
Sbjct  131  EEVRRIFHINNDFTPQEEQEIRRENQWAFE  160



>ref|XP_006436098.1| hypothetical protein CICLE_v10033809mg [Citrus clementina]
 ref|XP_006486025.1| PREDICTED: SKP1-like protein 1A-like [Citrus sinensis]
 gb|ESR49338.1| hypothetical protein CICLE_v10033809mg [Citrus clementina]
Length=160

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 101/150 (67%), Gaps = 8/150 (5%)
 Frame = -3

Query  544  VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKHA  365
            + + SSDGE FE+  TVA QSQT+  M+EDD CA+   IPLP +TG IL+MVVEYCKKH 
Sbjct  13   IILKSSDGETFEVEETVALQSQTIRHMVEDD-CADS-VIPLPNVTGTILSMVVEYCKKHV  70

Query  364  -----LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKTL  200
                       ++K +D +F+KVD +TL DL+LAA+YL IK L  LT  + +  I +K+ 
Sbjct  71   EAAAAAAGGDNDVKNWDRDFVKVDQETLLDLLLAANYLNIKDLLELTCQATADMIKDKSP  130

Query  199  PELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             E+ + F+I+N  TP+E ++IRREN  AFE
Sbjct  131  EEVRRIFHINNDFTPQEEQEIRRENQWAFE  160



>ref|XP_010683700.1| PREDICTED: SKP1-like protein 1B isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=150

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 101/150 (67%), Gaps = 8/150 (5%)
 Frame = -3

Query  544  VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKH-  368
            +T+ SSDGE FE+  +VA + +T+  MIEDD CA+   IPLP +T KIL+ V+EYCKKH 
Sbjct  2    ITLKSSDGEKFEVEESVALECETIKLMIEDD-CADT-AIPLPNVTAKILSKVIEYCKKHV  59

Query  367  ----ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKTL  200
                A  S+  ELK +D EF+KVD  TL +LILAA+YL I+ L  LT  ++S  I +KT 
Sbjct  60   ESAAAANSTNEELKIWDKEFVKVDQKTLFNLILAANYLNIRSLLDLTCQTVSDIIKDKTP  119

Query  199  PELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             E+ + FNI N  TPEE E IRREN  AF+
Sbjct  120  EEVRKMFNIKNDFTPEEEEAIRRENQWAFD  149



>ref|XP_008393845.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
 gb|ACB87913.1| SKP1-like protein 1 [Malus domestica]
Length=156

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 109/158 (69%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSSSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  58

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCK+H   +      S  +LKA+D EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  59   EYCKRHVDAAKPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI+N  TPEE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNINNDFTPEEEEEVRRENQWAFE  156



>gb|AFM75900.1| GSK1 [Gossypium hirsutum]
 gb|AFP55363.1| SKP1-like protein [Gossypium hirsutum]
 gb|KHG25005.1| SKP1-like protein 1B [Gossypium arboreum]
Length=156

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 109/158 (69%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSSSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  58

Query  385  EYCKKHALT------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH         S+  ELK++D +F+KVD  TL DLILAA+YL IKGL  LT  +++
Sbjct  59   EYCKKHVEAPKTDDRSADDELKSWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_008337985.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
Length=156

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 108/158 (68%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSSSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  58

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +      S  +LKA+D EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  59   EYCKKHVDAAKPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKTLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_002880415.1| hypothetical protein ARALYDRAFT_481069 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56674.1| hypothetical protein ARALYDRAFT_481069 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 102/160 (64%), Gaps = 16/160 (10%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +TG ILA V+EYCKK
Sbjct  4    KKIILKSSDGESFEVDEAVAVESQTIKHMIEDD-CAD-NGIPLPNVTGAILAKVIEYCKK  61

Query  370  HALTSSLR-------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            H   ++               ELKA+D++F+KVD  TL DLILAA+YL I GL  LT  +
Sbjct  62   HVEAAAEAGGDKDFCGSTENDELKAWDNDFVKVDQPTLFDLILAANYLNISGLLDLTCKA  121

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  +  KT  ++ + FNI N  TPEE  ++R EN  AFE
Sbjct  122  VADMMRGKTPEQMREHFNIKNDYTPEEEAEVRNENKWAFE  161



>ref|XP_010935123.1| PREDICTED: SKP1-like protein 1B [Elaeis guineensis]
Length=163

 Score =   130 bits (328),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 106/163 (65%), Gaps = 18/163 (11%)
 Frame = -3

Query  553  EKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCK  374
            EKK+T+ SSDGEVFE+  TVA +SQT+  MIEDD   N   IPLP +T KIL+ V+EYCK
Sbjct  3    EKKITLKSSDGEVFEVEETVAMESQTIKHMIEDDCAGN--GIPLPNVTSKILSKVIEYCK  60

Query  373  KH---ALTSSL------------RELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
            KH   A  SS              ELK +D +F+KVD  TL DLILAA+YL IKGL  LT
Sbjct  61   KHVDAAAASSKSTVDDTSSKIVDEELKTWDADFVKVDQATLFDLILAANYLNIKGLLDLT  120

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  121  CQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  163



>ref|XP_003621661.1| SKP1-like protein [Medicago truncatula]
 gb|AES77879.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 105/158 (66%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSD E FE+   VA +SQT+  MIEDD   N   IP+P +TG+ILA V+
Sbjct  1    MSSTTKKMTLKSSDNETFEVPEAVALESQTIKHMIEDDCTDN--GIPVPNVTGQILAKVI  58

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +S  E      LK +D EF+KVD DTL DLILAA+YL IK L  LT  S++
Sbjct  59   EYCKKHVDAASSDEKPSEDDLKNWDAEFVKVDQDTLFDLILAANYLNIKSLLDLTCQSVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_008232155.1| PREDICTED: SKP1-like protein 11 [Prunus mume]
Length=155

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 101/151 (67%), Gaps = 7/151 (5%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ S D + FE+ + VA QSQT+  M+EDD CA+ D IPL  +T   LA V+EYCKK
Sbjct  7    KKITLKSDDNQTFEVEVAVAMQSQTIKHMVEDD-CAD-DVIPLSNVTSSALAKVIEYCKK  64

Query  370  H----ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKT  203
            H    A   +   LK++D EF+KVD+  L DLILAA+YL IK L  LT  ++++ I +KT
Sbjct  65   HHEEDADVKNKESLKSWDAEFVKVDLSKLFDLILAANYLDIKSLLDLTCQTVANMIQDKT  124

Query  202  LPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              E+   FNI+N  TPEE ++IR+EN  AFE
Sbjct  125  PEEIRVIFNIENDFTPEEEKEIRKENEWAFE  155



>ref|XP_010935122.1| PREDICTED: SKP1-like protein 1A [Elaeis guineensis]
Length=163

 Score =   129 bits (325),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 107/163 (66%), Gaps = 18/163 (11%)
 Frame = -3

Query  553  EKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCK  374
            EKK+T+ SSDGEVFE+   VA +SQT+  MIEDD  +N   IPLP +T KIL+ V+EYCK
Sbjct  3    EKKITLKSSDGEVFEVEEAVAMESQTIKHMIEDDCASN--GIPLPNVTSKILSKVIEYCK  60

Query  373  KH---ALTSSLR------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
            +H   A  SS              ELK++D EF+KVD  TL DLILAA+YL IKGL  LT
Sbjct  61   RHVDFAAASSRSTADDTSSKPADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLT  120

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  121  CQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  163



>ref|XP_008382315.1| PREDICTED: SKP1-like protein 1A isoform X2 [Malus domestica]
Length=154

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 100/158 (63%), Gaps = 11/158 (7%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS   K+T+ SSD E+FE+   +A +SQT+  M+ED    N   IPLP +T  ILA V+
Sbjct  1    MSS--HKITLKSSDDEMFEVEEAIAMESQTIKHMVEDGCAGN--AIPLPNVTSAILAKVI  56

Query  385  EYCKKHA------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYC+KH+           + +K +D EF+K+D +TL DLI+AA+YL IKGL  LT  +++
Sbjct  57   EYCRKHSEDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVA  116

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  ++  T NI N  TPEE E+IRREN  AFE
Sbjct  117  DMIKGKTPEQIRTTLNIKNDFTPEEEEKIRRENQWAFE  154



>ref|XP_003605505.1| SKP1-like protein [Medicago truncatula]
 gb|AES87702.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=164

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 104/157 (66%), Gaps = 8/157 (5%)
 Frame = -3

Query  562  SSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVE  383
            S+  KK+T+ SSD E FE+   VA +SQT+  +I DD CA+   IPLP +TGKILAMV+E
Sbjct  8    STATKKITLKSSDNETFEIEKAVALESQTIKHLI-DDNCADDSGIPLPNVTGKILAMVIE  66

Query  382  YCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSS  221
            +CKKH   +S  E      +  +D EF+KVD DTL DLILAA+YL IK L  LT  +++ 
Sbjct  67   HCKKHVDATSSDEKPSEDEINKWDTEFVKVDQDTLFDLILAANYLNIKSLLDLTCKTVAD  126

Query  220  SIINKTLPELCQTFN-IDNLTPEEFEQIRRENH*AFE  113
             I  +T  E+ +TFN I++ TPEE E++R E   AF+
Sbjct  127  MIKGRTPEEIRKTFNIINDYTPEEEEEVRSETQWAFD  163



>ref|XP_007046627.1| S phase kinase-associated protein 1 [Theobroma cacao]
 gb|EOX90784.1| S phase kinase-associated protein 1 [Theobroma cacao]
Length=156

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 106/158 (67%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSSSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  58

Query  385  EYCKKHALTSSLR------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH             ELK +D +F+KVD  TL DLILAA+YL IKGL  LT  +++
Sbjct  59   EYCKKHVEAPKTEDRTAEDELKNWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|NP_564105.1| SKP1-like protein 4 [Arabidopsis thaliana]
 sp|Q9LNT9.1|ASK4_ARATH RecName: Full=SKP1-like protein 4; Short=AtSK4 [Arabidopsis thaliana]
 gb|AAF79899.1|AC022472_8 Contains similarity to Skp1 mRNA from Medicago sativa gb|AF135596 
and is a member of Skp1 family PF|01466 [Arabidopsis thaliana]
 gb|AAL25617.1| At1g20140/T20H2_8 [Arabidopsis thaliana]
 gb|AAM19990.1| At1g20140/T20H2_8 [Arabidopsis thaliana]
 gb|AEE29943.1| SKP1-like protein 4 [Arabidopsis thaliana]
Length=163

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 101/165 (61%), Gaps = 16/165 (10%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            M+  +K + + SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +TG ILA V+
Sbjct  1    MAETKKMIILKSSDGESFEIEEAVAVKSQTIKHMIEDD-CAD-NGIPLPNVTGAILAKVI  58

Query  385  EYCKKHALTSSLR-------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAV  245
            EYCKKH   ++               ELK +D EF+KVD  TL DLILAA+YL I GL  
Sbjct  59   EYCKKHVEAAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLD  118

Query  244  LTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            LT  +++  +  KT  ++   FNI N  TPEE  ++R EN  AFE
Sbjct  119  LTCKAVADQMRGKTPEQMRAHFNIKNDYTPEEEAEVRNENKWAFE  163



>gb|AAT12490.1| Skp1/Ask1-like protein [Zantedeschia hybrid cultivar]
Length=167

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 107/158 (68%), Gaps = 14/158 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGEVFE+  TVA +SQT+  +IEDD  A  D +PLP +TG+ILA V+E+CKK
Sbjct  12   KKLTLKSSDGEVFEVEETVAMESQTIRNLIEDDCTA--DGVPLPNVTGRILAKVIEFCKK  69

Query  370  HALTSSLR-----------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            H   ++L+           ELK +D +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  70   HVEIAALKADEGVDRAADEELKVWDADFVKVDQTTLFDLILAANYLNIKSLLDLTCQTVA  129

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  130  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  167



>ref|XP_004287783.1| PREDICTED: SKP1-like protein 1A-like [Fragaria vesca subsp. vesca]
Length=156

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 107/158 (68%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSSSAKKITLKSSDGESFEVEEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  58

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +      +  ELK +D +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  59   EYCKKHVDAAKPDEKVTEEELKVWDQDFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_003605510.1| SKP1-like protein [Medicago truncatula]
 gb|AES87707.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=175

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 112/177 (63%), Gaps = 11/177 (6%)
 Frame = -3

Query  616  VSFSPQNSPQSL-TAIATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCAN  440
            +S S ++ P+SL T    + S  KK+T+ S DGE F++   VA +SQT+  +I+D   ++
Sbjct  1    MSSSKEHHPESLATKEDLLDSSAKKITLKSYDGETFDIEEAVALESQTIKHLIDD--VSD  58

Query  439  KDCIPLPKITGKILAMVVEYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILA  278
               IP+P +TGKILA V+EYCKKH   +   E      LK +D EF++VD +TL DLILA
Sbjct  59   DTGIPIPNVTGKILAKVIEYCKKHVEYARSNEKPPEDELKKWDAEFVQVDQETLFDLILA  118

Query  277  ADYLCIKGLAVLTSLSMSSSIINKTLPE-LCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            A+YL IK L  LT  S++  ++    PE + +TFNI N  +PEE ++IR EN  AFE
Sbjct  119  ANYLNIKSLLDLTCKSVADMMLAAKTPEAIRETFNIKNDYSPEEEQKIRSENQWAFE  175



>ref|XP_006847969.1| hypothetical protein AMTR_s00029p00153350 [Amborella trichopoda]
 gb|ERN09550.1| hypothetical protein AMTR_s00029p00153350 [Amborella trichopoda]
Length=157

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 105/159 (66%), Gaps = 10/159 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MS  EKKVT+ SSDGEVFE+  +VA +SQT+  MIEDD   N   IPLP ++ KILA V+
Sbjct  1    MSKDEKKVTLKSSDGEVFEVEESVAVESQTIKHMIEDDCAGN--GIPLPNVSSKILAKVI  58

Query  385  EYCKKHALTSSL-------RELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            EYCK H     +        E+K++D EF++VD  TL DLILAA+YL IK L  LT  ++
Sbjct  59   EYCKYHVDAQKVTEDKTQEEEIKSWDAEFVRVDQATLFDLILAANYLNIKNLLDLTCQTV  118

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  ADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>gb|KDP23982.1| hypothetical protein JCGZ_25370 [Jatropha curcas]
Length=158

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 109/161 (68%), Gaps = 13/161 (8%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSS-SKKITLKSSDGEAFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  57

Query  385  EYCKKHALT---------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            EYCKKH  T         S+  ELK +D EF+KVD  TL DLILAA+YL IKGL  LT  
Sbjct  58   EYCKKHVETPKSDDRSNGSADDELKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQ  117

Query  232  SMSSSIINKTLPELCQTFNI-DNLTPEEFEQIRRENH*AFE  113
            +++  I  KT  E+ + FNI D+ TPEE E++RREN  AFE
Sbjct  118  TVADMIKGKTPDEIREIFNIKDDFTPEEEEELRRENQWAFE  158



>ref|XP_007221090.1| hypothetical protein PRUPE_ppa017105mg [Prunus persica]
 gb|EMJ22289.1| hypothetical protein PRUPE_ppa017105mg [Prunus persica]
Length=156

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 103/158 (65%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLE-KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMV  389
            M+S+E KK+T+ S DGE+FE+   VA QSQT+  M+EDD CA+   IPL  +T  I+A V
Sbjct  1    MASVEMKKITLKSEDGEIFEVEEAVAMQSQTIRHMVEDD-CADG-PIPLQNVTSNIVAKV  58

Query  388  VEYCKKHALTSSLRE-----LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            +EYCKKH    +  E     +K +D EF+KVD  T+ DLILAA+YL +K L  LT  +++
Sbjct  59   IEYCKKHHEEDADGEKNKEDIKKWDVEFVKVDQSTMFDLILAANYLNVKSLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ + FNI N  TPEE +++R EN  AFE
Sbjct  119  DMINGKTPEEIREIFNIKNDFTPEEEKEVRNENQWAFE  156



>ref|XP_002531150.1| skp1, putative [Ricinus communis]
 gb|EEF31235.1| skp1, putative [Ricinus communis]
Length=161

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 109/165 (66%), Gaps = 18/165 (11%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+
Sbjct  1    MSS--KKITLKSSDGEPFEVDEVVALESQTIKHMIEDD-CADS-GIPLPNVTSKILAKVI  56

Query  385  EYCKKHALT-------------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAV  245
            EYCKKH  T             ++  ELKA+D EF+KVD  TL DLILAA+YL IKGL  
Sbjct  57   EYCKKHVETPKSSSEDRTINNSNTDDELKAWDAEFVKVDQSTLFDLILAANYLNIKGLLD  116

Query  244  LTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  117  LTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  161



>ref|XP_008806600.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=164

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 106/164 (65%), Gaps = 19/164 (12%)
 Frame = -3

Query  553  EKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCK  374
            E K+T+ SSDGEVFE+  TVA +SQT+  +IEDD   N   IPLP +T KILA V+EYCK
Sbjct  3    ENKITLKSSDGEVFEVEETVAMESQTIKHLIEDDCATNG--IPLPNVTSKILAKVIEYCK  60

Query  373  KHA--------------LTSSLR--ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVL  242
            KH                +S L   ELKA+D EF+KVD  TL DLILAA+YL IKGL  L
Sbjct  61   KHVDAAAAASSKSTADDTSSKLADDELKAWDAEFVKVDQATLFDLILAANYLNIKGLLDL  120

Query  241  TSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            T  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  121  TCQTVADMIKGKTPEEIRKTFNIRNDFTPEEEEEVRRENQWAFE  164



>ref|XP_007156190.1| hypothetical protein PHAVU_003G265900g [Phaseolus vulgaris]
 gb|ESW28184.1| hypothetical protein PHAVU_003G265900g [Phaseolus vulgaris]
Length=155

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 104/153 (68%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+EYCKK
Sbjct  5    KKITLKSSDGEAFEVDEIVALESQTIKHMIEDD-CADS-GIPLPNVTSKILAKVIEYCKK  62

Query  370  HALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H   +S  E      LKA+D EF+KVD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  63   HVEANSADEKPTEDELKAWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMIKG  122

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  123  KTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>ref|XP_010690359.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=166

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 110/162 (68%), Gaps = 18/162 (11%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGE F++  +VA +SQT+  MIEDD CA+ + IPLP +TGKIL+ V+EYCKK
Sbjct  7    KKITLKSSDGENFDVEESVALESQTIKHMIEDD-CAD-NAIPLPNVTGKILSKVIEYCKK  64

Query  370  HALTSSLR---------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTS  236
            H  +++ +               ELK++D EF+KVD +TL DLILAA+YL IK L  LT 
Sbjct  65   HVESAAAKSSTEDRSSSNATADEELKSWDAEFVKVDQNTLFDLILAANYLNIKSLLDLTC  124

Query  235  LSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  125  QTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  166



>ref|XP_002305525.2| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
 gb|ABK92824.1| unknown [Populus trichocarpa]
 gb|EEE86036.2| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
Length=161

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 106/159 (67%), Gaps = 15/159 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGE F +   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+EYCKK
Sbjct  5    KKITLKSSDGETFVVDEAVAVESQTIKHMIEDD-CADNE-IPLPNVTSKILAKVIEYCKK  62

Query  370  HALTSSLRE------------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            H    S +E            LK++D EF+KVD +TL DLILAA+YL IKGL  LT  ++
Sbjct  63   HVEAGSDKEKNVTGVTEKDESLKSWDTEFVKVDQNTLFDLILAANYLNIKGLLDLTCQTV  122

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  123  ADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  161



>ref|XP_007202708.1| hypothetical protein PRUPE_ppa012752mg [Prunus persica]
 gb|EMJ03907.1| hypothetical protein PRUPE_ppa012752mg [Prunus persica]
Length=156

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 108/158 (68%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSSSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  58

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +      S  +LKA+D +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  59   EYCKKHVDAAKPDEKISEDDLKAWDQDFVKVDQATLFDLILAANYLNIKLLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_008232104.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
 ref|XP_008245448.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
Length=156

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLE-KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMV  389
            M+S+E KK+T+ S DGE+FE+   VA QSQT+  M+EDD CA+   IPLP +T  I+A V
Sbjct  1    MASVEMKKITLKSDDGEIFEVEEAVAMQSQTIRHMVEDD-CADG-PIPLPNVTSNIVAKV  58

Query  388  VEYCKKHALTSSLRE-----LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            +EYCKK     +  E     +K +D  F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  59   IEYCKKKHEEDADGEKNKEDIKNWDAAFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ + FNI N  TPEE +++R EN  AFE
Sbjct  119  DMIKGKTPEEIREIFNIKNDFTPEEEQEVRNENRWAFE  156



>ref|XP_009334694.1| PREDICTED: SKP1-like protein 1B [Pyrus x bretschneideri]
Length=156

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 108/159 (68%), Gaps = 11/159 (7%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS E+K+T+ SSDGE FE+   VA +SQT+  M+EDD CA+ + IPLP +T KILA V+
Sbjct  1    MSS-ERKITLKSSDGETFEVDEAVALESQTIKHMVEDD-CAD-NGIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTSSLRE-------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            EYC+KH   +   E       LKA+D EF+KVD  TL DLILAA+YL IK L  LT  ++
Sbjct  58   EYCRKHVEAAKPEERPAVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  117

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  ADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_008806601.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=163

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 107/163 (66%), Gaps = 18/163 (11%)
 Frame = -3

