BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20252_g2_i1 len=1757 path=[3177:0-368 3546:369-697 553:698-721
577:722-1508 6310:1509-1527 1383:1528-1756]

Length=1757
                                                                      Score     E

ref|XP_006353504.1|  PREDICTED: uncharacterized protein LOC102579879    608   0.0      
ref|XP_009766756.1|  PREDICTED: uncharacterized protein LOC104218054    607   0.0      
ref|XP_004251646.1|  PREDICTED: uncharacterized protein LOC101262285    603   0.0      
ref|XP_011078236.1|  PREDICTED: uncharacterized protein LOC105162032    602   0.0      
ref|XP_009602498.1|  PREDICTED: uncharacterized protein LOC104097612    602   0.0      
ref|XP_011093657.1|  PREDICTED: uncharacterized protein LOC105173566    600   0.0      
ref|XP_009597038.1|  PREDICTED: uncharacterized protein LOC104093034    594   0.0      
ref|XP_002283391.1|  PREDICTED: uncharacterized protein LOC100245695    593   0.0      Vitis vinifera
ref|XP_009757179.1|  PREDICTED: uncharacterized protein LOC104210073    593   0.0      
emb|CDP03235.1|  unnamed protein product                                583   0.0      
gb|KGN60567.1|  hypothetical protein Csa_2G000750                       578   0.0      
ref|XP_008458969.1|  PREDICTED: uncharacterized protein LOC103498220    577   0.0      
gb|KDP33775.1|  hypothetical protein JCGZ_07346                         575   0.0      
ref|XP_004141026.1|  PREDICTED: uncharacterized protein LOC101219082    574   0.0      
gb|KHG29270.1|  hypothetical protein F383_14119                         571   0.0      
ref|XP_007012983.1|  Uncharacterized protein TCM_037753                 567   0.0      
ref|XP_002514196.1|  conserved hypothetical protein                     564   0.0      Ricinus communis
ref|XP_008387423.1|  PREDICTED: uncharacterized protein LOC103449874    560   0.0      
ref|XP_010110868.1|  hypothetical protein L484_006983                   554   0.0      
ref|XP_007202154.1|  hypothetical protein PRUPE_ppa006267mg             554   0.0      
ref|XP_010249469.1|  PREDICTED: uncharacterized protein LOC104592027    552   0.0      
ref|XP_008242466.1|  PREDICTED: uncharacterized protein LOC103340798    548   0.0      
ref|XP_010049600.1|  PREDICTED: uncharacterized protein LOC104438202    543   0.0      
ref|XP_004287493.1|  PREDICTED: uncharacterized protein LOC101301714    539   0.0      
ref|XP_010688362.1|  PREDICTED: uncharacterized protein LOC104902329    536   0.0      
gb|KHG26934.1|  hypothetical protein F383_08453                         536   0.0      
ref|XP_009352575.1|  PREDICTED: uncharacterized protein LOC103943924    535   0.0      
ref|XP_006412853.1|  hypothetical protein EUTSA_v10025288mg             535   0.0      
ref|XP_010433108.1|  PREDICTED: uncharacterized protein LOC104717264    533   0.0      
ref|XP_010438312.1|  PREDICTED: uncharacterized protein LOC104721933    533   0.0      
ref|XP_008337614.1|  PREDICTED: uncharacterized protein LOC103400735    530   0.0      
ref|XP_010526420.1|  PREDICTED: uncharacterized protein LOC104803996    528   3e-180   
ref|XP_002867413.1|  hypothetical protein ARALYDRAFT_913577             528   3e-180   
gb|KFK29490.1|  hypothetical protein AALP_AA7G141200                    527   5e-180   
ref|NP_194660.1|  uncharacterized protein                               524   1e-178   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283793.1|  hypothetical protein CARUB_v10004884mg             522   6e-178   
emb|CDY48610.1|  BnaA01g07550D                                          522   7e-178   
emb|CDY06823.1|  BnaC01g09220D                                          520   6e-177   
emb|CBI27979.3|  unnamed protein product                                518   9e-177   
ref|XP_010447867.1|  PREDICTED: uncharacterized protein LOC104730404    521   1e-176   
ref|XP_009128862.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    515   3e-175   
ref|XP_007160272.1|  hypothetical protein PHAVU_002G307300g             514   5e-175   
ref|XP_010267102.1|  PREDICTED: uncharacterized protein LOC104604464    514   1e-174   
ref|XP_003525292.1|  PREDICTED: uncharacterized protein LOC100785838    513   4e-174   
ref|XP_003516376.1|  PREDICTED: uncharacterized protein LOC100805866    512   8e-174   
ref|XP_003530182.1|  PREDICTED: uncharacterized protein LOC100790306    508   2e-172   
ref|XP_007152956.1|  hypothetical protein PHAVU_004G174300g             498   1e-168   
gb|KDO55858.1|  hypothetical protein CISIN_1g017474mg                   495   3e-168   
ref|XP_003530524.1|  PREDICTED: uncharacterized protein LOC100811...    494   4e-167   
ref|XP_010539384.1|  PREDICTED: uncharacterized protein LOC104813482    493   2e-166   
emb|CAN70307.1|  hypothetical protein VITISV_026399                     484   5e-164   Vitis vinifera
ref|XP_003620756.1|  hypothetical protein MTR_6g090060                  481   1e-161   
ref|XP_006451341.1|  hypothetical protein CICLE_v10008480mg             464   2e-155   
ref|XP_010924447.1|  PREDICTED: uncharacterized protein LOC105047284    460   2e-153   
ref|XP_008799780.1|  PREDICTED: uncharacterized protein LOC103714350    452   1e-150   
ref|XP_004503501.1|  PREDICTED: uncharacterized protein LOC101489321    447   9e-149   
ref|XP_010915009.1|  PREDICTED: uncharacterized protein LOC105040251    443   1e-146   
ref|XP_008795504.1|  PREDICTED: uncharacterized protein LOC103711219    435   2e-143   
ref|XP_009410899.1|  PREDICTED: uncharacterized protein LOC103992782    433   1e-142   
ref|XP_009395733.1|  PREDICTED: uncharacterized protein LOC103980924    429   2e-141   
ref|XP_009416467.1|  PREDICTED: uncharacterized protein LOC103997060    429   3e-141   
ref|XP_006356806.1|  PREDICTED: uncharacterized protein LOC102599523    424   3e-139   
ref|XP_002510019.1|  conserved hypothetical protein                     422   2e-138   Ricinus communis
ref|XP_009759768.1|  PREDICTED: uncharacterized protein LOC104212246    422   2e-138   
ref|XP_004238051.1|  PREDICTED: uncharacterized protein LOC101246921    422   2e-138   
ref|XP_009595727.1|  PREDICTED: uncharacterized protein LOC104091979    419   2e-137   
ref|XP_008466095.1|  PREDICTED: uncharacterized protein LOC103503621    419   4e-137   
ref|XP_002285542.1|  PREDICTED: uncharacterized protein LOC100245533    418   4e-137   Vitis vinifera
ref|XP_004136235.1|  PREDICTED: uncharacterized protein LOC101220969    418   6e-137   
emb|CAN62368.1|  hypothetical protein VITISV_001847                     418   7e-137   Vitis vinifera
gb|KDP41556.1|  hypothetical protein JCGZ_15963                         417   2e-136   
ref|XP_002301131.1|  hypothetical protein POPTR_0002s11320g             416   5e-136   Populus trichocarpa [western balsam poplar]
ref|XP_009406176.1|  PREDICTED: uncharacterized protein LOC103989135    415   9e-136   
ref|XP_008352747.1|  PREDICTED: uncharacterized protein LOC103416271    414   3e-135   
ref|XP_010061596.1|  PREDICTED: uncharacterized protein LOC104449221    414   3e-135   
ref|XP_010104534.1|  hypothetical protein L484_025508                   412   7e-135   
ref|XP_011017042.1|  PREDICTED: uncharacterized protein LOC105120505    412   1e-134   
ref|XP_007018388.1|  Formin-like protein 18                             412   2e-134   
ref|XP_009357220.1|  PREDICTED: uncharacterized protein LOC103947956    410   6e-134   
ref|XP_011074314.1|  PREDICTED: uncharacterized protein LOC105159071    410   8e-134   
ref|XP_010943312.1|  PREDICTED: uncharacterized protein LOC105061065    409   1e-133   
gb|EYU36412.1|  hypothetical protein MIMGU_mgv1a006276mg                409   2e-133   
ref|XP_008339055.1|  PREDICTED: uncharacterized protein LOC103402092    409   3e-133   
ref|XP_008776853.1|  PREDICTED: uncharacterized protein LOC103696910    408   4e-133   
ref|XP_011078480.1|  PREDICTED: uncharacterized protein LOC105162206    408   5e-133   
emb|CDP00983.1|  unnamed protein product                                406   7e-132   
ref|XP_008219142.1|  PREDICTED: uncharacterized protein LOC103319390    405   8e-132   
ref|XP_007222135.1|  hypothetical protein PRUPE_ppa005719mg             403   4e-131   
ref|XP_006852767.1|  hypothetical protein AMTR_s00033p00137950          403   7e-131   
ref|XP_007137270.1|  hypothetical protein PHAVU_009G113400g             402   1e-130   
ref|XP_008801663.1|  PREDICTED: uncharacterized protein LOC103715709    401   1e-130   
ref|XP_004299850.1|  PREDICTED: uncharacterized protein LOC101308766    401   2e-130   
ref|XP_003603662.1|  hypothetical protein MTR_3g110630                  401   3e-130   
ref|XP_002306517.2|  hypothetical protein POPTR_0005s19380g             401   3e-130   Populus trichocarpa [western balsam poplar]
ref|XP_010941977.1|  PREDICTED: uncharacterized protein LOC105060083    400   7e-130   
ref|XP_010245617.1|  PREDICTED: uncharacterized protein LOC104589117    398   3e-129   
ref|XP_003526511.1|  PREDICTED: uncharacterized protein LOC100805268    398   5e-129   
ref|XP_003522725.1|  PREDICTED: uncharacterized protein LOC100775...    394   2e-127   
ref|XP_011011605.1|  PREDICTED: uncharacterized protein LOC105116107    393   4e-127   
ref|XP_009335470.1|  PREDICTED: uncharacterized protein LOC103928190    391   2e-126   
ref|XP_010544039.1|  PREDICTED: uncharacterized protein LOC104816779    391   4e-126   
ref|XP_004501082.1|  PREDICTED: uncharacterized protein LOC101496773    389   2e-125   
ref|XP_010692653.1|  PREDICTED: uncharacterized protein LOC104905738    389   3e-125   
gb|EYU34216.1|  hypothetical protein MIMGU_mgv1a006107mg                386   2e-124   
emb|CDY63745.1|  BnaC05g07770D                                          385   3e-124   
ref|XP_009399078.1|  PREDICTED: uncharacterized protein LOC103983571    384   3e-123   
emb|CDY57930.1|  BnaA06g37990D                                          380   3e-122   
ref|NP_172473.1|  uncharacterized protein                               379   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458327.1|  PREDICTED: uncharacterized protein LOC104739...    379   1e-121   
ref|XP_010490593.1|  PREDICTED: uncharacterized protein LOC104768341    379   2e-121   
ref|XP_003557619.1|  PREDICTED: uncharacterized protein LOC100825031    378   4e-121   
gb|EPS64751.1|  hypothetical protein M569_10025                         377   1e-120   
ref|XP_006417503.1|  hypothetical protein EUTSA_v10007581mg             377   1e-120   
ref|XP_006307457.1|  hypothetical protein CARUB_v10009083mg             377   1e-120   
dbj|BAF00981.1|  hypothetical protein                                   377   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144481.1|  PREDICTED: uncharacterized protein LOC103868126    375   2e-120   
ref|XP_010266771.1|  PREDICTED: uncharacterized protein LOC104604209    375   3e-120   
emb|CDY31054.1|  BnaA08g26040D                                          375   3e-120   
ref|XP_010458326.1|  PREDICTED: uncharacterized protein LOC104739...    375   4e-120   
gb|KFK43302.1|  hypothetical protein AALP_AA1G106600                    375   6e-120   
dbj|BAJ89011.1|  predicted protein                                      373   2e-119   
ref|NP_001058837.1|  Os07g0133500                                       373   4e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002892543.1|  hypothetical protein ARALYDRAFT_888260             372   5e-119   
ref|XP_009148322.1|  PREDICTED: uncharacterized protein LOC103871783    372   6e-119   
gb|EAZ02678.1|  hypothetical protein OsI_24791                          372   1e-118   Oryza sativa Indica Group [Indian rice]
emb|CDY20666.1|  BnaC08g13920D                                          369   6e-118   
gb|EAY75765.1|  hypothetical protein OsI_03678                          363   2e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_009407691.1|  PREDICTED: uncharacterized protein LOC103990325    362   6e-115   
ref|XP_008372951.1|  PREDICTED: uncharacterized protein LOC103436305    362   8e-115   
dbj|BAJ91729.1|  predicted protein                                      360   1e-114   
emb|CDM84004.1|  unnamed protein product                                360   1e-114   
ref|XP_004955420.1|  PREDICTED: uncharacterized protein LOC101777215    358   3e-113   
emb|CBI19337.3|  unnamed protein product                                358   3e-113   
ref|XP_004969897.1|  PREDICTED: uncharacterized protein LOC101784603    355   1e-112   
ref|XP_010232287.1|  PREDICTED: uncharacterized protein LOC100822437    354   4e-112   
gb|KHG07926.1|  hypothetical protein F383_34968                         354   5e-112   
ref|XP_010095633.1|  hypothetical protein L484_003734                   353   6e-112   
ref|XP_009408582.1|  PREDICTED: uncharacterized protein LOC103990981    353   1e-111   
ref|XP_002456333.1|  hypothetical protein SORBIDRAFT_03g034120          350   2e-110   Sorghum bicolor [broomcorn]
ref|XP_006486865.1|  PREDICTED: uncharacterized protein LOC102617316    350   3e-110   
ref|XP_002274843.1|  PREDICTED: uncharacterized protein LOC100254836    347   8e-110   Vitis vinifera
gb|KDO49502.1|  hypothetical protein CISIN_1g012226mg                   349   8e-110   
ref|XP_004292055.1|  PREDICTED: uncharacterized protein LOC101308741    348   8e-110   
ref|XP_006422727.1|  hypothetical protein CICLE_v10028366mg             348   1e-109   
emb|CBI25109.3|  unnamed protein product                                346   4e-109   
ref|XP_008454429.1|  PREDICTED: uncharacterized protein LOC103494838    347   4e-109   
ref|XP_002522078.1|  conserved hypothetical protein                     346   6e-109   Ricinus communis
dbj|BAJ85980.1|  predicted protein                                      340   2e-107   
ref|XP_003558723.1|  PREDICTED: uncharacterized protein LOC100826176    340   1e-106   
ref|XP_007041415.1|  Gb:AAC34331.1                                      338   7e-106   
gb|KDP37617.1|  hypothetical protein JCGZ_06960                         338   7e-106   
ref|XP_004150270.1|  PREDICTED: uncharacterized protein LOC101221491    338   7e-106   
ref|NP_001141500.1|  uncharacterized protein LOC100273612               337   1e-105   Zea mays [maize]
gb|KGN52731.1|  hypothetical protein Csa_4G000030                       337   3e-105   
ref|XP_011002550.1|  PREDICTED: uncharacterized protein LOC105109515    336   4e-105   
ref|NP_001143291.1|  hypothetical protein                               335   1e-104   Zea mays [maize]
ref|XP_004156872.1|  PREDICTED: uncharacterized LOC101221491            335   2e-104   
ref|XP_002313199.1|  hypothetical protein POPTR_0009s08730g             334   3e-104   Populus trichocarpa [western balsam poplar]
ref|XP_002298796.1|  hypothetical protein POPTR_0001s29590g             332   2e-103   Populus trichocarpa [western balsam poplar]
gb|EAY92004.1|  hypothetical protein OsI_13693                          326   2e-101   Oryza sativa Indica Group [Indian rice]
gb|EAZ28736.1|  hypothetical protein OsJ_12756                          326   3e-101   Oryza sativa Japonica Group [Japonica rice]
gb|AET05166.2|  DUF1005 family protein                                  323   3e-101   
gb|ACF82838.1|  unknown                                                 325   5e-101   Zea mays [maize]
ref|XP_011030280.1|  PREDICTED: uncharacterized protein LOC105129770    325   9e-101   
ref|XP_004981601.1|  PREDICTED: uncharacterized protein LOC101765126    324   1e-100   
tpg|DAA51652.1|  TPA: hypothetical protein ZEAMMB73_809833              324   1e-100   
ref|NP_001051414.1|  Os03g0773000                                       324   1e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002461423.1|  hypothetical protein SORBIDRAFT_02g002380          325   2e-100   Sorghum bicolor [broomcorn]
ref|XP_002980096.1|  hypothetical protein SELMODRAFT_111932             323   4e-100   
ref|XP_002992680.1|  hypothetical protein SELMODRAFT_135747             322   9e-100   
gb|ACG44256.1|  hypothetical protein                                    321   1e-99    Zea mays [maize]
ref|XP_002463817.1|  hypothetical protein SORBIDRAFT_01g006730          320   3e-99    Sorghum bicolor [broomcorn]
ref|XP_008236238.1|  PREDICTED: uncharacterized protein LOC103335027    317   5e-98    
emb|CDX95423.1|  BnaC01g33150D                                          317   1e-97    
tpg|DAA51653.1|  TPA: hypothetical protein ZEAMMB73_809833              325   1e-97    
emb|CDO97321.1|  unnamed protein product                                315   3e-97    
ref|XP_007201076.1|  hypothetical protein PRUPE_ppa006838mg             313   4e-97    
ref|XP_002962295.1|  hypothetical protein SELMODRAFT_77561              314   6e-97    
ref|XP_004157897.1|  PREDICTED: uncharacterized LOC101219082            306   8e-97    
ref|XP_002965215.1|  hypothetical protein SELMODRAFT_230537             314   9e-97    
ref|XP_008671026.1|  PREDICTED: uncharacterized protein LOC103648311    314   1e-96    
ref|XP_006658256.1|  PREDICTED: uncharacterized protein LOC102703230    310   3e-96    
ref|XP_004511326.1|  PREDICTED: uncharacterized protein LOC101500065    310   1e-95    
gb|KHG13181.1|  hypothetical protein F383_01774                         309   7e-95    
emb|CDY51694.1|  BnaA05g36810D                                          308   3e-94    
ref|XP_006406471.1|  hypothetical protein EUTSA_v10020590mg             308   8e-94    
ref|XP_009605701.1|  PREDICTED: uncharacterized protein LOC104100222    306   1e-93    
ref|XP_009111603.1|  PREDICTED: uncharacterized protein LOC103837023    306   2e-93    
gb|AFW87787.1|  hypothetical protein ZEAMMB73_393258                    305   4e-93    
emb|CDY24620.1|  BnaC05g33040D                                          305   4e-93    
ref|XP_009145758.1|  PREDICTED: uncharacterized protein LOC103869426    305   5e-93    
ref|XP_010557540.1|  PREDICTED: uncharacterized protein LOC104826503    303   3e-92    
gb|EYU30689.1|  hypothetical protein MIMGU_mgv1a0070432mg               294   4e-92    
ref|XP_009761264.1|  PREDICTED: uncharacterized protein LOC104213456    300   3e-91    
ref|XP_011092476.1|  PREDICTED: uncharacterized protein LOC105172657    298   1e-90    
ref|XP_011088149.1|  PREDICTED: uncharacterized protein LOC105169457    297   2e-90    
tpg|DAA59484.1|  TPA: hypothetical protein ZEAMMB73_809167              296   9e-90    
ref|XP_009801206.1|  PREDICTED: uncharacterized protein LOC104246980    292   2e-88    
ref|XP_006297520.1|  hypothetical protein CARUB_v10013544mg             293   3e-88    
gb|AAL60032.1|  unknown protein                                         293   6e-88    Arabidopsis thaliana [mouse-ear cress]
ref|NP_188602.1|  uncharacterized protein                               292   9e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487913.1|  PREDICTED: uncharacterized protein LOC104765839    292   2e-87    
ref|XP_010466129.1|  PREDICTED: uncharacterized protein LOC104746366    291   2e-87    
ref|XP_010030891.1|  PREDICTED: uncharacterized protein LOC104420809    291   2e-87    
ref|XP_006307458.1|  hypothetical protein CARUB_v10009084mg             289   6e-87    
ref|XP_009381291.1|  PREDICTED: uncharacterized protein LOC103969480    288   8e-87    
gb|AAP68894.1|  unknown protein                                         287   9e-87    Oryza sativa Japonica Group [Japonica rice]
gb|KFK39297.1|  hypothetical protein AALP_AA3G226300                    289   1e-86    
ref|XP_004173988.1|  PREDICTED: uncharacterized protein LOC101228095    280   1e-86    
ref|XP_008367920.1|  PREDICTED: uncharacterized protein LOC103431533    280   2e-86    
ref|XP_010042246.1|  PREDICTED: uncharacterized protein LOC104431287    283   2e-86    
gb|KCW56839.1|  hypothetical protein EUGRSUZ_I02507                     286   2e-86    
ref|XP_010541837.1|  PREDICTED: uncharacterized protein LOC104815217    288   4e-86    
ref|XP_002883199.1|  hypothetical protein ARALYDRAFT_479485             288   5e-86    
ref|XP_004230673.1|  PREDICTED: uncharacterized protein LOC101258701    285   1e-85    
ref|XP_006646307.1|  PREDICTED: uncharacterized protein LOC102706623    282   2e-85    
ref|XP_007157186.1|  hypothetical protein PHAVU_002G049700g             282   6e-85    
ref|XP_008777938.1|  PREDICTED: uncharacterized protein LOC103697788    282   1e-84    
ref|XP_009610822.1|  PREDICTED: uncharacterized protein LOC104104441    282   2e-84    
dbj|BAJ89116.1|  predicted protein                                      278   2e-84    
ref|XP_001760212.1|  predicted protein                                  280   5e-84    
ref|XP_006393185.1|  hypothetical protein EUTSA_v10011462mg             281   6e-84    
ref|XP_006355293.1|  PREDICTED: uncharacterized protein LOC102593921    278   3e-83    
ref|XP_003610647.1|  hypothetical protein MTR_5g005420                  277   6e-83    
gb|AFK43684.1|  unknown                                                 277   7e-83    
ref|XP_010275162.1|  PREDICTED: uncharacterized protein LOC104610306    277   1e-82    
ref|XP_010691530.1|  PREDICTED: uncharacterized protein LOC104904833    278   1e-82    
gb|EYU37533.1|  hypothetical protein MIMGU_mgv1a018154mg                277   1e-82    
ref|XP_002891552.1|  predicted protein                                  277   2e-82    
ref|XP_010266416.1|  PREDICTED: uncharacterized protein LOC104603937    276   2e-82    
ref|XP_010056513.1|  PREDICTED: uncharacterized protein LOC104444526    275   9e-82    
ref|XP_010905311.1|  PREDICTED: uncharacterized protein LOC105032546    274   2e-81    
ref|XP_010420061.1|  PREDICTED: uncharacterized protein DDB_G0271...    274   4e-81    
ref|XP_002268337.1|  PREDICTED: uncharacterized protein LOC100245378    271   1e-80    Vitis vinifera
ref|XP_010478443.1|  PREDICTED: uncharacterized protein LOC104757404    272   2e-80    
ref|XP_010500559.1|  PREDICTED: uncharacterized protein LOC104777930    272   2e-80    
gb|EPS68322.1|  hypothetical protein M569_06448                         271   2e-80    
ref|XP_010461856.1|  PREDICTED: uncharacterized protein LOC104742540    269   4e-79    
ref|NP_175426.1|  uncharacterized protein                               268   6e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008460086.1|  PREDICTED: uncharacterized protein LOC103499002    266   9e-79    
emb|CAN65847.1|  hypothetical protein VITISV_014976                     265   4e-78    Vitis vinifera
ref|XP_004145014.1|  PREDICTED: uncharacterized protein LOC101209874    265   4e-78    
ref|XP_002319218.1|  hypothetical protein POPTR_0013s06840g             265   5e-78    Populus trichocarpa [western balsam poplar]
ref|XP_011086622.1|  PREDICTED: uncharacterized protein LOC105168293    264   1e-77    
ref|XP_010097676.1|  hypothetical protein L484_023816                   264   1e-77    
gb|KDP39605.1|  hypothetical protein JCGZ_02625                         263   2e-77    
gb|KHG03019.1|  Wilms tumor                                             261   1e-76    
emb|CDP16208.1|  unnamed protein product                                261   2e-76    
gb|EYU27182.1|  hypothetical protein MIMGU_mgv1a006729mg                260   2e-76    
gb|EYU30690.1|  hypothetical protein MIMGU_mgv1a0070431mg               252   3e-76    
ref|XP_008232195.1|  PREDICTED: uncharacterized protein LOC103331357    260   3e-76    
ref|XP_007218028.1|  hypothetical protein PRUPE_ppa005972mg             259   4e-76    
ref|XP_008345095.1|  PREDICTED: uncharacterized protein LOC103407996    260   7e-76    
gb|ACF84078.1|  unknown                                                 255   2e-75    Zea mays [maize]
ref|XP_007029857.1|  Nuclear factor 1 A-type isoform 2                  257   3e-75    
ref|XP_002523978.1|  conserved hypothetical protein                     257   4e-75    Ricinus communis
ref|XP_006437344.1|  hypothetical protein CICLE_v10031611mg             257   4e-75    
ref|XP_009627129.1|  PREDICTED: uncharacterized protein LOC104117749    256   5e-75    
ref|XP_004307193.1|  PREDICTED: uncharacterized protein LOC101307926    257   6e-75    
ref|XP_001778621.1|  predicted protein                                  256   8e-75    
ref|XP_003521028.1|  PREDICTED: uncharacterized protein LOC100815...    256   1e-74    
ref|XP_009761711.1|  PREDICTED: uncharacterized protein LOC104213860    255   1e-74    
ref|XP_009361368.1|  PREDICTED: uncharacterized protein LOC103951663    256   2e-74    
gb|KHG10101.1|  Mitochondrial inner membrane protease subunit 1         254   5e-74    
ref|XP_009345575.1|  PREDICTED: uncharacterized protein LOC103937356    253   1e-73    
ref|XP_001754636.1|  predicted protein                                  253   1e-73    
ref|XP_007029856.1|  Nuclear factor 1 A-type isoform 1                  254   2e-73    
ref|XP_007134346.1|  hypothetical protein PHAVU_010G039800g             253   2e-73    
gb|KHN40365.1|  hypothetical protein glysoja_000863                     243   9e-73    
ref|XP_004510160.1|  PREDICTED: uncharacterized protein LOC101490...    250   2e-72    
ref|XP_003529004.1|  PREDICTED: uncharacterized protein LOC100788...    249   4e-72    
ref|XP_010324887.1|  PREDICTED: uncharacterized protein LOC101268299    248   8e-72    
ref|XP_009619401.1|  PREDICTED: uncharacterized protein LOC104111412    248   8e-72    
ref|XP_009786623.1|  PREDICTED: uncharacterized protein LOC104234713    248   1e-71    
ref|XP_009398606.1|  PREDICTED: uncharacterized protein LOC103983151    248   2e-71    
ref|XP_006346697.1|  PREDICTED: uncharacterized protein LOC102596535    247   2e-71    
gb|KHN16657.1|  hypothetical protein glysoja_002754                     237   2e-70    
gb|KEH18002.1|  stress-induced protein, putative                        243   9e-70    
gb|EYU42265.1|  hypothetical protein MIMGU_mgv1a007286mg                241   2e-69    
gb|KHM99820.1|  hypothetical protein glysoja_017518                     234   2e-69    
ref|XP_006359111.1|  PREDICTED: uncharacterized protein LOC102583...    241   3e-69    
ref|XP_006400305.1|  hypothetical protein EUTSA_v10013602mg             241   7e-69    
ref|XP_006289579.1|  hypothetical protein CARUB_v10003124mg             239   3e-68    
ref|XP_004229535.1|  PREDICTED: uncharacterized protein LOC101261157    239   3e-68    
ref|XP_010492723.1|  PREDICTED: uncharacterized protein LOC104770072    238   5e-68    
ref|XP_010420495.1|  PREDICTED: uncharacterized protein LOC104706...    238   9e-68    
ref|XP_010420494.1|  PREDICTED: uncharacterized protein LOC104706...    238   9e-68    
ref|XP_010453965.1|  PREDICTED: uncharacterized protein LOC104735808    237   1e-67    
ref|XP_009792899.1|  PREDICTED: uncharacterized protein LOC104239868    235   1e-67    
ref|NP_197266.1|  uncharacterized protein                               237   1e-67    
ref|XP_002873840.1|  hypothetical protein ARALYDRAFT_909762             237   2e-67    
gb|KFK25983.1|  hypothetical protein AALP_AA8G187900                    237   2e-67    
ref|XP_009108354.1|  PREDICTED: uncharacterized protein LOC103834048    236   5e-67    
ref|NP_001061067.1|  Os08g0163500                                       234   1e-66    
emb|CDY35490.1|  BnaA01g24220D                                          234   2e-66    
gb|ACN28488.1|  unknown                                                 234   2e-66    
ref|XP_009107533.1|  PREDICTED: uncharacterized protein LOC103833189    233   4e-66    
emb|CDY16904.1|  BnaC09g40310D                                          233   7e-66    
ref|XP_002443918.1|  hypothetical protein SORBIDRAFT_07g004370          232   1e-65    
emb|CAJ19269.1|  putative stress-induced protein                        231   2e-65    
emb|CDY28137.1|  BnaC06g03180D                                          229   6e-65    
ref|XP_003630690.1|  hypothetical protein MTR_8g102270                  220   5e-64    
ref|XP_010549738.1|  PREDICTED: uncharacterized protein LOC104820818    222   5e-62    
ref|NP_001044201.1|  Os01g0740400                                       215   9e-61    
emb|CDY40836.1|  BnaC01g31200D                                          217   1e-60    
ref|XP_010327488.1|  PREDICTED: uncharacterized protein LOC101263856    210   5e-59    
dbj|BAJ98408.1|  predicted protein                                      212   3e-58    
ref|XP_011004940.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    208   5e-57    
ref|NP_001183106.1|  uncharacterized protein LOC100501471               194   2e-53    
ref|XP_002970044.1|  hypothetical protein SELMODRAFT_440968             199   4e-53    
ref|XP_003573437.1|  PREDICTED: uncharacterized protein LOC100828811    184   5e-48    
ref|XP_002985234.1|  hypothetical protein SELMODRAFT_234693             174   3e-44    
emb|CDY42200.1|  BnaA01g25950D                                          166   5e-44    
gb|ACV88395.1|  putative stress-induced protein                         166   1e-43    
gb|EMT00514.1|  hypothetical protein F775_52390                         154   1e-39    
ref|XP_006853722.1|  hypothetical protein AMTR_s00056p00161450          152   3e-39    
ref|XP_003630691.1|  hypothetical protein MTR_8g102280                  151   4e-39    
emb|CDY48608.1|  BnaA01g07570D                                          148   3e-38    
ref|XP_010327489.1|  PREDICTED: uncharacterized protein LOC101265079    149   5e-38    
gb|EMT09909.1|  hypothetical protein F775_29267                         137   2e-34    
gb|EAZ13484.1|  hypothetical protein OsJ_03399                          135   2e-33    
gb|AAM62635.1|  unknown                                                 133   3e-32    
ref|XP_006659865.1|  PREDICTED: uncharacterized protein LOC102704909    135   5e-32    
ref|NP_001143250.1|  uncharacterized protein LOC100275778               131   6e-32    
ref|XP_006853723.1|  hypothetical protein AMTR_s00056p00161630          127   4e-29    
gb|AFK46956.1|  unknown                                                 122   2e-28    
emb|CDX82283.1|  BnaA03g35380D                                          118   8e-27    
gb|AIE44355.1|  putative stress-induced protein                       87.0    1e-16    
gb|AIE44359.1|  DUF1005 protein                                       87.0    2e-16    
gb|AIE44349.1|  putative stress-induced protein                       87.0    2e-16    
gb|EAZ13483.1|  hypothetical protein OsJ_03398                        84.7    1e-15    
gb|KHN30446.1|  hypothetical protein glysoja_033184                   82.4    4e-14    
gb|EMT05408.1|  hypothetical protein F775_19846                       76.3    3e-12    
ref|XP_008659476.1|  PREDICTED: uncharacterized protein LOC103638...  73.6    2e-11    
gb|AFW86416.1|  hypothetical protein ZEAMMB73_636711                  74.3    3e-11    
ref|XP_008671851.1|  PREDICTED: uncharacterized protein LOC103649328  70.9    8e-11    
ref|XP_010096462.1|  Ribonucleoside-diphosphate reductase large s...  75.5    8e-11    
ref|XP_006651858.1|  PREDICTED: uncharacterized protein LOC102704326  68.9    4e-10    
ref|XP_008675638.1|  PREDICTED: uncharacterized protein LOC103651713  68.2    1e-09    
ref|XP_008657846.1|  PREDICTED: uncharacterized protein LOC103637426  61.2    5e-07    
emb|CBI40002.3|  unnamed protein product                              52.0    2e-04    
ref|XP_002448303.1|  hypothetical protein SORBIDRAFT_06g024940        52.0    0.001    



>ref|XP_006353504.1| PREDICTED: uncharacterized protein LOC102579879 [Solanum tuberosum]
Length=423

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/426 (73%), Positives = 357/426 (84%), Gaps = 13/426 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP-SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDPCPFVRLIIES+A+KLP +ATK A  G+HPS+TPCYAKLK  +FP+QT +LPL    P
Sbjct  1     MDPCPFVRLIIESLALKLPLTATKSASHGIHPSSTPCYAKLKLKNFPTQTTILPLS---P  57

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMG-QTCGITSGKLLGVVQ  1214
               D+ SP +S AS  GFHLD +ALRRLS KP+ L +SVF GRMG + CG+TSGKL+G VQ
Sbjct  58    NSDTQSPPESAASVTGFHLDAAALRRLSAKPITLTVSVFTGRMGGRACGVTSGKLMGSVQ  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGG---ADKP--MLHVVVRSEPDPRFVFQFGGEPECS  1049
             V+VDLSG  S+  VFQ+GW KLG       DKP  MLH+ VR++PDPRFVFQFGGEPECS
Sbjct  118   VSVDLSGTHSKGRVFQNGWMKLGATAMAEKDKPVAMLHIAVRAQPDPRFVFQFGGEPECS  177

Query  1048  PVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWM  869
             PVVFQIQG+IRQPVFSCKFSA+RNNR+RSLP+DF+LN+RGWMRTFSG+RDR G+ERKGWM
Sbjct  178   PVVFQIQGNIRQPVFSCKFSADRNNRSRSLPTDFNLNNRGWMRTFSGERDRTGRERKGWM  237

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             IIIYDLSGS+VAAASMITPFVPSPGSDRVSRSN GAWLILRPNG  VSSWK WGRL+AWR
Sbjct  238   IIIYDLSGSAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGACVSSWKHWGRLQAWR  297

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA-SSLSPVRGFV  512
             ERG VDGLGYKFELVTD G TS IPIAEG M++KKGG+FCIDN  K +A S+ SP+RGFV
Sbjct  298   ERGPVDGLGYKFELVTDTGLTSTIPIAEGTMSMKKGGQFCIDNTVKDTALSTNSPIRGFV  357

Query  511   MCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
             M S+VEG+    +  VQV V HV CMADAALF+ALSAAIDLSMDAC+LFS KLRKE CHD
Sbjct  358   MVSNVEGEGKISTPMVQVGVQHVTCMADAALFIALSAAIDLSMDACRLFSQKLRKELCHD  417

Query  337   EHDSYF  320
             + +SYF
Sbjct  418   DQESYF  423



>ref|XP_009766756.1| PREDICTED: uncharacterized protein LOC104218054 [Nicotiana sylvestris]
Length=418

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/420 (77%), Positives = 361/420 (86%), Gaps = 8/420 (2%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG--VHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRLIIES+A+KLP+ATKPAG G  VHP +TPCYAKLK  +FPSQTA+LPLCS  
Sbjct  1     MDPCPFVRLIIESLALKLPTATKPAGSGSGVHPCSTPCYAKLKLKNFPSQTAILPLCST-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D SSP +S ASA GFHLD   LRRLS KPV LK+SVF GRMG+TCG+TSGKLLG VQ
Sbjct  60    -SQDPSSPPESSASAAGFHLDAVTLRRLSGKPVTLKVSVFTGRMGRTCGVTSGKLLGSVQ  118

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             V V+L+G  S+  VFQ+GW KLGG  A   MLH+ VR+EPDPRFVFQFGGEPECSPVVFQ
Sbjct  119   VNVNLNGTHSKSSVFQNGWMKLGGEPA-VAMLHMAVRAEPDPRFVFQFGGEPECSPVVFQ  177

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYD  854
             IQG+IRQPVFSCKFSA+RNNRTRSLP+DF+L +RGWMRTFS +RDRPG+ERKGWMIIIYD
Sbjct  178   IQGNIRQPVFSCKFSADRNNRTRSLPTDFNLGNRGWMRTFSAERDRPGRERKGWMIIIYD  237

Query  853   LSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSV  674
             LSGS+VAAAS+ITPFVPSPGSDRVSRSNPGAWLIL+PNG  VSSWKPWGRLEAWRERG V
Sbjct  238   LSGSAVAAASVITPFVPSPGSDRVSRSNPGAWLILQPNGSCVSSWKPWGRLEAWRERGPV  297

Query  673   DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA-SSLSPVRGFVMCSSV  497
             DGLGYKFELVTD G TSG+PIAEG M++KKGG+FCIDN  K SA SSLSP+RGFVM SSV
Sbjct  298   DGLGYKFELVTDIGLTSGVPIAEGTMSMKKGGQFCIDNTIKDSALSSLSPIRGFVMGSSV  357

Query  496   --EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDSY  323
               EGK    +VQV V HV CMADAALF+ALSAAIDLSMDAC+LFS KL KEFC+++ +S+
Sbjct  358   EGEGKPSAPTVQVGVRHVTCMADAALFIALSAAIDLSMDACRLFSQKLGKEFCNNDQESF  417



>ref|XP_004251646.1| PREDICTED: uncharacterized protein LOC101262285 [Solanum lycopersicum]
Length=423

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/426 (73%), Positives = 356/426 (84%), Gaps = 13/426 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP-SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDPCPFVRLIIES+A+KLP +ATK A  G+HPS+TPCYAKLK  +FP+QT +LPL    P
Sbjct  1     MDPCPFVRLIIESLALKLPLTATKSASHGIHPSSTPCYAKLKLKNFPTQTTILPLS---P  57

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMG-QTCGITSGKLLGVVQ  1214
               D+ SP +S A A GFHLD +ALRR S KP+ L +SVF GRMG + CG+TSGKL+G VQ
Sbjct  58    NSDTQSPPESAAIATGFHLDAAALRRSSAKPINLTVSVFTGRMGGRACGVTSGKLMGSVQ  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGA---DKP--MLHVVVRSEPDPRFVFQFGGEPECS  1049
             V+VDLSG  S+  VFQ+GW KLG       DKP  MLH+ VR+EPDPRFVFQFGGEPECS
Sbjct  118   VSVDLSGTNSKGRVFQNGWMKLGSTSTAEKDKPVAMLHIAVRAEPDPRFVFQFGGEPECS  177

Query  1048  PVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWM  869
             PVVFQIQG+IRQPVFSCKFSA+RNNR+RSLP+DF+LN+RGWMRTFSG+RDR G+ERKGWM
Sbjct  178   PVVFQIQGNIRQPVFSCKFSADRNNRSRSLPTDFNLNNRGWMRTFSGERDRTGRERKGWM  237

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             IIIYDLSGS+VAAASMITPFVPSPGSDRVSRSN GAWLILRPNG  VSSWK WGRL+AWR
Sbjct  238   IIIYDLSGSAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGACVSSWKHWGRLQAWR  297

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA-SSLSPVRGFV  512
             ERG VDGLGYKFELVTD G TS IPIAEG M++KKGG+FCIDN  K +A S+ SP+RGFV
Sbjct  298   ERGPVDGLGYKFELVTDTGLTSTIPIAEGTMSMKKGGQFCIDNTVKDTALSTNSPIRGFV  357

Query  511   MCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
             M S+VEG+    +  VQV V HV CMADAALF+ALSAAIDLSMDAC+LFS KLRKE C+D
Sbjct  358   MVSNVEGEGKISTPMVQVGVQHVTCMADAALFIALSAAIDLSMDACRLFSQKLRKELCND  417

Query  337   EHDSYF  320
             + +SYF
Sbjct  418   DQESYF  423



>ref|XP_011078236.1| PREDICTED: uncharacterized protein LOC105162032 [Sesamum indicum]
Length=415

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/421 (75%), Positives = 355/421 (84%), Gaps = 11/421 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLI+ES+A+KLPSATKPAG GVHPSTTPCYAKLK  +FPSQTALLPLC A   
Sbjct  1     MDPCPFVRLIVESLALKLPSATKPAGSGVHPSTTPCYAKLKIKNFPSQTALLPLCVAGET  60

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKP-VALKLSVFAGRMGQTCGITSGKLLGVVQV  1211
              +SS+      S   FHLDP ALRRL+ KP V LK+SVF GRMG+TCG+TSGKLLG VQV
Sbjct  61    PESST------SPAVFHLDPDALRRLACKPIVTLKISVFTGRMGRTCGVTSGKLLGSVQV  114

Query  1210  AVDLSGAQSRPVVFQSGWKKLGG-GGADKPMLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
              V+L  AQS+  V+Q+GW KLGG GG     LH+ VRSEPDPRFVFQFGGEPECSPVVFQ
Sbjct  115   CVNLGNAQSKGCVYQNGWMKLGGSGGEQAATLHLTVRSEPDPRFVFQFGGEPECSPVVFQ  174

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYD  854
             IQG+IRQPVFSCKFSAER+NR+RSLPSDF+LN++GW+RTFSG+RDR G+ERKGWM++IYD
Sbjct  175   IQGNIRQPVFSCKFSAERSNRSRSLPSDFNLNNKGWVRTFSGERDRVGRERKGWMVVIYD  234

Query  853   LSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSV  674
             LSGS VAAASM+TPFVPSPGSDRVSRSNPGAWLIL PNG S+SSWKPWGRLEAWRERG V
Sbjct  235   LSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILSPNGVSISSWKPWGRLEAWRERGPV  294

Query  673   DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLS-PVRGFVMCSSV  497
             DGLGYKFEL+T AG TSGIPIAEG M+VKKGG+FCIDN+RK SA SL  P RGFVM SSV
Sbjct  295   DGLGYKFELITHAGLTSGIPIAEGTMSVKKGGKFCIDNSRKDSALSLVLPSRGFVMGSSV  354

Query  496   EGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDSY  323
             EG+       VQV V HV CMADAALFVAL+AAIDLSMDAC+LFS KLR+EF  DE + +
Sbjct  355   EGEGKCSKPVVQVGVQHVTCMADAALFVALAAAIDLSMDACRLFSHKLRREFSLDEKELF  414

Query  322   F  320
              
Sbjct  415   L  415



>ref|XP_009602498.1| PREDICTED: uncharacterized protein LOC104097612 [Nicotiana tomentosiformis]
Length=418

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/420 (76%), Positives = 361/420 (86%), Gaps = 8/420 (2%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG--VHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRLIIES+A+KLP+ATKPAG G  VHP +TPCYAKLK  +FPSQTA+LPLCS  
Sbjct  1     MDPCPFVRLIIESLALKLPTATKPAGSGSGVHPCSTPCYAKLKLKNFPSQTAILPLCST-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                  SSP +S ASA GFHLD   LRRLS KPV+LK+SVF GRMG+TCG+TSGKLLG VQ
Sbjct  60    -SQYPSSPPESSASAAGFHLDAVTLRRLSGKPVSLKVSVFTGRMGRTCGVTSGKLLGSVQ  118

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             V+V+L+G  S+  VFQ+GW KLGG  A   +LH+ VR+EPDPRFVFQFGGEPECSPVVFQ
Sbjct  119   VSVNLNGTHSKSSVFQNGWMKLGGEPA-VAVLHMAVRAEPDPRFVFQFGGEPECSPVVFQ  177

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYD  854
             IQG+IRQPVFSCKFSA+RNNRTRSLP+DF+L +RGWMRTFS +RDRPG+ERKGWMIIIYD
Sbjct  178   IQGNIRQPVFSCKFSADRNNRTRSLPTDFNLGNRGWMRTFSAERDRPGRERKGWMIIIYD  237

Query  853   LSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSV  674
             LSGS+VAAAS+ITPFVPSPGSDRVSRSNPGAWLILRPNG  VSSWKPWGRLEAWRERG V
Sbjct  238   LSGSAVAAASVITPFVPSPGSDRVSRSNPGAWLILRPNGSCVSSWKPWGRLEAWRERGPV  297

Query  673   DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA-SSLSPVRGFVMCSSV  497
             DGLGYKFELVTD G TSG+PIAEG M++K+GG+FCIDN  K SA SSLSP+RGFVM SSV
Sbjct  298   DGLGYKFELVTDIGLTSGVPIAEGTMSMKRGGQFCIDNTVKDSALSSLSPIRGFVMGSSV  357

Query  496   --EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDSY  323
               EGK    +VQV V HV CMADAALF+ALSAAIDLSMDAC+LFS KL KEFC++  +S+
Sbjct  358   EGEGKPSAPTVQVGVRHVTCMADAALFIALSAAIDLSMDACRLFSQKLGKEFCNNAQESF  417



>ref|XP_011093657.1| PREDICTED: uncharacterized protein LOC105173566 [Sesamum indicum]
Length=419

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/420 (75%), Positives = 358/420 (85%), Gaps = 11/420 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLI+ES+A+KLPSAT+PAG GVHPS TPCYAKLK  +FPSQTALLPLCSA   
Sbjct  1     MDPCPFVRLIVESLALKLPSATRPAGSGVHPSATPCYAKLKIYNFPSQTALLPLCSA---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKP-VALKLSVFAGRMGQTCGITSGKLLGVVQV  1211
               ++ P +S   A GFHLDP A+R LS +P V LK+SVF GRMG+TCG+T GKLLG V+V
Sbjct  58    -AAAGPPESSTFAPGFHLDPEAIRSLSCRPAVTLKISVFTGRMGRTCGVTCGKLLGSVKV  116

Query  1210  AVDLSGAQSRPVVFQSGWKKLGGGGADK---PMLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             +V+L  AQ+R  V+Q+GW KLGG G       +LH++VRSEPDPRFVFQFGGEPECSPVV
Sbjct  117   SVNLGHAQTRACVYQNGWMKLGGEGGGGEPVAILHMIVRSEPDPRFVFQFGGEPECSPVV  176

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIII  860
             FQIQG+IRQPVFSCKFSAER+NR RSLPSDF++N+RGWMRTF+G++ R G+ERKGWMII+
Sbjct  177   FQIQGNIRQPVFSCKFSAERSNRLRSLPSDFNINNRGWMRTFAGEKGRVGRERKGWMIIV  236

Query  859   YDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERG  680
             YDLSGS+VAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG S+SSWKPWGRLEAWRERG
Sbjct  237   YDLSGSAVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGVSISSWKPWGRLEAWRERG  296

Query  679   SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASS-LSPVRGFVMCS  503
              VDGLGYKFEL+T+ G TSG+PIAEG MN+KKGGRFCIDN+RK SA S LSPVRGFVM S
Sbjct  297   PVDGLGYKFELITNNGLTSGVPIAEGTMNIKKGGRFCIDNSRKDSALSFLSPVRGFVMGS  356

Query  502   SVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             SVEG+       VQV V HV C ADAALFVALSAA+DLSMDAC+LFS KLRKEF +DE +
Sbjct  357   SVEGEGKVSKPVVQVGVQHVTCTADAALFVALSAAVDLSMDACRLFSHKLRKEFSNDEQE  416



>ref|XP_009597038.1| PREDICTED: uncharacterized protein LOC104093034 [Nicotiana tomentosiformis]
Length=419

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/422 (74%), Positives = 352/422 (83%), Gaps = 9/422 (2%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP-SATKPAGPGV-HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRLIIES+A+KLP +ATKP+G  V HPSTTPCYAKLK  +FPSQ  +LPL    
Sbjct  1     MDPCPFVRLIIESLALKLPLAATKPSGHHVIHPSTTPCYAKLKLKNFPSQITILPLS---  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
             P    SSP DS A A GFHLD +ALRR+S KPV L +S+F GRMG+TCG +SGKL+G VQ
Sbjct  58    PASTDSSPPDSSAVAAGFHLDAAALRRVSTKPVTLHVSIFTGRMGRTCGFSSGKLIGSVQ  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             V+VD +G  +   VFQ+GW KLG G     MLH+VVR+EPDPRFVFQFGGEPECSPV+FQ
Sbjct  118   VSVDFTGGHTEARVFQNGWMKLGTGEKPVAMLHLVVRAEPDPRFVFQFGGEPECSPVIFQ  177

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYD  854
             +QG+  QPVFSCKFSA+RNNR+RSLPSDF+LN+RGWMRTFSG++DR GKERKGWMIIIYD
Sbjct  178   VQGNRSQPVFSCKFSADRNNRSRSLPSDFNLNNRGWMRTFSGEKDRTGKERKGWMIIIYD  237

Query  853   LSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSV  674
             LSGS+VAAASMITPFVPSPGSDRVSRSN GAWLILRPNG SVSSWKPWGRLEAWRERG V
Sbjct  238   LSGSAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGASVSSWKPWGRLEAWRERGPV  297

Query  673   DGLGYKFELVTDAGFTS-GIPIAEGAMNVKKGGRFCIDNARKHSA-SSLSPVRGFVMCSS  500
             DGLGYKFELVTD G TS  IPIAEG M++KKGG+FCIDN  K S  SS SP+RGFVM S+
Sbjct  298   DGLGYKFELVTDTGLTSAAIPIAEGTMSMKKGGQFCIDNTVKDSVLSSNSPIRGFVMVST  357

Query  499   V--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDS  326
             V  EGK    +VQV V HV CMADAALFVALSAAIDLSMDAC+LFS KLRKE CHD+ +S
Sbjct  358   VEGEGKTSVPTVQVGVQHVKCMADAALFVALSAAIDLSMDACRLFSQKLRKELCHDDQES  417

Query  325   YF  320
             YF
Sbjct  418   YF  419



>ref|XP_002283391.1| PREDICTED: uncharacterized protein LOC100245695 [Vitis vinifera]
Length=417

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/421 (73%), Positives = 356/421 (85%), Gaps = 11/421 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLI+ES+A+KLP AT+PAG GVHPSTTPC+ KL+  +FPSQTALLPLCS+   
Sbjct  1     MDPCPFVRLIVESLALKLPQATRPAGSGVHPSTTPCFCKLRIKNFPSQTALLPLCSS---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 SP DS  S+ GFHLD + LRRLS KP+ L++SV+ GRMG+TCG++SGKLLG V V 
Sbjct  58    GGDPSP-DSTISSAGFHLDSALLRRLSGKPLTLRVSVYTGRMGRTCGVSSGKLLGRVHVM  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             ++L GA+SRP VFQ+GW KLG     KP   LH+VVRSEPDPRFVFQFGGEPECSPVVFQ
Sbjct  117   INLDGAESRPNVFQNGWLKLGNE-TSKPSARLHLVVRSEPDPRFVFQFGGEPECSPVVFQ  175

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYD  854
             IQG+IRQPVFSCKFSA+RN+R+RSL SDF+ N+RGWMR+FS +R+RPG+ERKGWMI+IYD
Sbjct  176   IQGNIRQPVFSCKFSADRNSRSRSLASDFNSNNRGWMRSFSNERERPGRERKGWMIMIYD  235

Query  853   LSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSV  674
             LSGS VA+ASMITPFVPSPGSDRVSRSNPGAWLILRP+G SVSSWKPWGRLEAWRERG +
Sbjct  236   LSGSPVASASMITPFVPSPGSDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPI  295

Query  673   DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDN--ARKHSASSLSPVRGFVMCSS  500
             DGLGYKFELVTD+G TSGIPIAE  MN+K+GG+FCID+   R  + SSL P+RGFVM S+
Sbjct  296   DGLGYKFELVTDSGPTSGIPIAESTMNIKRGGQFCIDSRIMRDSTLSSLLPLRGFVMGST  355

Query  499   VEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDS  326
             VEG+       VQV V HV CMADAALF+ALSAAIDLSMDAC+LFS KLRKE CHDE DS
Sbjct  356   VEGEGKVSKPVVQVGVQHVTCMADAALFIALSAAIDLSMDACRLFSRKLRKELCHDEQDS  415

Query  325   Y  323
             +
Sbjct  416   F  416



>ref|XP_009757179.1| PREDICTED: uncharacterized protein LOC104210073 [Nicotiana sylvestris]
Length=419

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/422 (73%), Positives = 346/422 (82%), Gaps = 9/422 (2%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP-SATKPAGPGV-HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDP PFVRLIIES+A+KLP +ATKP+G  V HPSTTP YAKLK  SFPSQ  +LPL    
Sbjct  1     MDPSPFVRLIIESLALKLPLAATKPSGHHVIHPSTTPSYAKLKLKSFPSQITVLPLS---  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
             P     +P DS A   GFHLD  ALRRLS KPV L +SVF GRMG TCG++SGKL+G VQ
Sbjct  58    PASTDPTPPDSSAVDAGFHLDAVALRRLSAKPVTLHVSVFTGRMGHTCGVSSGKLIGSVQ  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             V+VDLSG  S   VFQ+GW KL  G     MLH+VVR+EPDPRFVFQFGGEPECSPVVFQ
Sbjct  118   VSVDLSGTNSEARVFQNGWMKLAAGEKPGAMLHLVVRAEPDPRFVFQFGGEPECSPVVFQ  177

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYD  854
             +QG+  QPVFSCKFSA+RNNR+RSLPSDF+LN+RGWMRTFSG++DR G+ERKGWMIIIYD
Sbjct  178   VQGNRSQPVFSCKFSADRNNRSRSLPSDFNLNNRGWMRTFSGEKDRTGRERKGWMIIIYD  237

Query  853   LSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSV  674
             LSGS+VAAASMITPFVPSPGSDRVSRSN GAWLILRPNG SVSSWKPWGRLEAWRERG V
Sbjct  238   LSGSAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGASVSSWKPWGRLEAWRERGPV  297

Query  673   DGLGYKFELVTDAGFTS-GIPIAEGAMNVKKGGRFCIDNARKHSA-SSLSPVRGFVMCSS  500
             DGLGYKFELVTD G TS  IPIAEG M++KKGG+FCIDN  K S  SS SP+RGFVM S+
Sbjct  298   DGLGYKFELVTDTGLTSAAIPIAEGTMSMKKGGQFCIDNTVKDSVLSSNSPIRGFVMVST  357

Query  499   V--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDS  326
             V  EGK    ++QV V HV  MADAALF++LSAAIDLSMDAC+LFS KLRKE CHD+ +S
Sbjct  358   VEGEGKTSVPTIQVGVQHVKSMADAALFISLSAAIDLSMDACRLFSRKLRKELCHDDQES  417

Query  325   YF  320
             YF
Sbjct  418   YF  419



>emb|CDP03235.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/425 (75%), Positives = 363/425 (85%), Gaps = 13/425 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSA-TKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDPCPFVRLIIES+A+KLPS+ TKPAGPGVHPS TPCYAKLK ++FPSQTAL+PLC++  
Sbjct  1     MDPCPFVRLIIESLALKLPSSPTKPAGPGVHPSATPCYAKLKLTNFPSQTALIPLCTS--  58

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLSEKPV-ALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                SSS  DS  S+ GFHLDPS LRRLS KP+  LK+SVF GRMG+TCG+   KLLG V+
Sbjct  59    DPSSSSSPDSSTSSAGFHLDPSTLRRLSSKPLLTLKVSVFTGRMGRTCGVPCSKLLGSVK  118

Query  1213  VAVDL--SGAQSRPVVFQSGWKKLGG-GGADKPM--LHVVVRSEPDPRFVFQFGGEPECS  1049
             +++++  +GAQS+P V+ +GW KL G  G DKP+  LH VVRSEPDPRFVFQFGGEPECS
Sbjct  119   MSINVGGAGAQSKPSVYYNGWMKLAGSAGPDKPVAKLHAVVRSEPDPRFVFQFGGEPECS  178

Query  1048  PVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLN-SRGWMRTFSGDRDRPGKERKGW  872
             PVVFQIQ +IRQPVFSCKFSA+RNNR+RSLPSDF++  ++GW+RTFSG+R++ G+ERKGW
Sbjct  179   PVVFQIQENIRQPVFSCKFSADRNNRSRSLPSDFTMGGNKGWVRTFSGEREKSGRERKGW  238

Query  871   MIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAW  692
             MI+I+DLSGS+VAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAW
Sbjct  239   MIMIHDLSGSAVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAW  298

Query  691   RERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLS-PVRGF  515
             RERG VDGLGY+F LVTD+G TSG+PIAEG M+VK+GG+FCIDNARK S  SL  PVRGF
Sbjct  299   RERGPVDGLGYRFALVTDSGLTSGVPIAEGTMSVKRGGQFCIDNARKDSVLSLVLPVRGF  358

Query  514   VMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCH  341
             VM SSV  EGK     VQV V HV CMADAALFVALSAAIDLSMDAC+LFS KLRKE C 
Sbjct  359   VMGSSVEAEGKVSKPMVQVGVRHVTCMADAALFVALSAAIDLSMDACRLFSRKLRKELCP  418

Query  340   DEHDS  326
             DE DS
Sbjct  419   DEQDS  423



>gb|KGN60567.1| hypothetical protein Csa_2G000750 [Cucumis sativus]
Length=421

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/425 (72%), Positives = 346/425 (81%), Gaps = 14/425 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL+++S+A+ LP AT+PAG  VHPS TPC+ K+   +FPSQTALLPL S    
Sbjct  1     MDPCPFVRLMVDSLALNLPQATRPAGAAVHPSATPCFCKISIKNFPSQTALLPLSSV---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 SP DS AS+ GFHLDPS+LRRLS KPV + LSVFAGRMG TCG+ SGKLLG V++ 
Sbjct  58    -SGDSPPDSAASSAGFHLDPSSLRRLSGKPVVMCLSVFAGRMGHTCGVNSGKLLGRVRIT  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADK--PMLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             V + GA+S+P VFQ+GW KLG G  DK    LH+VVRSEPDPRFVFQFG EPECSPVVFQ
Sbjct  117   VSIDGAESKPKVFQNGWVKLGKG-EDKISARLHLVVRSEPDPRFVFQFGSEPECSPVVFQ  175

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRG--WMRTFSGDRDRPGKERKGWMIII  860
             IQG+IRQPVFSCKFSA+RN+RTRSLPSDFS NS    WMRTFSG+R++PG+ERKGWMI++
Sbjct  176   IQGNIRQPVFSCKFSADRNSRTRSLPSDFSFNSTKGKWMRTFSGEREKPGRERKGWMIMV  235

Query  859   YDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERG  680
             YDLSGS VAAASMITPFVPSPG+DRVSRSNPGAWLILRP+G SVSSWKPWGRLEAWRERG
Sbjct  236   YDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERG  295

Query  679   SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID--NARKHSASSLSPVRG-FVM  509
              +DGLGYKFELV D G  +GIPIAE  M+VKKGG+FCID    R  + +S S V+G FVM
Sbjct  296   PIDGLGYKFELVADTGLATGIPIAEATMSVKKGGQFCIDRKTVRDLTINSKSTVKGSFVM  355

Query  508   CSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDE  335
              SSVEG+       VQV V HV CMADAALFVALSAAIDLSMDAC+ F+ KLR+E CHDE
Sbjct  356   ASSVEGEGKVSKPIVQVGVQHVTCMADAALFVALSAAIDLSMDACRHFTQKLRRELCHDE  415

Query  334   HDSYF  320
             HDS F
Sbjct  416   HDSSF  420



>ref|XP_008458969.1| PREDICTED: uncharacterized protein LOC103498220 [Cucumis melo]
Length=421

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/425 (71%), Positives = 347/425 (82%), Gaps = 14/425 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL+++S+A+ LP AT+PAG  VHPS TPC+ K+   +FPSQTALLPL S    
Sbjct  1     MDPCPFVRLMVDSLALNLPQATRPAGAAVHPSATPCFCKISIKNFPSQTALLPLSSV---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 SP DS AS+ GFHLDPS+LRRLS KPV + LSVFAGRMG TCG+ SGKLLG V++ 
Sbjct  58    -SGDSPPDSAASSAGFHLDPSSLRRLSGKPVVMCLSVFAGRMGHTCGVNSGKLLGRVRIT  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADK--PMLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             V + GA+++P VFQ+GW KLG    DK    LH+VVRSEPDPRFVFQFGGEPECSPVVFQ
Sbjct  117   VSIDGAENKPKVFQNGWVKLGKD-EDKISARLHLVVRSEPDPRFVFQFGGEPECSPVVFQ  175

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRG--WMRTFSGDRDRPGKERKGWMIII  860
             IQG+IRQPVFSCKFSA+RN+RTRSLPSDFS NS    WMRTFSG+R++PG+ERKGWMI++
Sbjct  176   IQGNIRQPVFSCKFSADRNSRTRSLPSDFSFNSTKGKWMRTFSGEREKPGRERKGWMIMV  235

Query  859   YDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERG  680
             YDLSGS VAAASMITPFVPSPG+DRVSRSNPGAWLILRP+G SVSSWKPWGRLEAWRERG
Sbjct  236   YDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERG  295

Query  679   SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID--NARKHSASSLSPVRG-FVM  509
              +DGLGYKFELV D+G  +GIPIAE  M+VKKGG+FCID    R  + +S S V+G FVM
Sbjct  296   PIDGLGYKFELVADSGLATGIPIAEATMSVKKGGQFCIDRKTVRDFTTNSKSTVKGSFVM  355

Query  508   CSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDE  335
              SSVEG+       VQV V HV CMADAALFVALSAAIDLSMDAC+ F+ KLR+E CHDE
Sbjct  356   ASSVEGEGKVSKPIVQVGVQHVTCMADAALFVALSAAIDLSMDACRHFTQKLRRELCHDE  415

Query  334   HDSYF  320
             HDS F
Sbjct  416   HDSSF  420



>gb|KDP33775.1| hypothetical protein JCGZ_07346 [Jatropha curcas]
Length=422

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/426 (71%), Positives = 349/426 (82%), Gaps = 15/426 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLI+ES+A+KLP ATKPAG GVHPSTTPC+ KL+F +FPSQTALLP+CS    
Sbjct  1     MDPCPFVRLIVESLALKLPLATKPAGSGVHPSTTPCFCKLRFKNFPSQTALLPMCSTA--  58

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
               + SP D+  SA GFHLD  AL RLS KP+ L++ V+ GRMG+TCG+  GKLLG VQV+
Sbjct  59    --NDSPPDTSTSAPGFHLDAIALSRLSGKPITLRMEVYTGRMGRTCGVNGGKLLGHVQVS  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKPM--LHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             +DL  A S P VFQ+GW KLG    DKP   L++VVRSEPDPRFVFQFGGEPECSPVV+Q
Sbjct  117   IDLGNATSNPRVFQNGWLKLGNQ-PDKPAARLYLVVRSEPDPRFVFQFGGEPECSPVVYQ  175

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNS--RGWMRTFSGDRDRPGKERKGWMIII  860
             IQG+IRQPVFSCKFSA+RN R+RSLPSDF+LN+  RGW RTF+G+++R G+ERKGWMI+I
Sbjct  176   IQGNIRQPVFSCKFSADRNARSRSLPSDFTLNNNNRGWRRTFTGEKERAGRERKGWMIMI  235

Query  859   YDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERG  680
             YDLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRP+G SVSSWKPWGRLEAWRERG
Sbjct  236   YDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERG  295

Query  679   SVDGLGYKFELVTDAGFTS-GIPIAEGAMNVKKGGRFCIDNARKHSA---SSLSPVRGFV  512
              +DGLGYKFELVTD G  S GIPIAE  ++V+KGG+FCID+     +   SS SPV+GFV
Sbjct  296   PIDGLGYKFELVTDNGGPSRGIPIAEATLSVRKGGQFCIDSRIMKDSGLNSSRSPVKGFV  355

Query  511   MCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
             M S+VEG+       VQV + HV CMADAALF+ALSAAIDLSMDACQLFS KLRKE CHD
Sbjct  356   MDSTVEGEGKVSKPVVQVGMQHVTCMADAALFIALSAAIDLSMDACQLFSHKLRKELCHD  415

Query  337   EHDSYF  320
             E D  F
Sbjct  416   EQDYSF  421



>ref|XP_004141026.1| PREDICTED: uncharacterized protein LOC101219082 [Cucumis sativus]
Length=421

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/425 (71%), Positives = 345/425 (81%), Gaps = 14/425 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL+++S+A+ LP AT+PAG  V PS TPC+ K+   +FPSQTALLPL S    
Sbjct  1     MDPCPFVRLMVDSLALNLPQATRPAGAAVPPSATPCFCKISIKNFPSQTALLPLSSV---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 SP DS AS+ GFHLDPS+LRRLS KPV + LSVFAGRMG TCG+ SGKLLG V++ 
Sbjct  58    -SGDSPPDSAASSAGFHLDPSSLRRLSGKPVVMCLSVFAGRMGHTCGVNSGKLLGRVRIT  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADK--PMLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             V + GA+S+P VFQ+GW KLG G  DK    LH+VVRSEPDPRFVFQFG EPECSPVVFQ
Sbjct  117   VSIDGAESKPKVFQNGWVKLGKG-EDKISARLHLVVRSEPDPRFVFQFGSEPECSPVVFQ  175

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRG--WMRTFSGDRDRPGKERKGWMIII  860
             IQG+IRQPVFSCKFSA+RN+RTRSLPSDFS NS    WMRTFSG+R++PG+ERKGWMI++
Sbjct  176   IQGNIRQPVFSCKFSADRNSRTRSLPSDFSFNSTKGKWMRTFSGEREKPGRERKGWMIMV  235

Query  859   YDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERG  680
             YDLSGS VAAASMITPFVPSPG+DRVSRSNPGAWLILRP+G SVSSWKPWGRLEAWRERG
Sbjct  236   YDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERG  295

Query  679   SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID--NARKHSASSLSPVRG-FVM  509
              +DGLGYKFELV D G  +GIPIAE  M+VKKGG+FCID    R  + +S S V+G FVM
Sbjct  296   PIDGLGYKFELVADTGLATGIPIAEATMSVKKGGQFCIDRKTVRDLTINSKSTVKGSFVM  355

Query  508   CSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDE  335
              SSVEG+       VQV V HV CMADAALFVALSAAIDLSMDAC+ F+ KLR+E CHDE
Sbjct  356   ASSVEGEGKVSKPIVQVGVQHVTCMADAALFVALSAAIDLSMDACRHFTQKLRRELCHDE  415

Query  334   HDSYF  320
             HDS F
Sbjct  416   HDSSF  420



>gb|KHG29270.1| hypothetical protein F383_14119 [Gossypium arboreum]
Length=418

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/423 (71%), Positives = 351/423 (83%), Gaps = 14/423 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLI+ES+A+KLP ATKPAG GV+P+TTPC+ KL+  +FPSQTALLPL ++   
Sbjct  1     MDPCPFVRLIVESLALKLPQATKPAGSGVYPTTTPCFCKLRLKNFPSQTALLPLSNS---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 SP +S  SA GFHLD   LRRLS KPVAL++ V+ GRMG TCG++SGKL+G VQV 
Sbjct  58    -SGDSPPESSTSAAGFHLDALTLRRLSGKPVALRIEVYTGRMGHTCGVSSGKLVGRVQVT  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKPM--LHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             +DL  +Q+RP VFQ+GW KLG    +KP   LH+ V+SEPDPRFVFQFGGEPECSPVVFQ
Sbjct  117   LDLGVSQARPSVFQNGWMKLGNE-PEKPTAKLHLTVKSEPDPRFVFQFGGEPECSPVVFQ  175

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYD  854
             IQG+IRQPVFSCKFSA+R+ R+RSLP DFS  +RGWMRTFSG+++R G+ERKGWMI+I+D
Sbjct  176   IQGNIRQPVFSCKFSADRS-RSRSLPPDFSNKNRGWMRTFSGEKERQGRERKGWMIMIHD  234

Query  853   LSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSV  674
             LSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG SVSSWKPWGRLEAWRERG +
Sbjct  235   LSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGFSVSSWKPWGRLEAWRERGPI  294

Query  673   DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDN--ARKHSA-SSLSPVRGFVMCS  503
             DGLGYKFELVT+ G  +GIPIAE  M++KKGG+FCID   +R  SA SS SPV+GFVM +
Sbjct  295   DGLGYKFELVTENGPNNGIPIAEATMSIKKGGQFCIDRRVSRDPSALSSRSPVKGFVMGA  354

Query  502   SVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD-EH  332
             +VEG+       VQV + HV CMADAALF+ALSAAIDLSMDACQLFS KLRKE CHD EH
Sbjct  355   TVEGEGKVSKPVVQVGMQHVTCMADAALFIALSAAIDLSMDACQLFSRKLRKELCHDHEH  414

Query  331   DSY  323
             DS+
Sbjct  415   DSF  417



>ref|XP_007012983.1| Uncharacterized protein TCM_037753 [Theobroma cacao]
 gb|EOY30602.1| Uncharacterized protein TCM_037753 [Theobroma cacao]
Length=416

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/420 (71%), Positives = 346/420 (82%), Gaps = 12/420 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLI+ES+A+KLP ATKPAG GV+P+ TPC+ KL+  +FPSQTALLPL ++   
Sbjct  1     MDPCPFVRLIVESLALKLPQATKPAGSGVYPTATPCFCKLRIKNFPSQTALLPLSNS---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 SP +S  SA GFHLD   LRRLS KPV L++ V+ GRMG+TCG++ GKL+G VQV+
Sbjct  58    -SGDSPPESSTSAAGFHLDALTLRRLSGKPVTLRIEVYTGRMGRTCGVSCGKLVGRVQVS  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKPM--LHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             VDL  +Q+RP VFQ+GW KLG    DKP   LH+ VR+EPDPRFVFQFGGEPECSPVVFQ
Sbjct  117   VDLGVSQTRPSVFQNGWMKLGKE-PDKPTAKLHLTVRAEPDPRFVFQFGGEPECSPVVFQ  175