Query  553  EKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCK  374
            E+K+T+ SSDGEVFE+   VA +SQT+  MIEDD  +N   IPLP +T KIL+ V+EYCK
Sbjct  3    EQKITLKSSDGEVFEVEEAVAMESQTIKHMIEDDCASN--GIPLPNVTSKILSKVIEYCK  60

Query  373  KHA-------------LTSSLR--ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
            +H               +S L   ELKA+D EF+KVD  TL DLILAA+YL IKGL  LT
Sbjct  61   RHVDAAAASSKSTADDTSSKLADDELKAWDAEFVKVDQATLFDLILAANYLNIKGLLDLT  120

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  121  CQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  163



>gb|KEH23694.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 103/158 (65%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSD E FE+   VA +SQT+  MIEDD   N   IP+P +TG+ILA V+
Sbjct  1    MSSTSKKITLKSSDNETFEVPEAVALESQTIKHMIEDDCTDN--GIPVPNVTGQILAKVI  58

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH    S  E      LK +D EF+KVD D L DLILAA+YL IK L  LT  +++
Sbjct  59   EYCKKHVDAESSDEKPSEDDLKNWDAEFVKVDQDKLFDLILAANYLNIKSLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_006281119.1| hypothetical protein CARUB_v10027150mg [Capsella rubella]
 gb|EOA14017.1| hypothetical protein CARUB_v10027150mg [Capsella rubella]
Length=204

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 120/198 (61%), Gaps = 31/198 (16%)
 Frame = -3

Query  622  IPVSFSPQNSPQSLTAIATMSSLEK------KVTVSSSDGEVFELSLTVAQQSQTLNRMI  461
            IP+S SPQ S  SLT    +S ++K      K+T+ SSDGE FE+   VA +SQT+  MI
Sbjct  10   IPLS-SPQISSFSLTLKRRISKIQKPMSTVRKITLKSSDGENFEIDEAVALESQTIKHMI  68

Query  460  EDDYCANKDCIPLPKITGKILAMVVEYCKKHALTSSLRE---------------------  344
            EDD CA+ + IPLP +T KIL+ V+EYCKKH   ++  E                     
Sbjct  69   EDD-CAD-NGIPLPNVTSKILSKVIEYCKKHVEAAAKSETAVSAASTTTTAAASGSSDED  126

Query  343  LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-  167
            LK +D EFIKVD  TL DLILAA+YL IKGL  LT  +++  I  KT  E+ +TFNI N 
Sbjct  127  LKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKND  186

Query  166  LTPEEFEQIRRENH*AFE  113
             TPEE E++RREN  AFE
Sbjct  187  FTPEEEEEVRRENQWAFE  204



>gb|KHN41877.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 107/158 (68%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+
Sbjct  1    MSSA-KKITLKSSDGEAFEVEEAVALESQTIKHMIEDD-CADS-GIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +      S  +LKA+D EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKKHVEAANPEDKPSEDDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>gb|EMT15207.1| SKP1-like protein 1B [Aegilops tauschii]
Length=169

 Score =   127 bits (320),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 106/168 (63%), Gaps = 20/168 (12%)
 Frame = -3

Query  562  SSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVE  383
            S+  KK+T+ SSDGE FE+ + VA  SQT+  M+ED  CA+ + IPLP +T KIL+ V+E
Sbjct  4    SAAAKKLTLKSSDGEDFEVEVAVAMASQTIKHMVEDG-CAD-NIIPLPNVTAKILSKVIE  61

Query  382  YCKKHA-----------------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKG  254
            YC +HA                 +     +LKAFD EF+KV+  TL DLILAA+YL IKG
Sbjct  62   YCTQHAPKADDAAAADSTGTATAVKPDEEKLKAFDTEFVKVEQATLFDLILAANYLDIKG  121

Query  253  LAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            L  LT  +++  I  KT  E+ +TFNI N  TPEE E++R+EN  AFE
Sbjct  122  LLDLTCQTVADMIKGKTPEEIRKTFNITNDFTPEEEEEVRKENQWAFE  169



>ref|XP_009147940.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
 emb|CDX93698.1| BnaA06g03500D [Brassica napus]
Length=156

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 10/157 (6%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  KK+ + SSDG +FE+   VA QSQT+  MIEDD   N+  IP+P I G+IL+ V+ Y
Sbjct  2    STSKKIVLKSSDGHIFEVEEAVALQSQTIANMIEDDCVDNE--IPIPNINGEILSKVIVY  59

Query  379  CKKHAL-------TSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSS  221
            CKKH +       +S+  ELKA+D EF+K D  TL +LILAA++L IK L  L   +++ 
Sbjct  60   CKKHVVLPDGDSSSSAKEELKAWDAEFMKTDQSTLFNLILAANFLNIKNLLDLGCQTVAD  119

Query  220  SIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             I  KT  E+    NI+N  TPEE ++IR+EN  AFE
Sbjct  120  MITGKTPEEIRTVLNIENDFTPEEEKEIRKENQWAFE  156



>emb|CAA75117.1| fimbriata-associated protein [Antirrhinum majus]
Length=161

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 109/160 (68%), Gaps = 16/160 (10%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGEVFE+  ++A +SQT+  MIEDD CA+ + IPLP +TGKIL+ V+EYCK+
Sbjct  4    KKITLRSSDGEVFEVEESLALESQTIKHMIEDD-CAD-NVIPLPNVTGKILSKVIEYCKR  61

Query  370  H-------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            H             +  +S  ELKAFD +F+KVD  TL DLILAA+YL IK L  LT  +
Sbjct  62   HVDAAAAKADDKLASTGTSDDELKAFDADFVKVDQATLFDLILAANYLNIKTLLDLTCQT  121

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  122  VADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  161



>gb|AII79401.1| S-phase kinase-associated protein 1-like protein 4 [Malus hupehensis]
Length=156

 Score =   127 bits (319),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 107/158 (68%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSSSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  58

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +      S  +LKA+D EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  59   EYCKKHVDAAKPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKTLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  T EE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTTEEEEEVRRENQWAFE  156



>ref|XP_008357122.1| PREDICTED: SKP1-like protein 1B [Malus domestica]
 gb|AII79405.1| S-phase kinase-associated protein 1-like protein 2 [Malus hupehensis]
Length=156

 Score =   127 bits (319),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 107/159 (67%), Gaps = 11/159 (7%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS E+K+T+ SSDGE FE+   VA  SQT+  M+EDD CA+ + IPLP +T KILA V+
Sbjct  1    MSS-ERKITLKSSDGETFEVDEAVALMSQTIKHMVEDD-CAD-NGIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTSSLRE-------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            EYC+KH   +   E       LKA+D EF+KVD  TL DLILAA+YL IK L  LT  ++
Sbjct  58   EYCRKHVEAAKPEERASVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  117

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  ADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_010941328.1| PREDICTED: SKP1-like protein 1A [Elaeis guineensis]
Length=163

 Score =   127 bits (319),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 107/165 (65%), Gaps = 19/165 (12%)
 Frame = -3

Query  556  LEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYC  377
            + +K+ + SSDGEVFE+  +VA +SQT+  MIEDD   N   IPLP +T KIL+ V+EYC
Sbjct  1    MAEKIILKSSDGEVFEVEESVAMESQTIKHMIEDDCAGNG--IPLPNVTSKILSKVIEYC  58

Query  376  KKH----------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAV  245
            K+H                +  ++  ELKA+DDEF++VD  TL DLILAA+YL IKGL  
Sbjct  59   KRHVEASAAASKYAAEDSSSSKAADNELKAWDDEFVRVDQATLFDLILAANYLNIKGLLD  118

Query  244  LTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  LTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  163



>ref|XP_009379340.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=156

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 107/158 (68%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSSSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  58

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCK+H   +      S  +LKA+D EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  59   EYCKRHVDAAKPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  T EE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTQEEEEEVRRENQWAFE  156



>ref|XP_007225985.1| hypothetical protein PRUPE_ppa012755mg [Prunus persica]
 ref|XP_008221225.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
 gb|AFJ21662.1| Skp1-like protein 1 [Prunus avium]
 gb|EMJ27184.1| hypothetical protein PRUPE_ppa012755mg [Prunus persica]
Length=156

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 109/159 (69%), Gaps = 11/159 (7%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS E+K+T+ SSDGE FE+   VA +SQT+  M+EDD CA+ + IPLP +T KILA V+
Sbjct  1    MSS-ERKITLKSSDGETFEVDEAVALESQTIKHMVEDD-CAD-NGIPLPNVTSKILAKVI  57

Query  385  EYCKKHA-------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            EYCKKH          S+  +LKA+D +F+K+D  TL DLILAA+YL IK L  LT  ++
Sbjct  58   EYCKKHVDAAKPDDRPSNDEDLKAWDTDFVKIDQATLFDLILAANYLNIKSLLDLTCQTV  117

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  ADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_010536422.1| PREDICTED: SKP1-like protein 1A [Tarenaya hassleriana]
Length=166

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 109/166 (66%), Gaps = 18/166 (11%)
 Frame = -3

Query  562  SSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVE  383
            S++E+K+ + SSDGE FE+   VA +SQT+  M+EDD CA+ + IPLP +T K+LA V+E
Sbjct  3    SAVERKIILKSSDGEAFEVDEVVALESQTIKHMVEDD-CAD-NGIPLPNVTSKVLAKVIE  60

Query  382  YCKKHALTSSLR---------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLA  248
            YCKKH   ++                 +LKA+D EF+KVD  TL DLILAA+YL IKGL 
Sbjct  61   YCKKHVDAAAANNSEDCVGGSAGGDKDDLKAWDAEFVKVDQATLFDLILAANYLNIKGLL  120

Query  247  VLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  121  DLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  166



>ref|XP_010683792.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=170

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 104/165 (63%), Gaps = 21/165 (13%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            +K+T+ SSDGE F++  +VA + +T+  MIEDD CA+ + IPLP +T KIL+ V+ YCKK
Sbjct  7    RKITLKSSDGEKFDVEESVALECETIKLMIEDD-CAD-NVIPLPNVTAKILSKVIVYCKK  64

Query  370  HALTSSLR------------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAV  245
            H  +++ +                  ELK +D EF+KVD  TL DLILAA+YL IK L  
Sbjct  65   HVESAAAKSCSTEDSCSSTANSTTNEELKIWDKEFVKVDQSTLLDLILAANYLNIKSLLD  124

Query  244  LTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            LT  ++S  I +KT  E+ + FNI N  TPEE E IRREN  AF+
Sbjct  125  LTCQTVSDMIKDKTPEEVRKMFNIKNDFTPEEEEAIRRENQWAFD  169



>ref|XP_007041813.1| S phase kinase-associated protein 1 [Theobroma cacao]
 gb|EOX97644.1| S phase kinase-associated protein 1 [Theobroma cacao]
Length=156

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 108/158 (68%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            M+S  KK+ + SSDGE FE+   VA +SQT+  MIEDD CA+ + IP+P +T KILA V+
Sbjct  1    MASTSKKIMLRSSDGEAFEVEEAVAVESQTIKHMIEDD-CADNE-IPVPNVTSKILAKVL  58

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   ++ +E      LK +D +F+KVD +TL DLILAA+YL IK L  LT  +++
Sbjct  59   EYCKKHVDAAADKEKIPEDDLKVWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  EMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_009363460.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=156

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 107/158 (68%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSSSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  58

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +      S  +LKA+D EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  59   EYCKKHVDAAKPDEKISEDDLKAWDQEFVKVDQVTLFDLILAANYLNIKTLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  T EE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTTEEEEEVRRENQWAFE  156



>gb|EYU17579.1| hypothetical protein MIMGU_mgv1a015014mg [Erythranthe guttata]
Length=170

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 110/169 (65%), Gaps = 18/169 (11%)
 Frame = -3

Query  571  ATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAM  392
            +T  +  KK+T+ SSDGEVFE+   VA +SQT+  MIEDD CA+ + IPLP +TGKIL+ 
Sbjct  4    STAENGGKKITLRSSDGEVFEVEDAVAVESQTIKHMIEDD-CAD-NVIPLPNVTGKILSK  61

Query  391  VVEYCKKH---------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIK  257
            V+EYCK+H               +  +S  +LK FD +F+KVD  TL DLILAA+YL IK
Sbjct  62   VIEYCKRHVDAAASATKADDKLASAAASDEDLKVFDADFVKVDQATLFDLILAANYLNIK  121

Query  256  GLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             L  LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  122  SLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  170



>ref|XP_009414442.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=157

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 105/159 (66%), Gaps = 13/159 (8%)
 Frame = -3

Query  556  LEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYC  377
            ++KK+ + SSDGE FE+ + VA +SQT+  MIEDD   N   +PLP +T KILA V+EYC
Sbjct  1    MDKKIILKSSDGEEFEVDVAVAMESQTIRHMIEDDCFEN--GVPLPNVTSKILAKVIEYC  58

Query  376  KKHALTSSL----------RELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            +KH   +S            ELKA+D +F+KVD  TL DLILAA+YL IKGL  LT  ++
Sbjct  59   RKHVDAASNSSGDASKVPDEELKAWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTV  118

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  ADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>gb|EMT01771.1| SKP1-like protein 1B [Aegilops tauschii]
Length=252

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 115/202 (57%), Gaps = 28/202 (14%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A +   +K +T+ SSDG+ F++   VA +SQT+  MIEDD CA+ D IPLP +  KIL+
Sbjct  1    MAAVEGEKKMITLKSSDGQEFDVEEAVAMESQTIRHMIEDD-CADND-IPLPNVDSKILS  58

Query  394  MVVEYCKKHALTSS----------------------LRELKAFDDEFIKVDMDTLCDLIL  281
             V+EYCKKH   S                         +LK+FD EF+KVD  TL DLIL
Sbjct  59   KVIEYCKKHVQASPKPADSGAVTDANSSTSTAAAAPAEDLKSFDAEFVKVDRATLFDLIL  118

Query  280  AADYLCIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE--*  110
            AA+YL IKGL  LT  +++  I + T  E+ + FNI N  TPEE  ++R+ENH  +E   
Sbjct  119  AANYLNIKGLLDLTCQTVADMIKDNTPEEIRKIFNIKNDFTPEEEAEVRKENHLLWESGD  178

Query  109  YAITIPIYD*F*VMLQMLLDSW  44
             A TI IY  +    + L+  W
Sbjct  179  MAHTI-IYSYYLTRPERLIGRW  199



>ref|XP_009420815.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=159

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 107/161 (66%), Gaps = 15/161 (9%)
 Frame = -3

Query  556  LEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYC  377
            + K +T+ SSDGEVFE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA VVEYC
Sbjct  1    MAKTITLRSSDGEVFEVEEAVAMESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVVEYC  58

Query  376  KKH------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            KKH            A + +  +LK +D +F+KVD  TL DLILAA+YL IKGL  LT  
Sbjct  59   KKHVDAAARSSSSDDAPSVTEDDLKTWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQ  118

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  TVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  159



>ref|XP_003605511.1| SKP1 [Medicago truncatula]
 gb|AES87708.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=150

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 102/146 (70%), Gaps = 2/146 (1%)
 Frame = -3

Query  547  KVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKH  368
            K+ + SSDGE F++   VA QSQT+  +I D+ CAN   IPL  +TGKILAMV+EYCKKH
Sbjct  6    KIILKSSDGETFKIEKAVAMQSQTIKHLI-DEECANDTGIPLTNVTGKILAMVIEYCKKH  64

Query  367  ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKTLPELC  188
               +S  EL+ +D EF+KVD +TL +LI+AA+YL IK L  LT ++   +I +KT  E+ 
Sbjct  65   VDAASSDELEKWDAEFVKVDQNTLFNLIMAANYLNIKSLLDLTCMTTMDNIKDKTPEEIR  124

Query  187  QTFNIDN-LTPEEFEQIRRENH*AFE  113
            + FNI N  TPEE E++RREN  AFE
Sbjct  125  KIFNIKNDYTPEEEEEVRRENSWAFE  150



>ref|XP_010683699.1| PREDICTED: SKP1-like protein 1B isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=152

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 101/152 (66%), Gaps = 10/152 (7%)
 Frame = -3

Query  544  VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKHA  365
            +T+ SSDGE FE+  +VA + +T+  MIEDD CA+   IPLP +T KIL+ V+EYCKKH 
Sbjct  2    ITLKSSDGEKFEVEESVALECETIKLMIEDD-CADT-AIPLPNVTAKILSKVIEYCKKHV  59

Query  364  LT-------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINK  206
             +       S+  +LK +D EF+KVD  TL +LILAA+YL I+ L  LT  ++S  I +K
Sbjct  60   ESAAAAKSCSTEDKLKIWDKEFVKVDQKTLFNLILAANYLNIRSLLDLTCQTVSDIIKDK  119

Query  205  TLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            T  E+ + FNI N  TPEE E IRREN  AF+
Sbjct  120  TPEEVRKMFNIKNDFTPEEEEAIRRENQWAFD  151



>ref|XP_007202707.1| hypothetical protein PRUPE_ppa012732mg [Prunus persica]
 gb|EMJ03906.1| hypothetical protein PRUPE_ppa012732mg [Prunus persica]
Length=157

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 10/159 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  K++T+ SSD  +FE+   VA +SQ +  MIEDD CA+K CIP+P + G ILA V+
Sbjct  1    MSSPSKRITLKSSDPALFEVDEAVALESQIIKYMIEDD-CADK-CIPVPNVKGNILAKVI  58

Query  385  EYCKKHALTS------SLRELKAFDDEFI-KVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
             YCKKHA  +      +  +LKA+D +F+  V+  T+ DLILAA++L IK L  LT   +
Sbjct  59   VYCKKHADAAKPDSKITEYDLKAWDQDFLDDVNPATIFDLILAANFLNIKSLLDLTCQCI  118

Query  226  SSSIINKTLPELCQTFNI-DNLTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI DN TPEE E++RR+N  AFE
Sbjct  119  ADMIKGKTPAEIRKTFNIKDNFTPEEEEEVRRQNQWAFE  157



>ref|XP_002510576.1| skp1, putative [Ricinus communis]
 gb|EEF52763.1| skp1, putative [Ricinus communis]
Length=157

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 105/158 (66%), Gaps = 11/158 (7%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+EY
Sbjct  2    STSRKITLKSSDGETFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVIEY  59

Query  379  CKKHALTSSLR--------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            CKKH  TS           ELK +D EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  60   CKKHVETSKSDDRPSSVDDELKTWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  119

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>ref|XP_004512164.1| PREDICTED: SKP1-like protein 1A-like [Cicer arietinum]
Length=155

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 107/158 (68%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+
Sbjct  1    MSST-KKITLKSSDGEAFEVDEAVALESQTIKHMIEDD-CADS-GIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +S  +      LKA+D +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKKHVEAASSDDKPTEDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>ref|XP_008811458.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=164

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 106/164 (65%), Gaps = 19/164 (12%)
 Frame = -3

Query  553  EKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCK  374
            EKK+T+ SSDGEVFE+   VA +SQT+  MIEDD  +N   IPLP +T KIL+ V+EYCK
Sbjct  3    EKKITLKSSDGEVFEVDEMVAMESQTIKHMIEDDCASN--GIPLPNVTSKILSKVIEYCK  60

Query  373  KHALT------------SSLR----ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVL  242
            KH               +S +    +LK +D EF+KVD  TL DLILAA+YL IKGL  L
Sbjct  61   KHVDAAAAAASKSAADDTSFKLADDDLKTWDAEFVKVDQATLFDLILAANYLNIKGLLDL  120

Query  241  TSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            T  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  121  TCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  164



>gb|ABK96569.1| unknown [Populus trichocarpa x Populus deltoides]
Length=158

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 108/161 (67%), Gaps = 13/161 (8%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+++ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSS-GRKISLRSSDGESFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  57

Query  385  EYCKKHALT---------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            EYCKKH  T         S   ELK +D EF++VD  TL DLILAA+YL IKGL  LT  
Sbjct  58   EYCKKHVETPKSEDRGTNSGDDELKNWDTEFVRVDQATLFDLILAANYLNIKGLLDLTCQ  117

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  TVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  158



>gb|AAX83944.1| Skp1 [Capsicum annuum]
Length=156

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 103/157 (66%), Gaps = 10/157 (6%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  KK+ + SSDGE FE+   VA +SQT+  MIEDD CAN   IPLP +T KIL+ VVEY
Sbjct  2    SAPKKILLKSSDGETFEVDEAVALESQTIKHMIEDD-CANT-SIPLPNVTSKILSKVVEY  59

Query  379  CKKHALTSSLRE-------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSS  221
            CKKH    +  E       LK+FD EF+KVD  TL DLILAA+YL IK L  LT  +++ 
Sbjct  60   CKKHVDAGAKTEDKASEDDLKSFDSEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVAD  119

Query  220  SIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  156



>ref|XP_003517160.1| PREDICTED: SKP1-like protein 1A-like [Glycine max]
 gb|KHN36011.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 107/158 (68%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+
Sbjct  1    MSSA-KKITLKSSDGEAFEVDEAVALESQTIKHMIEDD-CADS-GIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +      S  +LKA+D +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKKHVEAANPEDKPSEDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>ref|XP_002890373.1| hypothetical protein ARALYDRAFT_889462 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66632.1| hypothetical protein ARALYDRAFT_889462 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 103/160 (64%), Gaps = 16/160 (10%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +TG ILA V+EYCKK
Sbjct  4    KKIILKSSDGESFEIDEAVAVESQTIKHMIEDD-CAD-NGIPLPNVTGAILAKVIEYCKK  61