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYD  854
             IQG+IRQPVFSCKFSA+R+ R+RSLP DF+  +RGWMRT SG+R+R G+ERKGWMI+IYD
Sbjct  176   IQGNIRQPVFSCKFSADRS-RSRSLPPDFTNKNRGWMRTLSGERERQGRERKGWMIMIYD  234

Query  853   LSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSV  674
             LSGS VAAAS+ITPFVPSPGSDRVSRSNPGAWLILRP+G SVSSWKPWGRLEAWRERG +
Sbjct  235   LSGSPVAAASVITPFVPSPGSDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPI  294

Query  673   DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDN--ARKHSASSLSPVRGFVMCSS  500
             DGLGYKFELVT+ G T+GIPIAE  M+VKKGG+FCID   +R  + S  SPV+GFVM S+
Sbjct  295   DGLGYKFELVTENGPTNGIPIAESTMSVKKGGQFCIDKRVSRDSALSLRSPVKGFVMGST  354

Query  499   V--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDS  326
             V  EGK     VQV + HV CMADAALF+ALSAAIDLSMDAC+LFS KLRKE CHDE DS
Sbjct  355   VEAEGKVSKPVVQVGMQHVTCMADAALFIALSAAIDLSMDACRLFSRKLRKELCHDEQDS  414



>ref|XP_002514196.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48150.1| conserved hypothetical protein [Ricinus communis]
Length=421

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/426 (71%), Positives = 350/426 (82%), Gaps = 17/426 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLI+ES+A+KLP ATKPAG GVHPS TPC+ KL+  +FPSQTALLPLC+  P 
Sbjct  1     MDPCPFVRLIVESLALKLPLATKPAGSGVHPSATPCFCKLRIKNFPSQTALLPLCTT-PG  59

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
             D   SP D+  SA GFHLD +A+RRLS KP+AL++ V+ GRMG TCG+  GKLLG V+V 
Sbjct  60    D---SP-DTATSAPGFHLDATAIRRLSGKPIALRVEVYTGRMGHTCGVNGGKLLGKVEVC  115

Query  1207  VDL-SGAQSRPVVFQSGWKKLGGGGADKPM--LHVVVRSEPDPRFVFQFGGEPECSPVVF  1037
             VDL + A + P VF +GW KLG    DKP   LH+VVRSEPDPRFVFQFGGEPECSPVVF
Sbjct  116   VDLGNAAVAHPRVFHNGWLKLGNQ-PDKPAARLHLVVRSEPDPRFVFQFGGEPECSPVVF  174

Query  1036  QIQGSIRQPVFSCKFSAERNNRTRSLPSDFSL--NSRGWMRTFSGDRDRPGKERKGWMII  863
             QIQG+IRQPVFSCKFSA+RN+R+RSLPSDF+L  N+RGW RTFSG+++R G+ERKGWMI+
Sbjct  175   QIQGNIRQPVFSCKFSADRNSRSRSLPSDFTLHNNNRGWRRTFSGEKERAGRERKGWMIM  234

Query  862   IYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRER  683
             I+DLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG SVS+WKPWGRLEAWRER
Sbjct  235   IHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGFSVSNWKPWGRLEAWRER  294

Query  682   GSVDGLGYKFELVTDAGFTS-GIPIAEGAMNVKKGGRFCIDNARKHSA---SSLSPVRGF  515
             G +DGLGYK ELVTD G  S GIPIAEG M ++KGG+FCID+     +   SS SPV+GF
Sbjct  295   GPLDGLGYKVELVTDNGGPSGGIPIAEGTMGMRKGGQFCIDSRIMKDSGLLSSRSPVKGF  354

Query  514   VMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCH  341
             VM ++VEG+       VQ+ V HV CMADAALF+ALSAAIDLSMDAC+LFS KLRKE CH
Sbjct  355   VMGATVEGEGKVSKPVVQIGVQHVTCMADAALFIALSAAIDLSMDACRLFSHKLRKELCH  414

Query  340   DEHDSY  323
             DE DS+
Sbjct  415   DEQDSF  420



>ref|XP_008387423.1| PREDICTED: uncharacterized protein LOC103449874 [Malus domestica]
Length=418

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/422 (70%), Positives = 341/422 (81%), Gaps = 12/422 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL ++++A+KLP AT+PAGPGVH STTPC+ +LK  +FP QTALL L ++   
Sbjct  1     MDPCPFVRLNVDALALKLPHATRPAGPGVHSSTTPCFCQLKIKNFPPQTALLNLSTSA--  58

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 SP DSF SA GFH+DP+ LRRL+ KPVAL++SV+ GRMGQTCG+TSGKLLG VQ++
Sbjct  59    --GDSPPDSFTSAPGFHVDPTLLRRLAGKPVALRVSVYTGRMGQTCGVTSGKLLGRVQLS  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             +DL  A++ P V  SGW KLG    DKP   LH+ VR+EPDPRFVFQFGGEPECSPVVFQ
Sbjct  117   IDLDSARAHPTVIHSGWMKLGKD-HDKPSARLHLTVRAEPDPRFVFQFGGEPECSPVVFQ  175

Query  1033  IQG-SIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIY  857
             IQG  IRQPVFSCKFSA+RN+R RSL SDF+  +RGWMRT S DR+RPG+ERKGWMI I+
Sbjct  176   IQGRDIRQPVFSCKFSADRNSRNRSLQSDFTTINRGWMRTPSADRERPGRERKGWMITIH  235

Query  856   DLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGS  677
             DLSGS VAAASMITPFV SPG+DRVSRSNPGAWLILRP+G S+SSWKPWGRLEAWRERG 
Sbjct  236   DLSGSPVAAASMITPFVASPGTDRVSRSNPGAWLILRPHGFSISSWKPWGRLEAWRERGP  295

Query  676   VDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDN--ARKHSASSLSPVRGFVMCS  503
             +DGLGYKFELVTD G +S I IAEG M+VKKGG FCID+   R    +S SPV+GFV  S
Sbjct  296   IDGLGYKFELVTDNGPSSSITIAEGTMSVKKGGEFCIDSRLNRDSGLNSRSPVKGFVTGS  355

Query  502   SVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             +VEG+       VQV V HV CMADAALFVALSAAIDLSMDAC+LFS KLRKE CHDE +
Sbjct  356   TVEGEGKVSKPVVQVGVQHVTCMADAALFVALSAAIDLSMDACRLFSHKLRKELCHDEQN  415

Query  328   SY  323
              +
Sbjct  416   CF  417



>ref|XP_010110868.1| hypothetical protein L484_006983 [Morus notabilis]
 gb|EXC28687.1| hypothetical protein L484_006983 [Morus notabilis]
Length=415

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/426 (70%), Positives = 346/426 (81%), Gaps = 22/426 (5%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF  LIIES+A+KLP AT+PAGPGVHPS TPC+ KL+ ++FPSQTALLPL ++   
Sbjct  1     MDPCPFALLIIESLALKLPQATRPAGPGVHPSATPCFCKLRLNNFPSQTALLPLSTSSAA  60

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLS-EKPVALKLSVFAGRMGQTCGITSGKLLGVVQV  1211
             D S     S AS   FHLD +A+RRLS  + + L+LSV+ GRMG+TCG++SGKLLG + V
Sbjct  61    DSSPDSATSSAS---FHLDSAAIRRLSSRRHLTLRLSVYTGRMGRTCGVSSGKLLGRLHV  117

Query  1210  AVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPVVFQI  1031
              +DL+GA S+P VFQ+GW KLGG   D   LH+VVRSEPDPRFVFQFGGEPECSPVVFQI
Sbjct  118   PLDLTGADSKPAVFQAGWMKLGG---DAARLHIVVRSEPDPRFVFQFGGEPECSPVVFQI  174

Query  1030  QGSIRQPVFSCKFSAERNNRTRSLPSDFSLNS--RGWMRTFSGDRDRPGKERKGWMIIIY  857
             QGSIRQPVFSCKFSA+RN+R+RSLPSDF+LNS  RGW RTFSG+R++PG+ERKGWM+ I+
Sbjct  175   QGSIRQPVFSCKFSADRNSRSRSLPSDFTLNSNNRGWTRTFSGEREKPGRERKGWMVTIH  234

Query  856   DLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGS  677
             DLSGS VAAASMITPFVPSPG+DRVSRSNPGAWLILRP+G S+SSWKPWGRLEAWRERG 
Sbjct  235   DLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSLSSWKPWGRLEAWRERGP  294

Query  676   VDGLGYKFELVT-DAGF----TSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPVRGFV  512
             VDGLGYKFELV  DA      T  IPIAE  M++KKGG F I N     +S+ SPV+GFV
Sbjct  295   VDGLGYKFELVVADANHCGPTTGNIPIAEATMSMKKGGLFSIVN-----SSTRSPVKGFV  349

Query  511   MCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
             M S+VEG+       VQV V HV CMADAALFVALSAAIDLSMDAC+LFS KLRKE CHD
Sbjct  350   MGSTVEGEGKVSKPVVQVGVQHVTCMADAALFVALSAAIDLSMDACRLFSHKLRKELCHD  409

Query  337   EHDSYF  320
             +HD YF
Sbjct  410   DHD-YF  414



>ref|XP_007202154.1| hypothetical protein PRUPE_ppa006267mg [Prunus persica]
 gb|EMJ03353.1| hypothetical protein PRUPE_ppa006267mg [Prunus persica]
Length=420

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/423 (71%), Positives = 349/423 (83%), Gaps = 12/423 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL ++S+A+KLP AT+PAGPGVH STTPC+ +LK  +FPSQTALL L ++L  
Sbjct  1     MDPCPFVRLNVDSLALKLPHATRPAGPGVHSSTTPCFCELKIKNFPSQTALLTLSNSL--  58

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                SSP DS  SA GFH+DP+ LRRL  KPV L++SV+ GRMG+TCG+TSGKLLG V ++
Sbjct  59    -SDSSPPDSSTSAPGFHVDPTLLRRLYGKPVTLRVSVYTGRMGRTCGVTSGKLLGRVHLS  117

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             +DL  A+  P V Q+GW KLG    +KP   LH+ VR+EPDPRFVFQFGGEPECSPVVFQ
Sbjct  118   IDLDSARVHPTVIQNGWMKLGKD-REKPSAKLHLTVRAEPDPRFVFQFGGEPECSPVVFQ  176

Query  1033  IQG-SIRQPVFSCKFSAERNNRTRSLPSDF-SLNSRGWMRTFSGDRDRPGKERKGWMIII  860
             IQG  IRQPVFSCKFSA+RN+R RSL SDF S+N+RGWMRTFSGDR+RPG+ERKGWMI I
Sbjct  177   IQGRDIRQPVFSCKFSADRNSRFRSLQSDFTSMNNRGWMRTFSGDRERPGRERKGWMITI  236

Query  859   YDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERG  680
             +DLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRP+G SVSSWKPWGRLEAWRERG
Sbjct  237   HDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERG  296

Query  679   SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNA--RKHSASSLSPVRGFVMC  506
              +DGLGYKFELVTD G +S I IAEG M+VKKGG+FCID++  R  + +S SPV+GFV  
Sbjct  297   PIDGLGYKFELVTDNGPSSSITIAEGTMSVKKGGQFCIDSSLMRDSALNSRSPVKGFVTG  356

Query  505   SSVEGKNGFL--SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEH  332
             S+VEG+      SVQV V HV CMADAALFVALSAAIDLSMDAC+LFS KLRKE CHDE 
Sbjct  357   STVEGEGKVSKPSVQVGVQHVTCMADAALFVALSAAIDLSMDACRLFSHKLRKELCHDEQ  416

Query  331   DSY  323
             + +
Sbjct  417   NCF  419



>ref|XP_010249469.1| PREDICTED: uncharacterized protein LOC104592027 [Nelumbo nucifera]
Length=417

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/418 (69%), Positives = 334/418 (80%), Gaps = 9/418 (2%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+I+E +A+KLP A+K AG GVHPSTTPC+ KL+  +FPSQTALLPL SA   
Sbjct  1     MDPCPFVRVIVEGLALKLPVASKHAGSGVHPSTTPCFCKLRLKNFPSQTALLPLSSA---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
               +  P D+  SA GFHLDP  LRRLS KP  L +SV+ G MG+TCGI+S KLLG V+V 
Sbjct  58    -SADLPPDTTTSAAGFHLDPFVLRRLSSKPTTLHVSVYTGSMGRTCGISSEKLLGRVRVV  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGG-GADKPMLHVVVRSEPDPRFVFQFGGEPECSPVVFQI  1031
             ++L G++ R  ++Q+GW KLG   G     LH+VVRSEPDPRFVFQFGGEPECSPVVFQI
Sbjct  117   LNLQGSEFRASLYQNGWMKLGKEPGKPSARLHLVVRSEPDPRFVFQFGGEPECSPVVFQI  176

Query  1030  QGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDL  851
             QG+IRQPVFSCKFSA+RN+R+RSL  D ++ SRGWM +F+ DRDRPG+ERKGWMI+IYDL
Sbjct  177   QGNIRQPVFSCKFSADRNSRSRSLQLDSNMKSRGWMNSFASDRDRPGRERKGWMIMIYDL  236

Query  850   SGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVD  671
             SGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRP G SVSSWKPWGRLEAWRERG +D
Sbjct  237   SGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPQGFSVSSWKPWGRLEAWRERGPID  296

Query  670   GLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNAR--KHSASSLSPVRGFVMCSSV  497
             GLGYKFELVTD G  SGI IAE  M+++KGG+FCID +     ++SS S  RGF+M S+V
Sbjct  297   GLGYKFELVTDTGTNSGISIAEATMSIRKGGQFCIDTSLVGDTASSSWSSRRGFIMGSTV  356

Query  496   EGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             EG+       VQV V HV   ADAALF+ALSAAIDLSMDAC+LFS KLRKE CHD+ D
Sbjct  357   EGEGKVSKPVVQVGVQHVTSTADAALFIALSAAIDLSMDACRLFSHKLRKELCHDQQD  414



>ref|XP_008242466.1| PREDICTED: uncharacterized protein LOC103340798 [Prunus mume]
Length=420

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/423 (70%), Positives = 348/423 (82%), Gaps = 12/423 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL ++S+A+KLP AT+PAGPGVH STTPC+ +LK  +FPSQTALL L ++L  
Sbjct  1     MDPCPFVRLNVDSLALKLPHATRPAGPGVHSSTTPCFCELKIKNFPSQTALLTLSNSL--  58

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                SSP DS  SA GFH+DP+ LRRLS KPV L++SV+ GRMG+TCG+TSGKLLG V ++
Sbjct  59    -SDSSPPDSSTSALGFHVDPALLRRLSGKPVTLRVSVYTGRMGRTCGVTSGKLLGRVHLS  117

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             +DL  A+  P V  +GW KLG    +KP   LH+ VR+EPDPRFVFQFGGEPECSPV+FQ
Sbjct  118   IDLDSARVHPTVIHNGWMKLGKD-REKPSARLHLTVRAEPDPRFVFQFGGEPECSPVIFQ  176

Query  1033  IQG-SIRQPVFSCKFSAERNNRTRSLPSDF-SLNSRGWMRTFSGDRDRPGKERKGWMIII  860
             IQG  IRQPVFSCKFSA+RN+R RSL SDF S+N+RGWM TFSGDR+RPG+ERKGWMI I
Sbjct  177   IQGRDIRQPVFSCKFSADRNSRFRSLQSDFTSMNNRGWMGTFSGDRERPGRERKGWMITI  236

Query  859   YDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERG  680
             +DLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRP+G +VSSWKPWGRLEAWRERG
Sbjct  237   HDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGFNVSSWKPWGRLEAWRERG  296

Query  679   SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNA--RKHSASSLSPVRGFVMC  506
              +DGLGYKFELVTD G +S I IAEG M+VKKGG+FCID++  R  + +S SPV+GFVM 
Sbjct  297   PIDGLGYKFELVTDNGPSSSITIAEGTMSVKKGGQFCIDSSLMRDSALNSRSPVKGFVMG  356

Query  505   SSVEGKNGFL--SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEH  332
             S+VEG+      SVQV   HV CMADAALFVALSAAIDLSMD+C+LFS KLRKE CHDE 
Sbjct  357   STVEGEGKVSKPSVQVGAQHVTCMADAALFVALSAAIDLSMDSCRLFSHKLRKELCHDEQ  416

Query  331   DSY  323
             + +
Sbjct  417   NCF  419



>ref|XP_010049600.1| PREDICTED: uncharacterized protein LOC104438202 [Eucalyptus grandis]
 gb|KCW82300.1| hypothetical protein EUGRSUZ_C03707 [Eucalyptus grandis]
Length=419

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/425 (69%), Positives = 344/425 (81%), Gaps = 17/425 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP-SATKPA--GPGVHPSTTPCYAKLKFSSFPSQTALLPLCSA  1397
             MDPCPFVRLI+ES+++KLP   +KPA  G G+HPS TPC+ KL+  +FP+QTALLPL S+
Sbjct  1     MDPCPFVRLIVESLSLKLPVDPSKPAVAGGGIHPSATPCFCKLRLKNFPAQTALLPLSSS  60

Query  1396  LPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMG-QTCGITSGK-LLG  1223
               K  + +P D+  SA GFHLDP+ LRRL+ KP  L++SV++GRMG +TCG++SGK LLG
Sbjct  61    --KSAADAPPDTATSAPGFHLDPADLRRLAGKPFTLRVSVYSGRMGGRTCGVSSGKKLLG  118

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGG--GGADKPMLHVVVRSEPDPRFVFQFGGEPECS  1049
              VQV+V L GAQ+RPVVFQSGW KLG   G A    LH+VVRSEPDPRF+FQFGGEPE S
Sbjct  119   RVQVSVGLDGAQARPVVFQSGWLKLGPAPGKAAPARLHLVVRSEPDPRFLFQFGGEPELS  178

Query  1048  PVVFQIQGS-IRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGW  872
             PVV+QIQGS IRQPVFSCKFSA+RN R+RSL SDF  +SRGWMRT SG+R+R  +ERKGW
Sbjct  179   PVVYQIQGSNIRQPVFSCKFSADRNCRSRSLASDFP-SSRGWMRTLSGERERHSRERKGW  237

Query  871   MIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAW  692
             M+ I+DLSGS VAAASM+TPFVPSPGSDRVSRSNPGAWLILRPNG SVSSWKPWGRLEAW
Sbjct  238   MVTIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGYSVSSWKPWGRLEAW  297

Query  691   RERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPVRGFV  512
             RERG  DGLGYKFELVT+ G T GIPIAE  ++VK+GG+F ID      +S  SPV+GFV
Sbjct  298   RERGPTDGLGYKFELVTEGGPTRGIPIAEATLSVKRGGQFSIDVG----SSLKSPVKGFV  353

Query  511   MCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
             M S+V  EGK    +VQV + HV CM DAALF+ALSAAIDLSMDACQLFS KLRKE CHD
Sbjct  354   MASTVEAEGKTSKPAVQVGMQHVTCMPDAALFIALSAAIDLSMDACQLFSHKLRKELCHD  413

Query  337   EHDSY  323
             + D Y
Sbjct  414   DQDCY  418



>ref|XP_004287493.1| PREDICTED: uncharacterized protein LOC101301714 [Fragaria vesca 
subsp. vesca]
Length=421

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/422 (68%), Positives = 339/422 (80%), Gaps = 13/422 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR++++S+A+KLP ATKPA  GVH STTPC+ ++K  +FP QTALL L ++   
Sbjct  1     MDPCPFVRVMVDSLALKLPHATKPARSGVHSSTTPCFCEMKIKNFPPQTALLSLSTST--  58

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
              + S P  S  SA GF+LDP+ALRRLS KP+ L++SV+ GRMG TCG+TSGKLLG V ++
Sbjct  59    -NDSPPDSSTTSAHGFNLDPTALRRLSGKPITLRVSVYTGRMGSTCGVTSGKLLGRVNLS  117

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             +DL  A++ P +  +GW KLG   +DKP   LH+VVR+EPDPRFVFQFGGEPECSPV+FQ
Sbjct  118   IDLDAAKTSPRMIHNGWMKLGKH-SDKPSARLHMVVRAEPDPRFVFQFGGEPECSPVIFQ  176

Query  1033  IQG-SIRQPVFSCKFSAERNNRTRSLPSDF-SLNSRGWMRTFSGDRDRPGKERKGWMIII  860
             IQG  I+QPVFSCKFSA+RN+R RSLP DF S N+RGW RTFSG+R+RPG+ERKGWMI I
Sbjct  177   IQGRDIQQPVFSCKFSADRNSRFRSLPPDFTSKNNRGWRRTFSGERERPGRERKGWMITI  236

Query  859   YDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERG  680
             +DLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRP+G SV++WKPWGRLEAWRERG
Sbjct  237   HDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGFSVNNWKPWGRLEAWRERG  296

Query  679   SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSAS---SLSPVRGFVM  509
              VDGLGYKFELVTD G +S I IAE  +++KKGG FCID+          S SPV+GFVM
Sbjct  297   PVDGLGYKFELVTDNGPSSSITIAEATLSMKKGGEFCIDSRLLRDQGLNYSRSPVKGFVM  356

Query  508   CSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDE  335
              SSVEG+       VQV V HV CMADAALFVALSAAIDLSMDAC+LFS KLRKE C+DE
Sbjct  357   GSSVEGEGKVSKPMVQVGVQHVTCMADAALFVALSAAIDLSMDACKLFSHKLRKELCYDE  416

Query  334   HD  329
              +
Sbjct  417   QN  418



>ref|XP_010688362.1| PREDICTED: uncharacterized protein LOC104902329 [Beta vulgaris 
subsp. vulgaris]
Length=426

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/429 (66%), Positives = 338/429 (79%), Gaps = 17/429 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKP-AGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDPCPF RLIIES+A++LP   KP AG GVHPSTTPCY K+    FPS+TALLPL    P
Sbjct  1     MDPCPFARLIIESLALQLPLGGKPSAGAGVHPSTTPCYCKITLKGFPSETALLPLS---P  57

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQV  1211
               +  SP +S  SA  FHLD  ALRR++ +P++L++ +++GRMGQTCG+TSGKL+G + +
Sbjct  58    GGEGPSPPESTTSAPEFHLDSGALRRMAGRPISLRVCIYSGRMGQTCGVTSGKLIGRINL  117

Query  1210  AVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPVVFQI  1031
              VD+ GA+ +P+VF SGW  L         LH+VVRSEPDPRFVFQFGGEPECSPVVFQI
Sbjct  118   CVDVKGAEVKPIVFHSGWMGLEKNNGGHAKLHLVVRSEPDPRFVFQFGGEPECSPVVFQI  177

Query  1030  QGSIRQPVFSCKFSAERNNRTRSLPSDFSLN-----SRGWM-RTFSGDRDRPGKERKGWM  869
             QG+IRQPVFSCKFSA+RN+R+RSLP++F+++     +R WM R+ SG++D+P +ERKGWM
Sbjct  178   QGNIRQPVFSCKFSADRNSRSRSLPANFAISNNNNNNRKWMVRSLSGEKDKPARERKGWM  237

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I+IYDLSGS VAAAS+ITPFVPSPGSDRVSRSNPGAWLILRP+G  V++WKPWGRLEAWR
Sbjct  238   IMIYDLSGSPVAAASVITPFVPSPGSDRVSRSNPGAWLILRPHGSHVNNWKPWGRLEAWR  297

Query  688   ERGSVDGLGYKFELVTDAGFT-SGIPIAEGAMNVKKGGRFCIDNARKHSASSL---SPVR  521
             ERG VDGLGYKFELVT+ G T +GIPIAE  M++KKGG+FCID  R  S   +   SPVR
Sbjct  298   ERGPVDGLGYKFELVTEDGPTRTGIPIAEATMSIKKGGKFCIDK-RDSSLEEVMVRSPVR  356

Query  520   GFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             GFVM S+VEG+       VQV + HV CMADA LFVALSAAIDLSMDAC+LFS KLRKE 
Sbjct  357   GFVMGSTVEGEGKISKPLVQVGMQHVTCMADAGLFVALSAAIDLSMDACRLFSQKLRKEL  416

Query  346   CHDEHDSYF  320
             C+DE    F
Sbjct  417   CYDEQHDLF  425



>gb|KHG26934.1| hypothetical protein F383_08453 [Gossypium arboreum]
Length=422

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/426 (67%), Positives = 335/426 (79%), Gaps = 18/426 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKP---AGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSA  1397
             MDPCPF+RLIIES+A+KLP  TKP   A  GV+P+TTPC+ KL+  +F SQTALLPL + 
Sbjct  1     MDPCPFLRLIIESLALKLPQPTKPVAVASGGVYPTTTPCFCKLRLKNFQSQTALLPLSNG  60

Query  1396  LPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVV  1217
                    SP +S  SA GFHLD   LRR+S KPV L + VF GRMG++CG+ SGKL+G V
Sbjct  61    ----SGDSPPESSTSAAGFHLDALTLRRVSGKPVTLCVEVFTGRMGRSCGVNSGKLVGSV  116

Query  1216  QVAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPV  1043
             QV V L  +Q+RP VFQ GW KLG    +KP   LH+ VR+E DPRFVFQFGGEPECSPV
Sbjct  117   QVTVHLGVSQTRPAVFQDGWMKLGND-HEKPSAKLHLTVRTELDPRFVFQFGGEPECSPV  175

Query  1042  VFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMII  863
             VFQIQG+I QPVFSCKFSA+R+ R+RSLP +FS  +RGWMRT + +++R G+ERKGWM++
Sbjct  176   VFQIQGNISQPVFSCKFSADRS-RSRSLPPNFSNKNRGWMRTLAREKERQGRERKGWMVM  234

Query  862   IYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRER  683
             IYDLSGS VAAASMITPFVPSPG+DRVSRSNPGAWLILRP+G SVSSWKPWGRLEAWRER
Sbjct  235   IYDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRER  294

Query  682   GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-----NARKHSASSLSPVRG  518
             G VDGLGYKFELVTD G ++G+PIAE  M+VKKGG FCID     +    S SS SP++G
Sbjct  295   GPVDGLGYKFELVTDNGPSNGVPIAEATMSVKKGGLFCIDRRVSKSDSAASTSSRSPIKG  354

Query  517   FVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             FVM S+VEG+       VQV + HV CMADAALF+ALSAAIDLSMDAC+LFS KLRKE C
Sbjct  355   FVMGSTVEGEGKVSKPMVQVGIQHVTCMADAALFIALSAAIDLSMDACRLFSRKLRKELC  414

Query  343   HDEHDS  326
             HDE DS
Sbjct  415   HDEQDS  420



>ref|XP_009352575.1| PREDICTED: uncharacterized protein LOC103943924 [Pyrus x bretschneideri]
Length=420

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/424 (67%), Positives = 336/424 (79%), Gaps = 14/424 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL ++S+A+KLP AT+PAG  VH STTPC+ +LK  +FP QT+++ L ++   
Sbjct  1     MDPCPFVRLNVDSLALKLPHATRPAGQRVHSSTTPCFCQLKIKNFPPQTSIVNLSTST--  58

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 SP +S  SA GFH+DP+ LRRL+ K VAL++SV+ GRMGQTCG+ SGKLLG VQ+ 
Sbjct  59    --GDSPPESSTSAPGFHVDPTMLRRLAGKTVALRVSVYTGRMGQTCGVASGKLLGRVQLN  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             +DL+ A+++     SGW KLG    DKP   LH+ VR+EPDPRFVFQFGGEPECSPV+FQ
Sbjct  117   IDLNSAKAQSTAIHSGWVKLGKD-CDKPSARLHLTVRAEPDPRFVFQFGGEPECSPVIFQ  175

Query  1033  IQG-SIRQPVFSCKFSAERNNRTRSLPSDFSL--NSRGWMRTFSGDRDRPGKERKGWMII  863
             IQG  IRQPVFSCKFSA+RN+R RSL SD+S   N+RGWMRT SGD ++P +ERKGWMI 
Sbjct  176   IQGRDIRQPVFSCKFSADRNSRNRSLQSDYSTINNNRGWMRTLSGDTEKPWRERKGWMIT  235

Query  862   IYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRER  683
             I+DLSGS VAAASMITPFVPSPG+DRVSRSNPGAWLILRP+G S+SSWKPWGRLEAWRER
Sbjct  236   IHDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSISSWKPWGRLEAWRER  295

Query  682   GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDN--ARKHSASSLSPVRGFVM  509
             G +DGLGYKFELVTD G +S I IAEG ++VKKGG+FCID+   R     S SPV+GFV 
Sbjct  296   GPIDGLGYKFELVTDNGPSSSITIAEGTLSVKKGGQFCIDSRLNRDSGLKSRSPVKGFVT  355

Query  508   CSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDE  335
              S+VEG+       VQV V HV CMADAALFVALSAAIDLSMDAC+LFS KLRKE CHDE
Sbjct  356   GSTVEGEGKVSKPVVQVGVQHVTCMADAALFVALSAAIDLSMDACRLFSHKLRKELCHDE  415

Query  334   HDSY  323
              + +
Sbjct  416   QNCF  419



>ref|XP_006412853.1| hypothetical protein EUTSA_v10025288mg [Eutrema salsugineum]
 gb|ESQ54306.1| hypothetical protein EUTSA_v10025288mg [Eutrema salsugineum]
Length=424

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/426 (67%), Positives = 336/426 (79%), Gaps = 16/426 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSAT--KPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL I+S+A++LP  T  K  G  VHPS+TPCY KL+   FPSQ ALLPL S  
Sbjct  1     MDPCPFVRLTIDSLALRLPETTTNKQIGGEVHPSSTPCYCKLRIKHFPSQKALLPLSSF-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D+SSP +S  SA GFHLD  A+RR+S K ++L++SV++GR G TCG+ SGKLLG V+
Sbjct  60    --SDASSPPESSTSAPGFHLDADAIRRVSGKKISLRVSVYSGRTGHTCGVASGKLLGRVE  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             V VDL+ A SR V F SGWKKLGG G DKP   LH++VR+EPDPRFVFQFGGEPECSPVV
Sbjct  118   VTVDLAAALSRTVAFHSGWKKLGGEG-DKPSARLHLLVRAEPDPRFVFQFGGEPECSPVV  176

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGDR--DRPGKERKGWM  869
             +QIQG+I+QPVFSCKFS++RN R+RSLPS F+ +SRGW+ RT SGD+   + G+ERKGWM
Sbjct  177   YQIQGNIKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQGRERKGWM  236

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I I+DLSGS VAAASMITPFV SPGSDRVSRSNPGAWLILRP+G  VSSWKPWGRLEAWR
Sbjct  237   ITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWR  296

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID---NARKHSASSLSPVRG  518
             ERG++DGLGYKFELV D   ++GIPIAEG MN K+GG+F ID   + +  S +  SPV+G
Sbjct  297   ERGAIDGLGYKFELVRDNSTSTGIPIAEGTMNTKQGGKFSIDRRVSGQGESPARSSPVKG  356

Query  517   FVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             FVM SSVEG+       V V   HV CMADAALFVALSAA+DLS+DACQLFS KLRKE C
Sbjct  357   FVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFSRKLRKELC  416

Query  343   HDEHDS  326
             HD+  S
Sbjct  417   HDDQSS  422



>ref|XP_010433108.1| PREDICTED: uncharacterized protein LOC104717264 [Camelina sativa]
Length=425

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/426 (66%), Positives = 335/426 (79%), Gaps = 15/426 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL I+S+A++LP  +  K  G  VHPS+TPCY KL+   FPSQ ALLPL S  
Sbjct  1     MDPCPFVRLTIDSLALRLPETATNKQIGGEVHPSSTPCYCKLRIKHFPSQKALLPLSSF-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D+SSP +S  SA GFHLD  A+RR+S K ++L++SV+AGR G TCG+ SGKLLG V+
Sbjct  60    --SDASSPPESSTSAPGFHLDAEAIRRVSGKKISLRVSVYAGRTGHTCGVASGKLLGRVE  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             VAVDL+ A SR V F SGWKKLGG G DKP   LH++VR+EPDPRFVFQFGGEPECSPVV
Sbjct  118   VAVDLAAALSRTVAFHSGWKKLGGDGGDKPSARLHLLVRAEPDPRFVFQFGGEPECSPVV  177

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGDR--DRPGKERKGWM  869
             +QIQ +++QPVFSCKFS++RN R+RSLPS F+ +SRGW+ RT SGD+   +  +ERKGWM
Sbjct  178   YQIQDNLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWM  237

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I I+DLSGS VAAASMITPFV SPGSDRVSRSNPGAWLILRP+G  VSSWKPWGRLEAWR
Sbjct  238   ITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWR  297

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID---NARKHSASSLSPVRG  518
             ERG++DGLGYKFELV D   ++GIPIAEG M+ K+GG+F ID   + +  S +  SPV+G
Sbjct  298   ERGAIDGLGYKFELVRDNSTSTGIPIAEGTMSTKQGGKFSIDRRVSGQGESPAISSPVKG  357

Query  517   FVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             FVM SSVEG+       V V   HV CMADAALFVALSAA+DLS+DACQLFS KLRKE C
Sbjct  358   FVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFSRKLRKELC  417

Query  343   HDEHDS  326
             HD+  S
Sbjct  418   HDDQSS  423



>ref|XP_010438312.1| PREDICTED: uncharacterized protein LOC104721933 [Camelina sativa]
Length=425

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/426 (66%), Positives = 335/426 (79%), Gaps = 15/426 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL I+S+A++LP  +  K  G  VHPS+TPCY KL+   FPSQ ALLPL S  
Sbjct  1     MDPCPFVRLTIDSLALRLPETATNKQIGGEVHPSSTPCYCKLRIKHFPSQKALLPLSSF-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D+SSP +S  SA GFHLD  A+RR+S K ++L++SV+AGR G TCG+ SGKLLG V+
Sbjct  60    --SDASSPPESSTSAPGFHLDADAIRRVSGKKISLRVSVYAGRTGHTCGVASGKLLGRVE  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             VAVDL+ A SR V F SGWKKLGG G DKP   LH++VR+EPDPRFVFQFGGEPECSPVV
Sbjct  118   VAVDLAAALSRTVAFHSGWKKLGGDGGDKPSARLHLLVRAEPDPRFVFQFGGEPECSPVV  177

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGDR--DRPGKERKGWM  869
             +QIQ +++QPVFSCKFS++RN R+RSLPS F+ +SRGW+ RT SGD+   +  +ERKGWM
Sbjct  178   YQIQDNLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWM  237

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I I+DLSGS VAAASMITPFV SPGSDRVSRSNPGAWLILRP+G  VSSWKPWGRLEAWR
Sbjct  238   ITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWR  297

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID---NARKHSASSLSPVRG  518
             ERG++DGLGYKFELV D   ++GIPIAEG M+ K+GG+F ID   + +  S +  SPV+G
Sbjct  298   ERGAIDGLGYKFELVRDNSTSTGIPIAEGTMSTKQGGKFSIDRRVSGQGESPAISSPVKG  357

Query  517   FVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             FVM SSVEG+       V V   HV CMADAALFVALSAA+DLS+DACQLFS KLRKE C
Sbjct  358   FVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFSRKLRKELC  417

Query  343   HDEHDS  326
             HD+  S
Sbjct  418   HDDQSS  423



>ref|XP_008337614.1| PREDICTED: uncharacterized protein LOC103400735 [Malus domestica]
Length=418

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/424 (67%), Positives = 334/424 (79%), Gaps = 16/424 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL ++S+A+KLP AT+PAGPGVH STTPC+  LK  +FP QT+++ L ++   
Sbjct  1     MDPCPFVRLNVDSLALKLPHATRPAGPGVHSSTTPCFCXLKIKNFPPQTSIVNLSTST--  58

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 SP +S  SA GFH+DP+ LRRL+ K VAL++SV+ GRMGQTCG+TSGKLLG VQ+ 
Sbjct  59    --GDSPPESSTSAPGFHVDPTMLRRLAGKTVALRVSVYTGRMGQTCGVTSGKLLGRVQLN  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             +DL+ A++      SGW KLG    DKP   LH+ VR+EPDPRFVFQFGGEPECSPV+FQ
Sbjct  117   IDLNSAKAHXTAIHSGWVKLGKD-CDKPSARLHLXVRAEPDPRFVFQFGGEPECSPVIFQ  175

Query  1033  IQG-SIRQPVFSCKFSAERNNRTRSLPSDFSL--NSRGWMRTFSGDRDRPGKERKGWMII  863
             IQG  IRQPVFSCKFSA+RN+R RSL SD++   N+RGWMRT SG++  P +ERKGWMI 
Sbjct  176   IQGRDIRQPVFSCKFSADRNSRNRSLQSDYTTINNNRGWMRTLSGEK--PWRERKGWMIT  233

Query  862   IYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRER  683
             I+DLSGS VAAASMITPFVPSPG+DRVSRSNPGAWLILRP+G S+SSWKPWGRLEAWRER
Sbjct  234   IHDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSISSWKPWGRLEAWRER  293

Query  682   GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDN--ARKHSASSLSPVRGFVM  509
             G +DGLGYKFELVTD G +S I IAEG M+VKKGG+FCID+   R     S SPV+GFV 
Sbjct  294   GPIDGLGYKFELVTDNGPSSSITIAEGTMSVKKGGQFCIDSRLNRDSGLKSRSPVKGFVT  353

Query  508   CSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDE  335
              S+VEG        VQV V HV C ADAALFVALSAAIDLSMDAC+LFS KLR+E CHDE
Sbjct  354   GSTVEGXGKVSKPVVQVGVQHVTCXADAALFVALSAAIDLSMDACRLFSHKLRRELCHDE  413

Query  334   HDSY  323
              + +
Sbjct  414   QNCF  417



>ref|XP_010526420.1| PREDICTED: uncharacterized protein LOC104803996 [Tarenaya hassleriana]
Length=420

 Score =   528 bits (1360),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 292/422 (69%), Positives = 336/422 (80%), Gaps = 16/422 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL ++S+A+KLP  ++ KP+G GVHPS TPCY KL+   FPSQTA       L
Sbjct  1     MDPCPFVRLTVDSLALKLPETASNKPSGGGVHPSATPCYCKLRIKHFPSQTA------LL  54

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
             P   SSSP +S AS+ GFHLD  ALRR+S K + L++SV+AGRMG+TCG+ SGKLLG V 
Sbjct  55    PLSSSSSPPESAASSPGFHLDAEALRRISGKKIPLRVSVYAGRMGRTCGVASGKLLGRVD  114

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGA-DKP--MLHVVVRSEPDPRFVFQFGGEPECSPV  1043
             VAVDL+ A +R VVF SGWKKLGG G  +KP   LH+VV++EPDPRFVFQFGGEPECSPV
Sbjct  115   VAVDLAAAIARTVVFHSGWKKLGGDGEKEKPSARLHLVVKAEPDPRFVFQFGGEPECSPV  174

Query  1042  VFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGD--RDRPGKERKGW  872
             VFQIQG+IRQPVFSCKFSA+RN R+RSLPS F+ +SRGW+ RT SG+    +  KERKGW
Sbjct  175   VFQIQGNIRQPVFSCKFSADRNGRSRSLPSGFTYSSRGWITRTLSGETREKKQAKERKGW  234

Query  871   MIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAW  692
             MI I+DLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRP+G SVSSWKPWGRLEAW
Sbjct  235   MITIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGNSVSSWKPWGRLEAW  294

Query  691   RERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPVRGFV  512
             RERG++DGLGY FELV D   T+ IPIAEG M+VK+GG+F ID+         SPV+GFV
Sbjct  295   RERGAIDGLGYSFELVRDNTTTTRIPIAEGTMSVKRGGKFSIDSKLTREIQRSSPVKGFV  354

Query  511   MCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
             M SSVEG+       V+V   HV CMADAALFVALSAA+DLSMDACQLFS KLRKE CHD
Sbjct  355   MGSSVEGEGKVSKPVVEVGAQHVTCMADAALFVALSAAVDLSMDACQLFSRKLRKELCHD  414

Query  337   EH  332
             EH
Sbjct  415   EH  416



>ref|XP_002867413.1| hypothetical protein ARALYDRAFT_913577 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43672.1| hypothetical protein ARALYDRAFT_913577 [Arabidopsis lyrata subsp. 
lyrata]
Length=424

 Score =   528 bits (1360),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 282/426 (66%), Positives = 335/426 (79%), Gaps = 16/426 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL I+S+A++LP  +  K  G  VHPS+TPCY KL+   FPSQ ALLPL S  
Sbjct  1     MDPCPFVRLTIDSLALRLPETATNKQIGGEVHPSSTPCYCKLRIKHFPSQKALLPLSSF-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D+SSP +S  SA GFHLD  A+RR+S K ++L++SV+AGR G TCG+ SGKLLG V+
Sbjct  60    --SDASSPPESSTSAPGFHLDAEAIRRVSGKKISLRVSVYAGRTGHTCGVASGKLLGKVE  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             VAVDL+ A SR V F +GWKKLGG G DKP   LH++VR+EPDPRFVFQFGGEPECSPVV
Sbjct  118   VAVDLAAALSRTVAFHNGWKKLGGEG-DKPSARLHLLVRAEPDPRFVFQFGGEPECSPVV  176

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGDR--DRPGKERKGWM  869
             +QIQ +++QPVFSCKFS++RN R+RSLPS F+ +SRGW+ RT SGD+   +  +ERKGWM
Sbjct  177   YQIQDNLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWM  236

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I I+DLSGS VAAASMITPFV SPGSDRVSRSNPGAWLILRP+G  VSSWKPWGRLEAWR
Sbjct  237   ITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWR  296

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID---NARKHSASSLSPVRG  518
             ERG++DGLGYKFELV D   ++GIPIAEG M+ K+GG+F ID   + +  S +  SPV+G
Sbjct  297   ERGAIDGLGYKFELVRDNSTSTGIPIAEGTMSTKQGGKFSIDRRVSGQGESPAISSPVKG  356

Query  517   FVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             FVM SSVEG+       V V   HV CMADAALFVALSAA+DLS+DACQLFS KLRKE C
Sbjct  357   FVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFSRKLRKELC  416

Query  343   HDEHDS  326
             HD+  S
Sbjct  417   HDDQSS  422



>gb|KFK29490.1| hypothetical protein AALP_AA7G141200 [Arabis alpina]
Length=424

 Score =   527 bits (1358),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 281/426 (66%), Positives = 335/426 (79%), Gaps = 16/426 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL I+S+A++LP  +  K  G  VHPS TPCY KL+   FPSQ ALLPL S  
Sbjct  1     MDPCPFVRLTIDSLALRLPETATNKQIGGEVHPSATPCYCKLRIKHFPSQKALLPLSSF-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D+SSP +S  SA GFHLD  A+RR++ K ++L++SV+AGR   TCG++SGKLLG V+
Sbjct  60    --SDASSPPESSTSAPGFHLDADAIRRVTGKKISLRVSVYAGRTSHTCGVSSGKLLGKVE  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             VAVDL+ A SR V F +GW KLGG G DKP   LH++VR+EPDPRFVFQFGGEPECSPVV
Sbjct  118   VAVDLAAALSRTVAFHNGWMKLGGEG-DKPSARLHLLVRAEPDPRFVFQFGGEPECSPVV  176

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGDR--DRPGKERKGWM  869
             +QIQG+I+QPVFSCKFS++RN R+RSLPS F+ +SRGWM RT SGD+   +  +ERKGWM
Sbjct  177   YQIQGNIKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWMTRTLSGDQWEKKQARERKGWM  236

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I I+DLSGS VAAASMITPFV SPGSDRVSRSNPGAWLILRP+G  VSSWKPWGRLEAWR
Sbjct  237   ITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWR  296

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID---NARKHSASSLSPVRG  518
             ERG++DGLGYKFELV+D   ++GIPIA+G M+ K+GG+F ID   + +  S +  SPV+G
Sbjct  297   ERGTIDGLGYKFELVSDNSTSTGIPIAQGTMSTKQGGKFSIDRRVSGQGESPARSSPVKG  356

Query  517   FVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             FVM SSVEG+       V V   HV CMADAALFVALSAA+DLS+DACQLFS KLRKE C
Sbjct  357   FVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFSRKLRKELC  416

Query  343   HDEHDS  326
             HD+  S
Sbjct  417   HDDQSS  422



>ref|NP_194660.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB79689.1| putative protein [Arabidopsis thaliana]
 gb|AAM13213.1| unknown protein [Arabidopsis thaliana]
 gb|AAO30065.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85617.1| uncharacterized protein AT4G29310 [Arabidopsis thaliana]
Length=424

 Score =   524 bits (1349),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 281/426 (66%), Positives = 334/426 (78%), Gaps = 16/426 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL I+S+A++LP  +  K  G  VHPS+TPCY KL+   FPSQ ALLPL S  
Sbjct  1     MDPCPFVRLTIDSLALRLPETATNKQIGGEVHPSSTPCYCKLRIKHFPSQKALLPLSSF-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D+SSP +S  SA GFHLD  A+RR+S K ++L++SV+AGR G TCG+ SGKLLG V+
Sbjct  60    --SDASSPPESSTSAPGFHLDADAIRRISGKKISLRVSVYAGRTGHTCGVASGKLLGKVE  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             VAVDL+ A SR V F +GWKKLGG G DKP   LH++V +EPDPRFVFQFGGEPECSPVV
Sbjct  118   VAVDLAAALSRTVAFHNGWKKLGGDG-DKPSARLHLLVCAEPDPRFVFQFGGEPECSPVV  176

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGDR--DRPGKERKGWM  869
             +QIQ +++QPVFSCKFS++RN R+RSLPS F+ +SRGW+ RT SGD+   +  +ERKGWM
Sbjct  177   YQIQDNLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWM  236

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I I+DLSGS VAAASMITPFV SPGSDRVSRSNPGAWLILRP+G  VSSWKPWGRLEAWR
Sbjct  237   ITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWR  296

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID---NARKHSASSLSPVRG  518
             ERG++DGLGYKFELV D   ++GIPIAEG M+ K+GG+F ID   + +  S +  SPV+G
Sbjct  297   ERGAIDGLGYKFELVRDNSTSTGIPIAEGTMSTKQGGKFSIDRRVSGQGESPAISSPVKG  356

Query  517   FVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             FVM SSVEG+       V V   HV CMADAALFVALSAA+DLS+DACQLFS KLRKE C
Sbjct  357   FVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFSRKLRKELC  416

Query  343   HDEHDS  326
             HD+  S
Sbjct  417   HDDQSS  422



>ref|XP_006283793.1| hypothetical protein CARUB_v10004884mg [Capsella rubella]
 gb|EOA16691.1| hypothetical protein CARUB_v10004884mg [Capsella rubella]
Length=424

 Score =   522 bits (1345),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 280/426 (66%), Positives = 333/426 (78%), Gaps = 16/426 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL I+S+A++LP  +  K  G  VHPS+TPCY KL+   FPSQ ALLPL S  
Sbjct  1     MDPCPFVRLTIDSLALRLPETATNKQIGGEVHPSSTPCYCKLRIKHFPSQKALLPLSSF-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D+SSP +S  SA GFHLD  A+RR+S K ++L++SV+AGR G +CG+ SGKLLG V+
Sbjct  60    --SDASSPPESSTSAPGFHLDADAIRRVSGKKISLRVSVYAGRTGHSCGVASGKLLGRVE  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             VAVDL+ A +R V F SGWKKLGG G DKP   LH++VR+EPDPRFVFQFGGEPECSPVV
Sbjct  118   VAVDLAAALTRTVAFHSGWKKLGGDG-DKPSARLHLLVRAEPDPRFVFQFGGEPECSPVV  176

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGDR--DRPGKERKGWM  869
             +QIQ +++QPVFSCKFS++RN R+RSLPS F+ +SRGW+ RT SGD+   +  +ERKGWM
Sbjct  177   YQIQDNLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWM  236

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I I+DLSGS VAAASMITPFV SPGSDRVSRSNPGAWLILRP+G  VSSWKPWGRLEAWR
Sbjct  237   ITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWR  296

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID---NARKHSASSLSPVRG  518
             ERG++DGLGYKFELV D   ++G PIAEG M+ K GG+F ID   + +  S +  SPV+G
Sbjct  297   ERGAIDGLGYKFELVRDNSTSTGNPIAEGTMSTKLGGKFSIDRRVSGQGESPAISSPVKG  356

Query  517   FVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             FVM SSVEG+       V V   HV CMADAALFVALSAA+DLS+DACQLFS KLRKE C
Sbjct  357   FVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFSRKLRKELC  416

Query  343   HDEHDS  326
             HD+  S
Sbjct  417   HDDQSS  422



>emb|CDY48610.1| BnaA01g07550D [Brassica napus]
Length=424

 Score =   522 bits (1344),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 285/426 (67%), Positives = 336/426 (79%), Gaps = 16/426 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL I+S+A++LP  +  K  G  VHPS TPCY KL+   FPSQ ALLPL S  
Sbjct  1     MDPCPFVRLTIDSLALRLPETATNKQVGGEVHPSATPCYCKLRIKHFPSQRALLPLSSIS  60

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D+SSP DS  SA GFHLD  A+RR+S K ++L++SV+AGR G TCG+ SGKLLG V+
Sbjct  61    ---DASSPPDSSTSAPGFHLDADAIRRVSGKKISLRVSVYAGRTGHTCGVASGKLLGRVE  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             VAVDL+ A SR V F +GWKKLGG G DKP   LH++VR+EPDPRFVFQFGGEPECSPVV
Sbjct  118   VAVDLAAALSRTVAFHNGWKKLGGDG-DKPSARLHLLVRAEPDPRFVFQFGGEPECSPVV  176

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGDR--DRPGKERKGWM  869
             +QIQG+I+QPVFSCKFS++RN R+RSLPS F+ +SRGW+ RT SGD+   +  +ERKGWM
Sbjct  177   YQIQGNIKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWM  236

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I I+DLSGS VAAASMITPFV SPGSDRVSRSNPGAWLILRP+G  VSSWKPWGRLEAWR
Sbjct  237   ITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWR  296

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID---NARKHSASSLSPVRG  518
             ERG+VDGLGYKFELVT+   ++G+PIAEG MN ++GG+F ID   + +  S +  SPV+G
Sbjct  297   ERGAVDGLGYKFELVTNNSTSTGVPIAEGTMNTRQGGKFIIDRRVSGQGESPARSSPVKG  356

Query  517   FVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             FVM SSVEG+       V V   HV CMADAALFVALSAA+DLS+DACQLFS KLRKE C
Sbjct  357   FVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFSRKLRKELC  416

Query  343   HDEHDS  326
             HD+  S
Sbjct  417   HDDQSS  422



>emb|CDY06823.1| BnaC01g09220D [Brassica napus]
Length=425

 Score =   520 bits (1338),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 288/427 (67%), Positives = 336/427 (79%), Gaps = 17/427 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL I+S+A++LP  +  K  G  VHPS TPCY KL+   FPSQ ALLPL S  
Sbjct  1     MDPCPFVRLTIDSLALRLPETATNKQVGGEVHPSATPCYCKLRIKHFPSQRALLPLSSIS  60

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D+SSP DS  SA GFHLD  A+RR+S K ++L++SV+AGR G TCG+ SGKLLG V+
Sbjct  61    ---DASSPPDSSTSAPGFHLDADAIRRVSGKKISLRVSVYAGRTGHTCGVASGKLLGRVE  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             VAVDL+ A SR V F +GWKKLGG G DKP   LH++VR+EPDPRFVFQFGGEPECSPVV
Sbjct  118   VAVDLAAALSRTVAFHNGWKKLGGDG-DKPSARLHLLVRAEPDPRFVFQFGGEPECSPVV  176

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGDR--DRPGKERKGWM  869
             +QIQG+I+QPVFSCKFS++RN R+RSLPS F+ +SRGW+ RT SGD+   +  +ERKGWM
Sbjct  177   YQIQGNIKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWM  236

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I I+DLSGS VAAASMITPFV SPGSDRVSRSNPGAWLILRP+G  VSSWKPWGRLEAWR
Sbjct  237   ITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWR  296

Query  688   ERGSVDGLGYKFELVTDAGFTS-GIPIAEGAMNVKKGGRFCID---NARKHSASSLSPVR  521
             ERG+VDGLGYKFELVTD   TS G+PIAEG M+ K+GG+F ID   + +  S +  SPV+
Sbjct  297   ERGAVDGLGYKFELVTDNTSTSTGVPIAEGTMSTKQGGKFIIDRRVSGQGESPARSSPVK  356

Query  520   GFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             GFVM SSVEG+       V V   HV CMADAALFVALSAA+DLS+DACQLFS KLRKE 
Sbjct  357   GFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFSRKLRKEL  416

Query  346   CHDEHDS  326
             CHD+  S
Sbjct  417   CHDDQSS  423



>emb|CBI27979.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   518 bits (1333),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 256/344 (74%), Positives = 297/344 (86%), Gaps = 8/344 (2%)
 Frame = -2

Query  1588  SLCGLKKMDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLP  1409
             SL G + MDPCPFVRLI+ES+A+KLP AT+PAG GVHPSTTPC+ KL+  +FPSQTALLP
Sbjct  12    SLLG-RSMDPCPFVRLIVESLALKLPQATRPAGSGVHPSTTPCFCKLRIKNFPSQTALLP  70

Query  1408  LCSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKL  1229
             LCS+       SP DS  S+ GFHLD + LRRLS KP+ L++SV+ GRMG+TCG++SGKL
Sbjct  71    LCSS---GGDPSP-DSTISSAGFHLDSALLRRLSGKPLTLRVSVYTGRMGRTCGVSSGKL  126

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPE  1055
             LG V V ++L GA+SRP VFQ+GW KLG     KP   LH+VVRSEPDPRFVFQFGGEPE
Sbjct  127   LGRVHVMINLDGAESRPNVFQNGWLKLGNE-TSKPSARLHLVVRSEPDPRFVFQFGGEPE  185

Query  1054  CSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKG  875
             CSPVVFQIQG+IRQPVFSCKFSA+RN+R+RSL SDF+ N+RGWMR+FS +R+RPG+ERKG
Sbjct  186   CSPVVFQIQGNIRQPVFSCKFSADRNSRSRSLASDFNSNNRGWMRSFSNERERPGRERKG  245

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEA  695
             WMI+IYDLSGS VA+ASMITPFVPSPGSDRVSRSNPGAWLILRP+G SVSSWKPWGRLEA
Sbjct  246   WMIMIYDLSGSPVASASMITPFVPSPGSDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEA  305

Query  694   WRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID  563
             WRERG +DGLGYKFELVTD+G TSGIPIAE  MN+K+GG+FCID
Sbjct  306   WRERGPIDGLGYKFELVTDSGPTSGIPIAESTMNIKRGGQFCID  349



>ref|XP_010447867.1| PREDICTED: uncharacterized protein LOC104730404 [Camelina sativa]
Length=474

 Score =   521 bits (1342),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 282/429 (66%), Positives = 335/429 (78%), Gaps = 16/429 (4%)
 Frame = -2

Query  1573  KKMDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCS  1400
             K+MDPCPFVRL I+S+A++LP  +  K  G  VHPS+TPCY KL+   FPSQ  LLPL S
Sbjct  47    KRMDPCPFVRLTIDSLALRLPETATNKQIGGEVHPSSTPCYCKLRIKHFPSQKTLLPLSS  106

Query  1399  ALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGV  1220
                  D+SSP +S  SA GFHLD  A+RR+S K ++L++SV+AGR G TCG+ SGKLLG 
Sbjct  107   F---SDASSPPESSTSAPGFHLDADAIRRVSGKKISLRVSVYAGRTGHTCGVASGKLLGR  163

Query  1219  VQVAVDLSGAQSRPVVFQSGWKKLGGGGAD-KP--MLHVVVRSEPDPRFVFQFGGEPECS  1049
             V+VAVDL+ A SR V F SGWKKLGG G   KP   LH++VR+EPDPRFVFQFGGEPECS
Sbjct  164   VEVAVDLAAALSRTVAFHSGWKKLGGDGGGDKPSARLHLLVRAEPDPRFVFQFGGEPECS  223

Query  1048  PVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGDR--DRPGKERK  878
             PVV+QIQ +++QPVFSCKFS++RN R+RSLPS F+ +SRGW+ RT SGD+   +  +ERK
Sbjct  224   PVVYQIQDNLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERK  283

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GWMI I+DLSGS VAAASMITPFV SPGSDRVSRSNPGAWLILRP+G  VSSWKPWGRLE
Sbjct  284   GWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLE  343

Query  697   AWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID---NARKHSASSLSP  527
             AWRERG++DGLGYKFELV D   ++GIPIAEG M+ K+GG+F ID   + +  S +  SP
Sbjct  344   AWRERGAIDGLGYKFELVRDNSTSTGIPIAEGTMSTKQGGKFSIDRRVSGQGESPAISSP  403

Query  526   VRGFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRK  353
             V+GFVM SSVEG+       V V   HV CMADAALFVALSAA+DLS+DACQLFS KLRK
Sbjct  404   VKGFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFSRKLRK  463

Query  352   EFCHDEHDS  326
             E CHD+  S
Sbjct  464   ELCHDDQSS  472



>ref|XP_009128862.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103853708 
[Brassica rapa]
Length=429

 Score =   515 bits (1327),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 283/431 (66%), Positives = 336/431 (78%), Gaps = 21/431 (5%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL I+S+A++LP  +  K  G  VHPS TPCY KL+   FPSQ ALLPL S  
Sbjct  1     MDPCPFVRLTIDSLALRLPETATNKQVGGEVHPSATPCYCKLRIKHFPSQRALLPLSSIS  60

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D+SSP DS  SA GFHLD  A+RR+S K ++L++SV+AGR G TCG+ SGKLLG V+
Sbjct  61    ---DASSPPDSSTSAPGFHLDADAIRRVSGKKISLRVSVYAGRTGHTCGVASGKLLGRVE  117

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             VAVDL+ A SR V F +GWKKLGG G DKP   LH++VR+EPDPRFVFQFGGEPECSPVV
Sbjct  118   VAVDLAAALSRTVAFHNGWKKLGGDG-DKPSARLHLLVRAEPDPRFVFQFGGEPECSPVV  176

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM-RTFSGDR--DRPGKERKGWM  869
             +QIQG+I+QPVFSCKFS++RN R+RSLPS F+ +SRGW+ RT SGD+   +  +ERKGWM
Sbjct  177   YQIQGNIKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWM  236

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I I+DLSGS VAAASMITPFV SPGSDRVSRSNPGAWLILRP+G  VSSWKPWGRLEAWR
Sbjct  237   ITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWR  296

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID---NARKHSASSLSPVRG  518
             ERG+VDGLGYKFELVT+   ++G+PIAEG M+ ++GG+F ID   + +  S +  SPV+G
Sbjct  297   ERGAVDGLGYKFELVTNNSTSTGVPIAEGTMSTRQGGKFIIDRRVSGQGESPARSSPVKG  356

Query  517   FVMCSSVEGKNGFL-------SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKL  359
             FVM SSVEG+           +  V   HV CMADAALFVALSAA+DLS+DACQLFS KL
Sbjct  357   FVMGSSVEGEGKVSKPVVHVGAQHVTAQHVICMADAALFVALSAAVDLSVDACQLFSRKL  416

Query  358   RKEFCHDEHDS  326
             RKE CHD+  S
Sbjct  417   RKELCHDDQSS  427



>ref|XP_007160272.1| hypothetical protein PHAVU_002G307300g [Phaseolus vulgaris]
 gb|ESW32266.1| hypothetical protein PHAVU_002G307300g [Phaseolus vulgaris]
Length=419

 Score =   514 bits (1325),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 279/423 (66%), Positives = 320/423 (76%), Gaps = 15/423 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAG-PGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDPCPFVRLI+ES+A+KLPS TKP    GVHPSTTPC+ K++ ++FP+ TALLPL     
Sbjct  1     MDPCPFVRLIVESLALKLPSPTKPPPLSGVHPSTTPCFCKIRINTFPTHTALLPLSV---  57

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQV  1211
                S S  D+  SA  FHLDP+ALRRLS KP++L LSV+ G MG++C +   KLLG V  
Sbjct  58    ---SPSAPDTTTSAPAFHLDPAALRRLSGKPLSLVLSVYNGPMGRSCWVRGAKLLGRVHF  114

Query  1210  AVDLSGAQSRPVVFQSGWKKLGG---GGADKPMLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
              V+LS A S    F +GW  L G          LH++VRSEPDPRFVFQFGGEPECSPVV
Sbjct  115   TVNLSTALSHSNTFHNGWLNLAGPHSRNKSSAQLHLIVRSEPDPRFVFQFGGEPECSPVV  174

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIII  860
             +QIQG+IRQPVFSCKFSA+RN R+RSLPSDFS N  GW R+ +GDR+R GKERKGWMI+I
Sbjct  175   YQIQGNIRQPVFSCKFSADRNYRSRSLPSDFSSNGNGWRRSSTGDRERQGKERKGWMIMI  234

Query  859   YDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERG  680
             +DLSGS VAAASM+TPFVPSPGSDRVSRSNPGAWLILRPNG SVSSWKPWGRLEAWRERG
Sbjct  235   HDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASVSSWKPWGRLEAWRERG  294

Query  679   SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSAS---SLSPVRGFVM  509
              VDGLGYK EL +D+G  + +PIAEG ++VKKGG+FCID      A     L    GFVM
Sbjct  295   PVDGLGYKVELFSDSGPANRVPIAEGTVSVKKGGQFCIDYKVMKDAGLGWRLPGEEGFVM  354

Query  508   CSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDE  335
              SSV  EGK     VQV   H+ CMADAALF+ALSAAIDLSMDAC LFS KLRKE CH E
Sbjct  355   GSSVDGEGKVSKPVVQVGAQHITCMADAALFIALSAAIDLSMDACTLFSHKLRKELCHHE  414

Query  334   HDS  326
              +S
Sbjct  415   QNS  417



>ref|XP_010267102.1| PREDICTED: uncharacterized protein LOC104604464 [Nelumbo nucifera]
Length=417

 Score =   514 bits (1323),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 279/419 (67%), Positives = 324/419 (77%), Gaps = 11/419 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+I+E +A+KLP A+K AG  VHPSTTPC+ KL+  +F SQTA+LPL S  P 
Sbjct  1     MDPCPFVRVIVEGLALKLPVASKHAGSEVHPSTTPCFCKLRLKNFSSQTAILPL-STTPG  59

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
             D   SP +S  S+ GFHLDP  LRRLS K   L +SV+ GRM +TCGI+S KLLG V + 
Sbjct  60    D---SPPESTTSSAGFHLDPLFLRRLSGKQTTLHVSVYTGRMSRTCGISSAKLLGRVHMT  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADK--PMLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
              +L G + R  +FQ+GW KLG   +DK    LH+V+RSEPDPRFVFQFGGEPECSPVVFQ
Sbjct  117   FNLQGTEHRTCMFQNGWMKLGKD-SDKSSARLHLVIRSEPDPRFVFQFGGEPECSPVVFQ  175

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYD  854
             IQG+IRQPVFSCKFSA+RN+R+RSL  D +    GWM++FS +RDR G+ERKGWMI+IYD
Sbjct  176   IQGNIRQPVFSCKFSADRNSRSRSLRLDSNNRGGGWMKSFSKERDRLGRERKGWMIMIYD  235

Query  853   LSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSV  674
             LSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRP G SVSSWKPWGRLEAWRERG  
Sbjct  236   LSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPQGFSVSSWKPWGRLEAWRERGPA  295

Query  673   DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDN--ARKHSASSLSPVRGFVMCSS  500
             DGLGYKFELVTD G  +G+P AE  M+V+KGG+FCID       ++SS S  RGFVM S+
Sbjct  296   DGLGYKFELVTDTGTNTGVPFAESTMSVRKGGQFCIDTNLVGDTASSSSSSRRGFVMGST  355

Query  499   VEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             VEG+       VQV V HV   ADAALFVALSAAIDLSMDAC+LFS KLRKE C  + +
Sbjct  356   VEGEGKVSKPVVQVGVQHVKSTADAALFVALSAAIDLSMDACRLFSRKLRKELCRYQQE  414



>ref|XP_003525292.1| PREDICTED: uncharacterized protein LOC100785838 [Glycine max]
Length=423

 Score =   513 bits (1320),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 274/428 (64%), Positives = 325/428 (76%), Gaps = 19/428 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPS--ATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPF+RL++ES+A+KLPS  A  P   GVHPSTTPC+ K++ ++FPS TALLPL S  
Sbjct  1     MDPCPFLRLLVESLALKLPSSPAKPPPLSGVHPSTTPCFCKIRINTFPSHTALLPLSS--  58

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                 S+S  D+  SA  FHLDP+ALRRLS KP+ L LSV+ G MG++CG+   KLLG + 
Sbjct  59    ----SASAPDTTTSAPAFHLDPAALRRLSAKPLTLALSVYNGPMGRSCGVRGAKLLGSLH  114

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGG----GADKP--MLHVVVRSEPDPRFVFQFGGEPEC  1052
             + ++L  A S    F +GW  L GG      +KP   LH+VVRSEPDPRFVFQFGGEPEC
Sbjct  115   LTINLPAALSHSNTFHNGWLNLRGGPHNNNNNKPSAQLHLVVRSEPDPRFVFQFGGEPEC  174

Query  1051  SPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGW  872
             SPVVFQIQG+IRQP+FSCKFSA+RN R+RSLPSDF+ N  GW R+ +G+++  G++RKGW
Sbjct  175   SPVVFQIQGNIRQPIFSCKFSADRNYRSRSLPSDFTKNRSGWRRSTTGEKEHQGRDRKGW  234

Query  871   MIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAW  692
             MI+I+DLSGS VAAASM+TPFVPSPGSDRVSRSNPGAWLILRPNG S SSWKPWGRLEAW
Sbjct  235   MIMIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASESSWKPWGRLEAW  294

Query  691   RERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA---SSLSPVR  521
             RERG VDGLGYK EL +D G  + IPIAEG M+VKKGG+FCID      A   S L    
Sbjct  295   RERGPVDGLGYKVELFSDNGPANRIPIAEGTMSVKKGGQFCIDYKVMKDAGLGSRLPGEE  354

Query  520   GFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             GFVM S+V  EGK     VQV   HV CMADAALF+ALSA++DLSMDAC+LFS KLRKE 
Sbjct  355   GFVMGSTVDGEGKVSKPVVQVGAQHVTCMADAALFIALSASVDLSMDACRLFSHKLRKEL  414

Query  346   CHDEHDSY  323
             C+ E DS+
Sbjct  415   CYHEQDSF  422



>ref|XP_003516376.1| PREDICTED: uncharacterized protein LOC100805866 [Glycine max]
Length=428

 Score =   512 bits (1318),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 280/430 (65%), Positives = 325/430 (76%), Gaps = 17/430 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAG-PGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDPCPFVRL+++S+A+ LPSATKP    GVHPSTTPC+ +++ ++FPSQTALLPL S+  
Sbjct  1     MDPCPFVRLMVDSLALNLPSATKPPPVSGVHPSTTPCFCQIRITNFPSQTALLPLSSSSS  60

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQV  1211
              D +    ++  SA GFHLD SALRRLS KP+ L+L+V++G   + CGI+S KLLG + +
Sbjct  61    GDANP---EAATSAPGFHLDSSALRRLSAKPLTLRLAVYSGSTARACGISSAKLLGRLNL  117

Query  1210  AVDLSGAQSRPVVFQSGWKKLGGGGAD-------KPMLHVVVRSEPDPRFVFQFGGEPEC  1052
              +DLS A SRP  F SGW  L              P +H+VVRSEPDPRFVFQFGGEPEC
Sbjct  118   TLDLSAALSRPNTFHSGWLNLRKNRTGFEPEHKPAPRVHIVVRSEPDPRFVFQFGGEPEC  177

Query  1051  SPVVFQIQ-GSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKG  875
             SPVVFQIQ  +IRQPVFSCKFSA+RN+R+R LPSDF+ N   W RT  G R+R G+ERKG
Sbjct  178   SPVVFQIQENNIRQPVFSCKFSADRNSRSRCLPSDFANNPSRWRRTLKGIRERHGRERKG  237

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRP-NGPSVSSWKPWGRLE  698
             WMI+I+DLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILR  NG SVSSWKPWGRLE
Sbjct  238   WMIMIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRTNNGASVSSWKPWGRLE  297

Query  697   AWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNA--RKHSASSLSPV  524
             AWRERG VDGLGYKFELVT+ G  +GIPIAE  MNVKKGG+FCID    R     S    
Sbjct  298   AWRERGPVDGLGYKFELVTENGPANGIPIAEATMNVKKGGQFCIDYKVMRDSGLGSRLKG  357

Query  523   RGFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKE  350
             +GFVM S+VEG+       VQV   HV CMADAALF+ALSAAIDLSMDAC+LFS KLRKE
Sbjct  358   KGFVMGSTVEGEGKVSKPVVQVGAQHVTCMADAALFIALSAAIDLSMDACKLFSHKLRKE  417

Query  349   FCHDEHDSYF  320
              CH+E    F
Sbjct  418   LCHEEQQVSF  427



>ref|XP_003530182.1| PREDICTED: uncharacterized protein LOC100790306 [Glycine max]
Length=429

 Score =   508 bits (1308),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 281/431 (65%), Positives = 323/431 (75%), Gaps = 18/431 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAG-PGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDPCPF+RL+I+S+A+ LPSATKP    GVHPSTTPC+ K++ ++FPSQTALL       
Sbjct  1     MDPCPFLRLMIDSLALNLPSATKPPPVSGVHPSTTPCFCKIRINNFPSQTALL---PLSS  57

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQV  1211
                + +  D+  SA GFHLD  ALRRLS KP+ L+L+V++G   + CG++S KLLG + +
Sbjct  58    SSSAHAAPDTATSAPGFHLDSLALRRLSGKPLTLRLAVYSGSTARACGVSSAKLLGCLNL  117

Query  1210  AVDLSGAQSRPVVFQSGW-----KKLGGGGADK---PMLHVVVRSEPDPRFVFQFGGEPE  1055
              +DLS A SRP  F SGW     KK G     +   P LHVVVRSEPDPRFVFQFGGEPE
Sbjct  118   TLDLSAALSRPSTFHSGWLSLRKKKTGSEPTHRKPVPRLHVVVRSEPDPRFVFQFGGEPE  177