Query  370  HALTSSLR-------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            H   ++               ELKA+D++F+KVD  TL DLILAA+YL I GL  LT  +
Sbjct  62   HVEAAAESGGDEDFCGSTENDELKAWDNDFVKVDQPTLFDLILAANYLNISGLLDLTCKA  121

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  +  KT  ++ + FNI N  TPEE E++R EN  AFE
Sbjct  122  VADMMRGKTPEQMREHFNIKNDYTPEEEEEVRNENKWAFE  161



>ref|NP_565604.1| putative E3 ubiquitin ligase ASK3 [Arabidopsis thaliana]
 sp|Q9SL93.1|ASK3_ARATH RecName: Full=SKP1-like protein 3; Short=AtSK3 [Arabidopsis thaliana]
 gb|AAD31370.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At3), putative 
[Arabidopsis thaliana]
 gb|AAK96604.1| At2g25700/F3N11.15 [Arabidopsis thaliana]
 gb|AAM98112.1| At2g25700/F3N11.15 [Arabidopsis thaliana]
 gb|AEC07739.1| putative E3 ubiquitin ligase ASK3 [Arabidopsis thaliana]
Length=163

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 99/165 (60%), Gaps = 16/165 (10%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            M+  +K + + SSDGE FE+   VA +SQT+  MIEDD   N   IPLP +TG ILA V+
Sbjct  1    MAETKKMIILKSSDGESFEVEEAVAVESQTIKHMIEDDCVDN--GIPLPNVTGAILAKVI  58

Query  385  EYCKKHALTSSL-------------RELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAV  245
            EYCKKH   ++               ELK +D++F+KVD  TL DL+ AA+YL I GL  
Sbjct  59   EYCKKHVEAAAEAGGDKDFYGSTENHELKTWDNDFVKVDHPTLFDLLRAANYLNISGLLD  118

Query  244  LTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            LT  +++  +  KT  ++ + FNI N  TPEE  ++R EN  AFE
Sbjct  119  LTCKAVADQMRGKTPAQMREHFNIKNDYTPEEEAEVRNENRWAFE  163



>gb|ABK92723.1| unknown [Populus trichocarpa]
Length=158

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 108/161 (67%), Gaps = 13/161 (8%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+++ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSS-GRKISLRSSDGESFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  57

Query  385  EYCKKHALT---------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            EYCKKH  T         S   ELK +D EF++VD  TL DLILAA+YL IKGL  LT  
Sbjct  58   EYCKKHVETPKPEDRGTNSGDDELKNWDTEFVRVDQATLFDLILAANYLNIKGLLDLTCQ  117

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  TVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  158



>ref|XP_002510577.1| skp1, putative [Ricinus communis]
 gb|EEF52764.1| skp1, putative [Ricinus communis]
Length=157

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 106/158 (67%), Gaps = 11/158 (7%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KIL+ V+EY
Sbjct  2    SAGKKITLKSSDGETFEVEELVALESQTIKHMIEDD-CADS-GIPLPNVTSKILSKVIEY  59

Query  379  CKKHALT--------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            CKKH  T        S+  +LKA+D EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  60   CKKHVETPKSEDRPSSADDDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  119

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>ref|XP_004512165.1| PREDICTED: SKP1-like protein 1A-like [Cicer arietinum]
Length=155

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 107/158 (68%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K T+ SSDGE FE+   VA +SQT+  MIEDD   N   IPLP +T KILA V+
Sbjct  1    MSST-RKFTLKSSDGEAFEVDEAVAVESQTIKHMIEDDCAGN--GIPLPNVTSKILAKVI  57

Query  385  EYCKKH--ALTSSLR----ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH  A TS  +    +LKA+D +F+KVD  TL +LILAA+YL IK L  LT ++++
Sbjct  58   EYCKKHVEAATSDDKPTEDDLKAWDSDFVKVDQATLFELILAANYLNIKNLLDLTCMTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>ref|XP_003612227.1| SKP1-like protein [Medicago truncatula]
 gb|ABG27020.1| SKP1-like b [Medicago truncatula]
 gb|ACJ84134.1| unknown [Medicago truncatula]
 gb|ACJ85945.1| unknown [Medicago truncatula]
 gb|AES95185.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
 gb|AFK39072.1| unknown [Medicago truncatula]
Length=155

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 107/158 (68%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+
Sbjct  1    MSST-RKITLKSSDGETFEVDEAVALESQTIKHMIEDD-CADS-GIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   ++  E      LK++D EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKKHVDAAAAEEKPNEDELKSWDSEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  +PEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFSPEEEEEVRRENQWAFE  155



>gb|KHG30151.1| SKP1-like protein 1A [Gossypium arboreum]
Length=156

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 108/158 (68%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            M+S  +K+ + SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+
Sbjct  1    MASTSRKIMLRSSDGETFEVEEAVAVESQTIKHMIEDD-CADNE-IPLPNVTSKILSKVL  58

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   ++ +E      LK +D +F+KVD +TL DLILAA+YL IK L  LT  +++
Sbjct  59   EYCKKHVDAAADKEKTPDDELKVWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>gb|ADQ00179.1| E3 ubiquitin ligase [Chlamydomonas sp. ICE-L]
Length=155

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 98/155 (63%), Gaps = 12/155 (8%)
 Frame = -3

Query  547  KVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKH  368
            KV + SSD +VFE+   VA  S+T+  MIED     ++ +PLP ++GKILA V+EYCK H
Sbjct  3    KVKLGSSDSQVFEVDEDVANLSETVKNMIED--TGVEELVPLPNVSGKILAKVIEYCKYH  60

Query  367  ALTSSLRE---------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSI  215
               +   +         +KA+D EF+KVD  TL DLILA +YL IKGL  LT  +++  I
Sbjct  61   VEANKKVDDKPSKTEEVVKAWDAEFVKVDQATLFDLILAGNYLHIKGLLDLTCQTVAQMI  120

Query  214  INKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              KT  E+ +TFNI N  TPEE +++RREN  AF+
Sbjct  121  KGKTPEEIRKTFNIKNDFTPEEEDEVRRENQWAFD  155



>ref|XP_007157884.1| hypothetical protein PHAVU_002G106100g [Phaseolus vulgaris]
 gb|AGV54260.1| SKP1-like protein [Phaseolus vulgaris]
 gb|ESW29878.1| hypothetical protein PHAVU_002G106100g [Phaseolus vulgaris]
Length=155

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 107/158 (68%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+
Sbjct  1    MSSA-RKITLKSSDGEAFEVDEAVALESQTIKHMIEDD-CADS-GIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +      S  +LKA+D +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKKHVDAANPDDKPSEEDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>ref|XP_009395355.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=160

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 106/161 (66%), Gaps = 17/161 (11%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K +T+ SSDGEVFE+   VA +SQT+  MIEDD CA ++ IPLP +T KILA V+EYCKK
Sbjct  2    KTITLKSSDGEVFEVDEAVAMESQTIKHMIEDD-CA-ENGIPLPNVTSKILAKVIEYCKK  59

Query  370  H--------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            H              A   +  ELK++D EF+KVD  TL DLILAA+YL IKGL  LT  
Sbjct  60   HVDASAAASSKSPDDASKLADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQ  119

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  TVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  160



>ref|XP_010941330.1| PREDICTED: SKP1-like protein 1B [Elaeis guineensis]
Length=164

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 105/164 (64%), Gaps = 19/164 (12%)
 Frame = -3

Query  553  EKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCK  374
            EKK+ + SSDGEVFE+   VA +SQT+  MIEDD  +N   IPLP +T KIL+ V+EYCK
Sbjct  3    EKKIILKSSDGEVFEVDEMVAMESQTIKHMIEDDCASN--GIPLPNVTSKILSKVIEYCK  60

Query  373  KHA--------------LTSSLRE--LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVL  242
            KH                +S L E  LK +D EF+KVD  TL DLILAA+YL IKGL  L
Sbjct  61   KHVDAAAAAASKSATDDTSSKLGEEDLKTWDAEFVKVDQATLFDLILAANYLNIKGLLDL  120

Query  241  TSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            T  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  121  TCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  164



>ref|XP_010683698.1| PREDICTED: SKP1-like protein 1B isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=171

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 102/164 (62%), Gaps = 22/164 (13%)
 Frame = -3

Query  544  VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKH-  368
            +T+ SSDGE FE+  +VA + +T+  MIEDD CA+   IPLP +T KIL+ V+EYCKKH 
Sbjct  9    ITLKSSDGEKFEVEESVALECETIKLMIEDD-CADT-AIPLPNVTAKILSKVIEYCKKHV  66

Query  367  ------------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVL  242
                              A +S+  ELK +D EF+KVD  TL +LILAA+YL I+ L  L
Sbjct  67   ESAAAAKSCSTEDSCSSTANSSTNEELKIWDKEFVKVDQKTLFNLILAANYLNIRSLLDL  126

Query  241  TSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            T  ++S  I +KT  E+ + FNI N  TPEE E IRREN  AF+
Sbjct  127  TCQTVSDIIKDKTPEEVRKMFNIKNDFTPEEEEAIRRENQWAFD  170



>gb|AAD34458.1| Skp1 [Medicago sativa]
Length=153

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 104/153 (68%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+EYCKK
Sbjct  3    RKITLKSSDGETFEVDEAVALESQTIKHMIEDD-CADS-GIPLPNVTSKILAKVIEYCKK  60

Query  370  HALTSSLR------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H   ++        ELK++D EF+KVD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  61   HVDAAAAEDKPNEDELKSWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKG  120

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  +PEE E++RREN  AFE
Sbjct  121  KTPEEIRKTFNIKNDFSPEEEEEVRRENQWAFE  153



>ref|XP_010033522.1| PREDICTED: SKP1-like protein 1B [Eucalyptus grandis]
 gb|KCW53208.1| hypothetical protein EUGRSUZ_J02478 [Eucalyptus grandis]
Length=155

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 110/158 (70%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T +ILA V+
Sbjct  1    MSSA-KKITLRSSDGESFEVDEAVAVESQTIKHMIEDD-CADS-GIPLPNVTSRILAKVI  57

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH  ++      +  +LKA+D EF+KVD  TL DLILAA+YL IKGL  LT L+++
Sbjct  58   EYCKKHVESAKPDDRTTEDDLKAWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCLTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  ++ ++F+I N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEDIRKSFSIKNDFTPEEEEEVRRENQWAFE  155



>ref|XP_003612225.1| SKP1-like protein [Medicago truncatula]
 gb|ABG27019.1| SKP1-like a [Medicago truncatula]
 gb|ACJ83981.1| unknown [Medicago truncatula]
 gb|AES95183.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
 gb|AFK47584.1| unknown [Medicago truncatula]
Length=155

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 107/158 (68%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+
Sbjct  1    MSST-RKITLKSSDGETFEVDEAVALESQTIKHMIEDD-CADS-GIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   ++  E      +K++D EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKKHVEAAAAEEKPSEDEIKSWDGEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  +PEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFSPEEEEEVRRENQWAFE  155



>ref|XP_011083455.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=170

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 108/162 (67%), Gaps = 18/162 (11%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            +K+T+ SSDGEVFE+   VA +SQT+  MIEDD CA+ + IPLP +TGKIL+ V+EYCK+
Sbjct  11   RKITLRSSDGEVFEVDEAVAVESQTIKHMIEDD-CAD-NVIPLPNVTGKILSKVIEYCKR  68

Query  370  H---------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTS  236
            H               +  ++  +LKAFD +F+KVD  TL DLILAA+YL IK L  LT 
Sbjct  69   HVDAAAAASKADDKLASTAATDDDLKAFDADFVKVDQATLFDLILAANYLNIKTLLDLTC  128

Query  235  LSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  129  QTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  170



>ref|NP_001241052.1| uncharacterized protein LOC100798104 [Glycine max]
 gb|ACU21125.1| unknown [Glycine max]
 gb|KHN00453.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 104/153 (68%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGE FE+   VA +SQT+  MIED+ CA+   IPLP +T KILA V+EYCKK
Sbjct  5    KKITLKSSDGEAFEVEEAVAVESQTIKHMIEDN-CADSG-IPLPNVTSKILAKVIEYCKK  62

Query  370  HALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H   +      S  ELKA+D +F+KVD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  63   HVEANCADEKPSEDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKG  122

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  123  KTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>ref|XP_006435227.1| hypothetical protein CICLE_v10002751mg [Citrus clementina]
 ref|XP_006473700.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR48467.1| hypothetical protein CICLE_v10002751mg [Citrus clementina]
Length=158

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 106/159 (67%), Gaps = 12/159 (8%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+EY
Sbjct  2    STSKKITLKSSDGEAFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVIEY  59

Query  379  CKKH---------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            CKKH         A +    +LKA+D +F+KVD  TL DLILAA+YL IK L  LT  ++
Sbjct  60   CKKHVEASKSDDRATSGVDDDLKAWDTDFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  119

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  ADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  158



>gb|EMS52877.1| SKP1-like protein 1B [Triticum urartu]
Length=166

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 104/165 (63%), Gaps = 17/165 (10%)
 Frame = -3

Query  562  SSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVE  383
            S+  KK+T+ SSDGE FE+ + VA  SQT+  M+ED  CA+ + IPLP +  K+L+ V+E
Sbjct  4    SAAAKKLTLKSSDGEDFEVEVAVAMASQTIKHMVEDG-CAD-NIIPLPNVNAKVLSKVIE  61

Query  382  YCKKHA--------------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAV  245
            YC +HA              +      LKAFD EF+KV+  TL DLILAA+YL IKGL  
Sbjct  62   YCTQHAPKADDAATADSATAVKPDEETLKAFDAEFVKVEQATLFDLILAANYLDIKGLLD  121

Query  244  LTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            LT  +++  I  KT  E+ +TFNI N  TPEE E++R+EN  AFE
Sbjct  122  LTCQTVADMIKGKTPEEIRKTFNITNDFTPEEEEEVRKENQWAFE  166



>ref|XP_003574990.1| PREDICTED: SKP1-like protein 1A [Brachypodium distachyon]
Length=162

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 103/161 (64%), Gaps = 13/161 (8%)
 Frame = -3

Query  562  SSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVE  383
            S  +K + + SSDG+ FE+   VA++S+T+  MIEDD CA+ + IPLP +  KIL  V+E
Sbjct  4    SDTKKMILLRSSDGKEFEVEEAVAKESRTILHMIEDD-CAD-NGIPLPNVDAKILTKVIE  61

Query  382  YCKKHAL----------TSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            YCKKHA           +++  +LK FD +F+KVD   L DLILAA+YL IKGL  LT  
Sbjct  62   YCKKHAAAADPSAADSNSTAAADLKEFDADFVKVDQAVLFDLILAANYLDIKGLLDLTCQ  121

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT+ E+   FNI N  TPEE  +IR+EN  AFE
Sbjct  122  TVADMIKGKTVEEIRTKFNIKNDFTPEEEAEIRKENQWAFE  162



>ref|XP_009395385.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=161

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 107/163 (66%), Gaps = 17/163 (10%)
 Frame = -3

Query  556  LEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYC  377
            + K +T+ SSDGEVFE+   VA +SQT+  MIEDD CA ++ IPLP +T KILA V+EYC
Sbjct  1    MAKMITLKSSDGEVFEVDEAVAMESQTIKHMIEDD-CA-ENGIPLPNVTSKILAKVIEYC  58

Query  376  KKHALTSSLR--------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
            +KH   S+                ELK++D EF+KVD  TL DLILAA+YL IKGL  LT
Sbjct  59   RKHVDASAAAASKSSDDSSKLADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLT  118

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  CQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  161



>ref|XP_011046673.1| PREDICTED: SKP1-like protein 1A [Populus euphratica]
Length=161

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 105/159 (66%), Gaps = 15/159 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGE F +   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+EYCKK
Sbjct  5    KKITLKSSDGETFVVDEAVAVESQTIKHMIEDD-CADNE-IPLPNVTSKILAKVIEYCKK  62

Query  370  HALTSSLRE------------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            H    S +E            LK++D EF+KVD +TL DLILAA+YL IK L  LT  ++
Sbjct  63   HVEAGSDKEKNVTGVTEKDESLKSWDTEFVKVDQNTLFDLILAANYLNIKDLLDLTCQTV  122

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  123  ADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  161



>ref|XP_010266012.1| PREDICTED: SKP1-like protein 1B [Nelumbo nucifera]
Length=154

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 104/153 (68%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KKVT+ SSDGE F++   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+EYCKK
Sbjct  4    KKVTLKSSDGETFDVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVIEYCKK  61

Query  370  HALT------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H  T       +  ELK +D EF+KVD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  62   HVETPKTDDRGAEDELKNWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKG  121

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  122  KTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  154



>ref|NP_001235349.1| uncharacterized protein LOC100306458 [Glycine max]
 gb|ACU14645.1| unknown [Glycine max]
 gb|KHN35539.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 103/153 (67%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+EYCKK
Sbjct  5    KKITLKSSDGEAFEVEEAVALESQTIKHMIEDD-CADS-GIPLPNVTSKILAKVIEYCKK  62

Query  370  HALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H   +S  E      LKA+D +F+ VD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  63   HVEANSADEKPSEDVLKAWDVDFVNVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKG  122

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  123  KTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>ref|XP_002863814.1| hypothetical protein ARALYDRAFT_917589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40073.1| hypothetical protein ARALYDRAFT_917589 [Arabidopsis lyrata subsp. 
lyrata]
Length=169

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 110/172 (64%), Gaps = 24/172 (14%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MS++ +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+
Sbjct  1    MSTV-RKITLKSSDGENFEIDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVI  57

Query  385  EYCKKH--------------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYL  266
            EYCKKH                    A  SS  +LK +D EFIKVD  TL DLILAA+YL
Sbjct  58   EYCKKHVEAAAKSETTTEAAATTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYL  117

Query  265  CIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             IKGL  LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  NIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  169



>emb|CAA75118.1| fimbriata-associated protein [Antirrhinum majus]
Length=165

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 16/160 (10%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGEVFE+   +A  SQT+  MIEDD CA+ + IPLP +TGKIL+ V+EYCK+
Sbjct  8    KKITLRSSDGEVFEVDEAIALLSQTIKHMIEDD-CAD-NVIPLPNVTGKILSKVIEYCKR  65

Query  370  HALTSSLR-------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            H    + +             +LKAFD +F+KVD  TL DLILAA+YL IK L  LT  +
Sbjct  66   HVDADAAKSEEKVAAAAAGDDDLKAFDADFVKVDQATLFDLILAANYLNIKTLLDLTCQT  125

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  126  VADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  165



>gb|ACU13236.1| unknown [Glycine max]
Length=155

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 104/153 (68%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGE FE+   VA +SQT+  M+ED+ CA+   IPLP +T KILA V+EYCKK
Sbjct  5    KKITLKSSDGEAFEVEEAVAVESQTIKHMVEDN-CADSG-IPLPNVTSKILAKVIEYCKK  62

Query  370  HALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H   +      S  ELKA+D +F+KVD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  63   HVEANCADEKPSEDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKG  122

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  123  KTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>ref|NP_001235929.1| uncharacterized protein LOC100527683 [Glycine max]
 gb|ACU16825.1| unknown [Glycine max]
Length=155

 Score =   124 bits (311),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 106/158 (67%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+
Sbjct  1    MSSA-KKITLKSSDGEAFEVEEAVALESQTIKHMIEDD-CADS-GIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +      S  +LKA+  EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKKHVEAANPEDKPSEDDLKAWAAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>gb|KFK35110.1| hypothetical protein AALP_AA5G237300 [Arabis alpina]
Length=162

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 100/166 (60%), Gaps = 19/166 (11%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+ + SSDGE FE+   VA QSQT+  MIEDD CA  D IPLP +TGKILA VV
Sbjct  1    MSS--KKIVLKSSDGESFEVDEAVALQSQTIKHMIEDD-CAG-DGIPLPNVTGKILAKVV  56

Query  385  EYCKKHA----------LTSSLRE---LKAFDDEFIKV-DMDTLCDLILAADYLCIKGLA  248
            EYCKKH           +  S  E   LK +D EF K  D  TL ++ILAA+YL I GL 
Sbjct  57   EYCKKHVEVEAEGGDKDVYGSKEEDEALKTWDTEFAKTDDQATLFEIILAANYLNIGGLL  116

Query  247  VLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             L   +++  +  KT  E+   FNI N  TPEE  ++RREN  AFE
Sbjct  117  DLMCKTVADMMRGKTPEEMRTLFNIKNDYTPEEEAEVRRENAWAFE  162



>gb|KDP36889.1| hypothetical protein JCGZ_08180 [Jatropha curcas]
Length=157

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 106/158 (67%), Gaps = 11/158 (7%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  +K+T+ S+DGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+EY
Sbjct  2    STGRKITLKSADGETFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVIEY  59

Query  379  CKKHALT--------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            CKKH  T        S+  ELK +D +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  60   CKKHVETPKSDDRPSSADEELKTWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  119

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>gb|KEH23692.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=159

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 100/159 (63%), Gaps = 11/159 (7%)
 Frame = -3

Query  562  SSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVE  383
            S+  K +T+ S D E+FE+   VA +SQT+  MIEDD CA+ + IP+  +TGKILA V+E
Sbjct  3    STTTKMITLKSYDNEIFEVPEAVALESQTIKHMIEDD-CAD-NAIPVQNVTGKILAKVIE  60