Query  1054  CSPVVFQIQ-GSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
             CSPVVFQIQ  +IRQPVFSCKFSA+RN+R+RSLPSDF+ N   W RT  G R+R G+ERK
Sbjct  178   CSPVVFQIQENNIRQPVFSCKFSADRNSRSRSLPSDFAKNPSRWRRTLKGVRERHGRERK  237

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GWMIII+DLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG  VSSWKPWGRLE
Sbjct  238   GWMIIIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGACVSSWKPWGRLE  297

Query  697   AWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPV--  524
             AWRERG VDGLGYKFELV + G T+GIPIAE  MNVKKGG+FCID      +  L     
Sbjct  298   AWRERGPVDGLGYKFELVIENGPTNGIPIAEATMNVKKGGQFCIDYKVMRDSGLLGSRLQ  357

Query  523   -RGFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRK  353
              +GFVM S+VEG+       VQV   HV CMADAALF+ALSAA+DLSMDACQLFS KLRK
Sbjct  358   GKGFVMGSTVEGEGKVSKPVVQVGAQHVTCMADAALFIALSAAVDLSMDACQLFSHKLRK  417

Query  352   EFCHDEHDSYF  320
             E CH E    F
Sbjct  418   ELCHHEEQVSF  428



>ref|XP_007152956.1| hypothetical protein PHAVU_004G174300g [Phaseolus vulgaris]
 gb|ESW24950.1| hypothetical protein PHAVU_004G174300g [Phaseolus vulgaris]
Length=420

 Score =   498 bits (1283),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 274/429 (64%), Positives = 322/429 (75%), Gaps = 22/429 (5%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATK-PAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDPCPFVRL+++S+A+ LPSA K P   GVHPSTTPC+ K++ ++FPSQTA         
Sbjct  1     MDPCPFVRLMVDSLALNLPSAAKAPPNSGVHPSTTPCFCKIRTTNFPSQTA-----LLPL  55

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQV  1211
                SSS  D+  +A GFHLD +ALRR    P++L+L+V++G   + CG+ + KLLG + +
Sbjct  56    SPSSSSAPDAVTAAPGFHLDSAALRR----PISLRLAVYSGSTARACGVAAAKLLGRLTL  111

Query  1210  AVDLSGAQSRPVVFQSGW-----KKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPEC  1052
              +DL+ A+ RP+ F SGW      K G     KP   LH+VVRSEPDPRFVFQFGGEPEC
Sbjct  112   TLDLASARDRPITFHSGWLSLRRNKSGSETNRKPSTRLHIVVRSEPDPRFVFQFGGEPEC  171

Query  1051  SPVVFQIQ-GSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKG  875
             SPVVFQIQ  +IRQPVFSCKFSA+RN+R+RSLPSDF  N   W R+  G R+R G+ERKG
Sbjct  172   SPVVFQIQENNIRQPVFSCKFSADRNSRSRSLPSDFGNNPSRWRRSLKGVRERHGRERKG  231

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEA  695
             WM+ I+DLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG SVSSWKPWGRLEA
Sbjct  232   WMVTIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGASVSSWKPWGRLEA  291

Query  694   WRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNA--RKHSASSLSPVR  521
             WRERG +DGLGYKFELV + G  +GIPIAE  MNVKKGG+FCID    R    SS  P +
Sbjct  292   WRERGPIDGLGYKFELVAENGPGNGIPIAEATMNVKKGGQFCIDYKVMRDSGLSSRLPGK  351

Query  520   GFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             GFVM SSVEG+       VQV   HV CMADAALF+ALSAAIDLSMDACQLFS KLRKE 
Sbjct  352   GFVMGSSVEGEGKVSKPLVQVGAQHVTCMADAALFIALSAAIDLSMDACQLFSHKLRKEL  411

Query  346   CHDEHDSYF  320
             CH+EH+  +
Sbjct  412   CHEEHEVKY  420



>gb|KDO55858.1| hypothetical protein CISIN_1g017474mg [Citrus sinensis]
Length=371

 Score =   495 bits (1275),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 264/375 (70%), Positives = 309/375 (82%), Gaps = 15/375 (4%)
 Frame = -2

Query  1414  LPLCSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSG  1235
             +PLC++     + +P +S  SA GFHLD ++LRRLS KP+ L++SV+AGRMG TCG++SG
Sbjct  1     MPLCTS----QNDAPPESSTSALGFHLDAASLRRLSNKPITLRVSVYAGRMGSTCGVSSG  56

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGE  1061
             KLLG + V +DL+GA S+ +VF++GW KLG    DKP   +H+ VRSEPDPRFVFQFGGE
Sbjct  57    KLLGRLNVIIDLAGADSKSIVFRNGWLKLGRE-PDKPSARIHLTVRSEPDPRFVFQFGGE  115

Query  1060  PECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLN---SRGWMRTFSGDRDRPG  890
             PECSPVVFQIQG+IRQPVFSCKFSA+RN+R+R LPSDF+ N   SRGWMRTFSGDR+R G
Sbjct  116   PECSPVVFQIQGNIRQPVFSCKFSADRNSRSRCLPSDFTNNNGSSRGWMRTFSGDRERSG  175

Query  889   KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPW  710
             +ERKGWMI+IYDLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG SVSSWKPW
Sbjct  176   RERKGWMIMIYDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGFSVSSWKPW  235

Query  709   GRLEAWRERGSVDGLGYKFELVTDA-GFTSGIPIAEGAMNVKKGGRFCIDN--ARKHSAS  539
             GRLEAWRERG+VDGLGYKFELVTD+ G  S I IAE  ++VKKGG+FCID+   R+   +
Sbjct  236   GRLEAWRERGAVDGLGYKFELVTDSTGPNSRISIAEATLSVKKGGKFCIDSRITRESLLN  295

Query  538   SLSPVRGFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFST  365
             S SPV+GFVM S+VEG+       V+V V HV CMADAALF+ALSAAIDLSMDAC+LFS 
Sbjct  296   SRSPVKGFVMGSTVEGEGKVSKPVVEVGVQHVTCMADAALFIALSAAIDLSMDACRLFSH  355

Query  364   KLRKEFCHDEHDSYF  320
             KLRKE CHDE D  F
Sbjct  356   KLRKELCHDEQDYSF  370



>ref|XP_003530524.1| PREDICTED: uncharacterized protein LOC100811541 isoform X1 [Glycine 
max]
 ref|XP_006584805.1| PREDICTED: uncharacterized protein LOC100811541 isoform X2 [Glycine 
max]
Length=424

 Score =   494 bits (1273),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 278/429 (65%), Positives = 327/429 (76%), Gaps = 20/429 (5%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPS--ATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPF+RLI+ES+A+KLPS  A  P   GVHPSTTPC+ K++ ++FPS TA+LPL S+ 
Sbjct  1     MDPCPFIRLIVESLALKLPSSPAKPPPLSGVHPSTTPCFCKIRINTFPSHTAILPLSSSA  60

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                D+++      SA  FHLDP+ALRRLS KP+ L LSV+ G MG++CG+   KLLG + 
Sbjct  61    SSPDTTT------SAPAFHLDPAALRRLSSKPLTLTLSVYNGPMGRSCGVRGAKLLGRLH  114

Query  1213  VAVDLSGAQSRPV--VFQSGWKKLGGG---GADKP--MLHVVVRSEPDPRFVFQFGGEPE  1055
             + ++L  A SR     F +GW  LGGG     +KP   LH+VVRSEPDPRFVFQFGGEPE
Sbjct  115   LTINLPAALSRSSANTFHNGWLNLGGGGPHNNNKPSAQLHLVVRSEPDPRFVFQFGGEPE  174

Query  1054  CSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKG  875
             CSPVVFQIQG+IRQPVFSCKFSA+RN R+RSLPSDF+ N  GW R+ +G+++  G++RKG
Sbjct  175   CSPVVFQIQGNIRQPVFSCKFSADRNYRSRSLPSDFTKNRSGWRRSSTGEKEHQGRDRKG  234

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEA  695
             WMI+I+DLSGS VAAASM+TPFVPSPGSDRVSRSNPGAWLILRPNG S SSWKPWGRLEA
Sbjct  235   WMIMIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASESSWKPWGRLEA  294

Query  694   WRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA---SSLSPV  524
             WRERG VDGLGYK EL +D G  + IPIAEG M+VKKGG+FCID      A   S L   
Sbjct  295   WRERGPVDGLGYKVELFSDNGPANRIPIAEGTMSVKKGGQFCIDYKVIKDAGLGSRLPGE  354

Query  523   RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKE  350
              GFVM S+V  EGK     VQV   HV CMADAALF+ALSAAIDLSMDAC+LFS KLRKE
Sbjct  355   EGFVMGSTVDGEGKVSKPVVQVGAQHVTCMADAALFIALSAAIDLSMDACRLFSHKLRKE  414

Query  349   FCHDEHDSY  323
              CH E DS+
Sbjct  415   LCHHEQDSF  423



>ref|XP_010539384.1| PREDICTED: uncharacterized protein LOC104813482 [Tarenaya hassleriana]
Length=426

 Score =   493 bits (1268),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 275/427 (64%), Positives = 331/427 (78%), Gaps = 16/427 (4%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP--SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSA-  1397
             MDPCPF+R+ I+S+A++LP  + ++PA  GVHPS TPCY KL+ S+FPSQTALLPL SA 
Sbjct  1     MDPCPFIRIDIDSLALQLPQPATSRPASTGVHPSATPCYCKLRISNFPSQTALLPLSSAT  60

Query  1396  ---LPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLL  1226
                   D+  SP+D  +SA GF LD +A+ RLS +PVAL++SV+AGRMG TCG+++GK+L
Sbjct  61    AGEYSGDNDGSPSDPGSSAPGFDLDGAAISRLSSRPVALRVSVYAGRMGTTCGLSAGKIL  120

Query  1225  GVVQVAVDLSGAQSRPVVFQSGWKKLGG-GGADKPMLHVVVRSEPDPRFVFQFGGEPECS  1049
             G VQV VD++  +SR VV  SGW KLGG  G     LH+VV+++PDPRFVF+FGGEPECS
Sbjct  121   GHVQVNVDVAAVRSRAVVCHSGWMKLGGETGKPAARLHLVVKAKPDPRFVFKFGGEPECS  180

Query  1048  PVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRG--WMRTFSGDRD-RPGKERK  878
             PVV+QIQG+I+QPVFSC FSA+RN+RTR          RG   MRTFSG+ + R  KERK
Sbjct  181   PVVYQIQGNIKQPVFSCNFSADRNSRTRPPSPVSGAGERGGCIMRTFSGEVNKRQVKERK  240

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPN-GPSVSSWKPWGRL  701
             GWMII+YDLSGS+VAAASM TPFVPSPGSDRVSR+NPGAWLIL+P+ G SV SWKPWGRL
Sbjct  241   GWMIIVYDLSGSAVAAASMATPFVPSPGSDRVSRANPGAWLILQPHCGLSVGSWKPWGRL  300

Query  700   EAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPV  524
             EAWRER GS DGLGY+FELVTD G   GI IAEG M+VK GGRFCID  R+ S    SPV
Sbjct  301   EAWRERGGSDDGLGYRFELVTDVG-GGGISIAEGTMSVKHGGRFCIDG-RRSSPDPRSPV  358

Query  523   RGFVMCSSVEGKNGFL--SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKE  350
             RGFVM ++VEG+      +V+VA  HV   ADAALFVALSAAIDLS+DAC+LFS KLRKE
Sbjct  359   RGFVMSATVEGEGRVSKPAVEVAAEHVGSTADAALFVALSAAIDLSIDACRLFSRKLRKE  418

Query  349   FCHDEHD  329
              CH + +
Sbjct  419   LCHGDEE  425



>emb|CAN70307.1| hypothetical protein VITISV_026399 [Vitis vinifera]
Length=369

 Score =   484 bits (1247),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 267/421 (63%), Positives = 308/421 (73%), Gaps = 59/421 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLI+ES+A+KLP AT+PAG GVHPSTTPC+  L+  +FPSQTALLPLCS+   
Sbjct  1     MDPCPFVRLIVESLALKLPQATRPAGSGVHPSTTPCFCXLRIKNFPSQTALLPLCSS---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 SP DS  S  GFHLD + LRRLS KP+ L++SV+ GRMG+TCG++SGKLLG V V 
Sbjct  58    GGDPSP-DSTISXAGFHLDSALLRRLSGKPLTLRVSVYTGRMGRTCGVSSGKLLGRVHVM  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             ++L GA+SRP VFQ+GW KLG     KP   LH+VVRSEPDPRFVFQFGGEPECSPVVFQ
Sbjct  117   INLDGAESRPNVFQNGWLKLGNE-TSKPSARLHLVVRSEPDPRFVFQFGGEPECSPVVFQ  175

Query  1033  IQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYD  854
             IQG+IRQPVFSCKFSA+RN+R+RSL SDF+ N+RGWMR                      
Sbjct  176   IQGNIRQPVFSCKFSADRNSRSRSLASDFNSNNRGWMR----------------------  213

Query  853   LSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSV  674
                                       SNPGAWLILRP+G SVSSWKPWGRLEAWRERG +
Sbjct  214   --------------------------SNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPI  247

Query  673   DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDN--ARKHSASSLSPVRGFVMCSS  500
             DGLGYKFELVTD+G TSGIPIAE  MN+K+GG+FCID+   R  + SSL P+RGFVM S+
Sbjct  248   DGLGYKFELVTDSGPTSGIPIAESTMNIKRGGQFCIDSRIMRDSTLSSLLPLRGFVMGST  307

Query  499   VEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDS  326
             VEG+       VQV V HV CMADAALF+ALSAAIDLSMDAC+LFS KLRKE CHDE DS
Sbjct  308   VEGEGKVSKPVVQVGVQHVTCMADAALFIALSAAIDLSMDACRLFSRKLRKELCHDEQDS  367

Query  325   Y  323
             +
Sbjct  368   F  368



>ref|XP_003620756.1| hypothetical protein MTR_6g090060 [Medicago truncatula]
 gb|AES76974.1| DUF1005 family protein [Medicago truncatula]
Length=423

 Score =   481 bits (1237),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 271/430 (63%), Positives = 317/430 (74%), Gaps = 23/430 (5%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-VHPSTT--PCYAKLKFSSFPSQTALLPLCSA  1397
             MD CP+VRL +ES+A+ LPS TKP+    +HPSTT  PC+  +   +FPSQT        
Sbjct  1     MDSCPYVRLTVESLALNLPSPTKPSPLSRIHPSTTTIPCFCTIHIPNFPSQTT-----LL  55

Query  1396  LPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVV  1217
                  SSS  ++ +SA+GFHLD +AL+RL+ KP+ L+LSV+AG MG+TCGI + KLLG V
Sbjct  56    PLSSSSSSSPETTSSADGFHLDSNALQRLTGKPIPLRLSVYAGSMGRTCGIANSKLLGRV  115

Query  1216  QVAVDLSGAQSRPVVFQSGWKKLGG------GGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
              V +DL  + SR V+F SGW  LG       G  D   +H VVR+EPDPRF+FQFGGEPE
Sbjct  116   VVNIDLKNSLSRSVMFHSGWLALGKKKGFEPGKKDSARVHFVVRTEPDPRFLFQFGGEPE  175

Query  1054  CSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKG  875
             CSPVVFQIQ +IRQPVFSCKFSA+RN+R+RS  +DF+     W R     ++R G+ERKG
Sbjct  176   CSPVVFQIQENIRQPVFSCKFSADRNSRSRSNATDFANTPSRWKRALKSVQERHGRERKG  235

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEA  695
             WMI ++DLSGS VAAASM+TPFVPSPGSDRVSRSNPGAWLILRPNG SVSSWKPWGRLEA
Sbjct  236   WMITVHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASVSSWKPWGRLEA  295

Query  694   WRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-NARKHS---ASSLSP  527
             WRERG VDGLGYKFELVT+    +GIPIAE  MNVKKGG+FCID N  K      S L P
Sbjct  296   WRERGHVDGLGYKFELVTE---NNGIPIAESTMNVKKGGQFCIDYNVMKEYYGLCSRLPP  352

Query  526   VRGFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRK  353
              +GFVM SSVEG+       VQV   HV CMADAALFVALSAAIDLSMDACQLFS KLRK
Sbjct  353   GKGFVMSSSVEGEGKISKPFVQVGAQHVTCMADAALFVALSAAIDLSMDACQLFSHKLRK  412

Query  352   EFCHDEHDSY  323
             E CH+E  S+
Sbjct  413   ELCHEEQVSF  422



>ref|XP_006451341.1| hypothetical protein CICLE_v10008480mg [Citrus clementina]
 gb|ESR64581.1| hypothetical protein CICLE_v10008480mg [Citrus clementina]
Length=409

 Score =   464 bits (1194),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 270/428 (63%), Positives = 310/428 (72%), Gaps = 32/428 (7%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP-SATKPAGPGVH-PSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRLI+ES+A+KLP +AT+PA      P     +A L  S       L      +
Sbjct  1     MDPCPFVRLIVESLALKLPHAATRPAAQDQELPLANSPHASLHVSKRRPTGVL-----HV  55

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                       S    E  H  PS   R              G  G TCG++SGKLLG + 
Sbjct  56    RVGLPPRRRLSPPPFEQTHHPPSVRLR--------------GPHGSTCGVSSGKLLGRLN  101

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             V +DL+GA S+ +VF++GW KLG    DKP   +H+ VRSEPDPRFVFQFGGEPECSPVV
Sbjct  102   VIIDLAGADSKSIVFRNGWLKLGRE-PDKPSPRIHLTVRSEPDPRFVFQFGGEPECSPVV  160

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLN---SRGWMRTFSGDRDRPGKERKGWM  869
             FQIQG+IRQPVFSCKFSA+RN+R+R LPSDF+ N   SRGWMRTFSGDR+R G+ERKGWM
Sbjct  161   FQIQGNIRQPVFSCKFSADRNSRSRCLPSDFTNNNGSSRGWMRTFSGDRERSGRERKGWM  220

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I+IYDLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG SVSSWKPWGRLEAWR
Sbjct  221   IMIYDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGFSVSSWKPWGRLEAWR  280

Query  688   ERGSVDGLGYKFELVTDA-GFTSGIPIAEGAMNVKKGGRFCIDN--ARKHSASSLSPVRG  518
             ERG+VDGLGYKFELVTD+ G  S I IAE  ++VKKGG+FCID+   R+   +S SPV+G
Sbjct  281   ERGAVDGLGYKFELVTDSTGPNSRISIAEATLSVKKGGKFCIDSRITRESLLNSRSPVKG  340

Query  517   FVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             FVM S+VEG+       V+V V HV CMADAALF+ALSAAIDLSMDAC+LFS KLRKE C
Sbjct  341   FVMGSTVEGEGKVSKPVVEVGVQHVTCMADAALFIALSAAIDLSMDACRLFSHKLRKELC  400

Query  343   HDEHDSYF  320
             HDE D  F
Sbjct  401   HDEQDYSF  408



>ref|XP_010924447.1| PREDICTED: uncharacterized protein LOC105047284 [Elaeis guineensis]
Length=441

 Score =   460 bits (1183),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 259/439 (59%), Positives = 310/439 (71%), Gaps = 27/439 (6%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLI+ES+A+KLP+ +KPAGPGVHPSTTPC+  L+    PS T   PL  A P 
Sbjct  1     MDPCPFVRLIVESLALKLPTVSKPAGPGVHPSTTPCFCTLQLKDHPSSTQTAPLPLATPS  60

Query  1387  DDSSSPTDSF---------ASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSG  1235
                 SPT S          A+   F LDP+A ++LS KP +L LSV+AGR G TCG ++ 
Sbjct  61    SSDPSPTASTLTETPSAISATPVVFSLDPAAFQKLSSKPASLVLSVYAGRTGSTCGFSAV  120

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
             +LLG V+V +DL    +R +V QSGW  +GG  +    LH+VVRSEPDPRFVFQFGGEPE
Sbjct  121   RLLGRVRVGLDLEAPPARAMVMQSGWVSVGGCRSAA-RLHLVVRSEPDPRFVFQFGGEPE  179

Query  1054  CSPVVFQIQ-------GSIRQPVFSCKFSAER--NNRTRSLPSDF-SLNSRGWMRTFSGD  905
             CSPVV+QIQ       G +RQPVFSC+FSA+R  N R+RSLPS+     ++GW   F  +
Sbjct  180   CSPVVYQIQENGGGHSGCLRQPVFSCRFSADRRHNTRSRSLPSNSPDRTNKGWFGCFGSE  239

Query  904   RDRPGKE-RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSV  728
             R    +E RKGW I I+DLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILR  G S 
Sbjct  240   RSHVRREQRKGWTITIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRATGSSG  299

Query  727   SS--WKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNAR  554
             S+  WKPWGRLEAWRERG VD LGY+FE+VTDA  T  +PIAE +++V+KGG+F ID + 
Sbjct  300   STPNWKPWGRLEAWRERGPVDALGYRFEIVTDAAPTERVPIAESSLSVRKGGQFSIDPSV  359

Query  553   KHSASSLSP--VRGFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMD  386
                  S S   V  FVM S+VEG+       VQV V HV+CMAD ALF+ALSAA+DLSMD
Sbjct  360   AGDVVSTSEPFVGAFVMVSTVEGEGKVSKPMVQVGVQHVSCMADVALFIALSAAVDLSMD  419

Query  385   ACQLFSTKLRKEFCHDEHD  329
             ACQLFS KLRKE C D+ +
Sbjct  420   ACQLFSQKLRKELCQDQQE  438



>ref|XP_008799780.1| PREDICTED: uncharacterized protein LOC103714350 [Phoenix dactylifera]
Length=429

 Score =   452 bits (1164),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 253/432 (59%), Positives = 309/432 (72%), Gaps = 23/432 (5%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF RLI+ES+A+KLP+ +KPAGPGVHPSTTPC+  ++    PS     PL  A P 
Sbjct  1     MDPCPFARLIVESLALKLPTVSKPAGPGVHPSTTPCFCTIRLQDHPSAAQTAPLPLAAPS  60

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 S T S A+   F LDP+AL++LS KP +L +SV+AGR G TCG ++G+LLG V++ 
Sbjct  61    SSDPSLTASAAAPVVFSLDPAALQKLSCKPASLVVSVYAGRTGSTCGFSAGRLLGRVRIG  120

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPVVFQIQ  1028
             VDL  A  R +V Q+GW  +GG  +    LH+VVRSEPDPRFVFQFGGEPECSPVV+Q+Q
Sbjct  121   VDLEAAPVRAMVMQTGWMSVGGRRSAA-RLHLVVRSEPDPRFVFQFGGEPECSPVVYQVQ  179

Query  1027  GS-------IRQPVFSCKFSAERNNRTRS---LPSDFSLNSRGWMRTFSGDRDRPGKE-R  881
             G+       +RQPVFSC+FSA+R     S    P   S + RGW   F  +R+   +E R
Sbjct  180   GNGGGHSSCLRQPVFSCRFSADRRRNAGSGPLPPHSSSSSIRGW---FGSERNHLRREQR  236

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSS--WKPWG  707
             KGW + I+DLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILRP G S S+  WKPWG
Sbjct  237   KGWTVTIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPTGFSGSTPNWKPWG  296

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP  527
             RLEAWRERG VD LGY+FELVTD+G + GIPIAE + +V+KGGRFCID     +  ++S 
Sbjct  297   RLEAWRERGPVDALGYRFELVTDSGPSGGIPIAESSFSVRKGGRFCIDPDPGVAGDTVSR  356

Query  526   ----VRGFVMCSSVEGKNGFL--SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFST  365
                 V GFVM + VEG+      +VQV   HV+CMAD ALF+ALSAA+DLS+DACQLFS 
Sbjct  357   SWPFVGGFVMAADVEGERKVSKPTVQVGAQHVSCMADVALFIALSAAVDLSIDACQLFSQ  416

Query  364   KLRKEFCHDEHD  329
             KLRKE C D+ +
Sbjct  417   KLRKELCQDQQN  428



>ref|XP_004503501.1| PREDICTED: uncharacterized protein LOC101489321 [Cicer arietinum]
Length=423

 Score =   447 bits (1151),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 259/429 (60%), Positives = 305/429 (71%), Gaps = 20/429 (5%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKL-PSATKPAG-PGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRL IES+++KL  S TKP    GVHPSTTPC+ K++  SFPS+ A        
Sbjct  1     MDPCPFVRLTIESLSLKLLHSPTKPLPLSGVHPSTTPCFCKIRIQSFPSRIA-----LLP  55

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQ  1214
                 SS  + S + +  FHLD +AL RLS KP+ L +SV+ G MG+ CG+ +  LLG V 
Sbjct  56    LSSSSSLSSQSQSQSTTFHLDSTALLRLSAKPLTLSISVYNGPMGRNCGVPTANLLGRVV  115

Query  1213  VAVDLSGAQSRPVVFQSGWKKLGGGGADKP----MLHVVVRSEPDPRFVFQFGGEPECSP  1046
             + + L  + S    F +GW KL G     P    MLH++VRSEPDPRFVF FGGEPECSP
Sbjct  116   LPIQLPTSLSSSNTFHNGWFKLCGNREPDPKPSHMLHLLVRSEPDPRFVFHFGGEPECSP  175

Query  1045  VVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDF--SLNSRGWMRTFSGDRDR--PGKERK  878
             V+FQIQ +I+QPVFSCKF+A+RN R++SLPSDF  + NS  W ++  GDR++   G ERK
Sbjct  176   VIFQIQENIKQPVFSCKFTADRNYRSQSLPSDFRNNNNSSRWRKSLRGDREQSVQGNERK  235

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPS-VSSWKPWGRL  701
             GWMI+I+DLSGS VAAASMITPFVPSPGS+RVSRSN GAWLILRPNG S VSSWKPWGRL
Sbjct  236   GWMIVIHDLSGSPVAAASMITPFVPSPGSNRVSRSNAGAWLILRPNGASTVSSWKPWGRL  295

Query  700   EAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPVR  521
             EAWRERGS+DGLGYK EL +D G  + I IAEG M+VKKGG+FCID+A     S   P  
Sbjct  296   EAWRERGSIDGLGYKVELFSDNGPVNAITIAEGTMSVKKGGKFCIDSAIL--GSKWLPGE  353

Query  520   GFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             GFVM S+V  EGK     VQV   HV CM DAALF+ALSAAIDLSMDAC LFS KLRKE 
Sbjct  354   GFVMGSTVSGEGKVSKPVVQVGARHVTCMPDAALFIALSAAIDLSMDACMLFSHKLRKEL  413

Query  346   CHDEHDSYF  320
             C D     F
Sbjct  414   CPDHQQYSF  422



>ref|XP_010915009.1| PREDICTED: uncharacterized protein LOC105040251 [Elaeis guineensis]
 ref|XP_010915015.1| PREDICTED: uncharacterized protein LOC105040251 [Elaeis guineensis]
Length=448

 Score =   443 bits (1140),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 254/448 (57%), Positives = 311/448 (69%), Gaps = 35/448 (8%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPS--QTALLPLCSAL  1394
             MDPCPF RLI+ES+A+KLP+ +KPAGPGVHP+TTPC+  ++    PS  QTA LPL +  
Sbjct  1     MDPCPFARLIVESLALKLPTVSKPAGPGVHPTTTPCFCTIQLQDHPSSTQTAPLPLATPS  60

Query  1393  PKDDS-------------SSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQT  1253
               D S              +P+   A+   F LDP+AL++ S KP +L +SV+AGR G T
Sbjct  61    SSDPSTTAAAAAASATPTETPSTVSAAPVVFSLDPAALQKFSGKPASLVVSVYAGRTGST  120

Query  1252  CGITSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQ  1073
             CG ++G+LLG ++V VDL  A  R +V QSGW  +GGG      LH+VVRSEPDPRFVFQ
Sbjct  121   CGFSAGRLLGRLRVGVDLEAAPVRAMVMQSGWVSVGGG-RSAARLHLVVRSEPDPRFVFQ  179

Query  1072  FGGEPECSPVVFQIQGS-------IRQPVFSCKFSAERNNRTRSLPSDFSLNS----RGW  926
             FGGEPECSPVV+Q+QG        +RQPVFSC+FSA+R   T S     + ++    +GW
Sbjct  180   FGGEPECSPVVYQVQGKGGGHSGCLRQPVFSCRFSADRRRNTGSGSLPSNSSNNSTIKGW  239

Query  925   MRTFSGDRDRPGKE-RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLIL  749
               +F  +R+   +E RKGW + I+DLSGS VAAASM+TPFVPSPGSDRVSRSN GAWLIL
Sbjct  240   FSSFGSERNHLRREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNAGAWLIL  299

Query  748   RPNGPSVSS--WKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGR  575
             +P G S S+  WKPWGRLEAWRERG VD LGY+FELVTD+G T GIPIAE +++V+KGG+
Sbjct  300   QPTGFSGSTPNWKPWGRLEAWRERGPVDALGYRFELVTDSGPTGGIPIAESSLSVRKGGQ  359

Query  574   FCIDNARKHSASSLS--PVRGFVMCSSVEGKNGFL--SVQVAVNHVNCMadaalfvalsa  407
             FCI         S S   V GFVM S VEG+      +VQV   HV+CMAD ALF+ALSA
Sbjct  360   FCIAPGVIGDGISRSWPSVGGFVMGSIVEGEGKVSKPTVQVGAQHVSCMADVALFIALSA  419

Query  406   AIDLSMDACQLFSTKLRKEFCHDEHDSY  323
             A+DLSMDACQLFS KLRKE C D H  Y
Sbjct  420   AVDLSMDACQLFSQKLRKELCQD-HQEY  446



>ref|XP_008795504.1| PREDICTED: uncharacterized protein LOC103711219 [Phoenix dactylifera]
Length=442

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 250/439 (57%), Positives = 312/439 (71%), Gaps = 26/439 (6%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPS--QTALLPLCSAL  1394
             MDPCPFVRLI+ES+A+KLP+ +KPAGPGVHPSTTPC+   +     S  QTA LP+ +  
Sbjct  1     MDPCPFVRLIVESLALKLPTVSKPAGPGVHPSTTPCFCTFQLQDHASSTQTAPLPIATPS  60

Query  1393  PKDDSS----SPTDSFASAEG--FHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGK  1232
               D S     + T S  SA    F LDP+AL++LS KP +L +SV+AGR G TCG ++G+
Sbjct  61    SSDPSPPASLTETASAISANPVVFSLDPAALQKLSGKPASLVVSVYAGRTGSTCGFSAGR  120

Query  1231  LLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
             LLG V+V + L  A +R +V QSGW  +G G      LH+VVRSEPDPRFVFQFGGEPEC
Sbjct  121   LLGRVRVELSLEAAPARAMVMQSGWVSVGRGCRSAARLHLVVRSEPDPRFVFQFGGEPEC  180

Query  1051  SPVVFQIQ-------GSIRQPVFSCKFSAERNNRTRSLPSDFSLNS----RGWMRTFSGD  905
             SPVV+QIQ       G +RQPVFSC+FSA+R   TRS     + ++    +GW      +
Sbjct  181   SPVVYQIQENGGGHSGCLRQPVFSCRFSADRRRNTRSRSLPSNSSNNSIIKGWFGCLGSE  240

Query  904   RD-RPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG--P  734
             R+ R   +RKGW + I+DLSGS VAAASMITPFVPSPGSDRVSRSNPGAWLILR  G   
Sbjct  241   RNHRRRDKRKGWTVTIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRATGFSG  300

Query  733   SVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNAR  554
             S ++WKPWGRLEAWRERG V+ LGY+FELVTD+G T  +PIAE +++V+KGG+F ID + 
Sbjct  301   STANWKPWGRLEAWRERGPVNTLGYRFELVTDSGPTDRVPIAESSLSVRKGGQFSIDPSV  360

Query  553   KHSASSLSP--VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMD  386
                  S S   V GFVM S+V  EGK    +VQV ++HV+CMAD ALF+AL+AA+DLSMD
Sbjct  361   AGDVVSRSEPFVGGFVMGSTVNGEGKVSKPTVQVGLHHVSCMADVALFIALAAAVDLSMD  420

Query  385   ACQLFSTKLRKEFCHDEHD  329
             ACQLF+ KLR+E C D+ +
Sbjct  421   ACQLFAKKLRRELCQDQQE  439



>ref|XP_009410899.1| PREDICTED: uncharacterized protein LOC103992782 [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   433 bits (1114),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 245/434 (56%), Positives = 303/434 (70%), Gaps = 24/434 (6%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPS----QTALLPLC-  1403
             MDPCPFVRLI+ES+A+KLPS  KPAGPGVHPS TPC+  ++    PS    QTA LPL  
Sbjct  24    MDPCPFVRLIVESLALKLPSVAKPAGPGVHPSATPCFCTVQLQDCPSSSATQTAPLPLAV  83

Query  1402  ----SALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSG  1235
                 +    + ++S     +SA    ++P+ALRR S +P +L ++V+AGR G TCG +SG
Sbjct  84    DPTSTTNLIEPAASTCAVASSAVVISIEPAALRRPSGRPASLTVAVYAGRTGSTCGFSSG  143

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
             +LLG V+VAVDL  A +R  V QSGW  +G G      LH+VVR+EPDPRFVFQFG EPE
Sbjct  144   RLLGRVRVAVDLESAATRAAVIQSGWVSMGSG-LSAARLHLVVRTEPDPRFVFQFGSEPE  202

Query  1054  CSPVVFQIQGS--------IRQPVFSCKFSAERNNRTRSL-PSDFSLNSRGWMRTFSGDR  902
             CSPVV+QIQG         +RQPVFSC+FSA+R   TR+  P   +   R W  +  G+R
Sbjct  203   CSPVVYQIQGGGGTGHGGCVRQPVFSCRFSADRRRTTRTTSPPTKNNRRRCWFGSLGGER  262

Query  901   DRPGKE-RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVS  725
             D   +E RKGW + I+DLSGS VAAAS++TPFV SPGSDRVSRSNPGAWLILR  GPS +
Sbjct  263   DHESREQRKGWTVTIHDLSGSPVAAASIVTPFVASPGSDRVSRSNPGAWLILRAVGPSAT  322

Query  724   SWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHS  545
              WKPWGRLEAWRE+G VD LGY+FEL+TDAG   G PI E +++++KGGRFCID      
Sbjct  323   DWKPWGRLEAWREKGPVDALGYRFELMTDAGPNRGFPIVESSLSMRKGGRFCIDPGVVEK  382

Query  544   ASSLSPVRGFVMCSSVEGKNGFL--SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLF  371
             +   +   GFVM ++VEG+      +VQV V HV+CMAD ALF+ALSAAIDLS DACQLF
Sbjct  383   SGPFA--GGFVMAATVEGQGKVSKPTVQVGVQHVSCMADVALFIALSAAIDLSGDACQLF  440

Query  370   STKLRKEFCHDEHD  329
             S KLRKE   D+ +
Sbjct  441   SHKLRKELSQDQQE  454



>ref|XP_009395733.1| PREDICTED: uncharacterized protein LOC103980924 [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   429 bits (1104),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 242/435 (56%), Positives = 302/435 (69%), Gaps = 26/435 (6%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLI+ES+A+KLP+  KP GPGVHPS TPC+  ++    PS    +PL  A+  
Sbjct  1     MDPCPFVRLIVESLALKLPTMAKPVGPGVHPSATPCFCTVQLQDRPSSYCSVPLPLAVDP  60