Query  382  YCKKHALTSSLRE--------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            YCKKH   +S  E        LK +D +F+KVD +TL +LILAA+YL IK L  LT  S 
Sbjct  61   YCKKHVQVASADEKPSESEEYLKNWDADFVKVDKETLFELILAANYLDIKSLLDLTCQSA  120

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  +  KT  E+ + FNI N  +PEE   IR EN  AFE
Sbjct  121  ADMMKGKTPEEMREMFNIKNDFSPEEEAAIRAENKWAFE  159



>gb|KFK36059.1| hypothetical protein AALP_AA4G072500 [Arabis alpina]
Length=151

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 97/149 (65%), Gaps = 5/149 (3%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + + S DGE+FE+   VA QSQT+  M+EDD   N   IP+  +TG+ILA V+EYCKK
Sbjct  5    KMIVLKSFDGEIFEIEEAVALQSQTIAHMVEDDCVEN--GIPISNVTGEILAKVIEYCKK  62

Query  370  HA-LTSSLRELKAFDDEFIK-VDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKTLP  197
            H     S  ELK +D+EF+K +D  TL +LILAA+YL IK L   T  +++  I  KT  
Sbjct  63   HVDGGGSEEELKTWDEEFMKNIDQSTLFNLILAANYLNIKTLLDFTCQTVADMIKGKTPE  122

Query  196  ELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++ +TFNI N  TPEE  ++R+EN  AFE
Sbjct  123  QIRETFNIKNDFTPEEEAKVRQENQWAFE  151



>ref|XP_008811446.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=162

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 106/164 (65%), Gaps = 18/164 (11%)
 Frame = -3

Query  556  LEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYC  377
            + +K+ + SSDGEVFE+  TVA +SQT+  MIEDD  +N   IPLP +T KIL+ V+EYC
Sbjct  1    MAEKIILKSSDGEVFEVEETVAMESQTIKHMIEDDCASNG--IPLPNVTSKILSKVIEYC  58

Query  376  KKHALTSSLR---------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVL  242
            K+H   S+                 ELKA+D EF++VD  TL DLILAA+YL IKGL  L
Sbjct  59   KRHVEASAAASKAAAEDSSSKLADDELKAWDAEFVRVDQATLFDLILAANYLNIKGLLDL  118

Query  241  TSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            T  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  TCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  162



>ref|XP_009149503.1| PREDICTED: SKP1-like protein 4 [Brassica rapa]
 emb|CDY29370.1| BnaA06g14260D [Brassica napus]
Length=161

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 98/163 (60%), Gaps = 17/163 (10%)
 Frame = -3

Query  556  LEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYC  377
            + KK+ + SSDGE FE+   VA +SQT+  M+EDD  A  D IPLP +T  ILA V+EYC
Sbjct  1    MSKKIILKSSDGESFEVDQAVALESQTIKHMVEDDCVA--DGIPLPNVTSAILAKVIEYC  58

Query  376  KKHALTSSLR--------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
            KKH   ++                ELK +D EF KVD  TL DLILAA+YL I GL  LT
Sbjct  59   KKHVDAAAEANAGDKDIYGNTEDTELKNWDTEFAKVDQPTLFDLILAANYLNITGLLDLT  118

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              +++  ++ KT  ++ + FNI N  T EE  ++R+EN  AFE
Sbjct  119  CKTVADMMVGKTPEQMREHFNIKNDYTAEEEAEVRKENAWAFE  161



>ref|XP_010494151.1| PREDICTED: SKP1-like protein 1B [Camelina sativa]
Length=168

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 109/171 (64%), Gaps = 23/171 (13%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MS++ +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+
Sbjct  1    MSTV-RKITLKSSDGENFEIDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVI  57

Query  385  EYCKKHA-------------------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLC  263
            EYCKKH                      SS  +LK +D EFIKVD  TL DLILAA+YL 
Sbjct  58   EYCKKHVEAAAKSETAVSTAATTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLN  117

Query  262  IKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            IKGL  LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  IKGLLDLTCQTVADMIKGKTPDEIRKTFNIKNDFTPEEEEEVRRENQWAFE  168



>ref|XP_004287067.1| PREDICTED: SKP1-like protein 4-like [Fragaria vesca subsp. vesca]
Length=159

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 104/161 (65%), Gaps = 12/161 (7%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS +K +T+ SSD E FE+   VA +SQT+  M+ED  CA+ + IPLP +TG ILA V+
Sbjct  1    MSSEKKLITLKSSDNETFEVDEAVALESQTIKHMVEDG-CAD-NAIPLPNVTGAILARVI  58

Query  385  EYCKKHAL---------TSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            EYCKKH            S    LK FD EF+KVD + L DLILAA+YL IKGL  LT  
Sbjct  59   EYCKKHVEEGGKDAEKDKSGESPLKTFDAEFVKVDQNVLFDLILAANYLNIKGLLDLTCQ  118

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  TVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  159



>gb|ACJ86090.1| unknown [Medicago truncatula]
Length=155

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 106/158 (67%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +  KILA V+
Sbjct  1    MSST-RKITLKSSDGETFEVDEAVALESQTIKHMIEDD-CADS-GIPLPNVASKILAKVI  57

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   ++  E      +K++D EF+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKKHVEAAAAEEKPSEDEIKSWDGEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  +PEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFSPEEEEEVRRENQWAFE  155



>ref|NP_565296.1| SKP1-like protein 14 [Arabidopsis thaliana]
 sp|O81057.1|ASK14_ARATH RecName: Full=SKP1-like protein 14; Short=AtSK14 [Arabidopsis 
thaliana]
 gb|AAC34485.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At14), putative 
[Arabidopsis thaliana]
 gb|AAY78682.1| putative E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 [Arabidopsis 
thaliana]
 gb|AEC05671.1| SKP1-like protein 14 [Arabidopsis thaliana]
Length=149

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 101/153 (66%), Gaps = 6/153 (4%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS   K+ +SSSDGE FE+   VA++ + +  MIEDD    +  +PL  +TGKIL++VV
Sbjct  1    MSS--NKIVLSSSDGESFEVEEAVARKLKIVEHMIEDDCVVTE--VPLQNVTGKILSIVV  56

Query  385  EYCKKHALTSSLRELKAFDDEFI-KVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            EYCKKH +     E K +D+EF+ K D  T+  L+LAA+YL IKGL  L++ +++  I +
Sbjct  57   EYCKKHVVDEESDEFKTWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKD  116

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ + FNI+N  TPEE   +R+EN  AFE
Sbjct  117  KTPEEIREIFNIENDFTPEEEAAVRKENAWAFE  149



>emb|CDY44209.1| BnaC05g15660D [Brassica napus]
Length=161

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 100/163 (61%), Gaps = 17/163 (10%)
 Frame = -3

Query  556  LEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYC  377
            + KK+ + SSDGE FE+   VA +SQT+  M+EDD  A  D IPLP +T  ILA V+EYC
Sbjct  1    MSKKIILKSSDGESFEVDEAVALESQTIKHMVEDDCIA--DGIPLPNVTSAILAKVIEYC  58

Query  376  KKHALTSSLR--------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
            KKH   ++                ELK +D EF KVD  TL DLILAA+YL I GL  LT
Sbjct  59   KKHVDAAAEANAGDKDIYGNTEDTELKNWDTEFAKVDQPTLFDLILAANYLNITGLLDLT  118

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              +++  I+ KT  ++ + FNI N  TPEE E++R+EN  AFE
Sbjct  119  CKTVADMIVGKTPAQMREHFNIKNDYTPEEEEEVRKENAWAFE  161



>ref|XP_009624363.1| PREDICTED: SKP1-like protein 1A isoform X2 [Nicotiana tomentosiformis]
Length=153

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 103/154 (67%), Gaps = 10/154 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + + SSDGE FE+  +VA +SQT+  MIEDD CA+   IPLP +T KILA V+EYCK+
Sbjct  2    KMIVLKSSDGETFEVEESVAVESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVIEYCKR  59

Query  370  HALTSSLRE-------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSII  212
            H   +S  E       LKAFD +F+KVD  TL DLILAA+YL IK L  LT  +++  I 
Sbjct  60   HVDAASKTEDKSVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  119

Query  211  NKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  GKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  153



>ref|XP_008445323.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=157

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 105/155 (68%), Gaps = 11/155 (7%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            +K+T+ SSDGE+FE+   VA +SQT+  MIEDD CA+   IPLP +T KIL+ V+EYCKK
Sbjct  5    RKITLKSSDGEIFEVDEAVALESQTIKHMIEDD-CADS-GIPLPNVTSKILSKVIEYCKK  62

Query  370  HA-------LTSSLRE-LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSI  215
            H         T S+ + LK +D EF+KVD  TL DLILAA+YL IK L  LT  +++  I
Sbjct  63   HVESPKPEDRTGSVDDDLKTWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  122

Query  214  INKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  123  KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>gb|KDP29669.1| hypothetical protein JCGZ_18831 [Jatropha curcas]
Length=159

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 104/160 (65%), Gaps = 13/160 (8%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  KKVT+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+EY
Sbjct  2    STSKKVTLKSSDGETFEVEEAVAVESQTIKHMIEDD-CADTE-IPLPNVTSKILAKVIEY  59

Query  379  CKKHALTSS----------LRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            CKKH   ++             L  +D +F+KVD +TL DLILAA+YL IK L  LT  +
Sbjct  60   CKKHVEAATADKDKDKSSSDEALTTWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQT  119

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  VADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  159



>ref|XP_002537506.1| skp1, putative [Ricinus communis]
 gb|EEF24877.1| skp1, putative [Ricinus communis]
Length=158

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 108/159 (68%), Gaps = 12/159 (8%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  KK+T+ SSDGE F++   VA +SQT+  +I+DD CA+   IP+P +TGKIL+ V+EY
Sbjct  2    SASKKITLKSSDGETFDVEEAVAVESQTIKHIIDDD-CADS-VIPIPNVTGKILSKVIEY  59

Query  379  CKKHALTSSLR---------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            CKKH   ++ +          LK++D +F++VD +TL DLILAA+YL +KGL  LT  ++
Sbjct  60   CKKHVADAAFKDNDNKDSDDALKSWDADFVRVDQNTLFDLILAANYLNVKGLLDLTCQTV  119

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  ADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  158



>gb|EPS66410.1| hypothetical protein M569_08366, partial [Genlisea aurea]
Length=168

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 108/162 (67%), Gaps = 18/162 (11%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGE+FE+   VA +SQT+  MIEDD CA+   IPLP + GKIL+ V+EYC++
Sbjct  9    KKITLRSSDGEIFEVEEAVAVESQTIKHMIEDD-CADS-VIPLPNVHGKILSKVIEYCRR  66

Query  370  HA------------LTSSL---RELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTS  236
            H             ++S+L    +LK+FD EF+KVD  TL DLILAA+YL IK L  LT 
Sbjct  67   HVEVGASAAKSDDKVSSALSPDEDLKSFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTC  126

Query  235  LSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             +++  I  KT  E+ +TFNI N  +PEE E++RREN  AFE
Sbjct  127  QTVADMIKGKTPEEIRKTFNIKNDFSPEEEEEVRRENQWAFE  168



>ref|XP_009779583.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
 gb|AAC63273.1| SKP1-like protein [Nicotiana clevelandii]
Length=153

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 103/154 (67%), Gaps = 10/154 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + + SSDGE FE+  +VA +SQT+  MIEDD CA+   IPLP +T KILA V+EYCK+
Sbjct  2    KMIVLRSSDGETFEVEESVALESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVIEYCKR  59

Query  370  HALTSSLRE-------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSII  212
            H   +S  E       LKAFD +F+KVD  TL DLILAA+YL IK L  LT  +++  I 
Sbjct  60   HVDAASKTEDKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  119

Query  211  NKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  GKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  153



>ref|XP_009783395.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
Length=155

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 105/158 (66%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  K + + SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+
Sbjct  1    MSS-SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCK+H   +      S  ELKAFD +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKRHVDATKTEDKASEDELKAFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  155



>ref|XP_006286731.1| hypothetical protein CARUB_v10002974mg [Capsella rubella]
 ref|XP_006289176.1| hypothetical protein CARUB_v10002614mg [Capsella rubella]
 gb|EOA19629.1| hypothetical protein CARUB_v10002974mg [Capsella rubella]
 gb|EOA22074.1| hypothetical protein CARUB_v10002614mg [Capsella rubella]
Length=152

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 97/151 (64%), Gaps = 7/151 (5%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + + SSDG+ F++   VA QSQT+  M+EDD CA  + IPL  +T K LA+V+EYCKK
Sbjct  4    KIIVLKSSDGQSFQVEEKVAIQSQTIAHMVEDD-CAGSE-IPLANVTSKTLALVIEYCKK  61

Query  370  H----ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKT  203
            H    A  +S  ELK +D++F++ D  TL DLIL A+YL I+ L  LT   ++  I  KT
Sbjct  62   HHVDEANPNSEEELKKWDEQFLETDQSTLFDLILGANYLNIQSLLDLTCQKVADMIKGKT  121

Query  202  LPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              E+   FNI+N  TPEE E +R+EN  AFE
Sbjct  122  PEEIRTLFNIENDFTPEEEEAVRKENQWAFE  152



>ref|XP_010442189.1| PREDICTED: SKP1-like protein 1B [Camelina sativa]
Length=170

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 109/173 (63%), Gaps = 25/173 (14%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MS++ +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+
Sbjct  1    MSTV-RKITLKSSDGENFEIEEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVI  57

Query  385  EYCKKHALT---------------------SSLRELKAFDDEFIKVDMDTLCDLILAADY  269
            EYCKKH                        SS  +LK +D EFIKVD  TL DLILAA+Y
Sbjct  58   EYCKKHVEAAAAKSETAVATAATTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANY  117

Query  268  LCIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            L IKGL  LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  LNIKGLLDLTCQTVADMIKGKTPDEIRKTFNIKNDFTPEEEEEVRRENQWAFE  170



>ref|XP_002270061.1| PREDICTED: SKP1-like protein 1B [Vitis vinifera]
 ref|XP_010664854.1| PREDICTED: SKP1-like protein 1B [Vitis vinifera]
 emb|CAN76662.1| hypothetical protein VITISV_040452 [Vitis vinifera]
Length=156

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 107/159 (67%), Gaps = 11/159 (7%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+T+ SSDGE F++   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+
Sbjct  1    MSS-SRKITLKSSDGEAFDVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVI  57

Query  385  EYCKKHA-------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            EYCKKH         +    ELKA+D +F+KVD  TL DLILAA+YL IK L  LT  ++
Sbjct  58   EYCKKHVEAPKPEERSGVDEELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  117

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  ADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  156



>ref|XP_010550803.1| PREDICTED: SKP1-like protein 1B [Tarenaya hassleriana]
Length=158

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 103/157 (66%), Gaps = 13/157 (8%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            +K+ + SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+EYCKK
Sbjct  4    RKIALKSSDGETFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVIEYCKK  61

Query  370  HALTSSLRE----------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSS  221
            H   S   E          LK +D EF+KVD  TL DLILAA+YL IKGL  LT  +++ 
Sbjct  62   HVDASVKTETATTYSTDDDLKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVAD  121

Query  220  SIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  122  MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  158



>gb|AFK44762.1| unknown [Lotus japonicus]
Length=155

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 106/158 (67%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDGE FE+   VA +S+T+  M+EDD CA+   IPLP  T KILA V+
Sbjct  1    MSSA-KKITLKSSDGEAFEVDEAVALESRTIKHMVEDD-CADS-GIPLPNATSKILAKVI  57

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   ++  E      LKA+D +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKKHVEAANPDEKPTEDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>ref|XP_002301954.1| hypothetical protein POPTR_0002s02020g [Populus trichocarpa]
 ref|XP_011034986.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
 gb|ABK94461.1| unknown [Populus trichocarpa]
 gb|EEE81227.1| hypothetical protein POPTR_0002s02020g [Populus trichocarpa]
Length=157

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 108/160 (68%), Gaps = 12/160 (8%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K T+ SSDGE FE+   VA +SQT+  MIE+D CA+ + IPLP +T KIL+ V+
Sbjct  1    MSS-SRKFTLKSSDGEAFEVDEAVALESQTIKHMIEED-CAD-NAIPLPNVTSKILSKVI  57

Query  385  EYCKKHALT--------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            EYCKKH  T        S+  +LK++D EF+KVD  TL DLILAA+YL IK L  LT  +
Sbjct  58   EYCKKHVETPKSDDRPSSADDDLKSWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQT  117

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  VADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>ref|XP_006362720.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=155

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 104/158 (66%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  K + + SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+
Sbjct  1    MSS-SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCK+H   S      S  ELK FD +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKRHVDASKTEDKASEDELKTFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  155



>emb|CDP16774.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 103/153 (67%), Gaps = 11/153 (7%)
 Frame = -3

Query  544  VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKHA  365
            + ++SSDGE FE+  +V  QSQT+  MIEDD CAN   IPLP +TG ILA V+EYCK+H 
Sbjct  2    IVLNSSDGETFEVEESVILQSQTIKHMIEDD-CANS-AIPLPNVTGTILAKVLEYCKQHV  59

Query  364  LTSSLRE--------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
              +   E        LK+FD EF+KVD  TL D+ILAA+YL IKGL VLT  +++  +  
Sbjct  60   KPNDGEESSKDEAERLKSFDAEFVKVDQKTLFDIILAANYLDIKGLLVLTCQTVADMMKG  119

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TF+I N  TPEE E++RREN  AFE
Sbjct  120  KTPEEIRKTFHIKNDYTPEEEEEVRRENSWAFE  152



>ref|XP_002306950.1| hypothetical protein POPTR_0005s26450g [Populus trichocarpa]
 gb|ABK95554.1| unknown [Populus trichocarpa]
 gb|EEE93946.1| hypothetical protein POPTR_0005s26450g [Populus trichocarpa]
Length=157

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 104/158 (66%), Gaps = 11/158 (7%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  +K  + SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T K+LA V+EY
Sbjct  2    STGRKFILKSSDGESFEVDEAVAVESQTIKHMIEDD-CAD-NGIPLPNVTSKVLAKVIEY  59

Query  379  CKKHA--------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            CKKH          +S+  +LKA+D EF+KVD  TL DLILAA+YL IK L  LT   ++
Sbjct  60   CKKHVESPKSDDRPSSAADDLKAWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQRVA  119

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>ref|XP_011043147.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=158

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 107/161 (66%), Gaps = 13/161 (8%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+++ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSS-GRKISLRSSDGESFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  57

Query  385  EYCKKHALT---------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            EYCKKH  T         S   ELK +D EF++VD  TL DLILAA+YL IK L  LT  
Sbjct  58   EYCKKHVETPKSEDRGTNSGGDELKNWDAEFVRVDQVTLFDLILAANYLNIKDLLDLTCQ  117

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  TVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  158



>gb|KHG24597.1| SKP1-like protein 1B [Gossypium arboreum]
Length=158

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 105/160 (66%), Gaps = 11/160 (7%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            M+S  +K+ + SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+
Sbjct  1    MASTGRKIILKSSDGENFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVI  58

Query  385  EYCKKHALTSSLRE--------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            EYCKKH   S   +        LK +D +F+KVD  TL DLILAA+YL IK L  LT  +
Sbjct  59   EYCKKHVEASKSEDRSASLDDDLKGWDADFVKVDQATLFDLILAANYLNIKALLDLTCQT  118

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  VADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  158



>gb|AAO85510.1| SKP1 [Nicotiana benthamiana]
Length=153

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 103/154 (67%), Gaps = 10/154 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + + SSDGE FE+  +VA +SQT+  MIEDD CA+   IPLP +T KILA V+EYCK+
Sbjct  2    KMIVLRSSDGETFEVEESVALESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVIEYCKR  59

Query  370  HALTSSLRE-------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSII  212
            H   +S  E       LKAFD +F+KVD  TL DLILAA+YL IK L  LT  +++  I 
Sbjct  60   HVDAASKTEDKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKRLLDLTCQTVADMIK  119

Query  211  NKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  GKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  153



>ref|XP_004146156.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN55643.1| hypothetical protein Csa_3G002630 [Cucumis sativus]
Length=155

 Score =   122 bits (305),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 101/158 (64%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS   K+T+ SSDG+ F++   VA QSQT+  MIED+ CA+ + IPLP +  KILA V+
Sbjct  1    MSS-SNKITLKSSDGDYFQVDDAVALQSQTIRHMIEDN-CAH-NGIPLPNVNSKILAKVI  57

Query  385  EYCKKHALTSSLR------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            +YC+KH   SS        +LK +D +F+ VD  TL DLILAA+YL +K L  LT  +++
Sbjct  58   QYCRKHVDASSADPLPSEDDLKTWDRDFVNVDQATLFDLILAANYLDVKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  K   E+ +TFNI N  TP E E++RREN  A E
Sbjct  118  DMIKGKKPEEIRKTFNIKNDFTPAEEEEVRRENQWACE  155



>gb|ABS17589.1| SKP1 component-like 1 [Humulus lupulus]
Length=157

 Score =   122 bits (305),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 105/158 (66%), Gaps = 11/158 (7%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  +K+T+ SSDGE  E+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+EY
Sbjct  2    STGRKITLKSSDGETLEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVIEY  59

Query  379  CKKHA--------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            CKKH          +S   ELKA+D +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  60   CKKHVGAPKAEDRASSVDDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  119

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>gb|ABB77425.1| Skp1-like protein 3 [Petunia integrifolia subsp. inflata]
 gb|ACT35736.1| SKP1-like 2 [Petunia x hybrida]
Length=155