Query  1387  DDSSSPTDSFASAEG-----FHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLG  1223
               S++  D+  S+         ++P+A +R S K  +L++SV+ GR G TCG +SG+LLG
Sbjct  61    TSSTNLIDAPTSSSSSSPVIISVEPAAWQRSSGKRASLEVSVYVGRTGSTCGFSSGRLLG  120

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPV  1043
              V+VAVDL  A +R  V QSGW  +G        LH+VVR+EPDPRFVFQFGGEPECSPV
Sbjct  121   RVRVAVDLETAATRAAVVQSGWVSMGSQ-TSAARLHLVVRTEPDPRFVFQFGGEPECSPV  179

Query  1042  VFQIQGS--------IRQPVFSCKFSAERNNRT--RSLPSDFSLNSRGWMRTFSGDRDRP  893
             V+QIQG         +RQPVFSC+F+A+R   T  RSLP+  S        +F G+RD  
Sbjct  180   VYQIQGKCASGQSGCVRQPVFSCRFTADRRRTTISRSLPTKRSFKR---CLSFGGERDHE  236

Query  892   GK--ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSW  719
              +  +RKGW + I+DLSGS VAAAS++TPFVPSPGSDRVSRSNPGAWLIL   GPS ++W
Sbjct  237   IRWEQRKGWTVTIHDLSGSPVAAASIVTPFVPSPGSDRVSRSNPGAWLILHAIGPSTTNW  296

Query  718   KPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA-  542
             KPWGRLEAWRERG  D LG +FELVTDAG  +G+PIAE +++V+KGG FCID +    A 
Sbjct  297   KPWGRLEAWRERGPADALGLRFELVTDAGPNNGLPIAESSLSVRKGGEFCIDPSVVAGAV  356

Query  541   --SSLSPVRGFVMCSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQL  374
                S   V GFVM ++VE  GK    +VQV + HV+CMAD ALF+ALSAAIDLSMDACQ 
Sbjct  357   MPGSWPFVGGFVMAAAVEGQGKASKPTVQVGLQHVSCMADVALFIALSAAIDLSMDACQS  416

Query  373   FSTKLRKEFCHDEHD  329
             FS KLR E C D+ +
Sbjct  417   FSQKLRSELCPDQQE  431



>ref|XP_009416467.1| PREDICTED: uncharacterized protein LOC103997060 [Musa acuminata 
subsp. malaccensis]
Length=442

 Score =   429 bits (1103),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 251/440 (57%), Positives = 303/440 (69%), Gaps = 28/440 (6%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLIIES+ +KLP+ +KPAGPGVHPSTTPC+  L      S     PL  A   
Sbjct  1     MDPCPFVRLIIESLVLKLPAISKPAGPGVHPSTTPCFCSLHLQDCASSPHTTPLPVAADP  60

Query  1387  DDSSSPTDSFASAEG-----FHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLG  1223
             + +++  ++   A         LDP  L+RLS K  +L +SV+ GR G TCG +SG+LLG
Sbjct  61    NSTTNLMEAPVPAGPPASVVISLDPPTLQRLSGKRASLVVSVYMGRTGSTCGFSSGRLLG  120

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPV  1043
              V+VA+DL  A +RP V Q+GW  +G G +    LH+VVRSEPDPRFVF FGGEPECSPV
Sbjct  121   RVRVAMDLEVAPTRPTVAQNGWVSVGAGRSAA-RLHLVVRSEPDPRFVFHFGGEPECSPV  179

Query  1042  VFQIQGS--------IRQPVFSCKFSAERNNRTRSLPSDFSLNS------RGWMRTFSGD  905
             V+QIQG+        IRQPVFSC+F+ +R   +RS+ S  + +       R W  +  G+
Sbjct  180   VYQIQGNCGGNRSRCIRQPVFSCRFTVDRRRNSRSMSSSLASDGSRSNSIRSWFSSLGGE  239

Query  904   RDRPGKE-RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSV  728
             RD   +E RKGW + I+DLSGS VAAASM+TPFVPSPGSDRVSRSNPGAWLILRP G S 
Sbjct  240   RDHQRREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPIGGST  299

Query  727   SS---WKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNA  557
             S+   WKPWGRLEAWRERG VD LGY+FELV D G   G+PIAE +++V+KGG+FCID +
Sbjct  300   SAATNWKPWGRLEAWRERGPVDALGYRFELVPDTGHIGGVPIAESSLSVRKGGQFCIDPS  359

Query  556   R--KHSASSLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSM  389
                   A       GFVM S+V  EGK    SVQV V HV+CMAD ALF+ALSAAIDLSM
Sbjct  360   VIGDMVAGQWPFDGGFVMGSTVEGEGKASKPSVQVGVQHVSCMADVALFIALSAAIDLSM  419

Query  388   DACQLFSTKLRKEFCHDEHD  329
             DACQLFS KLRKE C D+ D
Sbjct  420   DACQLFSQKLRKELCQDQQD  439



>ref|XP_006356806.1| PREDICTED: uncharacterized protein LOC102599523 [Solanum tuberosum]
Length=448

 Score =   424 bits (1090),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 242/450 (54%), Positives = 307/450 (68%), Gaps = 51/450 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTA++P    LP 
Sbjct  1     MDPCPFVRLSVCNLALKIPVASKPARSVVHPSSSPCFCKIKLKNFPLQTAVVPC--ILP-  57

Query  1387  DDSSSPTDSFAS-AEGFHLDPSALRRLSEK------PVALKLSVFAGRMGQTCGITSGKL  1229
              +S  P     S A  FHL+ S L +L  K       + L++S++ GR G TCG+ SG+L
Sbjct  58    -ESQFPDSQVQSHAASFHLNKSDLEKLVAKSLFGGGKLYLQISIYTGRRGSTCGVNSGRL  116

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK-PMLHVVVRSEPDPRFVFQFGGEPEC  1052
             LG V V +DL+G +SR V+F +GW  +G    +     H+ V++EPDPRFVFQF GEPEC
Sbjct  117   LGKVDVPLDLAGTESRSVLFYNGWIVIGKEAKNSSAQFHLSVKAEPDPRFVFQFDGEPEC  176

Query  1051  SPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             SP VFQIQG+IRQPVF+CKFS     +RN R+RSLP + S +SRGW+ +F  +R+RPGKE
Sbjct  177   SPQVFQIQGNIRQPVFTCKFSFRTPGDRNQRSRSLPLEHS-SSRGWLSSFGSERERPGKE  235

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGR
Sbjct  236   RKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWGR  292

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-------NARKHS  545
             LEAWRERGS DGLGY+FEL+ D+  T GI +AE  ++  KGG+F ID       N +   
Sbjct  293   LEAWRERGSADGLGYRFELIPDSAAT-GIVLAESTLSCSKGGKFVIDLGTSVSTNGKSTP  351

Query  544   ASSLSPV-------------------RGFVMCSSVEGKNGFL----SVQVAVNHVNCMad  434
              +S SP                    RGFVM ++VEG+ G      +V+V+V HVNC  D
Sbjct  352   VNSTSPACSPRGSGDFGYGLWPYCMYRGFVMSANVEGEGGSKCSKPTVEVSVQHVNCTED  411

Query  433   aalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             AA FVALSAAIDLS+DAC+LFS KLRKE C
Sbjct  412   AAAFVALSAAIDLSIDACRLFSQKLRKELC  441



>ref|XP_002510019.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52206.1| conserved hypothetical protein [Ricinus communis]
Length=441

 Score =   422 bits (1085),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 240/447 (54%), Positives = 302/447 (68%), Gaps = 46/447 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL + ++A+K+P ATK     VHPS++PC+ K+K  + P QTAL+P    +P 
Sbjct  1     MDPCPFIRLTVANLALKIPLATKSKRSVVHPSSSPCFCKIKLKNSPLQTALVPY---IPP  57

Query  1387  DDSSSPTDSFAS-AEGFHLDPSALRRLSEKP-----VALKLSVFAGRMGQTCGITSGKLL  1226
             D+++ P     + A  FHL  S L RL  K      V LK+S++ GR G TCG+ SG+LL
Sbjct  58    DNTNFPDGHPQTLAATFHLSKSDLDRLFAKSIFSGRVYLKISIYTGRRGTTCGVNSGRLL  117

Query  1225  GVVQVAVDLSGAQSRPVVFQSGWKKLGGGG---ADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
             G V V ++L+G +SR  VF +GW  +G      +     H+ V++EPDPRFVFQF GEPE
Sbjct  118   GKVCVPLNLAGTESRACVFHNGWIAVGKEANKVSSAAQFHLNVKAEPDPRFVFQFDGEPE  177

Query  1054  CSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             CSP VFQIQ +IRQPVF+CKFS     +RN R+RSLPS     +R W+ TF  +R+RPGK
Sbjct  178   CSPQVFQIQANIRQPVFTCKFSFRNIGDRNQRSRSLPSS---EARSWLSTFGSERERPGK  234

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPWG
Sbjct  235   ERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWG  291

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-----NARKHSA  542
             RLEAWRERG+ DGLGY+FEL+ D    +GI +AE  +++KKGG F ID     N R ++A
Sbjct  292   RLEAWRERGASDGLGYRFELIPDTN-AAGIVLAESTLSLKKGGNFVIDLGVNSNGRSNAA  350

Query  541   SSL-SP---------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfva  416
             S + SP                RGFVM +SV  EGK    SVQV+V HVNC  DAA FVA
Sbjct  351   SPVCSPRGSGDFGYGLWPYCVYRGFVMSASVEGEGKCSKPSVQVSVQHVNCTEDAAAFVA  410

Query  415   lsaAIDLSMDACQLFSTKLRKEFCHDE  335
             L+A +DLSMDAC+LFS +LRKE C D 
Sbjct  411   LAATVDLSMDACRLFSQRLRKELCQDR  437



>ref|XP_009759768.1| PREDICTED: uncharacterized protein LOC104212246 [Nicotiana sylvestris]
Length=444

 Score =   422 bits (1085),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 237/446 (53%), Positives = 303/446 (68%), Gaps = 47/446 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PCY K+K  +FP QTA++P   +   
Sbjct  1     MDPCPFVRLSVCNLALKVPVASKPAHSVVHPSSSPCYCKIKLKNFPLQTAVVPCILS---  57

Query  1387  DDSSSPTDSFAS-AEGFHLDPSALRRLSEK------PVALKLSVFAGRMGQTCGITSGKL  1229
              +S  P     S A  FHL+   L +L  K       + LK+S++ GR G TCG+ SG+L
Sbjct  58    -ESQFPDGQVQSHAASFHLNRCDLEKLVAKSLFGGGKLFLKISIYTGRRGSTCGVNSGRL  116

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK-PMLHVVVRSEPDPRFVFQFGGEPEC  1052
             LG V V +DL+G +SR V+F +GW  +G    +     H+ V++EPDPRFVFQF GEPEC
Sbjct  117   LGKVDVPLDLAGTESRSVLFHNGWIVIGKEAKNSSAQFHLSVKAEPDPRFVFQFEGEPEC  176

Query  1051  SPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             SP VFQIQG+IRQPVF+CKFS     +RN R+RSLP + S +SR W+ +F  +R+RPGKE
Sbjct  177   SPQVFQIQGTIRQPVFTCKFSFRTTGDRNQRSRSLPLEHS-SSRNWLSSFGSERERPGKE  235

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGR
Sbjct  236   RKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWGR  292

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-------NARKHS  545
             LEAWRERGS D LGY+FEL+ D+   +GI +AE  ++ +KGG+F ID       N +   
Sbjct  293   LEAWRERGSADSLGYRFELIPDSA-AAGIVLAESTLSCRKGGKFVIDLGTSVSTNGKLTP  351

Query  544   ASSLSPV-------------------RGFVMCSSVEGKNGFLSVQVAVNHVNCMadaalf  422
              +S SP                    RGFVM +SVEG+    +V+V+V HVNC  DAA +
Sbjct  352   GNSTSPACSPRGSGDFGYGLWPYCMYRGFVMSASVEGECSKPTVEVSVQHVNCTEDAAAY  411

Query  421   valsaAIDLSMDACQLFSTKLRKEFC  344
             VALSAAIDLS+DAC+LFS KLRKE C
Sbjct  412   VALSAAIDLSIDACRLFSQKLRKELC  437



>ref|XP_004238051.1| PREDICTED: uncharacterized protein LOC101246921 [Solanum lycopersicum]
Length=448

 Score =   422 bits (1085),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 240/450 (53%), Positives = 307/450 (68%), Gaps = 51/450 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTA++P    LP 
Sbjct  1     MDPCPFVRLSVCNLALKIPIASKPARSVVHPSSSPCFCKIKLKNFPLQTAVVPC--ILP-  57

Query  1387  DDSSSPTDSFAS-AEGFHLDPSALRRLSEK------PVALKLSVFAGRMGQTCGITSGKL  1229
              +S  P     S A  FHL+ S L +L  K       + L++S++ GR G TCG+ SG+L
Sbjct  58    -ESQFPDGQVQSHAASFHLNKSDLEKLVAKSLFGGRKLYLQISIYTGRRGSTCGVNSGRL  116

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK-PMLHVVVRSEPDPRFVFQFGGEPEC  1052
             LG V V +DL+G +SR V+F +GW  +G    +     H+ V++EPDPRFVFQF GEPEC
Sbjct  117   LGKVDVPLDLAGTESRSVLFYNGWIVIGKEAKNSSAQFHLSVKAEPDPRFVFQFDGEPEC  176

Query  1051  SPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             SP VFQIQG+IRQPVF+CKFS     +RN R+RSLP + S +SRGW+ +F  +R+RPGKE
Sbjct  177   SPQVFQIQGNIRQPVFTCKFSFRTPGDRNQRSRSLPLEHS-SSRGWLSSFGSERERPGKE  235

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WL+LRP      +WKPWGR
Sbjct  236   RKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLVLRPGD---GTWKPWGR  292

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-------NARKHS  545
             LEAWRERGS DGLGY+FEL+ D+   +GI +AE  ++  KGG+F ID       N +   
Sbjct  293   LEAWRERGSADGLGYRFELIPDSA-AAGIVLAESTLSCSKGGKFVIDLGTSVSTNGKSTP  351

Query  544   ASSLSPV-------------------RGFVMCSSVEGKNGFL----SVQVAVNHVNCMad  434
              +S SP                    RGFVM ++VEG+ G      +V+V+V HVNC  D
Sbjct  352   VNSTSPACSPRGSGDFGYGLWPYCMYRGFVMSANVEGEGGSKCSKPTVEVSVQHVNCTED  411

Query  433   aalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             AA FVALSAAIDLS+DAC+LFS KLRKE C
Sbjct  412   AAAFVALSAAIDLSIDACRLFSQKLRKELC  441



>ref|XP_009595727.1| PREDICTED: uncharacterized protein LOC104091979 [Nicotiana tomentosiformis]
Length=444

 Score =   419 bits (1078),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 237/446 (53%), Positives = 301/446 (67%), Gaps = 47/446 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PCY K+K  +FP QTA++P     P 
Sbjct  1     MDPCPFVRLSVCNLALKVPVASKPAHSVVHPSSSPCYCKIKLKNFPLQTAVVPC--IFP-  57

Query  1387  DDSSSPTDSFAS-AEGFHLDPSALRRLSEK------PVALKLSVFAGRMGQTCGITSGKL  1229
              +S  P     S A  FHL+   L +L  K       + LK+S++ GR G TCG+ SG+L
Sbjct  58    -ESQFPDAQVQSHAASFHLNKCDLEKLVAKSLFGGGKLFLKISIYTGRRGSTCGVNSGRL  116

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK-PMLHVVVRSEPDPRFVFQFGGEPEC  1052
             LG V V +DL+G +SR V+F +GW  +G    +     H+ V++EPDPRFVFQF GEPEC
Sbjct  117   LGKVDVPLDLAGTESRSVLFHNGWIVIGKEAKNSSAQFHLSVKAEPDPRFVFQFDGEPEC  176

Query  1051  SPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             SP VFQIQG+IRQPVF+CKFS     +RN R+RSLP + S +SR W+ +F  +R+RPGKE
Sbjct  177   SPQVFQIQGTIRQPVFTCKFSFRTTGDRNQRSRSLPLEHS-SSRNWLSSFGSERERPGKE  235

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGR
Sbjct  236   RKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWGR  292

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-------NARKHS  545
             LEAWRERGS D LGY+FEL+ D+  T GI +AE  ++  K G+F ID       N +   
Sbjct  293   LEAWRERGSADSLGYRFELIPDSAAT-GIVLAESTLSCSKAGKFVIDLGTSVSTNGKLTP  351

Query  544   ASSLSPV-------------------RGFVMCSSVEGKNGFLSVQVAVNHVNCMadaalf  422
              +S SP                    RGFVM +SVEG+    +V+V+V HVNC  DAA +
Sbjct  352   GNSTSPACSPRGSGDFGYGLWPYCMYRGFVMSASVEGECSKPTVEVSVQHVNCTEDAAAY  411

Query  421   valsaAIDLSMDACQLFSTKLRKEFC  344
             VALSAA+DLS+DAC+LFS KLRKE C
Sbjct  412   VALSAAVDLSIDACRLFSQKLRKELC  437



>ref|XP_008466095.1| PREDICTED: uncharacterized protein LOC103503621 [Cucumis melo]
 ref|XP_008466096.1| PREDICTED: uncharacterized protein LOC103503621 [Cucumis melo]
Length=444

 Score =   419 bits (1076),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 238/447 (53%), Positives = 301/447 (67%), Gaps = 47/447 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PC+ K+KF   P QTA++P   A   
Sbjct  1     MDPCPFVRLTVGNLALKVPVASKPARSVVHPSSSPCFCKIKFKKLPVQTAVVPFIQA---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
              +  S     ++A  FHL    L +L+ K +      LK+S+++GR G TCGI SG+LLG
Sbjct  58    GNQFSDGQVQSTAATFHLSKFDLDKLAGKSLFGSKPCLKISIYSGRRGTTCGIDSGRLLG  117

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK-PMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +DL+G +S+  VF +GW  +G    D     H+ V++EPDPRFVFQF GEPECSP
Sbjct  118   RVSVPLDLTGTESKATVFHNGWISVGKDSKDSCAQFHLNVKAEPDPRFVFQFDGEPECSP  177

Query  1045  VVFQIQGSIRQPVFSCKFS---AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKG  875
              VFQIQG+IRQPVF+CKFS    +R  R+RSLP++   +SR W+ +F  +R+RPGKERKG
Sbjct  178   QVFQIQGNIRQPVFTCKFSFRTGDRTQRSRSLPTE---SSRWWLSSFGSERERPGKERKG  234

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEA  695
             W I I+DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGRLEA
Sbjct  235   WSITIHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---DTWKPWGRLEA  291

Query  694   WRERGSVDGLGYKFELV--TDAGFT-SGIPIAEGAMNVKKGGRFCID-----NARKHSAS  539
             WRERG  DGLGY+FEL+  T+ G + +GI +AE A+N+ KGG+F ID     N R    +
Sbjct  292   WRERGGSDGLGYRFELIPDTNGGMSAAGIVLAESALNINKGGKFLIDLGGSSNGRSTPVN  351

Query  538   SLSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalf  422
              +SP                    RGFVM +SV  EGK     V+V V HVNC  D A F
Sbjct  352   PMSPACSPRSSGDYGYGPWPYCVYRGFVMGASVEGEGKCSKPRVEVGVQHVNCTEDVAAF  411

Query  421   valsaAIDLSMDACQLFSTKLRKEFCH  341
             VAL+AAIDLS+DAC+LFS KLRKE C 
Sbjct  412   VALAAAIDLSIDACRLFSHKLRKELCQ  438



>ref|XP_002285542.1| PREDICTED: uncharacterized protein LOC100245533 [Vitis vinifera]
Length=447

 Score =   418 bits (1075),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 235/450 (52%), Positives = 304/450 (68%), Gaps = 46/450 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL++ ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTA++P    +P 
Sbjct  1     MDPCPFVRLLVGNLALKVPVASKPARSVVHPSSSPCFCKIKLKNFPLQTAVVPF---IPP  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             ++          A  FHL  + L +L+ K +      LK++V+ GR G TCG+ SG+LLG
Sbjct  58    ENQFPDGQVQTLAASFHLSKADLEKLAAKSIFAGKLCLKIAVYTGRRGTTCGVNSGRLLG  117

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG-ADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +DL+G ++RP VF +GW  +G G        H+ V+SEPDPRFVFQF GEPEC+P
Sbjct  118   RVTVPLDLAGTETRPCVFHNGWISVGKGTKGSSAQFHLNVKSEPDPRFVFQFDGEPECNP  177

Query  1045  VVFQIQGSIRQPVFSCKFSAER----NNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
              VFQIQGSIRQPVF+CKFS       N R+RSL S+ +++SR W+ +F  +R+RPG+ERK
Sbjct  178   QVFQIQGSIRQPVFTCKFSFRNTGGPNQRSRSLQSE-TISSRTWLSSFGSERERPGRERK  236

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGRLE
Sbjct  237   GWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWGRLE  293

Query  697   AWRERGSVDGLGYKFELV--TDAGF-TSGIPIAEGAMNVKKGGRFCID-----NARKHSA  542
             AWRERGS DGLGY+FEL+  T+ G   +GI ++E  +   KGG+F ID     N R    
Sbjct  294   AWRERGSSDGLGYRFELIPDTNGGMGAAGIVLSESTLGSNKGGKFVIDLGGGSNGRATPG  353

Query  541   SSLSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaal  425
             S+ SP                    RGFVM ++V  EGK    SV+++V HVNC  DAA 
Sbjct  354   SATSPACSPRSSGDFGYGLWPYCSYRGFVMSATVEGEGKCSKPSVEISVQHVNCTEDAAA  413

Query  424   fvalsaAIDLSMDACQLFSTKLRKEFCHDE  335
             FVAL+AA+DLSMDAC+LFS KLRKE C  +
Sbjct  414   FVALAAAVDLSMDACRLFSHKLRKELCQHQ  443



>ref|XP_004136235.1| PREDICTED: uncharacterized protein LOC101220969 [Cucumis sativus]
 ref|XP_004168124.1| PREDICTED: uncharacterized protein LOC101227231 [Cucumis sativus]
 gb|KGN60303.1| hypothetical protein Csa_3G894510 [Cucumis sativus]
Length=444

 Score =   418 bits (1074),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 239/450 (53%), Positives = 299/450 (66%), Gaps = 53/450 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSA---  1397
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PC+ K+KF   P QT ++P   A   
Sbjct  1     MDPCPFVRLTVGNLALKVPVASKPARSVVHPSSSPCFCKIKFKKLPVQTVVVPFIQAGNQ  60

Query  1396  LPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGK  1232
              P     S      +A  FHL    L +L+ K +      LK+S+++GR G TCGI SG+
Sbjct  61    FPDGQVQS------TAATFHLSKVDLDKLAGKSLFASKPCLKISIYSGRRGTTCGIDSGR  114

Query  1231  LLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK-PMLHVVVRSEPDPRFVFQFGGEPE  1055
             LLG V V +DL+G +S+  VF +GW  +G    D     H+ V++EPDPRFVFQF GEPE
Sbjct  115   LLGRVSVPLDLTGTESKATVFHNGWISVGKDSKDSCAQFHLNVKAEPDPRFVFQFDGEPE  174

Query  1054  CSPVVFQIQGSIRQPVFSCKFS---AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             CSP VFQIQG+IRQPVF+CKFS    +R  R RSLP++   +SRGW+ +F  +R+RPGKE
Sbjct  175   CSPQVFQIQGNIRQPVFTCKFSFRTGDRTQRCRSLPTE---SSRGWLSSFGSERERPGKE  231

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I I+DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGR
Sbjct  232   RKGWSITIHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---DTWKPWGR  288

Query  703   LEAWRERGSVDGLGYKFELV--TDAGFT-SGIPIAEGAMNVKKGGRFCID-----NARKH  548
             LEAWRERG  DGLGY+FEL+  T+ G + +GI +AE A+N+ KGG+F ID     N R  
Sbjct  289   LEAWRERGGSDGLGYRFELIPDTNGGMSAAGIVLAESALNINKGGKFLIDLGGSSNGRST  348

Query  547   SASSLSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMada  431
               + +SP                    RGFVM +SV  EGK     V+V V HVNC  D 
Sbjct  349   PVNPMSPACSPRSSGDYGYGLWPYCVYRGFVMGASVEGEGKCSKPRVEVGVQHVNCTEDV  408

Query  430   alfvalsaAIDLSMDACQLFSTKLRKEFCH  341
             A FVAL+AAIDLS+DAC+LFS KLRKE C 
Sbjct  409   AAFVALAAAIDLSIDACRLFSHKLRKELCQ  438



>emb|CAN62368.1| hypothetical protein VITISV_001847 [Vitis vinifera]
Length=457

 Score =   418 bits (1075),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 236/452 (52%), Positives = 305/452 (67%), Gaps = 46/452 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL++ ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTA++P    +P 
Sbjct  1     MDPCPFVRLLVGNLALKVPVASKPARSVVHPSSSPCFCKIKLKNFPLQTAVVPF---IPP  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             ++          A  FHL  + L +L+ K +      LK++V+ GR G TCG+ SG+LLG
Sbjct  58    ENQFPDGQVQTLAASFHLSKADLEKLAAKSIFAGKLCLKIAVYTGRRGTTCGVNSGRLLG  117

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG-ADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +DL+G ++RP VF +GW  +G G        H+ V+SEPDPRFVFQF GEPEC+P
Sbjct  118   RVTVPLDLAGTETRPCVFHNGWISVGKGTKGSSAQFHLNVKSEPDPRFVFQFDGEPECNP  177

Query  1045  VVFQIQGSIRQPVFSCKFSAER----NNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
              VFQIQGSIRQPVF+CKFS       N R+RSL S+ +++SR W+ +F  +R+RPG+ERK
Sbjct  178   QVFQIQGSIRQPVFTCKFSFRNTGGPNQRSRSLQSE-TISSRTWLSSFGSERERPGRERK  236

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGRLE
Sbjct  237   GWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWGRLE  293

Query  697   AWRERGSVDGLGYKFELV--TDAGF-TSGIPIAEGAMNVKKGGRFCID-----NARKHSA  542
             AWRERGS DGLGY+FEL+  T+ G   +GI ++E  +   KGG+F ID     N R    
Sbjct  294   AWRERGSSDGLGYRFELIPDTNGGMGAAGIVLSESTLGSNKGGKFVIDLGGGSNGRATPG  353

Query  541   SSLSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaal  425
             S+ SP                    RGFVM ++V  EGK    SV+++V HVNC  DAA 
Sbjct  354   SATSPACSPRSSGDFGYGLWPYCSYRGFVMSATVEGEGKCSKPSVEISVQHVNCTEDAAA  413

Query  424   fvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             FVAL+AA+DLSMDAC+LFS KLRKE C  + D
Sbjct  414   FVALAAAVDLSMDACRLFSHKLRKELCVWQQD  445



>gb|KDP41556.1| hypothetical protein JCGZ_15963 [Jatropha curcas]
Length=449

 Score =   417 bits (1071),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 240/450 (53%), Positives = 299/450 (66%), Gaps = 46/450 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPC FVRL + ++AVK+P ATKPA   VHPS++PC+ K+K  +FP QTA++P    LP+
Sbjct  1     MDPCLFVRLTVGNLAVKIPVATKPARSVVHPSSSPCFCKIKLKNFPLQTAVVPY--ILPE  58

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             ++      +   A  FHL  S L RL  K +      +K+S++ GR G TCG+ SG+LLG
Sbjct  59    NNQFPEGQAQTIAATFHLSKSDLDRLVAKSIFAGKLYIKISIYTGRRGTTCGVNSGRLLG  118

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLG--GGGADKPMLHVVVRSEPDPRFVFQFGGEPECS  1049
              V V +DL+G  SR  VF +G   +G           H+ V++EPDPRFVFQF GEPECS
Sbjct  119   KVSVPLDLAGTDSRACVFHNGCISVGKETTKGSSAQFHLNVKAEPDPRFVFQFDGEPECS  178

Query  1048  PVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKER  881
             P VFQIQG+IRQPVF+CKFS     +RN R+RSL  +   +SR W+ +F  +R+RPGKER
Sbjct  179   PQVFQIQGNIRQPVFTCKFSLRNTGDRNQRSRSLQYEPG-SSRSWLSSFGSERERPGKER  237

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRL  701
             KGW + ++DLSGS VA ASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGRL
Sbjct  238   KGWSLTVHDLSGSPVATASMVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWGRL  294

Query  700   EAWRERGSVDGLGYKFELV--TDAGFT-SGIPIAEGAMNVKKGGRFCID-----NARKHS  545
             EAWRERG+ DGLGY+FEL+  T+ G + +GI +AE  M   KGG F ID     N R   
Sbjct  295   EAWRERGASDGLGYRFELIPDTNGGMSAAGIVLAESTMRSNKGGEFIIDLGANSNGRSTP  354

Query  544   ASSLSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaa  428
              +S+SPV                   RGFVM +SV  EGK    SVQV+V HVNC  DAA
Sbjct  355   VNSMSPVCSPRSSGDFGYGLWPFCMYRGFVMSASVEGEGKCSKPSVQVSVQHVNCTEDAA  414

Query  427   lfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
              FVAL+AAIDLSMDAC+LFS +LRKE C D
Sbjct  415   AFVALAAAIDLSMDACRLFSQRLRKELCQD  444



>ref|XP_002301131.1| hypothetical protein POPTR_0002s11320g [Populus trichocarpa]
 gb|EEE80404.1| hypothetical protein POPTR_0002s11320g [Populus trichocarpa]
Length=445

 Score =   416 bits (1068),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 236/448 (53%), Positives = 301/448 (67%), Gaps = 44/448 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+ + ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTA++P     P 
Sbjct  1     MDPCPFVRITVGNLALKIPVASKPARSVVHPSSSPCFCKIKLKNFPLQTAVIPY---TPP  57

Query  1387  DDSSSPTDSFAS-AEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLL  1226
             D++  P     + A  FHL  S L RL  K +      +K+S++ GR G TCG+ SG+LL
Sbjct  58    DNTQFPEGQHQTLAATFHLCKSDLDRLVTKSIFTNKLHVKISIYTGRRGNTCGVNSGRLL  117

Query  1225  GVVQVAVDLSGAQSRPVVFQSGWKKLGGG--GADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
             G V V +DL+G +SR VVF +GW  +G           H+ V++EPDPRFVFQF GEPEC
Sbjct  118   GKVSVPLDLAGTESRGVVFHNGWISVGKECVKGSSAQFHLNVKAEPDPRFVFQFDGEPEC  177

Query  1051  SPVVFQIQGSIRQPVFSCKFS-----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             SP VFQIQG+IRQPVF+CKFS      +R+ R+RSL  + + +SR W+ +F  +R+RP K
Sbjct  178   SPQVFQIQGNIRQPVFTCKFSLRTTTGDRSQRSRSLQGEPN-SSRSWLSSFGSERERPLK  236

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I I+DLSGS VAAASM+TPFVPSPGSDRVSRSNPG+WLILRP      +WKPWG
Sbjct  237   ERKGWSITIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGSWLILRPGD---GTWKPWG  293

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFT---SGIPIAEGAMNVKKGGRFCIDNARKHSASS  536
             RLEAWRERGS DGLGY+FEL+ D   +   + I +AE  ++  KGG+F ID     +  +
Sbjct  294   RLEAWRERGSSDGLGYRFELIPDTKGSMSAASIVLAESTLSSHKGGKFVIDLGAGSNGRA  353

Query  535   LSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfv  419
              SPV                   RGFVM +SV  EGK     V+V+V HVNC  DAA FV
Sbjct  354   TSPVGSPRGSGDYGHGLWPYCMYRGFVMSASVDGEGKCSKPGVEVSVQHVNCTEDAAAFV  413

Query  418   alsaAIDLSMDACQLFSTKLRKEFCHDE  335
             AL+AA+DLSMDACQLFS +LRKE C D+
Sbjct  414   ALAAAVDLSMDACQLFSQRLRKELCQDQ  441



>ref|XP_009406176.1| PREDICTED: uncharacterized protein LOC103989135 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   415 bits (1067),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 251/449 (56%), Positives = 307/449 (68%), Gaps = 37/449 (8%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRLIIES+ +KLP+ ++ AGPGVHPSTTPC+  ++    PS +   PL  A   
Sbjct  1     MDPCPFVRLIIESLVLKLPAISRSAGPGVHPSTTPCFCSIELQDCPSSSHTTPLPVAADP  60

Query  1387  DDSSSPTDSFASAE-----GFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLG  1223
               +++  ++ ASA         LDP+ L+RLS K   L +SV+ GR G TCG +SG+LLG
Sbjct  61    TSTTNLMEAPASAVPSAPVAISLDPATLQRLSGKRARLTVSVYVGRTGSTCGFSSGRLLG  120

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPV  1043
              V+VAVDL  A +RP V QSGW  +G G +    LH+VVRSEPDPRFVFQFGGEPECSPV
Sbjct  121   RVRVAVDLEIAPARPTVAQSGWVMVGHGRSAA-RLHLVVRSEPDPRFVFQFGGEPECSPV  179

Query  1042  VFQIQGS--------IRQPVFSCKFSAERNNRTRS----LPSDFSLNS---RGWMRTFSG  908
             V+QI G+        IRQPVFSC+FS +R   TRS    LPSD + ++   R W  +   
Sbjct  180   VYQIPGNCGSSRSGCIRQPVFSCRFSIDRRRSTRSSSISLPSDAASHNNSMRCWFGSLGA  239

Query  907   DRD-RPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGP-  734
              ++ R  ++RKGW + I+DLSGS VAAASM+TPFVPSPGSDRVSRS+PGAWLILR   P 
Sbjct  240   KKNQRRREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSDRVSRSDPGAWLILRAIVPP  299

Query  733   ----------SVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKK  584
                       S ++WKPWGRLEAWRERG+VD LG +FELV D G   G+PIAE +++V+K
Sbjct  300   SSSSSSSSSSSSTNWKPWGRLEAWRERGAVDALGCRFELVPDTGPIGGVPIAESSLSVRK  359

Query  583   GGRFCIDNARKHS--ASSLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfva  416
             GG FCID +      A     + GFVM S+V  EGK    SVQV V HV+CMAD ALF+A
Sbjct  360   GGHFCIDPSVIGDVVAGPWPFLGGFVMGSTVEGEGKASKPSVQVGVQHVSCMADVALFIA  419

Query  415   lsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             LSAAIDLSMDACQLFS KLRKE C D+ D
Sbjct  420   LSAAIDLSMDACQLFSQKLRKELCKDQQD  448



>ref|XP_008352747.1| PREDICTED: uncharacterized protein LOC103416271 [Malus domestica]
Length=444

 Score =   414 bits (1063),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 234/449 (52%), Positives = 307/449 (68%), Gaps = 51/449 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFS--SFPSQTALLPLCSAL  1394
             MDPCPFVR+ + ++A+K+P A+KPA   VHPS++PC+ K+K +  + P Q A++P    L
Sbjct  1     MDPCPFVRVTVGNLALKIPVASKPARSVVHPSSSPCFCKIKLNILNLPPQNAVVP---CL  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKL  1229
             P D  +   D+ A+A  FHL  S L RL+ K +      LK+S++ GR G TCG+ SG+L
Sbjct  58    PPDTQT--LDNPATAAXFHLSKSDLDRLASKSIFASRLCLKISIYTGRRGTTCGVNSGRL  115

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLG-----GGGADKPMLHVVVRSEPDPRFVFQFGG  1064
             LG V V +DL+G +S+P VF +GW  +G     GG A +   H+ V++EPDPRFVFQF G
Sbjct  116   LGRVSVPLDLAGTESKPSVFHNGWVSVGKGPNKGGSAAQTQFHLNVKAEPDPRFVFQFDG  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDR  896
             EPECSP VFQI+G+IRQPVF+CKFS    A+R  R+RSL S+   +SR W+ +F  +R+R
Sbjct  176   EPECSPQVFQIRGNIRQPVFTCKFSFRTSADRTQRSRSLQSEQG-SSRSWLSSFGSERER  234

Query  895   PGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWK  716
             PGKERKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP     ++WK
Sbjct  235   PGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---NTWK  291

Query  715   PWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASS  536
             PWGRLEAWRERG  DGLGY+FEL+ D    +GI +AE  +++ KGG+F +D     S++ 
Sbjct  292   PWGRLEAWRERGGADGLGYRFELIPDTS-GAGIVLAESTISLNKGGKFVLDLG-SGSSNR  349

Query  535   LSPV----------------------RGFVMCSSVEGKN--GFLSVQVAVNHVNCMadaa  428
             L P+                      RGFVM + VEG+      +V+V+V HVNC  DAA
Sbjct  350   LGPISPGCSPRGSGDFGYGLWPYCMXRGFVMSAKVEGEGRCSKPAVEVSVQHVNCTEDAA  409

Query  427   lfvalsaAIDLSMDACQLFSTKLRKEFCH  341
              FVAL+AA+DLSMDAC+LFS +LRKE C 
Sbjct  410   AFVALAAAVDLSMDACRLFSQRLRKELCQ  438



>ref|XP_010061596.1| PREDICTED: uncharacterized protein LOC104449221 [Eucalyptus grandis]
 gb|KCW68587.1| hypothetical protein EUGRSUZ_F02199 [Eucalyptus grandis]
Length=464

 Score =   414 bits (1065),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 245/469 (52%), Positives = 304/469 (65%), Gaps = 63/469 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + S+A+K+P A KPA   VHPS+TPC+ K+K  SFP QTAL+P    LP 
Sbjct  1     MDPCPFVRLTVGSLALKIPVAAKPARSAVHPSSTPCFCKIKLKSFPLQTALVP---HLPP  57

Query  1387  DDSSSPTDSFAS--------------AEGFHLDPSALRRLSEK-----PVALKLSVFAGR  1265
             D ++ PTD  AS                 FHL  + L RL+ K      V LK+SVF GR
Sbjct  58    D-AAHPTDGPASPPGVVVVGGGGGGGGATFHLSKADLDRLAGKSIFSGKVCLKVSVFTGR  116

Query  1264  MGQTCGITSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGG--GADKPMLHVVVRSEPD  1091
              G TCG++SG+LLG V V +DL+GA+SR  VF SGW  +G    G+     H+ V++EPD
Sbjct  117   RGATCGVSSGRLLGKVSVPLDLAGAESRACVFHSGWINVGKDTKGSSSAQFHLTVKAEPD  176

Query  1090  PRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN------RTRSLPSDFSLNSRG  929
             PRFVFQF GEPECSP VFQIQG+IRQPVF+C+FS   +N      R+RSLPS+ S  SR 
Sbjct  177   PRFVFQFDGEPECSPQVFQIQGNIRQPVFTCEFSFRSHNGDHHAQRSRSLPSESSC-SRN  235

Query  928   WMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLIL  749
             W+ +F  +R++PG+ERKGW I ++DLSGS VA ASM+TPFV SPGSDRVSRSNPG+WLIL
Sbjct  236   WLSSFGSEREKPGRERKGWSITVHDLSGSPVATASMVTPFVASPGSDRVSRSNPGSWLIL  295

Query  748   RPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTD-AGFTSGIPIAEGAMNVKKGGRF  572
             RP      +WKPWGRLEAWRERG  D LG +FE++ D AG  +G+ ++E  ++ K GGRF
Sbjct  296   RPGD---GTWKPWGRLEAWRERGGSDSLGCRFEIIPDSAGAGAGVVVSESTLSSKSGGRF  352

Query  571   CID------NARKHSASSLSPV-------------------RGFVMCSSV--EGKNGFLS  473
              ID      N R    S+ SP                    RGFVM + V  EGK    +
Sbjct  353   QIDLGSNGGNGRATPGSAGSPACSPRSSGDFGHGLWPYCMYRGFVMAAGVEGEGKCSKPT  412

Query  472   VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDS  326
             V+V+V HV C  DAA FVAL+AA+DLSMDAC LF+ +LRKE CH    S
Sbjct  413   VEVSVQHVGCTEDAAAFVALAAAVDLSMDACMLFTQRLRKELCHTADSS  461



>ref|XP_010104534.1| hypothetical protein L484_025508 [Morus notabilis]
 gb|EXC01135.1| hypothetical protein L484_025508 [Morus notabilis]
Length=442

 Score =   412 bits (1060),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 231/445 (52%), Positives = 301/445 (68%), Gaps = 41/445 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTA++P    +P 
Sbjct  1     MDPCPFVRLTVGNLALKIPVASKPARSVVHPSSSPCFCKVKLKNFPLQTAVVPF---IPP  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             ++      +   A  FHL  S L R+S K +      L+++++ GR G TCG+ SG+LLG
Sbjct  58    ENQFPDGQTHTVAATFHLSKSDLDRISGKTIFSGRLCLRIAIYTGRRGTTCGVNSGRLLG  117

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGG-GGADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V ++L+G +++  VF +GW  +G          H+ VR+EPDPRFVFQF GEPECSP
Sbjct  118   KVSVPLELAGTEAKSTVFHNGWISVGKEAKGSSAHFHLNVRAEPDPRFVFQFDGEPECSP  177

Query  1045  VVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
              VFQIQG+IRQPVF+CKFS     +RN R+RSL S+ S +SR W+ +F  +R+RP KERK
Sbjct  178   QVFQIQGNIRQPVFTCKFSFRNTGDRNQRSRSLQSEPS-SSRSWLGSFGSERERPIKERK  236

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILR   P+  +WKPWGRLE
Sbjct  237   GWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILR---PAEGTWKPWGRLE  293

Query  697   AWRERGSVDGLGYKFELVTDAG---FTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP  527
             AWRERG  DGLGY+FELV DAG     +GI ++E  +N +KGG+F ID     +  S SP
Sbjct  294   AWRERGGSDGLGYRFELVPDAGGGVSAAGIVLSESTLNSQKGGKFVIDLGSSRAGGSGSP  353

Query  526   V-------------------RGFVMCSSVEGKN--GFLSVQVAVNHVNCMadaalfvals  410
                                 RGFVM + VEG+      +V+++V HV C  DAA FVAL+
Sbjct  354   ACSPRSSGDFGYGLWPYCAYRGFVMSAKVEGEGRCSKPTVEMSVQHVGCTEDAAAFVALA  413

Query  409   aAIDLSMDACQLFSTKLRKEFCHDE  335
             AAIDLSMDAC+LFS +LRKE CH +
Sbjct  414   AAIDLSMDACRLFSHRLRKELCHQQ  438



>ref|XP_011017042.1| PREDICTED: uncharacterized protein LOC105120505 [Populus euphratica]
Length=445

 Score =   412 bits (1059),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 233/448 (52%), Positives = 300/448 (67%), Gaps = 44/448 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+ + ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTA++P    +P 
Sbjct  1     MDPCPFVRITVGNLALKIPVASKPARSVVHPSSSPCFCKIKLKNFPLQTAVIPY---IPP  57

Query  1387  DDSSSPTDSFAS-AEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLL  1226
             D++  P     + A  FHL  S L RL    +      +K+S++ GR G TCG+ SG+LL
Sbjct  58    DNTQFPEGQQQTLAATFHLCKSDLDRLVTNSIFTNKLHVKISIYTGRRGNTCGVNSGRLL  117

Query  1225  GVVQVAVDLSGAQSRPVVFQSGWKKLGGG--GADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
             G V V +DL+G +SR VVF +GW  +G           H+ V++EPDPRFVFQF GEPEC
Sbjct  118   GKVSVPLDLAGTESRGVVFHNGWISVGKECVKGSSAQFHLNVKAEPDPRFVFQFDGEPEC  177

Query  1051  SPVVFQIQGSIRQPVFSCKFS-----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             SP VFQIQG+IRQPVF+CKFS      +RN R+RSL  + + +SR W+ +F  +R+RP K
Sbjct  178   SPQVFQIQGNIRQPVFTCKFSFRTTTGDRNQRSRSLQGEPN-SSRSWLSSFGSERERPLK  236

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I ++DLSGS VAAASM+TPFVPSPGSDRVSRSNPG+WLILRP      +WKPWG
Sbjct  237   ERKGWSITVHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGSWLILRPGD---GTWKPWG  293

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFT---SGIPIAEGAMNVKKGGRFCIDNARKHSASS  536
             RLEAWRERGS DGLGY+FEL+ D   +   + I +AE  ++  KGG+F ID     +  +
Sbjct  294   RLEAWRERGSSDGLGYRFELIPDTKGSMSAASIVLAESTLSSHKGGKFVIDLGGGSNGRA  353

Query  535   LSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfv  419
              SPV                   RGFVM +SV  EGK     V+V+V HVNC  DAA FV
Sbjct  354   TSPVGSPRGSGDYGHGLWPYCMYRGFVMSASVDGEGKCSKPGVEVSVQHVNCTEDAAAFV  413

Query  418   alsaAIDLSMDACQLFSTKLRKEFCHDE  335
             AL+AA+DLSMDAC+ FS +LRKE C D+
Sbjct  414   ALAAAVDLSMDACKFFSQRLRKELCQDQ  441



>ref|XP_007018388.1| Formin-like protein 18 [Theobroma cacao]
 gb|EOY15613.1| Formin-like protein 18 [Theobroma cacao]
Length=445

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 299/449 (67%), Gaps = 46/449 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+ + ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTA++P    +P 
Sbjct  1     MDPCPFVRITVGNLALKIPVASKPARSVVHPSSSPCFCKIKLKNFPLQTAVVPY---IPP  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             ++          A  FHL  + + +L+ K +      LK++++ GR G TCG+ SG+LLG
Sbjct  58    ENQFPDNQLQTLAATFHLSKADIDKLAAKSIFSAKLCLKIAIYTGRRGTTCGVNSGRLLG  117

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLG--GGGADKPMLHVVVRSEPDPRFVFQFGGEPECS  1049
              V V +DL+G +SR  VF SGW  +G           H+ V++EPDPRFVFQF GEPECS
Sbjct  118   KVSVPLDLAGTESRACVFHSGWISIGKEANKGSSAQFHLNVKAEPDPRFVFQFDGEPECS  177

Query  1048  PVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKER  881
             P VFQI+G+IRQPVF+CKFS     +RN R+RSL S+ S +SRGW+ +F  +R+RPGKER
Sbjct  178   PQVFQIRGNIRQPVFTCKFSFRSTGDRNQRSRSLQSEPS-SSRGWLSSFGSERERPGKER  236

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRL  701
             KGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPW RL
Sbjct  237   KGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWARL  293

Query  700   EAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID------NARKHSAS  539
             EAWRERGS DGLGY+FEL+ D    + I +AE  ++  KGG+F ID      N R    S
Sbjct  294   EAWRERGSSDGLGYRFELIPDMS-AAAIVLAESTLSSGKGGKFVIDLGGGGTNGRATPGS  352

Query  538   SLSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalf  422
             + SP                    RGFVM + V  EGK     V+V+V HVNC  DAA F
Sbjct  353   ATSPACSPRSSGDFGYGLWPFCVYRGFVMSARVEGEGKCSKPCVEVSVQHVNCTEDAAAF  412

Query  421   valsaAIDLSMDACQLFSTKLRKEFCHDE  335
             VAL+AA+DLSMDAC+LFS +LRKE C+ +
Sbjct  413   VALAAAVDLSMDACRLFSQRLRKELCNHQ  441



>ref|XP_009357220.1| PREDICTED: uncharacterized protein LOC103947956 [Pyrus x bretschneideri]
Length=444

 Score =   410 bits (1054),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 233/449 (52%), Positives = 306/449 (68%), Gaps = 51/449 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFS--SFPSQTALLPLCSAL  1394
             MDPCPFVR+ + ++A+K+P A+KPA   VHPS++PC+ K+K +  + P Q A++P    L
Sbjct  1     MDPCPFVRVTVGNLALKIPVASKPARSVVHPSSSPCFCKIKLNILNLPPQNAVVP---CL  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKL  1229
             P D  +   D+ A+A  FHL  S L RL+ K +      LK+S++ GR G TCG+ SG+L
Sbjct  58    PPDTQT--LDNPATAATFHLSKSDLDRLASKSIFASRLCLKISIYTGRRGTTCGVNSGRL  115

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLG-----GGGADKPMLHVVVRSEPDPRFVFQFGG  1064
             LG V V +DL+G +S+P VF +GW  +G     GG A +   H+ V++EPDPRFVFQF G
Sbjct  116   LGRVSVPLDLAGTESKPSVFHNGWVSVGKGPNKGGSAAQTQFHLNVKAEPDPRFVFQFDG  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDR  896
             EPECSP VFQI+G+IRQPVF+CKFS    A+R  R+RSL S+   +SR W+ +F  +R+R
Sbjct  176   EPECSPQVFQIRGNIRQPVFTCKFSFRASADRTQRSRSLQSEQG-SSRSWLSSFGSERER  234

Query  895   PGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWK  716
             PGKERKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRS+PG+WLILRP     ++WK
Sbjct  235   PGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSHPGSWLILRPGD---NTWK  291

Query  715   PWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASS  536
             PWGRLEAWRERG  DGLGY+FEL+ D    +GI +AE  +++ KGG+F +D     S++ 
Sbjct  292   PWGRLEAWRERGGADGLGYRFELIPDTS-GAGIVLAESTISLNKGGKFVLDLG-SGSSNR  349

Query  535   LSP----------------------VRGFVMCSSVEGKN--GFLSVQVAVNHVNCMadaa  428
             L P                       RGFVM + VEG+      +V+V+V HVNC  DAA
Sbjct  350   LGPNSPGCSPRGSGDFGYGLWPYSMYRGFVMSAKVEGEGRCSKPAVEVSVQHVNCTEDAA  409

Query  427   lfvalsaAIDLSMDACQLFSTKLRKEFCH  341
              FVAL+AA+DLSMDAC+LFS +LRKE C 
Sbjct  410   AFVALAAAVDLSMDACRLFSQRLRKELCQ  438



>ref|XP_011074314.1| PREDICTED: uncharacterized protein LOC105159071 [Sesamum indicum]
Length=455

 Score =   410 bits (1055),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 230/454 (51%), Positives = 297/454 (65%), Gaps = 52/454 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K   A KPA   VHPS++PC+  +K ++F  Q A++P    +P 
Sbjct  1     MDPCPFVRLTVGNLAIKTSVAAKPARSAVHPSSSPCFCTIKLNNFLLQNAVVPY---IPP  57

Query  1387  DDSSSPT-DSFASAEGFHLDPSALRRLSEKPV--------ALKLSVFAGRMGQTCGITSG  1235
             + +  P  +S   A  FHL    + RL+ K           LK+SV++GR G TCG++SG
Sbjct  58    ETTQFPDGNSQTLAASFHLSKPDVDRLTGKSSLFSTSKRPQLKISVYSGRRGATCGLSSG  117

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
             +LLG + V +DL+ A+SR +VF SGW  +G         H+ V++EP+PRFVF+F GEPE
Sbjct  118   RLLGKISVPLDLAAAESRAIVFHSGWINVGKEAKGMAQFHLNVKAEPEPRFVFEFDGEPE  177

Query  1054  CSPVVFQIQGSIRQPVFSCKFS---AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             CSP VFQI+GSIRQPVF+CKFS    +RN R+RSLP + S  +RGW+ +F  +R+RPGKE
Sbjct  178   CSPQVFQIRGSIRQPVFTCKFSFRTGDRNQRSRSLPPEHSSGARGWLTSFGSERERPGKE  237

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I I+DLSGS VAAASM+TPFV SPGSDRVSRSNPG WLILRP      +WKPWGR
Sbjct  238   RKGWSITIHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGCWLILRPGD---GTWKPWGR  294

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-NARKHSASSLSP  527
             LEAWRERG+ DGLGY+FEL+ D+   +GI +AE  ++  KGG+F ID N   +   + +P
Sbjct  295   LEAWRERGAGDGLGYRFELIPDSAAAAGIVLAESTLSCSKGGKFVIDLNGNGNGTPTGTP  354

Query  526   --------------------------VRGFVMCSSVE-------GKNGFLSVQVAVNHVN  446
                                        RGFVM +SVE       GK     V+V+V HV+
Sbjct  355   KSAAASPGCSPRSSGDFGYGLWPYCMYRGFVMSASVEGEGRSGRGKTAAPQVEVSVQHVS  414

Query  445   CMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             C  DAA FVALSAA+DLS+DAC+LFS KLRKE C
Sbjct  415   CTEDAAAFVALSAALDLSIDACRLFSHKLRKELC  448



>ref|XP_010943312.1| PREDICTED: uncharacterized protein LOC105061065 [Elaeis guineensis]
Length=442

 Score =   409 bits (1052),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 223/439 (51%), Positives = 301/439 (69%), Gaps = 36/439 (8%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLC--SAL  1394
             MDPCPFVR+++ ++A+K+P A +PAG GVHPST+PC+ K++ + +P QTA++PL    A 
Sbjct  1     MDPCPFVRVLVGNLALKIPVAARPAGAGVHPSTSPCFCKIRLNKYPYQTAVVPLVPPEAT  60

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPV------ALKLSVFAGRMGQTCGITSGK  1232
                D   P+ +   A GFHL  + L +L+ K +       LK++++ GR G TCG++SG+
Sbjct  61    SPPDCDQPSATLNLAAGFHLSRADLEKLAGKSIFAGGKARLKVAIYTGRRGTTCGVSSGR  120

Query  1231  LLGVVQVAVDLSGAQSRPVVFQSGW-KKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
             LLG V + +DL GA+ +  VF +GW     G  +    LH+ VR++PDPRFVF+FGG+PE
Sbjct  121   LLGKVTLPLDLKGAEGKACVFHNGWISVGKGSKSSSAQLHLTVRADPDPRFVFEFGGDPE  180

Query  1054  CSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             CSP VFQ+QGS+RQPVF+CKFS    A+RN R+RS+ ++   +SR W+ +F  +R+RP K
Sbjct  181   CSPQVFQVQGSMRQPVFTCKFSCRNPADRNLRSRSVAAE-PCSSRSWLSSFGSERERPMK  239

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWL+LRP G    +WKPWG
Sbjct  240   ERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLVLRPGG---GTWKPWG  296

Query  706   RLEAWRERGS--VDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASS-  536
             RLEAWRERG    DG+GY+F+LV D   ++G+P+AE  ++  KGG+F ID      +   
Sbjct  297   RLEAWRERGGGVSDGIGYRFQLVPDTAMSAGVPLAESTVSTSKGGKFTIDLTGAGGSPGG  356

Query  535   --------------LSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaA  404
                            S  RGFVM S+V  EGK    SV++ V+HV C  DAA FVAL+AA
Sbjct  357   SPRGSGHFGAGPWPFSGYRGFVMSSTVEGEGKCSRPSVEIGVHHVGCTEDAAAFVALAAA  416

Query  403   IDLSMDACQLFSTKLRKEF  347
             +DLSMDAC+LFS KLRKE 
Sbjct  417   VDLSMDACRLFSHKLRKEL  435



>gb|EYU36412.1| hypothetical protein MIMGU_mgv1a006276mg [Erythranthe guttata]
Length=450

 Score =   409 bits (1052),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 232/449 (52%), Positives = 291/449 (65%), Gaps = 48/449 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL IE++A+K P A KPA   VHPS++PC+  +K   FP Q A++P    +P 
Sbjct  1     MDPCPFVRLTIENLALKFPVAAKPARSAVHPSSSPCFCVIKLKGFPIQNAVVPY---IPP  57

Query  1387  DDSSSPT-DSFASAEGFHLDPSALRRLSEKPV--------ALKLSVFAGRMGQTCGITSG  1235
             + +  P  +S A A  FHL    + RL  K           LK++V++GR G +CG+ SG
Sbjct  58    ESAQFPEGNSHALAASFHLSKPDVDRLLGKSSIFSGGKRPQLKIAVYSGRRGASCGVNSG  117

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
             +LLG + V +DL+ A+SR VVF +GW  +G         H+ V++EPDPRFVFQF GEPE
Sbjct  118   RLLGKITVPLDLTAAESRAVVFHNGWISVGVEAKGAAQFHLNVKAEPDPRFVFQFDGEPE  177

Query  1054  CSPVVFQIQGSIRQPVFSCKFS---AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             CSP VFQI+G +RQPVF+CKFS    +RN R+ SLPS+ S  +R W+ +F  +R+RPGKE
Sbjct  178   CSPQVFQIKGDVRQPVFTCKFSFRAPDRNQRSMSLPSEHSNGARAWLSSFGSERERPGKE  237

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I I+DLSGS VA ASM+TPFVP PGSD+VSRSNPG WLILRP      +WKPWGR
Sbjct  238   RKGWSITIHDLSGSPVAVASMVTPFVPLPGSDKVSRSNPGCWLILRPGD---GTWKPWGR  294

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID----------NAR  554
             LEAWRERG+ DGLGY+FEL+ D+   +GI +AE A++  KGG+F ID            R
Sbjct  295   LEAWRERGASDGLGYRFELILDSAAAAGIVLAESALSCSKGGKFVIDLNGGGGTPSGTPR  354

Query  553   KHSAS----------------SLSPVRGFVMCSSVE----GKNGFLSVQVAVNHVNCMad  434
                AS                  S  RGFVM + VE    GK     V+V+V HV C  D
Sbjct  355   SGGASPGCSPRGSGDFGNGLWPYSAYRGFVMSACVEGNGRGKTVGPVVEVSVQHVTCTED  414

Query  433   aalfvalsaAIDLSMDACQLFSTKLRKEF  347
             AA FVALSAA+DLSMDAC+LFS KLRKE 
Sbjct  415   AAAFVALSAALDLSMDACRLFSQKLRKEL  443



>ref|XP_008339055.1| PREDICTED: uncharacterized protein LOC103402092 [Malus domestica]
Length=444

 Score =   409 bits (1050),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 232/449 (52%), Positives = 305/449 (68%), Gaps = 51/449 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFS--SFPSQTALLPLCSAL  1394
             MDPCPFVR+ + ++A+K+P A+KPA   VHPS++PC+ K+K +  +   Q A++P    L
Sbjct  1     MDPCPFVRVTVGNLALKIPVASKPARSVVHPSSSPCFCKIKLNILNLXPQNAVVP---CL  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKL  1229
             P D  +   D+ A+A  FHL  S L RL+ K +      LK+S++ GR G TCG+ SG+L
Sbjct  58    PPDTQT--LDNPATAAXFHLSKSDLDRLASKSIFASRLCLKISIYTGRRGTTCGVNSGRL  115

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLG-----GGGADKPMLHVVVRSEPDPRFVFQFGG  1064
             LG V V +DL+G +S+P VF +GW  +G     GG A +   H+ V++EPDPRFVFQF G
Sbjct  116   LGRVSVPLDLAGTESKPSVFHNGWVSVGKGPNKGGSAAQTQFHLNVKAEPDPRFVFQFDG  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDR  896
             EPECSP VFQI+G+IRQPVF+CKFS    A+R  R+RSL S+   +SR W+ +F  +R+R
Sbjct  176   EPECSPQVFQIRGNIRQPVFTCKFSFRTSADRTQRSRSLQSEQG-SSRSWLSSFGSERER  234

Query  895   PGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWK  716
             PGKERKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP     ++WK
Sbjct  235   PGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---NTWK  291

Query  715   PWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASS  536
             PWGRLEAWRERG  DG GY+FEL+ D    +GI +AE  +++ KGG+F +D     S++ 
Sbjct  292   PWGRLEAWRERGGADGXGYRFELIPDTS-GAGIVLAESTISLNKGGKFVLDLG-SGSSNR  349

Query  535   LSPV----------------------RGFVMCSSVEGKN--GFLSVQVAVNHVNCMadaa  428
             L P+                      RGFVM + VEG+      +V+V+V HVNC  DAA
Sbjct  350   LGPISPGCSPRGSGDFGYGLWPYCMXRGFVMSAKVEGEGRCSKPAVEVSVQHVNCTEDAA  409

Query  427   lfvalsaAIDLSMDACQLFSTKLRKEFCH  341
              FVAL+AA+DLSMDAC+LFS +LRKE C 
Sbjct  410   AFVALAAAVDLSMDACRLFSQRLRKELCQ  438



>ref|XP_008776853.1| PREDICTED: uncharacterized protein LOC103696910 [Phoenix dactylifera]
Length=442

 Score =   408 bits (1048),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 232/441 (53%), Positives = 304/441 (69%), Gaps = 40/441 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++ ++A+K+P A +PAG GVHPS++PC+ K+  + FP QTA++PL    P+
Sbjct  1     MDPCPFVRVLVGNLALKIPVAARPAGAGVHPSSSPCFCKIWLNKFPYQTAVVPLVP--PE  58

Query  1387  DDSSSPTDSFASA----EGFHLDPSALRRLSEKPV------ALKLSVFAGRMGQTCGITS  1238
                SS  D  ++A      FHL  + L +LS K +       LK++++ GR G TCG++S
Sbjct  59    VSFSSGGDQHSAALTLAAVFHLARADLEKLSGKSIFVGAKARLKVAIYTGRRGTTCGVSS  118

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK-PMLHVVVRSEPDPRFVFQFGGE  1061
             G+LLG V + +DL GA+ R  VFQSGW  +G G     P LH+ VR++PDPRFVF+FGGE
Sbjct  119   GQLLGKVNLPLDLKGAEGRACVFQSGWVSVGKGSKSSSPQLHLTVRADPDPRFVFEFGGE  178

Query  1060  PECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             PECSP VFQ+QGS+RQPVF+CKFS    A+RN R+RS+P++   NSR W+ +F  +R+RP
Sbjct  179   PECSPQVFQVQGSMRQPVFTCKFSCRNPADRNLRSRSVPAE-PCNSRSWLSSFGSERERP  237

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              KERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWL+LRP      +WKP
Sbjct  238   IKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLVLRPGD---GTWKP  294

Query  712   WGRLEAWRER--GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSAS  539
             W RLEAWRER  G+ DGLGY+F+LV D   ++G P+AE  ++  KGG+F ID      + 
Sbjct  295   WARLEAWRERGGGTSDGLGYRFQLVPDTAVSAGAPLAECTVSTSKGGKFTIDLTGAGGSP  354

Query  538   SLSP---------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvals  410
             + SP                RGFVM S+V  EGK    SV+V V HV C  DAA FVAL+
Sbjct  355   AGSPRGSIDFGAGPWPFSGYRGFVMSSTVEGEGKCSRPSVEVGVQHVGCTEDAAAFVALA  414

Query  409   aAIDLSMDACQLFSTKLRKEF  347
             AA+DLSMDAC+LFS KLR+E 
Sbjct  415   AAVDLSMDACRLFSHKLRREL  435



>ref|XP_011078480.1| PREDICTED: uncharacterized protein LOC105162206 [Sesamum indicum]
Length=451

 Score =   408 bits (1049),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 230/451 (51%), Positives = 299/451 (66%), Gaps = 50/451 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++ +K+P A KPA   VHPS++PC+ K+K  +FP Q A++P    +P 
Sbjct  1     MDPCPFVRLTVGNLGLKIPMAAKPARSAVHPSSSPCFCKIKLKNFPLQDAIVPY---VPS  57

Query  1387  DDSSSPT-DSFASAEGFHLDPSALRRL---------SEKPVALKLSVFAGRMGQTCGITS  1238
             +++ SP   S   A  F L  S L RL         S+KP  LK+SV++ R G +CG++S
Sbjct  58    ENAPSPDCSSHTIAASFDLCKSDLDRLNGKSSLFSTSKKP-QLKISVYSARRGASCGVSS  116

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEP  1058
             G+LLG + V +DL  A+ + VVF +GW  +G    +    H+ V++EPDPRFVFQF G P
Sbjct  117   GRLLGKITVQLDLPAAELKAVVFHNGWINVGKKKKNMAQFHMNVKAEPDPRFVFQFDGAP  176

Query  1057  ECSPVVFQIQGSIRQPVFSCKF---SAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             ECSP VFQ++G+IRQPVF+CKF   +A+RN R+RSL S+    +RGW+ +F  +R+RPGK
Sbjct  177   ECSPQVFQLRGNIRQPVFTCKFNFRAADRNQRSRSLSSEQISPARGWLSSFGSERERPGK  236

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I I+DLSGS VA ASM+TPFV  PGSDRV+RSN G WLILRP      +WKPWG
Sbjct  237   ERKGWSITIHDLSGSPVAVASMVTPFVAGPGSDRVTRSNSGCWLILRPGD---GTWKPWG  293

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID------NARKHS  545
             RLEAWR+RGS DGLGY+FELV ++  +SGI +AE  ++  KGG+F ID       A K  
Sbjct  294   RLEAWRDRGSADGLGYRFELVHNSAASSGIVLAESTLSCSKGGKFIIDLNGNGATAMKPG  353

Query  544   ASSLSPV-------------------RGFVMCSSVE-----GKNGFLSVQVAVNHVNCMa  437
             +++ +PV                   +GFVM + VE     GK   L V+V V  VNCM 
Sbjct  354   SAAATPVCSPRSSGDFGYALWPYSLYKGFVMSAKVEGEGHSGKTAPLMVEVGVQQVNCME  413

Query  436   daalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             DAA FVALSAA+DLSMDAC+LFS KLRKE C
Sbjct  414   DAAAFVALSAALDLSMDACRLFSHKLRKELC  444



>emb|CDP00983.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   406 bits (1043),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 236/463 (51%), Positives = 302/463 (65%), Gaps = 59/463 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++ +K+P A KPA   VHPS++PCY K+K  +FP QTA++P  +  P+
Sbjct  1     MDPCPFVRLTVGNLGLKIPVAAKPARSVVHPSSSPCYCKIKLKNFPLQTAVVPYITPEPQ  60

Query  1387  D-DSSSPTDSFASAEGFHLDPSALRRL--------SEKPVALKLSVFAGRMGQTCGITSG  1235
               D ++   + A+A  F+L  S L +L        S K + L +S++ G  G TCG+ SG
Sbjct  61    SPDGAAQVQASAAAATFNLGKSDLEKLAGKSLFGGSSKRLHLTVSIYTGGRGTTCGVNSG  120

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK-PMLHVVVRSEPDPRFVFQFGGEP  1058
             +LLG ++V +DL+G ++R V+F +GW  +G    +     H+ V+SEPDPRFVFQF GEP
Sbjct  121   RLLGKIRVPLDLAGTETRSVIFHNGWINVGKESKNSSAQFHLNVKSEPDPRFVFQFDGEP  180

Query  1057  ECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPG  890
             ECSP VFQIQGSIRQPVF+CKFS     +RN R+ SLPS+ S  SR W+ +F  +R+RPG
Sbjct  181   ECSPQVFQIQGSIRQPVFTCKFSFRSAPDRNQRSWSLPSELSC-SRSWLSSFGSERERPG  239

Query  889   KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPW  710
             KERKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPW
Sbjct  240   KERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPW  296

Query  709   GRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-----------  563
             GRLEAWRERGS DGLGY+FEL+ D+   +GI +AE  ++  KGG+F ID           
Sbjct  297   GRLEAWRERGSADGLGYRFELIPDSAAAAGIVLAESTLSSSKGGKFVIDLGSGSPAGGAG  356

Query  562   ---NARKHSASSLSPV-------------------RGFVMCSSVEGK--------NGFLS  473
                N R    S  SP                    RGFVM + V G+        N   +
Sbjct  357   GTANGRATPGSVASPACSPRSSGDFGYGLWPYCVYRGFVMSARVAGEGDGRKSKCNRPPT  416

Query  472   VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             V+V+V HVNC  DAA +VALSAA+DLSMDAC+LFS KLRKE C
Sbjct  417   VEVSVQHVNCTEDAAAYVALSAAVDLSMDACRLFSQKLRKELC  459



>ref|XP_008219142.1| PREDICTED: uncharacterized protein LOC103319390 [Prunus mume]
Length=447

 Score =   405 bits (1040),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 234/457 (51%), Positives = 301/457 (66%), Gaps = 58/457 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+ + ++A+K+P A+KPA   VHPS+ PC+ K+K ++ P Q A++P    LP 
Sbjct  1     MDPCPFVRVTVGNLALKIPVASKPARSVVHPSSAPCFCKIKLNNLPPQNAVVP---CLPP  57

Query  1387  DDSSSPTDSFASAEG----FHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSG  1235
             +  +   DS A A G    FHL  S L R+  K +      LK+S++ GR G TCG+ SG
Sbjct  58    EAQT--LDSAAQANGVAATFHLSKSDLDRVGSKSIFAPKLCLKISIYTGRRGSTCGVNSG  115

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGG-----ADKPMLHVVVRSEPDPRFVFQF  1070
             +LLG V V +DL+G +S+P VF +GW  +G G      + +   H+ V++EPDPRFVFQF
Sbjct  116   RLLGRVSVPLDLAGTESKPSVFHNGWVSVGKGVLKGVFSAQTQFHLNVKAEPDPRFVFQF  175

Query  1069  GGEPECSPVVFQIQGSIRQPVFSCKFS----AER-NNRTRSLPSDFSLNSRGWMRTFSGD  905
              GEPECSP VFQIQG+IRQPVF+CKFS     +R   R+RSL  D   NSR W+ +F  +
Sbjct  176   DGEPECSPQVFQIQGNIRQPVFTCKFSFRSTGDRGTQRSRSLHLDHG-NSRSWLGSFGSE  234

Query  904   RDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVS  725
             R+RPGKERKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP     +
Sbjct  235   RERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---N  291

Query  724   SWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHS  545
             +WKPWGRLEAWRERG  DGLGY+FEL+ D    +GI +AE  +++ KGG+F +D     S
Sbjct  292   TWKPWGRLEAWRERGGSDGLGYRFELIPDTS-GAGIVLAESTLSLNKGGKFVLDLG---S  347

Query  544   ASSLSPV------------------------RGFVMCSSVEGKN--GFLSVQVAVNHVNC  443
              S   PV                        RGFVM + VEG+      +V+V+V HVNC
Sbjct  348   GSGTRPVPNSPGCSPRGSGDFGYGLWPYCLYRGFVMSAKVEGEGRCSKPAVEVSVQHVNC  407

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEH  332
               DAA +VAL+AA+DLSMDAC+LFS +LRKE C D  
Sbjct  408   TEDAAAYVALAAAVDLSMDACRLFSQRLRKELCQDSE  444



>ref|XP_007222135.1| hypothetical protein PRUPE_ppa005719mg [Prunus persica]
 gb|EMJ23334.1| hypothetical protein PRUPE_ppa005719mg [Prunus persica]
Length=447