 Score =   122 bits (305),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 104/156 (67%), Gaps = 9/156 (6%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  K + + SSDGE F++  +VA +SQT+  MIEDD CA+   IPLP +T KILA V+EY
Sbjct  2    STSKMIVLKSSDGETFQVEESVALESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVIEY  59

Query  379  CKKHALT------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            CK+H         +S  ELK+FD +F+KVD  TL DLILAA+YL IK L  LT  +++  
Sbjct  60   CKRHVEANKSEDKASEDELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  155



>gb|ACA61785.1| SKP1-like protein 3 [Petunia x hybrida]
Length=155

 Score =   122 bits (305),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 104/156 (67%), Gaps = 9/156 (6%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  K + + SSDGE F++  +VA +SQT+  MIEDD CA+   IPLP +T KILA V+EY
Sbjct  2    STSKMIVLKSSDGETFQVEESVALESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVIEY  59

Query  379  CKKHALT------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            CK+H         +S  ELK+FD +F+KVD  TL DLILAA+YL IK L  LT  +++  
Sbjct  60   CKRHVEANKAEDKASEDELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  155



>gb|ABB77426.1| Skp1-like protein 1 [Petunia integrifolia subsp. inflata]
 gb|ACA61786.1| SKP1-like protein 4 [Petunia x hybrida]
Length=156

 Score =   122 bits (305),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 103/157 (66%), Gaps = 10/157 (6%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  K + + SSDGE FE+  +VA +SQT+  MIEDD CA+   IPLP +T KILA V+EY
Sbjct  2    STSKMIVLKSSDGETFEVEESVALESQTIKHMIEDD-CADS-SIPLPNVTSKILAKVIEY  59

Query  379  CKKHALTS-------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSS  221
            CK+H   +       S  +LK FD EF+KVD  TL DLILAA+YL IK L  LT  +++ 
Sbjct  60   CKRHVEAAAKTDDKVSEEDLKNFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVAD  119

Query  220  SIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  156



>emb|CDX85931.1| BnaC06g22030D [Brassica napus]
 emb|CDX68112.1| BnaA07g21520D [Brassica napus]
Length=151

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 102/150 (68%), Gaps = 6/150 (4%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  M+EDD   N   +PLP +T KILA V+EYCKK
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNG--VPLPNVTSKILAKVIEYCKK  61

Query  370  HAL---TSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKTL  200
            HA+    SS  +LKA+D EF+K+D  TL +LILAA+YL IK L  LT  +++  I  KT 
Sbjct  62   HAVDGGGSSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTP  121

Query  199  PELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             E+  TFNI N  +PEE E++RREN  AFE
Sbjct  122  EEIRTTFNIKNDFSPEEEEEVRRENQWAFE  151



>ref|XP_004250723.1| PREDICTED: SKP1-like protein 1A [Solanum lycopersicum]
Length=155

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 101/153 (66%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + + SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+EYCK+
Sbjct  5    KMIVLKSSDGETFEVDEAVALESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVIEYCKR  62

Query  370  HALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H   S      S  ELK FD +F+KVD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  63   HVDASKTEDKASEDELKTFDADFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADMIKG  122

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  123  KTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  155



>gb|EMT17500.1| hypothetical protein F775_42820 [Aegilops tauschii]
Length=166

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 103/167 (62%), Gaps = 14/167 (8%)
 Frame = -3

Query  577  AIATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKIL  398
            A A  ++ EKK+ + SSDG  F +  TVA +SQT+  M+EDD CAN + IPLP +  +IL
Sbjct  2    AYAAAATPEKKLMLRSSDGVEFLVEETVAIESQTIKHMVEDD-CAN-NIIPLPNVKAEIL  59

Query  397  AMVVEYCKKHA-----------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGL  251
             MV++YCK+H              +S  +LK FD EF++V+   L DLILAA+YL IKGL
Sbjct  60   TMVIKYCKQHVQKRGAEPTDSTAKASEWDLKTFDKEFVEVEQRVLFDLILAANYLDIKGL  119

Query  250  AVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              LT   ++  I   T  E+ +T NI N LT EE +++RR+N  AFE
Sbjct  120  MDLTCQKVAVMIKKMTPEEIRKTLNIKNDLTKEEVDELRRKNQWAFE  166



>gb|AAT99735.1| SKP1 [Nicotiana tabacum]
Length=155

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 104/158 (66%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  K + + SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+
Sbjct  1    MSS-SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCK+H   +      S  ELK FD +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKRHVDATKTEDKASEDELKGFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  155



>ref|XP_010680409.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=158

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 107/156 (69%), Gaps = 12/156 (8%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            +K+T+ SSDGE FE+  +VA +SQT+  M+EDD CA+ + IPLP +T KILA V+EYCKK
Sbjct  5    RKITLKSSDGETFEVEESVALESQTIKHMVEDD-CAD-NVIPLPNVTSKILAKVIEYCKK  62

Query  370  H-----ALTSSLR----ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            H     +  ++ R    ELK +D +F+KVD  TL DLILAA+YL IK L  LT  +++  
Sbjct  63   HVDFPKSSENNDRQVDDELKTWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  122

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  123  IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  158



>ref|XP_004291337.1| PREDICTED: SKP1-like protein 1B-like [Fragaria vesca subsp. vesca]
Length=159

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 107/162 (66%), Gaps = 14/162 (9%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KILA V+
Sbjct  1    MSS-GRKITLKSSDGESFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILAKVI  57

Query  385  EYCKKHA----------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTS  236
            EYCKKH            +S   ELK +D +F+KVD  TL DLILAA+YL IK L  LT 
Sbjct  58   EYCKKHVDAAPKSDDRSSSSGDEELKNWDADFVKVDQATLFDLILAANYLNIKNLLDLTC  117

Query  235  LSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  QTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  159



>ref|XP_010095548.1| SKP1-like protein 1B [Morus notabilis]
 gb|EXB60668.1| SKP1-like protein 1B [Morus notabilis]
Length=157

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 109/160 (68%), Gaps = 12/160 (8%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+
Sbjct  1    MSS-GRKITLKSSDGETFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVI  57

Query  385  EYCKKHA--------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            EYCKKH          +S+  +LKA+D +F+KVD  TL DLILAA+YL IK L  LT  +
Sbjct  58   EYCKKHVEAPKSDDRASSADDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  117

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  VADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>emb|CDP14555.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 106/160 (66%), Gaps = 12/160 (8%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  K + + SSDGE FE+   VA +SQT+  MIED+ CA+  CIPLP +T KILA V+
Sbjct  1    MSS-PKIIVLKSSDGETFEVEELVALESQTIKHMIEDN-CADT-CIPLPNVTSKILAKVI  57

Query  385  EYCKKHALT--------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            EYCKKH           SS  +LK+FD +F+KVD  TL DLILAA+YL IK L  LT  +
Sbjct  58   EYCKKHVEAPKSSDGDKSSDEDLKSFDADFVKVDQGTLFDLILAANYLNIKSLLDLTCQT  117

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  VADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  157



>gb|AFB18000.1| SKP1 protein [Nicotiana tabacum]
Length=155

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 103/158 (65%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  K + + SSDGE FE+   VA +SQT+  MIEDD CA    IPLP +T KILA V+
Sbjct  1    MSS-SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDD-CAGT-SIPLPNVTSKILAKVI  57

Query  385  EYCKKHALTS------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCK+H   +      S  ELK FD +F+KVD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKRHVDATKTEDKASEDELKGFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  155



>ref|XP_004143010.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 ref|XP_004161077.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN62264.1| hypothetical protein Csa_2G346050 [Cucumis sativus]
Length=157

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 104/155 (67%), Gaps = 11/155 (7%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            +K+T+ SSDGE+FE+   VA +SQT+  MIEDD CA+   IPLP +  KIL+ V+EYCKK
Sbjct  5    RKITLKSSDGEIFEVDEAVALESQTIKHMIEDD-CADS-GIPLPNVNSKILSKVIEYCKK  62

Query  370  HA-------LTSSLRE-LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSI  215
            H         T S+ + LK +D EF+KVD  TL DLILAA+YL IK L  LT  +++  I
Sbjct  63   HVESPKPEDRTGSVDDDLKTWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  122

Query  214  INKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  123  KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>ref|XP_010471746.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=162

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 104/163 (64%), Gaps = 16/163 (10%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  KK+ + SSDGE FE+  +VA++SQT+  M+EDD   N   +PLP +T KILA V+EY
Sbjct  2    STTKKIVLKSSDGESFEVDESVARESQTIAHMVEDDCVDNG--VPLPNVTSKILAKVIEY  59

Query  379  CKKH-------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
            CKKH             A +S+  ELK +D EF+K+D  TL +LILAA+YL IK L  LT
Sbjct  60   CKKHVEVTASKTDAAEGAASSADEELKTWDAEFMKIDQATLFELILAANYLNIKNLLDLT  119

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              +++  I  KT  E+  TFNI N  TPEE E++RREN  AFE
Sbjct  120  CQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE  162



>ref|XP_004289997.1| PREDICTED: SKP1-like protein 4-like [Fragaria vesca subsp. vesca]
Length=154

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 98/156 (63%), Gaps = 7/156 (4%)
 Frame = -3

Query  565  MSSLEKKVTV-SSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMV  389
            MS+  KK+ V  ++D E FE+   V  QSQT+  M+ED+ CA+ + IPLP +T K L+ V
Sbjct  1    MSTETKKILVLHTADNETFEIEEAVVLQSQTIKHMVEDE-CAD-NAIPLPNVTSKTLSKV  58

Query  388  VEYCKKHALTSSL---RELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            +EYCKKHA  S       L+A+D +F+  D DTL D+I+AA+YL IK L  LT   ++  
Sbjct  59   LEYCKKHAEDSGEGGEEALRAWDADFVNFDTDTLYDVIMAANYLNIKSLLDLTCQRVADM  118

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
               KT  E+  TFNI N  +PEE E +RREN  AFE
Sbjct  119  CKGKTPEEIRNTFNIKNDFSPEEEEAVRRENQWAFE  154



>ref|XP_006359705.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=156

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 101/153 (66%), Gaps = 10/153 (7%)
 Frame = -3

Query  547  KVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKH  368
            K+ + SSDGEVFE+   VA +SQT+  +IEDD CA  + IPLP +T KILA V+EY K+H
Sbjct  6    KILLKSSDGEVFEVDEAVALESQTIKHLIEDD-CAGSN-IPLPNVTSKILAKVIEYSKRH  63

Query  367  ALTSSLRE-------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
               SS  E       LK FD EF+KVD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  64   VEASSKTEDKAAEDELKVFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADMIKG  123

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  124  KTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  156



>ref|XP_008448523.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=155

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 105/158 (66%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSDG+ FE+   VA QSQT+  MIED  CA+ + IPLP +  KILA V+
Sbjct  1    MSS-SKKITLKSSDGDYFEVDGAVALQSQTIRHMIEDS-CAD-NGIPLPNVNSKILAKVI  57

Query  385  EYCKKHALTSSLR------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYC+KH   SSL       +LK +D +F+ VD  TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCRKHVNASSLDPAPSVDDLKTWDRDFVNVDQATLFDLILAANYLDIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>ref|XP_010539092.1| PREDICTED: SKP1-like protein 1B [Tarenaya hassleriana]
Length=157

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 103/156 (66%), Gaps = 12/156 (8%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            +K+T+ SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T KIL+ V+EYCKK
Sbjct  4    RKITLKSSDGETFEVDEAVALESQTIKHMIEDD-CAD-NGIPLPNVTSKILSKVIEYCKK  61

Query  370  HA---------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            H            +    +K +D EF+KVD  TL DLILAA+YL IKGL  LT  +++  
Sbjct  62   HVDAAAKSEAAAAAEEDVMKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADM  121

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  122  IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>ref|XP_004231049.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=156

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 101/153 (66%), Gaps = 10/153 (7%)
 Frame = -3

Query  547  KVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKH  368
            K+ + SSDGEVFE+   VA +SQT+  +IEDD CA  + IPLP +T KILA V+EY K+H
Sbjct  6    KILLKSSDGEVFEVDEAVALESQTIKHLIEDD-CAGSN-IPLPNVTSKILAKVIEYSKRH  63

Query  367  ALTSSLRE-------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
               SS  E       LK FD EF+KVD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  64   VEASSKTEDKAAEDELKVFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADMIKG  123

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  124  KTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  156



>ref|XP_011003066.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=157

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 104/158 (66%), Gaps = 11/158 (7%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  +K  + SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +T K+LA V+EY
Sbjct  2    SAGRKFILKSSDGESFEVDEAVAVESQTIKHMIEDD-CAD-NGIPLPNVTSKVLAKVIEY  59

Query  379  CKKHA--------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            CKKH          +S+  +LKA+D EF+KVD  TL DLILAA+YL IK L  LT   ++
Sbjct  60   CKKHVESPKSDDRPSSAADDLKAWDAEFVKVDQATLFDLILAANYLNIKHLLDLTCQRVA  119

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  ++ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  DMIKGKTPEDIRKTFNIKNDFTPEEEEEVRRENQWAFE  157



>ref|XP_004306259.1| PREDICTED: SKP1-like protein 4-like [Fragaria vesca subsp. vesca]
Length=172

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 104/172 (60%), Gaps = 18/172 (10%)
 Frame = -3

Query  580  TAIATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKI  401
            T+ A   S +K  T+ SSD E FE+   VA Q QT+  MIEDD CA +  IPLP +TGKI
Sbjct  3    TSAAPEESTKKMFTLRSSDCEAFEVEEAVALQLQTIKHMIEDD-CA-EGGIPLPNVTGKI  60

Query  400  LAMVVEYCKKH-----------ALTSSLRE-LKAFDDEFIK---VDMDTLCDLILAADYL  266
            LA V+EYCKKH            L+S+  + LK +D EF+K    D + L D+ILAA+YL
Sbjct  61   LAKVIEYCKKHIRAVAKDSSSFGLSSNEDDALKTWDGEFVKELEADQNVLFDMILAANYL  120

Query  265  CIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             IKGL  +T   ++  +  KTL E+   F+I N  T +E E++RREN  AFE
Sbjct  121  NIKGLLDVTCTHVAGMMRGKTLEEIRTIFHIKNDYTKDEEEEVRRENQWAFE  172



>emb|CDY40610.1| BnaC06g02260D [Brassica napus]
Length=156

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 98/157 (62%), Gaps = 10/157 (6%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  KK+ + SSDG +FE+   VA QSQT+  MIEDD   N   IP+  I G+IL+ V+EY
Sbjct  2    STSKKIVLKSSDGHIFEVEEAVALQSQTIAHMIEDDCVDNG--IPISNINGEILSKVIEY  59

Query  379  CKKHAL-------TSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSS  221
            CKKH +       +SS  ELKA+D EF+K D  T+ +LILAA++L IK L  L   +++ 
Sbjct  60   CKKHVVLPDGDSSSSSREELKAWDAEFMKTDQSTIFNLILAANFLNIKNLLDLGCQTVAD  119

Query  220  SIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             I  KT  E     NI+N  TPEE E+IR+EN  AFE
Sbjct  120  MITGKTPEETRTVLNIENDFTPEEEEEIRKENQWAFE  156



>gb|ABB69022.1| SKP1 [Brassica napus]
Length=160

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 103/159 (65%), Gaps = 15/159 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSD E FE+   VA++SQTL  M+EDD C + D IPLP +TGKILA V+EYCKK
Sbjct  4    KKIVLKSSDNESFEVDEAVARESQTLAHMVEDD-CTDND-IPLPNVTGKILAKVIEYCKK  61

Query  370  H------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            H               SS  +LKA+D EF+K+D  TL +LILAA+YL IK L  LT  ++
Sbjct  62   HVDAAAAKTEAADGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+  TFNI N  +PEE E++RREN  AFE
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFSPEEEEEVRRENQWAFE  160



>ref|XP_006285109.1| hypothetical protein CARUB_v10006442mg [Capsella rubella]
 gb|EOA18007.1| hypothetical protein CARUB_v10006442mg [Capsella rubella]
Length=152

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 104/151 (69%), Gaps = 7/151 (5%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + + S+DGE F++   VA QSQT+  M+EDD CAN + IPLP +TGKIL++V+EYCKK
Sbjct  4    KIIELKSNDGETFKVEEKVAIQSQTIAHMVEDD-CANSE-IPLPNVTGKILSLVIEYCKK  61

Query  370  HALTS----SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKT  203
            H +      S  ELK +D++F+++D  TL +LIL A+YL IK L  LT  +++  I  KT
Sbjct  62   HNVDEANPISAEELKKWDEKFLEIDQPTLFELILGANYLNIKSLLDLTCQTVADMITGKT  121

Query  202  LPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            L E+   FNI+N  TPEE E+IRREN  AFE
Sbjct  122  LDEIRAHFNIENDFTPEEEEEIRRENQWAFE  152



>gb|ACA61784.1| SKP1-like protein 2 [Petunia x hybrida]
 gb|ACT35738.1| SKP1-like 1 [Petunia x hybrida]
Length=154

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 103/154 (67%), Gaps = 9/154 (6%)
 Frame = -3

Query  553  EKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCK  374
            EK + + SSDGE F++  +VA +SQT+  MIEDD CA+   IPLP +T +ILA V+EYCK
Sbjct  3    EKMIVLKSSDGETFQVEESVAVESQTIKHMIEDD-CADS-SIPLPNVTSQILAKVIEYCK  60

Query  373  KHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSII  212
            +H   S   +      LK+FD +F+KVD  TL DLILAA+YL IK L  LT  +++  I 
Sbjct  61   RHVEASKSEDKATEDDLKSFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  120

Query  211  NKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  121  GKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  154



>ref|XP_004301672.1| PREDICTED: SKP1-like protein 4-like [Fragaria vesca subsp. vesca]
Length=163

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 106/163 (65%), Gaps = 4/163 (2%)
 Frame = -3

Query  598  NSPQSLTAIATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLP  419
            N+       ++ SS +K +T+ S+DGE FE+   VA +SQT+  M+EDD CA ++ IPLP
Sbjct  4    NTENPAATTSSTSSEKKMITLQSADGEPFEIEEVVALESQTIKHMVEDD-CA-ENAIPLP  61

Query  418  KITGKILAMVVEYCKKHALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
             + G ILA V+EYCKKH +  +  +LKA+D E++ VD + L DLILAA+YL IKGL  LT
Sbjct  62   NVKGAILAKVIEYCKKH-VEDAGEDLKAWDAEYVNVDQNVLFDLILAANYLNIKGLLDLT  120

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
               ++  I  KT  E+   FNI N  TPEE E++RREN  A E
Sbjct  121  CQKVADMIKGKTPEEIRTLFNITNDFTPEEEEEVRRENQWALE  163



>ref|XP_011092967.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=169

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 105/162 (65%), Gaps = 18/162 (11%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + + SSDGE FE+   VA +SQT+  MIED+ CA+  CIPLP +T KILA V+EYCK+
Sbjct  10   KMIVLKSSDGETFEVEEAVAVESQTIKHMIEDN-CADT-CIPLPNVTSKILAKVIEYCKR  67

Query  370  HA-----------LTSSLR----ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTS  236
            H            LT + +    +LKAFD EF+KVD  TL DLILAA+YL IK L  LT 
Sbjct  68   HVDAAAKANADGALTPADKVVDEDLKAFDTEFVKVDQGTLFDLILAANYLNIKSLLDLTC  127

Query  235  LSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  128  QTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  169



>ref|XP_004159727.1| PREDICTED: SKP1-like protein 1A-like [Cucumis sativus]
Length=155

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 100/158 (63%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS   K+ + SSDG+ F++   VA QSQT+  MIED+ CA+ + IPLP +  KILA V+
Sbjct  1    MSS-SNKIILKSSDGDYFQVDDAVALQSQTIRHMIEDN-CAH-NGIPLPNVNSKILAKVI  57

Query  385  EYCKKHALTSSLR------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            +YC+KH   SS        +LK +D +F+ VD  TL DLILAA+YL +K L  LT  +++
Sbjct  58   QYCRKHVDASSADPLPSEDDLKTWDRDFVNVDQATLFDLILAANYLDVKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  K   E+ +TFNI N  TP E E++RREN  A E
Sbjct  118  DMIKGKKPEEIRKTFNIKNDFTPAEEEEVRRENQWACE  155



>ref|NP_568603.1| SKP1-like protein 1B [Arabidopsis thaliana]
 sp|Q9FHW7.1|SKP1B_ARATH RecName: Full=SKP1-like protein 1B; AltName: Full=SKP1-like 2; 
AltName: Full=UFO-binding protein 2 [Arabidopsis thaliana]
 gb|AAC14445.1| Skp1 homolog [Arabidopsis thaliana]
 dbj|BAB08452.1| UIP2 [Arabidopsis thaliana]
 gb|AAO44064.1| At5g42190 [Arabidopsis thaliana]
 dbj|BAE99755.1| UIP2 [Arabidopsis thaliana]
 gb|AED94777.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
Length=171

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 106/174 (61%), Gaps = 26/174 (15%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MS++ +K+T+ SSDGE FE+   VA +SQT+  MIEDD   N   IPLP +T KIL+ V+
Sbjct  1    MSTV-RKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDN--GIPLPNVTSKILSKVI  57

Query  385  EYCKKHALT----------------------SSLRELKAFDDEFIKVDMDTLCDLILAAD  272
            EYCK+H                         SS  +LK +D EFIKVD  TL DLILAA+
Sbjct  58   EYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAAN  117

Query  271  YLCIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            YL IKGL  LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  YLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  171



>gb|EPS61104.1| hypothetical protein M569_13700 [Genlisea aurea]
Length=167

 Score =   120 bits (300),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 106/161 (66%), Gaps = 16/161 (10%)
 Frame = -3

Query  553  EKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCK  374
            E K+ + SSDGE+FE+  +VA +SQT+  +IED  CA+   IPLP +T KIL+ V+EYCK
Sbjct  9    ESKIVLRSSDGELFEVDESVALESQTIKHLIEDK-CADT-AIPLPNVTAKILSKVIEYCK  66

Query  373  KH---------ALTSSLR----ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            +H          LT S +    ELKAFD EF+KVD  TL DLILAA+YL IK L  LT  
Sbjct  67   QHISAASKVTDGLTLSEKAVEDELKAFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQ  126

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  127  TVADMIKGKTPEEIRKTFNIQNDFTPEEEEEVRRENAWAFE  167



>gb|AAC63110.1| UIP2 [Arabidopsis thaliana]
Length=172

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 106/174 (61%), Gaps = 26/174 (15%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MS++ +K+T+ SSDGE FE+   VA +SQT+  MIEDD   N   IPLP +T KIL+ V+
Sbjct  2    MSTV-RKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDN--GIPLPNVTSKILSKVI  58

Query  385  EYCKKHALT----------------------SSLRELKAFDDEFIKVDMDTLCDLILAAD  272
            EYCK+H                         SS  +LK +D EFIKVD  TL DLILAA+
Sbjct  59   EYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAAN  118

Query  271  YLCIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            YL IKGL  LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  YLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  172



>ref|XP_009591491.1| PREDICTED: SKP1-like protein 1A [Nicotiana tomentosiformis]
 ref|XP_009782768.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
Length=156

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 103/157 (66%), Gaps = 10/157 (6%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  K + + SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+EY
Sbjct  2    STSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVIEY  59

Query  379  CKKHALT-------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSS  221
            CK+H          +S  +LK+FD +F+KVD  TL DLILAA+YL IK L  LT  +++ 
Sbjct  60   CKRHVDAVAKTDDKASEDDLKSFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  119

Query  220  SIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  156



>dbj|BAB85606.1| kinetochore protein [Brassica juncea]
Length=161

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 101/160 (63%), Gaps = 16/160 (10%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA++SQTL  M+EDD   N   IPLP +T KILA V+EYCKK
Sbjct  4    KKIVLKSSDGESFEVDEAVARESQTLAHMVEDDCIENG--IPLPNVTSKILAKVIEYCKK  61

Query  370  H-------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            H                SS  +LKA+D EF+K+D  TL +LILAA+YL IK L  LT  +
Sbjct  62   HVDAAAAKTEGAVDGAASSDDDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  E+  TFNI N  +PEE E++RREN  AFE
Sbjct  122  VADMIKGKTPEEIRTTFNIKNDFSPEEEEEVRRENQWAFE  161



>gb|AFK43118.1| unknown [Medicago truncatula]
Length=160

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 101/153 (66%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T++SSDGE+FE+  TVA + +T+  +IED    + + IP+PK+TGKILA++VEYCKK
Sbjct  10   KKITLTSSDGEIFEIEKTVAVEFKTIKNLIED--VVDNNRIPIPKVTGKILALIVEYCKK  67

Query  370  HALT------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H         SS  +LK +D EF+++D   L DLI AA +L IK L  LT  +++  +  
Sbjct  68   HVNAVNSDEKSSEHDLKTWDAEFVQLDHPVLFDLISAASFLDIKSLYDLTRKTVADMMNG  127

Query  208  KTLPELCQTFNI-DNLTPEEFEQIRRENH*AFE  113
            KT  ++   FNI ++ +P+E E+IR E+  A+E
Sbjct  128  KTPEQIRAMFNIVNDYSPQEEEEIRSEHPWAYE  160



>ref|XP_006360903.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=150

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 100/151 (66%), Gaps = 9/151 (6%)
 Frame = -3

Query  544  VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKHA  365
            + + SSDGE FE+   VA +SQT+  MIEDD CA+   IPLP +T KILA V+EYCK+H 
Sbjct  2    IVLRSSDGETFEVDEAVALESQTIKHMIEDD-CADT-SIPLPNVTSKILAKVIEYCKRHV  59

Query  364  LT------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKT  203
                    ++  +LK FD EF+KVD  TL DLILAA+YL IK L  LT  +++  I  KT
Sbjct  60   EVPKTEDKTAEEDLKTFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  119

Query  202  LPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  PEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  150



>ref|XP_006292236.1| hypothetical protein CARUB_v10018443mg [Capsella rubella]
 gb|EOA25134.1| hypothetical protein CARUB_v10018443mg [Capsella rubella]
Length=156

 Score =   119 bits (298),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 104/159 (65%), Gaps = 13/159 (8%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+ + SSDGE FE+   VA++ Q +  MIEDD CA+K  IPL  +TGKILAMVV
Sbjct  1    MSS--QKIVLVSSDGETFEVEEAVARKLQIVGHMIEDD-CAHK-PIPLQNVTGKILAMVV  56

Query  385  EYCKKH-------ALTSSLRELKAFDDEFIK-VDMDTLCDLILAADYLCIKGLAVLTSLS  230
            EYCK H       A     ++LK +D+EF+K +D+DT+ +LILAA+YL +  L  LT   
Sbjct  57   EYCKTHVNDDHVDASEEVKKKLKDWDEEFMKNLDLDTIFNLILAANYLNVTVLLDLTCQV  116

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AF  116
            ++  I +K + E+ + FN+ N  TPEE E IR+EN  A+
Sbjct  117  VADYIKDKKVEEVREIFNVKNDFTPEEEETIRKENEWAY  155



>ref|XP_008245788.1| PREDICTED: SKP1-like protein 11 [Prunus mume]
Length=155

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 100/151 (66%), Gaps = 7/151 (5%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ S D + FE+ + VA QSQT+  M+EDD CAN D IPL  +T   LA V+EYCKK
Sbjct  7    KKITLKSDDNQTFEVEVAVAMQSQTIKHMVEDD-CAN-DAIPLSNVTSSALAKVIEYCKK  64

Query  370  H----ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKT  203
            H    A   +   LK++D EF+K+D+  L DLILAA+YL IK L  LTS +++  I +KT
Sbjct  65   HHEEDADVKNKESLKSWDAEFVKMDLSKLFDLILAANYLDIKSLLDLTSQTVADMIKDKT  124

Query  202  LPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              E+   FNI+N  TPEE ++IR EN  AFE
Sbjct  125  PEEIRVIFNIENDFTPEEEKEIREENKWAFE  155



>ref|XP_010266846.1| PREDICTED: SKP1-like protein 1B isoform X1 [Nelumbo nucifera]
 ref|XP_010266847.1| PREDICTED: SKP1-like protein 1B isoform X1 [Nelumbo nucifera]
Length=154

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 100/153 (65%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KKVT+  SDGE F++   VA +SQT+  MIE+D   N   IPLP +T KIL  V+EYCKK
Sbjct  4    KKVTLKGSDGETFDVDEAVALESQTIKHMIEEDCIDNG--IPLPNVTSKILCKVIEYCKK  61

Query  370  HALT------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H  T      ++  ELK +D EF+KVD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  62   HVETPRTDDRTADEELKNWDAEFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIKG  121

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  122  KTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  154



>ref|XP_007201294.1| hypothetical protein PRUPE_ppa012728mg [Prunus persica]
 gb|EMJ02493.1| hypothetical protein PRUPE_ppa012728mg [Prunus persica]
Length=157

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 98/159 (62%), Gaps = 10/159 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            M++ +K +T+ S+DGE+FE+   VA +SQT+  M EDD   N   IPLP +   +LA V+
Sbjct  1    MATEKKMITLKSADGEIFEVEEAVALESQTIKHMAEDDCVDN--AIPLPNVESHVLAKVI  58

Query  385  EYCKKHALTSSLRE----LKAFDDEF---IKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            EYC+KH   ++  E    +K F+D+F   IK D   L D ILAA+YL IK L  LT  ++
Sbjct  59   EYCRKHVELAANDENKDTVKEFNDDFVNEIKADQSVLFDTILAANYLNIKSLLDLTCQTV  118

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  K   E+ +TFNI N  TPEE  +IR+EN  AFE
Sbjct  119  ADMIKGKAPEEIRKTFNIHNDFTPEEEAEIRKENEWAFE  157



>ref|XP_010266848.1| PREDICTED: SKP1-like protein 1B isoform X2 [Nelumbo nucifera]
Length=154

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 100/153 (65%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KKVT+ SSDGE F +   VA +SQT+  MIE+D   N   IPLP +T KIL+ V+EYCKK
Sbjct  4    KKVTLKSSDGETFNVDKAVALESQTIMHMIEEDCIDN--GIPLPTVTSKILSKVIEYCKK  61

Query  370  HALTSSL------RELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H  T+         +LK +D EF+KVD  TL DLILAA+YL IK L  LT  +++  I  
Sbjct  62   HVKTTRTDDRTADEKLKNWDAEFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIKG  121

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  122  KTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  154



>gb|ABB77427.1| Skp1-like protein 2 [Petunia integrifolia subsp. inflata]
Length=154

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 102/154 (66%), Gaps = 9/154 (6%)
 Frame = -3

Query  553  EKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCK  374
            EK + + SSDGE F++  +VA +SQT+  MIEDD CA+   IPLP +T +ILA V+EYCK
Sbjct  3    EKMIVLKSSDGETFQVEESVAVESQTIKHMIEDD-CADS-SIPLPNVTSQILAKVIEYCK  60

Query  373  KHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSII  212
            +H   S   +      LK+FD +F+KVD   L DLILAA+YL IK L  LT  +++  I 
Sbjct  61   RHVEASKTEDKATEDDLKSFDADFVKVDQSMLFDLILAANYLNIKSLLDLTCQTVADMIK  120

Query  211  NKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  121  GKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  154



>ref|XP_011088616.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=166

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 104/164 (63%), Gaps = 16/164 (10%)
 Frame = -3

Query  562  SSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVE  383
             + +K + + SSDGE FE+   VA +SQT+  MIED+ CA+   IPLP +T KILA V+E
Sbjct  5    GAAQKMIVLKSSDGETFEVEEAVAPESQTIKHMIEDN-CADT-SIPLPNVTSKILAKVIE  62

Query  382  YCKKHALTSSLR-------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVL  242
            YCK+H   ++               +LKAFD EF+KVD  TL DLILAA+YL IK L  L
Sbjct  63   YCKRHVDAAAKASADATASDKVAEDDLKAFDAEFVKVDQGTLFDLILAANYLNIKSLLDL  122

Query  241  TSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            T  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  123  TCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  166



>gb|ACA61783.1| SKP1-like protein 1 [Petunia x hybrida]
Length=155

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 102/156 (65%), Gaps = 9/156 (6%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  K + + SSDGE F++  +VA +S T   MIEDD CA+   IPLP +T KILA V+EY
Sbjct  2    STSKMIVLKSSDGETFQVEESVALESXTXKHMIEDD-CADT-SIPLPNVTSKILAKVIEY  59

Query  379  CKKHALT------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            CK+H         +S  ELK+FD +F+KVD  TL DLILAA+YL IK L  LT  +++  
Sbjct  60   CKRHVEANKSEDKASEDELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  155



>ref|XP_009372997.1| PREDICTED: SKP1-like protein 1A isoform X1 [Pyrus x bretschneideri]
Length=160

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = -3

Query  562  SSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVE  383
            + L+KK+T+ SSD E+FE+   VA +SQT+  M+ED    N   IPLP +T  ILA V+E
Sbjct  6    ADLKKKITLKSSDDEMFEVEEVVAMESQTIKHMVEDGCAGN--AIPLPNVTSAILAKVIE  63

Query  382  YCKKH------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSS  221
            YC+KH            + +K +D EF+K+D +TL DLI+AA+YL IKGL  LT  +++ 
Sbjct  64   YCRKHREDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVAD  123

Query  220  SIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             I  KT  ++  TFNI N  TPEE E+IRREN  AFE
Sbjct  124  MIKGKTPEQIRTTFNIKNDFTPEEEEEIRRENQWAFE  160



>ref|XP_006390250.1| hypothetical protein EUTSA_v10019260mg [Eutrema salsugineum]
 gb|ESQ27536.1| hypothetical protein EUTSA_v10019260mg [Eutrema salsugineum]
Length=159

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 104/163 (64%), Gaps = 16/163 (10%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+ + SSDGE FE+   VA +SQT+  M+EDD   N   +PLP +T KILA V+
Sbjct  1    MSS--KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNG--VPLPNVTSKILAKVI  56

Query  385  EYCKKHALT-----------SSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
            EYCKKH  +           SS  +LKA+D EF+K+D  TL +LILAA+YL IK L  LT
Sbjct  57   EYCKKHVDSAASKSEAVDGASSDEDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLT  116

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              +++  I  KT  E+  TFNI N  TPEE E++RREN  AFE
Sbjct  117  CQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE  159



>emb|CDX73212.1| BnaC06g36600D [Brassica napus]
Length=161

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 101/160 (63%), Gaps = 16/160 (10%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSD E FE+   VA++SQTL  M+EDD   N   IPLP +TGKILA V+EYCKK
Sbjct  4    KKIVLKSSDNESFEVDEAVARESQTLAHMVEDDCTDNG--IPLPNVTGKILAKVIEYCKK  61

Query  370  H-------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            H                SS  +LKA+D EF+K+D  TL +LILAA+YL IK L  LT  +
Sbjct  62   HVDAAAAKTEAAADGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  E+  TFNI N  +PEE E++RREN  AFE
Sbjct  122  VADMIKGKTPDEIRTTFNIKNDFSPEEEEEVRRENQWAFE  161



>ref|XP_008236029.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
 ref|XP_008236030.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
Length=157

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 98/159 (62%), Gaps = 10/159 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            M++ +K +T+ S+DGE+FE+   VA +SQT+  M EDD   N   IPLP +   ILA V+
Sbjct  1    MATEKKIITLKSADGEIFEVEEAVALESQTIKHMAEDDCVDN--AIPLPIVESHILAKVI  58

Query  385  EYCKKHALTSSLRE----LKAFDDEF---IKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            EYC+KH   ++  E    +K F+D+F   IK D   L D ILAA+YL IK L  LT  ++
Sbjct  59   EYCRKHVEFAANDENKDTVKKFNDDFVNEIKTDQSVLFDTILAANYLNIKSLLDLTCQTV  118

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+ +TFNI N  TPEE   IR+EN  AFE
Sbjct  119  ADMIKGKTPEEIRKTFNIQNDFTPEEEAAIRKENEWAFE  157



>ref|XP_010416502.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=162

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 102/163 (63%), Gaps = 16/163 (10%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S  KK+ + SSDGE FE+   VA +SQT+  M+EDD   N   +PLP +T KILA V+EY
Sbjct  2    STTKKIVLKSSDGESFEVDELVALESQTIAHMVEDDCVDNG--VPLPNVTSKILAKVIEY  59

Query  379  CKKH-------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
            CKKH             A +S+  ELK +D EF+K+D  TL +LILAA+YL IK L  LT
Sbjct  60   CKKHVEVTASKTDAVDGAASSADEELKTWDAEFMKIDQATLFELILAANYLNIKNLLDLT  119

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              +++  I  KT  E+  TFNI N  TPEE E++RREN  AFE
Sbjct  120  CQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE  162



>dbj|BAE72121.1| SKP1-like protein [Silene latifolia]
Length=173

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 104/167 (62%), Gaps = 23/167 (14%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +TGKIL+ V+EYCKK
Sbjct  9    KKILLKSSDGEDFEVDQIVALESQTIKHMIEDD-CAD-NAIPLPNVTGKILSKVIEYCKK  66

Query  370  HALTSSLR--------------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGL  251
            H   +                       +LK +D EF+KVD +TL DLILAA+YL IK L
Sbjct  67   HVEFAEKNKGETTTTTSAAGTGTTPVDDDLKNWDTEFVKVDQNTLFDLILAANYLNIKSL  126

Query  250  AVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  127  LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  173



>dbj|BAB85607.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 100/159 (63%), Gaps = 15/159 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  M+EDD   N   IPLP +T KILA V+EYCKK
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNG--IPLPNVTSKILAKVIEYCKK  61

Query  370  H------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            H               SS  +LKA+D EF+K+D  TL +LILAA+YL IK L  LT  ++
Sbjct  62   HVDAAASKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+  TFNI N  TPEE E++RREN  AFE
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE  160



>ref|XP_006425391.1| hypothetical protein CICLE_v10026642mg [Citrus clementina]
 ref|XP_006467001.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR38631.1| hypothetical protein CICLE_v10026642mg [Citrus clementina]
Length=168

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 105/171 (61%), Gaps = 23/171 (13%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  K + + S DGE FE+   VA +S T+  MIEDD CA+ + IPLP +TGKILA VV
Sbjct  1    MSS-PKMIVLKSCDGESFEVEEAVALESTTIKHMIEDD-CAD-NGIPLPNVTGKILAKVV  57

Query  385  EYCKKH-------------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLC  263
            EYCKKH                   A      +LK++D +F+KVD  TL DLILAA+YL 
Sbjct  58   EYCKKHVEVPATQDSNNSGANSNGTATNGGEEDLKSWDTDFVKVDQATLFDLILAANYLN  117

Query  262  IKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            IKGL  LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  IKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  168



>gb|KDO71310.1| hypothetical protein CISIN_1g030962mg [Citrus sinensis]
Length=168

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 105/171 (61%), Gaps = 23/171 (13%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  K + + S DGE FE+   VA +S T+  MIEDD CA+ + IPLP +TGKILA VV
Sbjct  1    MSS-PKMIVLKSCDGESFEVEEAVALESTTIKHMIEDD-CAD-NGIPLPNVTGKILAKVV  57

Query  385  EYCKKH-------------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLC  263
            EYCKKH                   A      +LK++D +F+KVD  TL DLILAA+YL 
Sbjct  58   EYCKKHVEVPTTQDSNTSGANSNGAATNGGEEDLKSWDTDFVKVDQATLFDLILAANYLN  117

Query  262  IKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            IKGL  LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  IKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  168



>ref|NP_567959.1| SKP1-like protein 11 [Arabidopsis thaliana]
 sp|O49484.1|ASK11_ARATH RecName: Full=SKP1-like protein 11; Short=AtSK11 [Arabidopsis 
thaliana]
 emb|CAA17551.1| kinetochore (SKP1p)-like protein [Arabidopsis thaliana]
 emb|CAB80138.1| kinetochore (SKP1p)-like protein [Arabidopsis thaliana]
 gb|ABE66110.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 [Arabidopsis 
thaliana]
 gb|AEE86340.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 98/156 (63%), Gaps = 9/156 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  K + + SSDG+ FE+   VA QSQT+  M+EDD  A  D IPL  +  KIL  V+
Sbjct  1    MSS--KMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVA--DGIPLANVESKILVKVI  56

Query  385  EYCKKHALTS----SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            EYCKKH +      S  +L  +D++F+ ++  T+ +LILAA+YL IK L  LT  +++  
Sbjct  57   EYCKKHHVDEANPISEEDLNNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADM  116

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  E+  TFNI+N  TPEE E +R+EN  AFE
Sbjct  117  IKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE  152



>gb|ABK28664.1| unknown [Arabidopsis thaliana]
Length=153

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 98/156 (63%), Gaps = 9/156 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  K + + SSDG+ FE+   VA QSQT+  M+EDD  A  D IPL  +  KIL  V+
Sbjct  1    MSS--KMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVA--DGIPLANVESKILVKVI  56

Query  385  EYCKKHALTS----SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            EYCKKH +      S  +L  +D++F+ ++  T+ +LILAA+YL IK L  LT  +++  
Sbjct  57   EYCKKHHVDEANPISEEDLNNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADM  116

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  E+  TFNI+N  TPEE E +R+EN  AFE
Sbjct  117  IKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE  152



>emb|CDM86749.1| unnamed protein product [Triticum aestivum]
Length=143

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 88/144 (61%), Gaps = 21/144 (15%)
 Frame = -3

Query  487  QSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKHAL------------------  362
            +SQT+  MIEDD CA+ + IPLP +  KILA V+EYCKKH                    
Sbjct  2    ESQTIRHMIEDD-CAD-NGIPLPNVDSKILAKVIEYCKKHVQASTNPADSGAADANSSTS  59

Query  361  TSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKTLPELCQT  182
            T+   +LK+FD EF+KVD  TL D ILAA+YL IKGL  LT  +++  I  KT  E+ +T
Sbjct  60   TAPAEDLKSFDAEFVKVDQATLFDFILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKT  119

Query  181  FNIDN-LTPEEFEQIRRENH*AFE  113
            FNI N  TPEE  +IRREN  AFE
Sbjct  120  FNIKNDFTPEEEAEIRRENQWAFE  143



>ref|XP_004248654.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=150

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 100/151 (66%), Gaps = 9/151 (6%)
 Frame = -3

Query  544  VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKHA  365
            + +  SDGE FE+   VA +SQT+  MIEDD CA+   IPLP IT KILA+V+EYCK+H 
Sbjct  2    IVLRCSDGETFEVDKAVALESQTIKHMIEDD-CADTS-IPLPNITSKILALVIEYCKRHL  59

Query  364  LTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKT  203
              + + +      LK FD EF+KVD  TL +LILAA+YL IK L  LT  +++  I  KT
Sbjct  60   EVAKVEDQTAEEDLKTFDAEFVKVDQSTLFNLILAANYLNIKSLMDLTCQTVAEMIKGKT  119

Query  202  LPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  120  PEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  150



>gb|KEH23696.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 100/158 (63%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+T+ SSD E FE+   VA +SQT+  MIEDD   N   IP+P +TG+ILA V+
Sbjct  1    MSSTTKKITLKSSDNETFEVPEAVALESQTIKYMIEDDCTDN--GIPVPNVTGQILAKVI  58

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH    S  E      LK +D EF+KVD   L  LILAA+YL IK L  LT  +++
Sbjct  59   EYCKKHVDAESSDEKPSEDDLKNWDAEFVKVDQAKLFGLILAANYLNIKSLLDLTCQTVA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  T EE E+IRREN  AFE
Sbjct  119  DMIKGKTPEEIRKTFNIKNDFTSEEEEEIRRENQWAFE  156



>ref|XP_009418685.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=161

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 104/163 (64%), Gaps = 17/163 (10%)
 Frame = -3

Query  556  LEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYC  377
            + K + + SSDGEVFE+   VA +SQT+  MIEDD CA ++ IPLP +T  ILA V+EYC
Sbjct  1    MAKTIMLKSSDGEVFEVDEAVAMESQTIKHMIEDD-CA-ENGIPLPNVTSAILAKVIEYC  58

Query  376  KKHALTSSLRE--------------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
            +KH   S+                 +K++D EF+KVD  TL DLILAA+YL IKGL  LT
Sbjct  59   RKHVEASAAAASKSSDDGSKPTDDVIKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLT  118

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  CQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  161



>gb|KEH19789.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=158

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 100/158 (63%), Gaps = 9/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+T+ SSDGE FE+   VA +SQT+  +IE   C +   IPL ++T  ILA V+
Sbjct  1    MSST-RKITLKSSDGETFEIDEVVAMESQTIKHVIEAG-CVDDAGIPLLQVTRNILAKVI  58

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCKKH   +S  E      L A+D EF+KVD  TL  L LAA+YL IK L  LT  +++
Sbjct  59   EYCKKHVEATSSEEKPSEDALNAWDTEFLKVDPYTLMKLTLAANYLNIKNLYDLTCKTIA  118

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              + NK   E+ +TFNI N  TPEE  ++R+E++ AF+
Sbjct  119  DMMKNKPPEEIRETFNIVNDYTPEEEAEVRQEHYQAFQ  156



>ref|NP_565467.1| SKP1-like protein 17 [Arabidopsis thaliana]
 sp|Q9SL65.1|ASK17_ARATH RecName: Full=SKP1-like protein 17; Short=AtSK17; AltName: Full=Protein 
MEIDOS [Arabidopsis thaliana]
 gb|AAD24382.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At17), putative 
[Arabidopsis thaliana]
 gb|AEC06973.1| SKP1-like protein 17 [Arabidopsis thaliana]
Length=150

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 102/153 (67%), Gaps = 7/153 (5%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+ ++SSD E FE+   VA++ Q +  MI+DD CA+K  I L  +TGKILA+++
Sbjct  1    MSS--KKIVLTSSDDECFEIDEAVARKMQMVAHMIDDD-CADK-AIRLQNVTGKILAIII  56

Query  385  EYCKKHAL-TSSLRELKAFDDEFIK-VDMDTLCDLILAADYLCIKGLAVLTSLSMSSSII  212
            EYCKKH     +  E   +D EF+K +DMDTL  L+ AADYL + GL  L + +++    
Sbjct  57   EYCKKHVDDVEAKNEFVTWDAEFVKNIDMDTLFKLLDAADYLIVIGLKNLIAQAIADYTA  116

Query  211  NKTLPELCQTFNIDN-LTPEEFEQIRRENH*AF  116
            +KT+ E+ + FNI+N  TPEE E++R++N  AF
Sbjct  117  DKTVNEIRELFNIENDYTPEEEEELRKKNEWAF  149



>dbj|BAJ91150.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=169

 Score =   117 bits (293),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 104/170 (61%), Gaps = 17/170 (10%)
 Frame = -3

Query  577  AIATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKIL  398
            A A  +  ++ VT+ SSDGE FE+   VA +SQT+  +IEDD CA+ + IPLP +  KIL
Sbjct  2    AAAGDAGEKRMVTLKSSDGEEFEVEEAVAVESQTIRHLIEDD-CAD-NGIPLPNVNSKIL  59

Query  397  AMVVEYCKKHA--------------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCI  260
            + V+EYC KH                     +LK +D EF+KVD  TL DLILAA++L I
Sbjct  60   SKVIEYCNKHVQAKPADAAGAGASDAPPPADDLKNWDAEFVKVDQATLFDLILAANFLNI  119

Query  259  KGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KGL  LT  +++  I  KT  E+ +TFNI N  TP+E E+IRREN  AFE
Sbjct  120  KGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPDEEEEIRRENQWAFE  169



>gb|KEH23706.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=158

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 102/160 (64%), Gaps = 11/160 (7%)
 Frame = -3

Query  565  MSSLEKK-VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMV  389
            MSS  KK +T+ S DGE FE+S  VA +SQT+  +IEDD CA+ + IP+P +TGKILA V
Sbjct  1    MSSTSKKMITLKSDDGETFEVSEAVALKSQTIKHIIEDD-CAD-NVIPVPNVTGKILAKV  58

Query  388  VEYCKKHALTSSLRE------LKAFDDEFIK-VDMDTLCDLILAADYLCIKGLAVLTSLS  230
            +EYCKKH   +S  E      LK +D +F K VD  TL  ++LAA+YL IK L  L   +
Sbjct  59   IEYCKKHVEATSSDEKVSEDDLKNWDADFAKEVDQQTLFQILLAANYLNIKNLLDLCCQT  118

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I +K   E+ + F+++N   PEE  ++R EN  AFE
Sbjct  119  VADDIKDKKPEEIREIFSVENDFNPEEEAKVRNENAWAFE  158



>emb|CDP16772.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 98/148 (66%), Gaps = 4/148 (3%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + ++SSDG  FE+  +VA QSQT+  MIED+ CA+   IPLP + G  LA V+EY KK
Sbjct  13   KMIVLNSSDGATFEVEESVAVQSQTIKHMIEDN-CADT-SIPLPNVNGVTLARVLEYIKK  70

Query  370  HALTSSLRE-LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKTLPE  194
            HA      E LK+FD EF+KVD  +L ++ILAA+YL IKGL  LT  +++  I + T+ E
Sbjct  71   HAEAKDDEEGLKSFDAEFVKVDQASLFEIILAANYLDIKGLLDLTCQTVADQIKDLTVEE  130

Query  193  LCQTFNI-DNLTPEEFEQIRRENH*AFE  113
            +   FNI ++ TPEE  ++R ++  AFE
Sbjct  131  VRAIFNIMNDFTPEEEAKLRNDHAWAFE  158



>ref|XP_006359704.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=158

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 106/161 (66%), Gaps = 13/161 (8%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSSL KK+++ SSDGEVFE+   VA +SQT+  +IEDD CA  D IP+  +T  ILA V+
Sbjct  1    MSSL-KKISLRSSDGEVFEVEEAVALESQTIKFLIEDD-CAGSD-IPISNVTSNILAKVL  57

Query  385  EYCKKHA---------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSL  233
            EY K+H            ++  +LK FD EF+KVD  TL DLILAA+YL IKGL  LT  
Sbjct  58   EYLKRHVEADDKAADDKAAADNDLKVFDAEFVKVDQKTLFDLILAANYLNIKGLLDLTCQ  117

Query  232  SMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  TVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  158



>ref|XP_004248653.2| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=160

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 100/151 (66%), Gaps = 9/151 (6%)
 Frame = -3

Query  544  VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKHA  365
            + + SSDGE FE+   VA +SQT+  MIED+ CA+   IPLP IT KILA+V+EYCK+H 
Sbjct  12   IVLRSSDGETFEVDKAVALESQTIKHMIEDN-CADT-SIPLPNITSKILALVIEYCKRHL  69

Query  364  LTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKT  203
              + + +      LK FD EF+KVD  TL +LILA +YL IK L  LT  +++  I  KT
Sbjct  70   EVAKVEDKIAEEDLKTFDAEFVKVDQSTLFNLILAVNYLNIKSLMDLTCQTVAEMIKGKT  129

Query  202  LPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  130  PEEIRKTFNIKNDFTPEEEEEVRRENAWAFE  160



>ref|XP_010450797.1| PREDICTED: SKP1-like protein 11 [Camelina sativa]
Length=153

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 97/154 (63%), Gaps = 7/154 (5%)
 Frame = -3

Query  559  SLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEY  380
            S +K + + SSDG+ F++   +A QSQT+  M+EDD CA+ + IPL  +T K L++V+EY
Sbjct  2    STKKMIMLKSSDGQSFKVEEEIAIQSQTIAHMVEDD-CASTE-IPLANVTSKTLSLVIEY  59

Query  379  CKKHALTS----SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSII  212
            CKKH +      S  ELK +D +F++ D  T+ DLIL A+YL I  L  LT  +++  I 
Sbjct  60   CKKHHVDDANPISEEELKTWDKQFMETDQSTIFDLILVANYLNIPSLLDLTCQTVADMIT  119

Query  211  NKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             KT  ++   FNI N  TPEE  ++RREN  AFE
Sbjct  120  GKTPEQIRAHFNIKNDFTPEEEAEVRRENQWAFE  153



>ref|XP_009372998.1| PREDICTED: SKP1-like protein 1A isoform X2 [Pyrus x bretschneideri]
Length=154

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 98/153 (64%), Gaps = 9/153 (6%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSD E+FE+   VA +SQT+  M+ED    N   IPLP +T  ILA V+EYC+K
Sbjct  4    KKITLKSSDDEMFEVEEVVAMESQTIKHMVEDGCAGN--AIPLPNVTSAILAKVIEYCRK  61

Query  370  H------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIIN  209
            H            + +K +D EF+K+D +TL DLI+AA+YL IKGL  LT  +++  I  
Sbjct  62   HREDEGATAADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMIKG  121

Query  208  KTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            KT  ++  TFNI N  TPEE E+IRREN  AFE
Sbjct  122  KTPEQIRTTFNIKNDFTPEEEEEIRRENQWAFE  154



>ref|XP_010448526.1| PREDICTED: SKP1-like protein 4 [Camelina sativa]
Length=162

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 95/160 (59%), Gaps = 17/160 (11%)
 Frame = -3

Query  547  KVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKH  368
            K+ + SSDGE+FE+   VA +SQT+  MIEDD  +N   IPLP +TG  LA V+EYCKKH
Sbjct  5    KIILKSSDGEIFEVDEAVAVESQTIKHMIEDDCASNG--IPLPNVTGATLAKVIEYCKKH  62

Query  367  ALTSSL--------------RELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
               ++                EL  +D EF+KVD  TL DLILAA+YL I GL  LT  +
Sbjct  63   VEAAAEADGADKDFCGKTENSELNTWDTEFVKVDQPTLFDLILAANYLNIGGLLDLTCKA  122

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  +  KT  E+   FNI N  T EE E++R EN  AFE
Sbjct  123  VADQMRGKTPDEMRAHFNIKNDYTKEEEEEVRNENKWAFE  162



>ref|XP_010477249.1| PREDICTED: SKP1-like protein 4 [Camelina sativa]
Length=162

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 97/160 (61%), Gaps = 17/160 (11%)
 Frame = -3

Query  547  KVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKH  368
            K+ + SSDGE FE+   VA +SQT+  MIED  CA+ + IPLP +TG ILA V+EYCKKH
Sbjct  5    KIILKSSDGESFEVDEAVAVESQTIKHMIEDK-CAD-NGIPLPNVTGAILAKVIEYCKKH  62

Query  367  AL--------------TSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
                            ++   ELK +D EF+KVD  TL DLILAA+YL I GL  LT  +
Sbjct  63   VEAAAEAAGADKDFCGSTENDELKTWDTEFVKVDQPTLFDLILAANYLNIGGLLDLTCQA  122

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  +  KT  E+   FNI N  T EE E++R EN  AFE
Sbjct  123  VADQMKGKTPDEMRAHFNIKNDYTKEEEEEVRNENKWAFE  162



>ref|XP_004144851.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 ref|XP_004163420.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN43257.1| hypothetical protein Csa_7G012950 [Cucumis sativus]
Length=155

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 102/158 (65%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+ + SSDGE F++   VA +SQT+  MIEDD CA+   IPLP +T  IL+ V+
Sbjct  1    MSS-SKKIVLRSSDGETFDVDEIVAVESQTIKHMIEDD-CADT-VIPLPNVTSAILSKVI  57

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCK H  T           LK +D EF+KVD +TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKMHVETDDKDSKVIDDTLKTWDAEFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>gb|EMT01637.1| SKP1-like protein 1B [Aegilops tauschii]
Length=150

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A     +K +T+ SSDGE F++   VA +SQT+  MIEDD CA+ + IPLP +  KIL+
Sbjct  1    MAAEEGEKKMITLKSSDGEEFQVEEAVAMESQTIRHMIEDD-CAD-NGIPLPNVDSKILS  58

Query  394  MVVEYCKKHALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSI  215
                     A  S + +LK+FD EF+KVD  TL DLILAA+YL IK L  LT  +++  I
Sbjct  59   SSS---TSTAAPSPVEDLKSFDAEFVKVDQATLYDLILAANYLNIKVLLDLTCQTVADMI  115

Query  214  INKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              KT  E+ +TFNI N  TPEE  +IRREN  AFE
Sbjct  116  KGKTPEEIRKTFNIKNDFTPEEEAEIRRENQWAFE  150



>ref|XP_009104691.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
 dbj|BAB85608.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 100/159 (63%), Gaps = 15/159 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  M+EDD   N   +PLP +T KILA V+EYCKK
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNG--VPLPNVTSKILAKVIEYCKK  61

Query  370  H------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            H               SS  +LKA+D EF+K+D  TL +LILAA+YL IK L  LT  ++
Sbjct  62   HVDAAASKSEAVDGGGSSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+  TFNI N  +PEE E++RREN  AFE
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFSPEEEEEVRRENQWAFE  160



>ref|XP_010447075.1| PREDICTED: SKP1-like protein 11 isoform X1 [Camelina sativa]
 ref|XP_010447076.1| PREDICTED: SKP1-like protein 11 isoform X2 [Camelina sativa]
Length=154

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 100/156 (64%), Gaps = 7/156 (4%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MS+ +K + + SSDG+ FE+   VA QSQT+  M+EDD CA K  IPL  +T K LA+V+
Sbjct  1    MSTTKKMIMLKSSDGQSFEVEEEVAIQSQTIAHMVEDD-CA-KTEIPLANVTSKTLALVM  58

Query  385  EYCKKHALTSS----LRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            EYCKKH +  +      +LK +D EF++ D  T+ DLILAA+YL I  L  LT  +++  
Sbjct  59   EYCKKHHVDEANPIPEEKLKTWDKEFMETDQSTIFDLILAANYLNIASLLDLTCQTVADM  118

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  ++   FNI N  TPEE E++R+EN  AFE
Sbjct  119  ITGKTPDQIRTHFNIKNDFTPEEEEEVRKENQWAFE  154



>dbj|BAB85605.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 100/159 (63%), Gaps = 15/159 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  M+EDD   N   +PLP +T KILA V+EYCKK
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNG--VPLPNVTSKILAKVIEYCKK  61

Query  370  H------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            H               SS  +LKA+D EF+K+D  TL +LILAA+YL IK L  LT  ++
Sbjct  62   HVDAVASKSEAVDGGGSSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+  TFNI N  +PEE E++RREN  AFE
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFSPEEEEEVRRENQWAFE  160



>gb|KFK42033.1| hypothetical protein AALP_AA2G203200 [Arabis alpina]
Length=159

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 99/158 (63%), Gaps = 14/158 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  M+EDD   N   +PLP +T KILA V+EYCKK
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNG--VPLPNVTSKILAKVIEYCKK  61

Query  370  HA-----------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            H              SS  +LK +D EF+K+D  TL +LILAA+YL IK L  LT  +++
Sbjct  62   HVDAAASKSEAVDGGSSDEDLKTWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  121

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+  TFNI N  TPEE E++RREN  AFE
Sbjct  122  DMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE  159



>ref|XP_010425103.1| PREDICTED: SKP1-like protein 16 [Camelina sativa]
Length=163

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 104/162 (64%), Gaps = 15/162 (9%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS   KV ++SSDGE FE+   VA++ Q +  MI+DD CA+K  IPL  +TGKILA+V+
Sbjct  1    MSS--NKVVLTSSDGETFEIEEAVARKLQIIGHMIDDD-CADK-AIPLANVTGKILALVI  56

Query  385  EYCKKHA---------LTSSLRELKAFDDEFIK-VDMDTLCDLILAADYLCIKGLAVLTS  236
            EYCKKH            +  +ELK +D +F+K +D++T   +ILAA+YL +K L  LT 
Sbjct  57   EYCKKHVDDDKDSTKEEEAKAKELKTWDAQFMKNIDLETNFSIILAANYLNVKDLLDLTC  116

Query  235  LSMSSSIINKTLPELCQTFNID-NLTPEEFEQIRRENH*AFE  113
             S++  I + +  E+   FNI+ + TPEE  +IR+EN  AFE
Sbjct  117  QSVADHIKDMSPEEIRTIFNIECDFTPEEEAKIRKENAWAFE  158



>ref|XP_003573486.1| PREDICTED: SKP1-like protein 1A [Brachypodium distachyon]
Length=168

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 105/168 (63%), Gaps = 20/168 (12%)
 Frame = -3

Query  562  SSLEKK-VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            S  EKK +T+ SSDGE FE+  TVA +SQT+  MIEDD CA+ + IPLP +  KIL+ V+
Sbjct  3    SDGEKKMITLKSSDGEEFEVEETVAMESQTIRHMIEDD-CAD-NGIPLPNVNSKILSKVI  60

Query  385  EYCKKHA----------------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKG  254
            EYC KH                   +   +LK +D +F+KVD  TL DLILAA+YL IKG
Sbjct  61   EYCNKHVHAADATDAAAANTSAAPAAPTDDLKNWDADFVKVDQATLFDLILAANYLNIKG  120

Query  253  LAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            L  LT  +++  I  KT  E+ +TFNI N  TPEE E+IRREN  AFE
Sbjct  121  LLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEIRRENQWAFE  168



>ref|XP_008357536.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
Length=191

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 93/149 (62%), Gaps = 9/149 (6%)
 Frame = -3

Query  553  EKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCK  374
            +KK+T++SS  E+FE+   VA +SQT+  M+ED  CA+ + IPLP +T  ILA V+EYC 
Sbjct  45   KKKITLNSSGNEMFEVEEAVAMESQTIKHMVEDG-CAD-NTIPLPNVTSAILAKVIEYCT  102

Query  373  KHA------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSII  212
            KH        T +    K +D EFIK++ +TL DLI+AA+YL IKGL  LT   +   I 
Sbjct  103  KHREEDRAIATDNENNFKEWDAEFIKINQNTLYDLIMAANYLNIKGLLDLTCQIVVDXIK  162

Query  211  NKTLPELCQTFNIDN-LTPEEFEQIRREN  128
             K   E+ + FNI N   P+E E+I REN
Sbjct  163  GKAPEEIRKMFNIKNDFAPKEEEKIHREN  191



>ref|XP_010669692.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=171

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 106/166 (64%), Gaps = 22/166 (13%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+T+ SSDGE F++  +VA + QT+  +IEDD CA+ + IPLP +T KIL+ V+EYCKK
Sbjct  7    KKITLKSSDGENFDVEESVALECQTIKYIIEDD-CAD-NVIPLPNVTAKILSKVIEYCKK  64

Query  370  HA-------------------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLA  248
            H                     T+   ELK +D EF+KVD +TL DLILAA+YL IK L 
Sbjct  65   HVESVAAAKSSTEDGSSSSNPTTADEEELKTWDAEFVKVDQNTLFDLILAANYLNIKSLL  124

Query  247  VLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             LT  ++++ +  KT  E+ +TFNI N  TPEE E++RREN  AF+
Sbjct  125  DLTCQTVANMMTGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFD  170



>ref|XP_010438976.1| PREDICTED: SKP1-like protein 4 [Camelina sativa]
Length=162

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 95/160 (59%), Gaps = 17/160 (11%)
 Frame = -3

Query  547  KVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKH  368
            K+ + SSDGE+FE+   VA +S T+  MIEDD  +N   IPLP +TG ILA V+EYCKKH
Sbjct  5    KIILKSSDGEIFEVDEAVAVESLTIKHMIEDDCASNG--IPLPNVTGAILAKVIEYCKKH  62

Query  367  AL--------------TSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
                             +   EL  +D EF+KVD  TL +LILAA+YL I GL  LT  +
Sbjct  63   VEAAAEADGADKDFCGNTENSELNTWDTEFLKVDQPTLFELILAANYLNISGLLDLTCKA  122

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  +  KT  E+   FNI N  +PEE E++R EN  AFE
Sbjct  123  VADQMKGKTPDEMRAHFNIKNDYSPEEEEEVRNENKWAFE  162



>ref|NP_567967.1| SKP1-like protein 12 [Arabidopsis thaliana]
 sp|O65674.1|ASK12_ARATH RecName: Full=SKP1-like protein 12; Short=AtSK12 [Arabidopsis 
thaliana]
 emb|CAA18826.1| Skp1p-like protein [Arabidopsis thaliana]
 emb|CAB80164.1| Skp1p-like protein [Arabidopsis thaliana]
 gb|AEE86383.1| SKP1-like protein 12 [Arabidopsis thaliana]
Length=152

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 98/156 (63%), Gaps = 9/156 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  K + + SSDG+ FE+   VA QSQT+  M+EDD  A  D IPL  +  KIL  V+
Sbjct  1    MSS--KMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVA--DGIPLANVESKILVKVI  56

Query  385  EYCKKHALTS----SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
            EYCKK+ +      S  +L  +D++F+ ++  T+ +LILAA+YL IK L  LT  +++  
Sbjct  57   EYCKKYHVDEANPISEEDLNKWDEKFMDLEQSTIFELILAANYLNIKSLFDLTCQTVADM  116

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  E+  TFNI+N  TPEE E +R+EN  AFE
Sbjct  117  IKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE  152



>dbj|BAE72119.1| SKP1-like protein [Silene latifolia]
Length=160

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 91/149 (61%), Gaps = 22/149 (15%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  MIEDD CA+ + IPLP +TGKIL+ V+EYCKK
Sbjct  9    KKILLKSSDGEDFEVDQIVALESQTIKHMIEDD-CAD-NAIPLPNVTGKILSKVIEYCKK  66

Query  370  HALTSSLR--------------------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGL  251
            H   +                       +LK +D EF+KVD +TL DLILAA+YL IK L
Sbjct  67   HVEFAEKNKGETTTTTSAAGTGTTPVDDDLKNWDTEFVKVDQNTLFDLILAANYLNIKSL  126

Query  250  AVLTSLSMSSSIINKTLPELCQTFNIDNL  164
              LT  +++  I  KT  E+ +TFNI N+
Sbjct  127  LDLTCQTVADMIKGKTPEEIRKTFNIKNV  155



>ref|XP_002885471.1| hypothetical protein ARALYDRAFT_898637 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61730.1| hypothetical protein ARALYDRAFT_898637 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 99/151 (66%), Gaps = 7/151 (5%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K ++++SSDG+ FE+    A+Q Q +N MIEDD CA+++ IPLP +TGKILAMV+EYCKK
Sbjct  4    KMISLTSSDGQTFEIKEDAARQCQIINHMIEDD-CADRE-IPLPNVTGKILAMVLEYCKK  61

Query  370  H----ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKT  203
            H    A  S+  +LK +D++F++ D  TL DLI AA YL I+ L  L   + S     KT
Sbjct  62   HHVDDANPSTDEDLKKWDEKFMEKDQLTLFDLINAASYLDIQSLLDLACQTASDMSKAKT  121

Query  202  LPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            L +  + FNI+N  TPEE + + ++   AFE
Sbjct  122  LDQTREFFNIENDFTPEEEKAVLKDYQKAFE  152



>ref|XP_008447950.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=155

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 101/158 (64%), Gaps = 10/158 (6%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  KK+ + SSDGE F++   VA +SQT+  MIEDD C +   IPLP +T  IL+ VV
Sbjct  1    MSS-SKKIVLRSSDGETFDVDEIVAVESQTIKHMIEDD-CVDT-VIPLPNVTSAILSKVV  57

Query  385  EYCKKHALTSSLRE------LKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            EYCK H  T           LK +D EF+KVD +TL DLILAA+YL IK L  LT  +++
Sbjct  58   EYCKMHVETDDKDSKVIDDTLKTWDAEFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVA  117

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  118  DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  155



>ref|XP_010433736.1| PREDICTED: SKP1-like protein 4 [Camelina sativa]
Length=172

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 100/171 (58%), Gaps = 23/171 (13%)
 Frame = -3

Query  568  TMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMV  389
            TM+S   K+ + SSDGE+FE+   VA +SQT+  MIED+  +N   IPLP +TG ILA V
Sbjct  6    TMAS--NKIILKSSDGEIFEVDEAVAVESQTIKHMIEDNCASNG--IPLPNVTGAILAKV  61

Query  388  VEYCKKHAL------------------TSSLRELKAFDDEFIKVDMDTLCDLILAADYLC  263
            +EYCKKH                     +   EL  +D EF+K+D  +L DLILAA+Y  
Sbjct  62   IEYCKKHVEAAAEAAAEADGADKDFCGNTENSELNTWDTEFLKIDQPSLFDLILAANYRN  121

Query  262  IKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I GL  LT  ++++ +  KT  E+   FNI N  +PEE E++R EN  AFE
Sbjct  122  ISGLLDLTCKAVAAQMKGKTPDEMRAHFNIKNDYSPEEEEEVRNENKWAFE  172



>gb|AII79406.1| S-phase kinase-associated protein 1-like protein 6 [Malus hupehensis]
Length=165

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 103/167 (62%), Gaps = 18/167 (11%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            M++ +K +T+ SSDGE FE+   VA +SQT+  M+EDD CA+ + IPLP +T  ILA V+
Sbjct  1    MAAEKKMITLKSSDGEAFEVDEAVAMESQTIKHMVEDD-CAD-NAIPLPNVTSHILAKVI  58

Query  385  EYCKKH------------ALTSSLRELKAFDDEF---IKVDMDTLCDLILAADYLCIKGL  251
            EYC+KH                    LK FDD+F   IK D + L DLILAA+YL IK L
Sbjct  59   EYCRKHVEGRTDGDSTDVGKIGDENTLKKFDDDFVNEIKADQNVLFDLILAANYLNIKSL  118

Query  250  AVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              LT  +++  I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  119  LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  165



>ref|NP_565123.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
 sp|Q39255.1|SKP1A_ARATH RecName: Full=SKP1-like protein 1A; Short=SKP1-like 1; AltName: 
Full=UFO-binding protein 1 [Arabidopsis thaliana]
 pdb|2P1M|A Chain A, Tir1-ask1 Complex Structure
 pdb|2P1N|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1N|D Chain D, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1O|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1P|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1Q|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|3C6N|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 pdb|3C6O|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein-Substrate 
Interactions In Auxin Perception And Signaling
 pdb|3C6P|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 pdb|3OGK|A Chain A, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|C Chain C, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|E Chain E, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|G Chain G, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|I Chain I, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|K Chain K, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|M Chain M, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|O Chain O, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGL|A Chain A, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|C Chain C, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|E Chain E, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|G Chain G, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|I Chain I, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|K Chain K, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|M Chain M, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|O Chain O, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGM|A Chain A, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|C Chain C, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|E Chain E, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|G Chain G, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|I Chain I, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|K Chain K, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|M Chain M, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|O Chain O, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 gb|AAF26761.1|AC007396_10 T4O12.17 [Arabidopsis thaliana]
 gb|AAB17535.1| homolog to Skp1p, an evolutionarily conserved kinetochore protein 
in budding yeast [Arabidopsis thaliana]
 gb|AAC14444.1| Skp1 homolog [Arabidopsis thaliana]
 gb|AAC63109.1| UIP1 [Arabidopsis thaliana]
 gb|AAL87354.1| putative SKP1/ASK1 protein At1 [Arabidopsis thaliana]
 gb|AAM45019.1| putative SKP1/ASK1 protein At1 [Arabidopsis thaliana]
 gb|AEE35780.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
Length=160

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 100/159 (63%), Gaps = 15/159 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  M+EDD   N   +PLP +T KILA V+EYCK+
Sbjct  4    KKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNG--VPLPNVTSKILAKVIEYCKR  61

Query  370  H------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            H               +S  +LKA+D +F+K+D  TL +LILAA+YL IK L  LT  ++
Sbjct  62   HVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+  TFNI N  TPEE E++RREN  AFE
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE  160



>dbj|BAE72118.1| SKP1-like protein [Silene latifolia]
Length=171

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 102/172 (59%), Gaps = 20/172 (12%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A  ++  +K+ + SSDGE F +   VA +SQT+  MIED+ CA+ + IPLP +T K L+
Sbjct  1    MAETTTTSRKIMLKSSDGENFVVDEIVALESQTIKHMIEDE-CAD-NAIPLPNVTAKTLS  58

Query  394  MVVEYCKKH-----------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYL  266
             V+EYCKKH                  +     ELK +D++F+KVD +TL D+ LAA+YL
Sbjct  59   KVIEYCKKHVNAAAAKTADTATTSTAGVAGGDDELKKWDEKFMKVDQNTLFDICLAANYL  118

Query  265  CIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             IK L  LT  +++  I N    E+ + FNI N  TPEE  +IR+E+  AFE
Sbjct  119  NIKDLLDLTCQTVADMIKNMMPEEVRKVFNITNDFTPEEEAEIRKEHQWAFE  170



>ref|XP_006302938.1| hypothetical protein CARUB_v10021077mg [Capsella rubella]
 gb|EOA35836.1| hypothetical protein CARUB_v10021077mg [Capsella rubella]
Length=159

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 100/158 (63%), Gaps = 14/158 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  M+EDD   N   +PLP +T KILA V+EYCKK
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVENG--VPLPNVTSKILAKVIEYCKK  61

Query  370  HALTSSLR-----------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMS  224
            H   ++ +           +LK +D +F+K+D  TL +LILAA+YL IK L  LT  +++
Sbjct  62   HVEAAAAKSEAVEGASTDDDLKTWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  121

Query  223  SSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              I  KT  E+  TFNI N  TPEE E++RREN  AFE
Sbjct  122  DMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE  159



>dbj|BAB85603.1| kinetochore protein [Brassica juncea]
 emb|CDX87650.1| BnaA07g32230D [Brassica napus]
Length=161

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 99/160 (62%), Gaps = 16/160 (10%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSD E FE+   VA++SQTL  M+EDD   N   IPLP +TGKILA V+EYCKK
Sbjct  4    KKIVLKSSDDESFEVDEAVARESQTLAHMVEDDCTDNG--IPLPNVTGKILAKVIEYCKK  61

Query  370  H-------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            H                 S  +LKA+D EF+ +D  TL +LILAA+YL IK L  LT  +
Sbjct  62   HVDAAAAKTEATADGGAPSDEDLKAWDAEFMNIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            ++  I  KT  E+  TFNI N  +PEE E++RREN  AFE
Sbjct  122  VADMIKGKTPDEIRTTFNIKNDFSPEEEEEVRRENQWAFE  161



>ref|XP_002878309.1| hypothetical protein ARALYDRAFT_907521 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54568.1| hypothetical protein ARALYDRAFT_907521 [Arabidopsis lyrata subsp. 
lyrata]
Length=153

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 96/155 (62%), Gaps = 9/155 (6%)
 Frame = -3

Query  556  LEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYC  377
            + K V + SSDGE F++   VA QSQT+  M+EDD C   D IP+  +TG  L+ V+EYC
Sbjct  1    MSKMVMLQSSDGESFQVEEAVAVQSQTIAHMVEDD-CVG-DGIPVSNVTGATLSKVIEYC  58

Query  376  KKH-----ALTSSLRELKAFDDEFIK-VDMDTLCDLILAADYLCIKGLAVLTSLSMSSSI  215
            KKH     +LT    ELK +D EF+K ++  TL  +ILAA+YL IK L  L   +++ +I
Sbjct  59   KKHVVAAESLTEEWDELKKWDAEFMKAMEQSTLFHVILAANYLNIKDLFDLGCQTVADTI  118

Query  214  INKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             +K   E+   F I N  TPEE E+IR++N  AFE
Sbjct  119  TDKNTDEIRALFGIRNDFTPEEEEEIRQQNQWAFE  153



>ref|XP_009106248.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
Length=161

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 98/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSD E FE+   VA++SQTL  M+EDD   N   IPLP +TGKILA V+EYCKK
Sbjct  4    KKIVLKSSDAESFEVDEAVARESQTLAHMVEDDCTDNG--IPLPNVTGKILAKVIEYCKK  61

Query  370  H-------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLS  230
            H                 S  +LKA+D EF+ +D  TL +LILAA+YL IK L  LT  +
Sbjct  62   HVDAAAAKTEATADGGAPSDEDLKAWDAEFMNIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  229  MSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +   I  KT  E+  TFNI N  +PEE E++RREN  AFE
Sbjct  122  VPDMIKGKTPDEIRTTFNIKNDFSPEEEEEVRRENQWAFE  161



>ref|XP_001690964.1| E3 ubiquitin ligase [Chlamydomonas reinhardtii]
 gb|EDP05410.1| E3 ubiquitin ligase [Chlamydomonas reinhardtii]
Length=157

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 100/156 (64%), Gaps = 13/156 (8%)
 Frame = -3

Query  547  KVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKKH  368
            KV + SSD ++FE+   VA QSQT+  ++ED     +D IPLP ++G+ILA V+EY K H
Sbjct  4    KVKLMSSDAQMFEVDEDVAFQSQTVKNLVED--AGTEDAIPLPNVSGRILAKVIEYSKYH  61

Query  367  A----------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSS  218
                        T +  ++K +DDEF+KVD  TL DLILAA+YL IKGL  LT  +++  
Sbjct  62   VEAEKKGADDKPTKTEDDVKRWDDEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVAQM  121

Query  217  IINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            I  KT  E+ +TFNI N  TPEE E++RREN  AF+
Sbjct  122  IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFD  157



>ref|XP_002453117.1| hypothetical protein SORBIDRAFT_04g000330 [Sorghum bicolor]
 gb|EES06093.1| hypothetical protein SORBIDRAFT_04g000330 [Sorghum bicolor]
Length=169

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 104/171 (61%), Gaps = 19/171 (11%)
 Frame = -3

Query  574  IATMSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILA  395
            +A+    +K +T+ SSD E FE+   VA +SQT+  MIEDD CA+ + IPLP +  KIL+
Sbjct  1    MASEGDNKKMITLRSSDNEEFEVEEAVAMESQTIRHMIEDD-CAD-NGIPLPNVNSKILS  58

Query  394  MVVEYCKKHALTSS----------------LRELKAFDDEFIKVDMDTLCDLILAADYLC  263
             V+EYC KH   ++                  +LK +D EF+KVD  TL DLILAA+YL 
Sbjct  59   KVIEYCNKHVHAAAKPAEGADANAAAAAGGGEDLKNWDAEFVKVDQATLFDLILAANYLN  118

Query  262  IKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            IKGL  LT  +++  I  KT  E+ +TFNI N  T EE ++IRREN  AFE
Sbjct  119  IKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTQEEEDEIRRENQWAFE  169



>ref|XP_009128146.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
 emb|CDY39073.1| BnaA02g17620D [Brassica napus]
Length=160

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 99/159 (62%), Gaps = 15/159 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  M+EDD   N   IPLP +T KILA V+EYCKK
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNG--IPLPNVTSKILAKVIEYCKK  61

Query  370  H------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            H               SS  +LKA+D EF+K+D  TL +LILAA+YL IK L  LT  ++
Sbjct  62   HVDAAASKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+  TFNI N  T EE E++RREN  AFE
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFTAEEEEEVRRENQWAFE  160



>emb|CDY13521.1| BnaC02g23320D [Brassica napus]
Length=160

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 99/159 (62%), Gaps = 15/159 (9%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            KK+ + SSDGE FE+   VA +SQT+  M+EDD   N   IPLP +T KILA V+EYCKK
Sbjct  4    KKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNG--IPLPNVTSKILAKVIEYCKK  61

Query  370  H------------ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSM  227
            H               SS  +LKA+D EF+K+D  TL +LILAA+YL IK L  LT  ++
Sbjct  62   HVDAAASKTDAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  226  SSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
            +  I  KT  E+  TFNI N  T EE E++RREN  AFE
Sbjct  122  ADMIKGKTPEEIRTTFNIKNDFTAEEEEEVRRENQWAFE  160



>gb|EMS45381.1| SKP1-like protein 1B [Triticum urartu]
Length=174

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 100/176 (57%), Gaps = 25/176 (14%)
 Frame = -3

Query  574  IATMSSLEKK-VTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKIL  398
            +AT+ + EKK + + S+DGE FE+   V  +SQT+  MIEDDY A+K  IP+P I  K+L
Sbjct  1    MATVEACEKKMIMLKSADGEEFEVEEAVTMESQTIRHMIEDDY-ADK-GIPIPNINSKVL  58

Query  397  AMVVEYCKKHALTSSL---------------------RELKAFDDEFIKVDMDTLCDLIL  281
            + V+EYC KH L  ++                      +LK +D EFI VD DTL +LI 
Sbjct  59   SKVIEYCNKHVLAKTVDVSSGATCATASDTMAPATLAEDLKIWDAEFINVDPDTLFELIK  118

Query  280  AADYLCIKGLAVLTSLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AF  116
             A YL IKGL  LT  + +  I  K   E+   FNI+N   PE+ E+IRREN  AF
Sbjct  119  VASYLDIKGLFDLTCQTAADMISGKPPEEIRNFFNIENDYLPEDEEKIRRENPWAF  174



>ref|XP_010061081.1| PREDICTED: SKP1-like protein 1B isoform X1 [Eucalyptus grandis]
 gb|KCW67978.1| hypothetical protein EUGRSUZ_F01672 [Eucalyptus grandis]
Length=160

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 104/163 (64%), Gaps = 15/163 (9%)
 Frame = -3

Query  565  MSSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVV  386
            MSS  +K+ + SSD E FE+ + VA + QT+  MIEDD CA  D IPLP ++ KIL+ ++
Sbjct  1    MSS-SRKIVLESSDKESFEVEVAVALECQTIKHMIEDD-CAG-DGIPLPNVSSKILSKII  57

Query  385  EYCKKHALTSSLR-----------ELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLT  239
            E+C+KH      R           ELKA+D EFIKVD  TL DLILAA+YL IKGL  LT
Sbjct  58   EFCRKHVDADRERAGSASPAAADDELKAWDAEFIKVDQATLFDLILAANYLNIKGLLDLT  117

Query  238  SLSMSSSIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              +++  I  KT  E+ ++FNI N  T EE E++RREN  AFE
Sbjct  118  CQNVADMIKGKTPEEIRKSFNIKNDFTAEEEEEVRRENQWAFE  160



>ref|XP_002885472.1| hypothetical protein ARALYDRAFT_898638 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61731.1| hypothetical protein ARALYDRAFT_898638 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   114 bits (284),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 99/151 (66%), Gaps = 7/151 (5%)
 Frame = -3

Query  550  KKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCKK  371
            K + + SSDGE FE+    A+QSQT+  +I+DD C +K+ IP+P +TGKIL+MVVEY  K
Sbjct  4    KIIKLKSSDGESFEIKEEAARQSQTIFHLIDDD-CTDKE-IPVPNVTGKILSMVVEYLNK  61

Query  370  H----ALTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSSSIINKT  203
            H    A  S+  +LK +D EF+++D  T+ DLI+AA++L IK L  LT  +++  I  +T
Sbjct  62   HHVGDANPSTDEDLKKWDAEFMQIDQSTIFDLIMAANHLNIKSLTDLTCQTVADMIKEET  121

Query  202  LPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
              ++ Q FNI+N  TPEE + + +    AFE
Sbjct  122  PKQIRQRFNIENDFTPEEEKAVLKNYQKAFE  152



>emb|CCG34083.1| SCF ubiquitin ligase [uncultured eukaryote]
Length=158

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 100/157 (64%), Gaps = 12/157 (8%)
 Frame = -3

Query  553  EKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVEYCK  374
            E KV++ SSD E+F+++  VA +SQT+  MIED   AN   IPLP ++ KIL+ V+EYCK
Sbjct  4    ESKVSLKSSDDELFDVTEAVAFESQTIKNMIEDTGTAN--AIPLPNVSSKILSKVIEYCK  61

Query  373  KHALTS---------SLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSS  221
             H             S  E+K +D EF+KVD  TL DLILAA+YL IK L  LT  +++ 
Sbjct  62   FHVEAQKPADEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVAD  121

Query  220  SIINKTLPELCQTFNIDN-LTPEEFEQIRRENH*AFE  113
             I  KT  E+ +TFNI N  TPEE E++RREN  AFE
Sbjct  122  MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE  158



>ref|XP_008347749.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
Length=196

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 92/152 (61%), Gaps = 9/152 (6%)
 Frame = -3

Query  562  SSLEKKVTVSSSDGEVFELSLTVAQQSQTLNRMIEDDYCANKDCIPLPKITGKILAMVVE  383
            +S  +K+T++SS  E+FE+   VA +SQT+  M+ED  CA  + IPLP +T  ILA V+E
Sbjct  47   TSAGQKITLNSSGSEMFEVEEAVAMESQTIKHMVEDG-CAG-NTIPLPNVTSAILAKVIE  104

Query  382  YCKKHA------LTSSLRELKAFDDEFIKVDMDTLCDLILAADYLCIKGLAVLTSLSMSS  221
            YC KH        T      K +D EFIK++ +TL DLI+AA+YL IKGL  LT   +  
Sbjct  105  YCTKHREEGXAIATDXENNFKEWDAEFIKINQNTLYDLIMAANYLNIKGLLDLTCQIVVD  164

Query  220  SIINKTLPELCQTFNIDN-LTPEEFEQIRREN  128
             I  K   E+ + FNI N   P+E E+I REN
Sbjct  165  XIKGKAPEEIRKMFNIKNDFAPKEEEKIHREN  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 984917279386