 Score =   403 bits (1036),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 233/457 (51%), Positives = 300/457 (66%), Gaps = 58/457 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+ + ++A+K+P A+KPA   VHPS+ PC+ K+K ++ P Q A++P    LP 
Sbjct  1     MDPCPFVRVTVGNLALKIPVASKPARSVVHPSSAPCFCKIKLNNLPPQNAVVP---CLPP  57

Query  1387  DDSSSPTDSFASAEG----FHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSG  1235
             +  +   DS A A G    FHL  S L R+  K +      LK+S++ GR G TCG+ SG
Sbjct  58    EAQT--LDSAAQANGVAATFHLSKSDLDRVGSKSIFAPKLCLKISIYTGRRGSTCGVNSG  115

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGG-----ADKPMLHVVVRSEPDPRFVFQF  1070
             +LLG V V +DL+G + +P VF +GW  +G G      + +   H+ V++EPDPRFVFQF
Sbjct  116   RLLGRVSVPLDLAGTECKPSVFHNGWVSVGKGVLKGVFSAQTQFHLNVKAEPDPRFVFQF  175

Query  1069  GGEPECSPVVFQIQGSIRQPVFSCKFS----AER-NNRTRSLPSDFSLNSRGWMRTFSGD  905
              GEPECSP VFQIQG+IRQPVF+CKFS     +R   R+RSL  D   NSR W+ +F  +
Sbjct  176   DGEPECSPQVFQIQGNIRQPVFTCKFSFRSTGDRGTQRSRSLHLDHG-NSRSWLGSFGSE  234

Query  904   RDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVS  725
             R+RPGKERKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP     +
Sbjct  235   RERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---N  291

Query  724   SWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHS  545
             +WKPWGRLEAWRERG  DGLGY+FEL+ D    +GI +AE  +++ KGG+F +D     S
Sbjct  292   TWKPWGRLEAWRERGGSDGLGYRFELIPDTS-GAGIVLAESTLSLNKGGKFVLDLG---S  347

Query  544   ASSLSPV------------------------RGFVMCSSVEGKN--GFLSVQVAVNHVNC  443
              S   PV                        RGFVM + VEG+      +V+V+V HVNC
Sbjct  348   GSGTRPVPNSPGCSPRGSGDFGYGLWPYCLYRGFVMSAKVEGEGRCSKPAVEVSVQHVNC  407

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEH  332
               DAA +VAL+AA+DLSMDAC+LFS +LRKE C D  
Sbjct  408   TEDAAAYVALAAAVDLSMDACRLFSQRLRKELCQDSE  444



>ref|XP_006852767.1| hypothetical protein AMTR_s00033p00137950 [Amborella trichopoda]
 gb|ERN14234.1| hypothetical protein AMTR_s00033p00137950 [Amborella trichopoda]
Length=454

 Score =   403 bits (1035),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 235/461 (51%), Positives = 309/461 (67%), Gaps = 63/461 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++ ++A+K+P A+KP+  GVHP+T+PC+ ++K  +FP QTA++PL S    
Sbjct  1     MDPCPFVRILVGNLALKIPVASKPSRSGVHPTTSPCFCEIKMRNFPMQTAMVPLVS----  56

Query  1387  DDSSSP-TDSFASAEGFHLDPSALRRLSEKPV------ALKLSVFAGRMGQTCGITSGKL  1229
               S SP ++S A A  FHLD + L++L+ K +       L +S++ GR G TCG++SG+L
Sbjct  57    --SDSPFSESQAMAASFHLDKADLQKLAGKSILGGPKACLSVSIYTGRRGSTCGVSSGRL  114

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECS  1049
             LG V+V+++L GA+S+  VFQ+GW  +G G      LH+ VR+EPDPRFVFQF GEPECS
Sbjct  115   LGKVRVSLNLEGAESKGCVFQNGWMGVGKGKGSA-QLHLSVRAEPDPRFVFQFDGEPECS  173

Query  1048  PVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSG-DRDRPGKE  884
             P VFQ+QG+IRQPVF+CKF      ERN R+R++ S+ +  SR W+ +  G D +RP +E
Sbjct  174   PQVFQLQGNIRQPVFTCKFGCRPVGERNMRSRNVQSE-TCTSRSWLGSRGGSDCERPVRE  232

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I I+DLSGS VAAASM+TPFVPSPGSDRVSR+NPGAWLILRP      +WKPW R
Sbjct  233   RKGWAITIHDLSGSPVAAASMVTPFVPSPGSDRVSRTNPGAWLILRPGD---GTWKPWAR  289

Query  703   LEAWRERGSVDGLGYKFELVTD----AGFTSGIPIAEGAMNVKKGGRFCID---------  563
             LEAWRERG+ D LGY+F L+++    A   S I +AE +++  KGG+F ID         
Sbjct  290   LEAWRERGAHDALGYRFHLLSESSSTASMNSSILLAESSLSASKGGKFTIDIGIASTGMA  349

Query  562   --NARKHSASSLSPV----------------------RGFVMCSSVEGKNGFLS--VQVA  461
               N R  +  ++SPV                      RGFVM SSVEG+       V + 
Sbjct  350   QSNGRV-TPGTVSPVCSSPRSSADFGHALWPVVQHGLRGFVMSSSVEGEGRCSKPFVHIG  408

Query  460   VNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
             V HV CM DAA +VAL+AAIDLSMDAC+LFS KLRKE C  
Sbjct  409   VQHVACMEDAAAYVALAAAIDLSMDACRLFSQKLRKELCQQ  449



>ref|XP_007137270.1| hypothetical protein PHAVU_009G113400g [Phaseolus vulgaris]
 gb|ESW09264.1| hypothetical protein PHAVU_009G113400g [Phaseolus vulgaris]
Length=449

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 231/452 (51%), Positives = 301/452 (67%), Gaps = 50/452 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PC+ K+K  SFP Q+A++P    +P 
Sbjct  1     MDPCPFVRLTVGNLALKIPVASKPARSIVHPSSSPCFCKIKLKSFPLQSAVVPF---IPP  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +   +     A  FHL    L RL+ K +      LK+S++ GR G TCG++SG+LLG
Sbjct  58    EKNLPDSQVHPIAATFHLSKCDLDRLAGKSIFAGKLCLKISIYTGRRGTTCGVSSGRLLG  117

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG-ADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +DL+G  ++  VF +GW ++G          H+ V++EPDPRFVFQF GEPECSP
Sbjct  118   KVSVPLDLAGTLAKTTVFHNGWIRIGKDAKGSSAQFHLNVKAEPDPRFVFQFDGEPECSP  177

Query  1045  VVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
              VFQIQG+I QPVF+CKFS     +RNNR+RSL S+     R W+ +F  +R+RPGKERK
Sbjct  178   QVFQIQGNISQPVFTCKFSFRNTGDRNNRSRSLQSE--PGGRSWLSSFGSERERPGKERK  235

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I+++DLSGS VAAASM+TPFV SPGSDRVS SNPG+WLILR   PS  +WKPWG+LE
Sbjct  236   GWSIMVHDLSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLILR---PSDGTWKPWGKLE  292

Query  697   AWRERGSVDGLGYKFELV--TDAGFT-SGIPIAEGAMNVKKGGRFCID--------NARK  551
             AWRERG  DGLGY+FEL+  T+ G + +GI +AE  ++  KGG+F ID        N R 
Sbjct  293   AWRERGGSDGLGYRFELIPDTNGGMSAAGIVLAESTLSSYKGGKFVIDMSCRTGGSNGRV  352

Query  550   HSASSLSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMad  434
                S+ SP                    RGFVM +SV  EGK     V+V+V HVNC  D
Sbjct  353   TPGSATSPACSPRSSGDYGYGLWPYCMYRGFVMSASVEGEGKCSKPRVEVSVPHVNCTED  412

Query  433   aalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
             AA FVAL+AA+DLS+DAC+LFS +LRKE C +
Sbjct  413   AAAFVALAAAVDLSVDACRLFSQRLRKELCQE  444



>ref|XP_008801663.1| PREDICTED: uncharacterized protein LOC103715709 [Phoenix dactylifera]
 ref|XP_008801664.1| PREDICTED: uncharacterized protein LOC103715710 [Phoenix dactylifera]
Length=442

 Score =   401 bits (1031),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 302/441 (68%), Gaps = 40/441 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPL----CS  1400
             MDPCPFVR+++ ++A+K+P   +PA  GVHPST+PC+ K++ + FP QTA++PL     +
Sbjct  1     MDPCPFVRVLVGNLALKIPVKARPARAGVHPSTSPCFCKIRLNKFPYQTAVVPLVPPEAA  60

Query  1399  ALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPV------ALKLSVFAGRMGQTCGITS  1238
             + P  D SS T + A+  GFHL    L +LS K +       LK++++ GR G TCG++S
Sbjct  61    SPPCGDQSSATLTLAA--GFHLSRVDLEKLSGKSIFAGGRARLKVAIYTGRRGTTCGVSS  118

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGW-KKLGGGGADKPMLHVVVRSEPDPRFVFQFGGE  1061
             G+LLG V + +DL GA+ +  VF SGW     G  +    LH+ VR+ PDPRFVF+FGGE
Sbjct  119   GRLLGKVTLPLDLKGAEVKACVFHSGWISVGKGSKSSSAQLHLTVRAVPDPRFVFEFGGE  178

Query  1060  PECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             PECSP VFQ+QGS+RQPVF+CKFS    A+RN  +RS+P +   +SR W+ +F  +R+RP
Sbjct  179   PECSPQVFQVQGSMRQPVFTCKFSCRNPADRNLGSRSVPME-PCSSRNWLSSFGSERERP  237

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              KERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWL+LRP G    +WKP
Sbjct  238   LKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLVLRPGG---GTWKP  294

Query  712   WGRLEAWRER--GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID--------  563
             WGRLEAWRER  G+ DG+G++F+LV D    +G+P+AE  ++  KGG+F ID        
Sbjct  295   WGRLEAWRERGGGASDGIGFRFQLVPDTAMGAGVPLAESTVSTGKGGKFTIDLTGAGWSP  354

Query  562   -NARKHSAS------SLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvals  410
               + + SA         S  RGFVM S+V  EGK    SV+V V HV C  DAA FVAL+
Sbjct  355   RGSPRRSADFGAGPWPFSGYRGFVMSSTVDGEGKCSRPSVEVGVQHVGCAEDAAAFVALA  414

Query  409   aAIDLSMDACQLFSTKLRKEF  347
             A++DLSMDAC+LF+ KLRKE 
Sbjct  415   ASVDLSMDACRLFTHKLRKEL  435



>ref|XP_004299850.1| PREDICTED: uncharacterized protein LOC101308766 [Fragaria vesca 
subsp. vesca]
Length=453

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 225/454 (50%), Positives = 300/454 (66%), Gaps = 52/454 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+ + ++A+K+P A+KPA   VHPS++PC+ K+K ++ P QTA++P    LP 
Sbjct  1     MDPCPFVRVTVGNLALKIPVASKPARTVVHPSSSPCFCKIKLNNLPVQTAVVP---CLPP  57

Query  1387  DDSS--SPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKL  1229
             +  +  + T    +A  FHL  S L R++ K +      LK++++ GR G TCG+ SG+L
Sbjct  58    ETQTLDANTGLGVTAATFHLSKSDLDRVASKSIFSGKLCLKIAIYTGRRGTTCGVNSGRL  117

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLG----GGGADKPMLHVVVRSEPDPRFVFQFGGE  1061
             LG V V + L+G Q++  VF +GW  +G    G GA     H+ V++EPDPRFVFQF GE
Sbjct  118   LGRVSVPLGLAGTQAKASVFHNGWVSVGKGVKGAGAQITQFHLNVKAEPDPRFVFQFDGE  177

Query  1060  PECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             PECSP VFQIQG+IRQPVF+CKFS     +R  R+RS  SD S  SR W+ +F  +R+RP
Sbjct  178   PECSPQVFQIQGNIRQPVFTCKFSFRNTGDRTQRSRSSHSDQS-GSRSWLSSFGSERERP  236

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
             G+ERKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG WLILRP      +W+P
Sbjct  237   GRERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGCWLILRPGD---GTWQP  293

Query  712   WGRLEAWRERGSVDGLGYKFELV--TDAGFTS-GIPIAEGAMNVKKGGRFCIDNARKHSA  542
             WGRLEAWRERG  DGLGY+FEL+  T+ G ++ GI +AE  +++ KGG+F +D      +
Sbjct  294   WGRLEAWRERGGADGLGYRFELIPDTNGGMSAGGIVLAESTLSLNKGGKFVLDLGSNSGS  353

Query  541   SSLSPV-------------------------RGFVMCSSVEGKN--GFLSVQVAVNHVNC  443
              + +PV                         RGFVM + VEG+      +V+V+V HV C
Sbjct  354   GNKAPVVPNSPACSPKSSGDFGYGLWPYCLYRGFVMSARVEGERRCSKPTVEVSVQHVTC  413

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEFCH  341
               DAA +VAL+AA+DL MDAC+LFS +LRKE C 
Sbjct  414   TEDAAAYVALAAAVDLCMDACRLFSQRLRKELCQ  447



>ref|XP_003603662.1| hypothetical protein MTR_3g110630 [Medicago truncatula]
 gb|AES73913.1| DUF1005 family protein [Medicago truncatula]
Length=454

 Score =   401 bits (1031),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 230/458 (50%), Positives = 301/458 (66%), Gaps = 59/458 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL I ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTAL+P    +P 
Sbjct  1     MDPCPFVRLTIGNLALKIPVASKPARSVVHPSSSPCFCKIKLKNFPLQTALVPF---IPH  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             +++S  +     A  FHL  + L RL+ K +      LK++++ GR G TCG+ SG+LLG
Sbjct  58    ENNSPDSQIQPIAASFHLSKADLDRLTGKSIFAKKLTLKIAIYTGRSGTTCGVNSGRLLG  117

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLG----GGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
              V V ++L+G  ++  VF +GW  +G    GG A     H+ V++EPDPRFVFQF GEPE
Sbjct  118   KVSVPLNLTGTLTKATVFHNGWITVGKDDKGGSA---QFHLNVKAEPDPRFVFQFDGEPE  174

Query  1054  CSPVVFQIQGSIRQPVFSCKFS-----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPG  890
             CSP VFQIQG+I QPVF+CKFS      +RN R+RS+ S+    SR W+ +F  +R+R G
Sbjct  175   CSPQVFQIQGNISQPVFTCKFSFRNNSGDRNQRSRSMQSEVGA-SRSWLSSFGSERERTG  233

Query  889   KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPW  710
             KERKGW I ++DLSGS VAAASM+TPFV SPGSDRVS SNPG+WLILRP      +WKPW
Sbjct  234   KERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLILRPGD---GTWKPW  290

Query  709   GRLEAWRERGSVDGLGYKFELVTDAGFT---SGIPIAEGAMNVKKGGRFCID--------  563
             GRLEAWRERG  DGLGY+FEL+ D   +    GI IAE  +++ +GG+F +D        
Sbjct  291   GRLEAWRERGGSDGLGYRFELMPDTNGSMSAGGIVIAESTLSLTRGGKFVLDLSSRCGGG  350

Query  562   ---NARKHSASSLSPV-------------------RGFVMCSSVEGKN--GFLSVQVAVN  455
                N R    ++ SPV                   RGFVM +SVEG+      +V+V+V 
Sbjct  351   GGSNGRATPGNATSPVCSPRGSGDYGYGLWPYCMYRGFVMSASVEGEGRCSKPTVEVSVP  410

Query  454   HVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCH  341
             HVNC  DAA FVAL+AA+DLS+DAC+LFS +LRKE C 
Sbjct  411   HVNCTEDAAAFVALAAAVDLSVDACRLFSQRLRKELCQ  448



>ref|XP_002306517.2| hypothetical protein POPTR_0005s19380g [Populus trichocarpa]
 gb|EEE93513.2| hypothetical protein POPTR_0005s19380g [Populus trichocarpa]
Length=448

 Score =   401 bits (1030),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 237/454 (52%), Positives = 301/454 (66%), Gaps = 53/454 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLC-SALP  1391
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTA++P   S  P
Sbjct  1     MDPCPFVRLTVGNLALKIPVASKPARSVVHPSSSPCFCKIKLKNFPLQTAVIPYIPSQFP  60

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLL  1226
             +    +P      A  FHL  S L RL  K +      LK+S++ GR+G TCG+ SG+LL
Sbjct  61    EGQLQTP------AATFHLSKSDLDRLVAKSIFTNKLQLKISLYTGRLGTTCGVNSGRLL  114

Query  1225  GVVQVAVDLSGAQSRPVVFQSGWKKLGGGG--ADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
             G V V +DL+G +SR V F +GW  +G     +   + H+ V++EPDPRFVFQF GEPEC
Sbjct  115   GKVSVPLDLAGTESRGVTFHNGWISIGKESVKSSSAVFHLNVKAEPDPRFVFQFDGEPEC  174

Query  1051  SPVVFQIQGSIRQPVFSCKFS------AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPG  890
             SP VFQI+G+IRQPVF+CKFS       +RN R+ SL  +   +SR W+ +F  + +RP 
Sbjct  175   SPQVFQIRGNIRQPVFTCKFSLRTTGGGDRNRRSISLQEE-PSSSRSWLSSFGSEIERPL  233

Query  889   KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPW  710
             KERKGW I ++DLSGS VAAASM+TPFVPSPGSDRVSRSNPG+WLILRP      +WKPW
Sbjct  234   KERKGWSITVHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGSWLILRPG---AGTWKPW  290

Query  709   GRLEAWRERGSVDGLGYKFELVTDAGFT---SGIPIAEGAMNVKKGGRFCID-----NAR  554
             GRLE+WRERGS DGLGY+FEL+ D   T   + I +AE  ++  KGG+F ID     N R
Sbjct  291   GRLESWRERGSSDGLGYRFELIPDTNGTMSAASIVLAESTLSSHKGGKFVIDLGACSNGR  350

Query  553   KHSASSLSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMa  437
                A+S SPV                   RGFVM +SV  EGK     V+V V HVNC  
Sbjct  351   TTPANSASPVCSPRGGGDHGYGLWPNCMHRGFVMSASVEGEGKCSKPGVEVGVQHVNCTE  410

Query  436   daalfvalsaAIDLSMDACQLFSTKLRKEFCHDE  335
             DAA FVAL+AA+DLSMDAC+LFS +LRKE C D+
Sbjct  411   DAAAFVALAAAVDLSMDACKLFSQRLRKELCQDQ  444



>ref|XP_010941977.1| PREDICTED: uncharacterized protein LOC105060083 [Elaeis guineensis]
Length=442

 Score =   400 bits (1027),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 300/441 (68%), Gaps = 40/441 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLC---SA  1397
             MDPCPFVR+++ ++A+K+P A +PAG GVHPST+PC+ K++ + FP QTA++PL    ++
Sbjct  1     MDPCPFVRVLVGNLALKIPVAARPAGAGVHPSTSPCFCKIRLNKFPYQTAVVPLVPPEAS  60

Query  1396  LPKD-DSSSPTDSFASAEGFHLDPSALRRLSEKPV------ALKLSVFAGRMGQTCGITS  1238
              P   D  S   + A+   FHL  + L +LS K +       LK++++ GR G TCG+ S
Sbjct  61    FPSGGDQHSAALTLAAV--FHLARADLEKLSGKSIFAGAKARLKVAIYTGRRGTTCGVNS  118

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK-PMLHVVVRSEPDPRFVFQFGGE  1061
             G+LLG V++ +DL GA  R  VF SGW  +G G       L++ VR++PDPRFVF+FGGE
Sbjct  119   GQLLGKVKLPLDLKGADRRACVFHSGWVSVGKGSKSSSAQLYLTVRADPDPRFVFEFGGE  178

Query  1060  PECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             PECSP VFQ+QGS+RQPVF+CKFS     + N R+RS+P++   +SR W+ +F  +R+RP
Sbjct  179   PECSPQVFQVQGSMRQPVFTCKFSCRSLVDWNLRSRSVPAE-PCSSRSWLASFGSERERP  237

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              KERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWL+LRP      +WKP
Sbjct  238   IKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLVLRPGD---GTWKP  294

Query  712   WGRLEAWRER--GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSAS  539
             W RLEAWRER  G+ DGLGY+F LV D   ++G+P+AE  ++  +GG+F ID      + 
Sbjct  295   WARLEAWRERGGGTSDGLGYRFHLVPDTAMSAGVPLAESTVSTSRGGKFTIDLTGAGGSP  354

Query  538   SLSP---------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvals  410
             + SP                RGFVM S+V  EGK    SV+V V HV C  DAA FVAL+
Sbjct  355   AGSPRGSAEFGAGPWPFSWYRGFVMSSTVEGEGKCSRPSVEVGVQHVGCTEDAAAFVALA  414

Query  409   aAIDLSMDACQLFSTKLRKEF  347
             AAIDLSMDAC+LFS KLRKE 
Sbjct  415   AAIDLSMDACRLFSRKLRKEL  435



>ref|XP_010245617.1| PREDICTED: uncharacterized protein LOC104589117 [Nelumbo nucifera]
Length=442

 Score =   398 bits (1023),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 230/444 (52%), Positives = 297/444 (67%), Gaps = 39/444 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL++ ++A+K+P A+KP+  GVHP ++PC+ K+K  +FP QTA++PL    P+
Sbjct  1     MDPCPFVRLLVGNLALKIPVASKPSRCGVHPVSSPCFCKIKLKNFPQQTAIVPLIP--PE  58

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             +           A  FHL  + L +L+ K +      LK++++ GR G TCG+ SG+LLG
Sbjct  59    NQFPDGQQPHTLAASFHLSKADLEKLAGKSIFSWKPCLKIAIYTGRRGTTCGVNSGRLLG  118

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPM-LHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +DL+G +SR  +F SGW  +G       + LH+ VR+EPDPRFVFQF GEPECSP
Sbjct  119   RVSVPLDLAGTESRASIFHSGWISVGKDAKGSSVQLHLNVRAEPDPRFVFQFDGEPECSP  178

Query  1045  VVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMI  866
              VFQIQG+IRQPVF+CKFS  RN+  R+  S    +SR W+ +F  +R+RPG+ERKGW +
Sbjct  179   QVFQIQGNIRQPVFTCKFSF-RNSGDRNQLSRSPSSSRSWLSSFGSERERPGRERKGWSV  237

Query  865   IIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRE  686
              ++DLSGS VA ASM+TPFV SPGSDRVSRSNPGAWLILRP      +WKPWGRLEAWRE
Sbjct  238   TVHDLSGSPVAVASMVTPFVASPGSDRVSRSNPGAWLILRPGD---GTWKPWGRLEAWRE  294

Query  685   RGSVDGLGYKFELVTDAG---FTSGIPIAEGAMNVKKGGRFCID---NARKHSASSLSPV  524
             RGS DGLGY+FE+++D        GI +AE  +   KGG+F ID   + R   ASS SP 
Sbjct  295   RGSNDGLGYRFEVMSDTNGGMSADGIVLAESTLGTGKGGKFVIDMSGSGRSTPASSNSPA  354

Query  523   -------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsa  407
                                RGFVM S+V  EGK    +V+V+V HVNC  DAA FVAL+A
Sbjct  355   CSPKSSGDFGYGLWPYCMYRGFVMSSTVEGEGKCSKPTVEVSVQHVNCTEDAAAFVALAA  414

Query  406   AIDLSMDACQLFSTKLRKEFCHDE  335
             A+DLSMDAC+LFS +LRKE    +
Sbjct  415   AMDLSMDACRLFSQRLRKELVQHQ  438



>ref|XP_003526511.1| PREDICTED: uncharacterized protein LOC100805268 [Glycine max]
Length=456

 Score =   398 bits (1023),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 229/457 (50%), Positives = 301/457 (66%), Gaps = 55/457 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PC+ K+K  +FP Q+A++P    +P 
Sbjct  1     MDPCPFVRLTVGNLALKIPVASKPALSVVHPSSSPCFCKIKLKNFPLQSAVVPF---IPP  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             +     +     A  FHL  S + +L+ K +      LK+S++ GR G TCG++SG+LLG
Sbjct  58    ESHFPDSQVHPIAATFHLSKSDIDKLAGKSIFAGKLCLKISIYTGRRGTTCGVSSGRLLG  117

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG-ADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +DL+G  ++  VF +GW ++G          H+ V++EPDPRFVFQF GEPECSP
Sbjct  118   RVSVPLDLTGTVAKTTVFHNGWIRIGKDAKGSSAQFHLNVKAEPDPRFVFQFDGEPECSP  177

Query  1045  VVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
              VFQIQG+I QPVF+CKFS     +RN+R+RSL S+    SR W+ +F  +R+RPGKERK
Sbjct  178   QVFQIQGNISQPVFTCKFSFRNNGDRNHRSRSLQSEPG-GSRSWLSSFGSERERPGKERK  236

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I ++DLSGS VAAASM+TPFV SPGSDRVS SNPG+WLILR   PS  +WKPWGRLE
Sbjct  237   GWSITVHDLSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLILR---PSDGTWKPWGRLE  293

Query  697   AWRERGSVDGLGYKFELV--TDAGFT-SGIPIAEGAMNVKKGGRFCID------------  563
             AWRERG  DGLGY+FEL+  T+ G + +GI +AE  ++  KGG+F ID            
Sbjct  294   AWRERGGSDGLGYRFELIPDTNGGMSAAGIVLAESTLSNNKGGKFVIDLSCRNGNVSGNG  353

Query  562   --NARKHSASSLSPV-------------------RGFVMCSSVEGKN--GFLSVQVAVNH  452
               N R    S+ SP                    RGFVM +SVEG+      +V+V+V H
Sbjct  354   GSNGRATPGSATSPACSPRSSGDYGYGLWPYCMYRGFVMSASVEGEGRCSKPTVEVSVPH  413

Query  451   VNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCH  341
             VNC  DAA FVAL+AA+DLS+DAC+LFS +LRKE C 
Sbjct  414   VNCTEDAAAFVALAAAVDLSVDACRLFSQRLRKELCQ  450



>ref|XP_003522725.1| PREDICTED: uncharacterized protein LOC100775992 isoform 1 [Glycine 
max]
Length=457

 Score =   394 bits (1012),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 230/458 (50%), Positives = 301/458 (66%), Gaps = 56/458 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF RL + ++A+K+P A+KPA   VHPS++PC+ K++  +FP Q+A++P    +P 
Sbjct  1     MDPCPFSRLTVRNLALKIPVASKPARSVVHPSSSPCFCKIQLKNFPLQSAVVPF---IPP  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             D     +     A  FHL  S L +L+ K +      LK+S++ GR G TCG++SG+LLG
Sbjct  58    DSLFPDSLVHPIAATFHLSKSDLDKLAGKSIFSAKLCLKISIYTGRRGSTCGVSSGRLLG  117

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG-ADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +DL+G  ++  VF +GW ++G          H+ V++EPDPRFVFQF GEPECSP
Sbjct  118   RVSVPLDLTGTVAKTTVFHNGWIRIGKDAKGSSAQFHLNVKAEPDPRFVFQFDGEPECSP  177

Query  1045  VVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
              VFQIQG+I QPVF+CKFS     +RN+R+RSL S+    SR W+ +F  +R+RPGKERK
Sbjct  178   QVFQIQGNISQPVFTCKFSFRNNGDRNHRSRSLQSEPG-GSRSWLSSFGSERERPGKERK  236

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I ++DLSGS VAAASM+TPFV SPGSDRVS SNPG+WLILR   PS  +WKPWGRLE
Sbjct  237   GWSITVHDLSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLILR---PSDGTWKPWGRLE  293

Query  697   AWRERGSVDGLGYKFELV--TDAGFT-SGIPIAEGAMNVKKGGRFCID----NA------  557
             AWRERG  DGLGY+FEL+  T+ G + +GI +AE  ++  KGG+F ID    NA      
Sbjct  294   AWRERGGSDGLGYRFELIPDTNGGMSAAGIVLAESTLSSNKGGKFVIDLSCRNAVNGSGN  353

Query  556   -----RKHSASSLSPV-------------------RGFVMCSSVEGKN--GFLSVQVAVN  455
                  R    S+ SP                    RGFVM +SVEG+      +V+V+V 
Sbjct  354   GGSNGRATPGSATSPACSPRSSGDYGYGLWPYCMYRGFVMSASVEGEGRCSKPTVEVSVP  413

Query  454   HVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCH  341
             HVNC  DAA FVAL+AA+DLS+DAC+LFS +LRKE C 
Sbjct  414   HVNCTEDAAAFVALAAAVDLSVDACRLFSQRLRKELCQ  451



>ref|XP_011011605.1| PREDICTED: uncharacterized protein LOC105116107 [Populus euphratica]
Length=448

 Score =   393 bits (1009),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 233/453 (51%), Positives = 298/453 (66%), Gaps = 51/453 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTA++P    +P 
Sbjct  1     MDPCPFVRLTVGNLALKIPVASKPARSVVHPSSSPCFCKIKLKNFPLQTAVIPY---IPS  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
                     + A+   FHL  S L RL  K +      LK+S++ GR+G TCG+ SG+LLG
Sbjct  58    QFPEGQLQTVAAT--FHLSKSDLDRLVAKSIFTNKLQLKISLYTGRLGTTCGVNSGRLLG  115

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG--ADKPMLHVVVRSEPDPRFVFQFGGEPECS  1049
              V V +DL+G +SR V F +GW  +G     +   + H+ V++EPDPRFVFQF GEPECS
Sbjct  116   KVSVPLDLAGTESRGVTFHNGWISIGKESVKSSSAVFHLNVKAEPDPRFVFQFDGEPECS  175

Query  1048  PVVFQIQGSIRQPVFSCKFS------AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             P VFQI+G+IRQPVF+CKFS       +RN R+ SL  +   +SR W+ +F  +R+RP K
Sbjct  176   PQVFQIRGNIRQPVFTCKFSLRTTGGGDRNRRSISLQEE-PSSSRSWVSSFGSERERPLK  234

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I ++DLSGS VAAASM+TPFVPS GSDRVSRSNPG+WLILRP      +WKPWG
Sbjct  235   ERKGWSITVHDLSGSPVAAASMVTPFVPSRGSDRVSRSNPGSWLILRPG---AGTWKPWG  291

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFT---SGIPIAEGAMNVKKGGRFCID-----NARK  551
             RLE+WRER S DGLGY+FEL+ D   T   + I +AE  ++  KGG+F ID     N R 
Sbjct  292   RLESWRERSSSDGLGYRFELIPDTNGTMSAASILLAECTLSSHKGGKFVIDLGACSNGRT  351

Query  550   HSASSLSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMad  434
                +S SPV                    GFVM +SV  EGK   L V+V V HVNC  D
Sbjct  352   TPENSASPVCSPRGSGDHGYGLWPNCLHSGFVMSASVEGEGKCSKLGVEVGVPHVNCTED  411

Query  433   aalfvalsaAIDLSMDACQLFSTKLRKEFCHDE  335
             AA FVAL+AA+DLSMDAC+LFS +LRKE C D+
Sbjct  412   AAAFVALAAAVDLSMDACKLFSQRLRKELCQDQ  444



>ref|XP_009335470.1| PREDICTED: uncharacterized protein LOC103928190 [Pyrus x bretschneideri]
Length=444

 Score =   391 bits (1004),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 229/448 (51%), Positives = 304/448 (68%), Gaps = 49/448 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSF--PSQTALLPLCSAL  1394
             MDPCPFVR+ + ++A+K+P A+KPA   VHPS++PC+ K+KF++   P Q A++P    L
Sbjct  1     MDPCPFVRVTVGNLALKIPVASKPASSVVHPSSSPCFCKIKFNNLNIPPQNAVIP---CL  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKL  1229
               D  +   D+ A+A  FHL  S L RL+ K +      LK+S++ GR G TCG+ SG+L
Sbjct  58    HPDTQT--LDNPATAATFHLSKSDLDRLASKSIFASRFCLKISIYTGRRGTTCGVNSGRL  115

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLG-----GGGADKPMLHVVVRSEPDPRFVFQFGG  1064
             LG V V +DL+G +S+P VF +GW  +G     GG + +   H+ V++EPDPRFVFQF G
Sbjct  116   LGRVSVPLDLAGTESKPSVFHNGWVSVGKGANKGGSSAQSQFHLNVKTEPDPRFVFQFDG  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDR  896
             EPECSP VFQIQG++RQPVF+C FS    A+R  R+RS+ SD   +SR W+ +F  +R+R
Sbjct  176   EPECSPQVFQIQGNLRQPVFTCTFSFRTPADRTQRSRSVQSDQG-SSRSWLSSFGSERER  234

Query  895   PGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWK  716
              G+ERKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP     ++WK
Sbjct  235   HGRERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---NTWK  291

Query  715   PWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID--NARKHSA  542
             PWGRLEAWRERG  DGLGY+FEL+ D    +G+ +AE  +++ KGG+F +D  +   + A
Sbjct  292   PWGRLEAWRERGGADGLGYRFELIPDTS-GAGVVLAESTLSLNKGGKFVLDLGSGSSNRA  350

Query  541   SSLSP-------------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaal  425
                SP                    RGFVM + V  EG+    +V+V+V HVNC  DAA 
Sbjct  351   GPNSPGCSPRGSGDFGYGLWPFCMYRGFVMSAKVQGEGRCSKPAVEVSVQHVNCTEDAAA  410

Query  424   fvalsaAIDLSMDACQLFSTKLRKEFCH  341
             FVAL+AA+DLSMDAC+LFS +LRKE C 
Sbjct  411   FVALAAAVDLSMDACRLFSQRLRKELCQ  438



>ref|XP_010544039.1| PREDICTED: uncharacterized protein LOC104816779 [Tarenaya hassleriana]
Length=456

 Score =   391 bits (1004),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 228/460 (50%), Positives = 295/460 (64%), Gaps = 59/460 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL + ++A+K+P A+K +   VHP+T+PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTVGNLALKVPLASKISSSVVHPTTSPCFCKIKLKNFPPQTAAVPY---IPP  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             D +  P     +A  FHL  S L R   + +      LK+S++ GR G  CG+ SG LL 
Sbjct  58    DTAQFPEIQTLAAT-FHLSKSDLDRFFSRSIFASKPCLKISIYTGRSGGACGVHSGTLLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK----PMLHVVVRSEPDPRFVFQFGGEPE  1055
              V V +DL+G QS+  VF +GW  +G G           H+ V++EPDPRFVFQF GEPE
Sbjct  117   KVSVPLDLTGTQSKACVFHNGWISIGKGAEKSSSSVAQFHLNVKAEPDPRFVFQFDGEPE  176

Query  1054  CSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             CSP VFQIQG+IRQPVF+CKFS     +R  R+RS+P + S+ SR W+ +F  +R+RPGK
Sbjct  177   CSPQVFQIQGNIRQPVFTCKFSFRHTGDRTQRSRSMPPETSV-SRSWLNSFGSERERPGK  235

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRP-NGPSVSSWKPW  710
             ERKGW I ++DLSGS VA AS++TPFV SPG+DRVSRSNPG+WLILRP NG     WKPW
Sbjct  236   ERKGWSITVHDLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGNG----IWKPW  291

Query  709   GRLEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID----------  563
             GRLEAWRER G+ +GLGY+FEL+ D    +GI +AE  ++  KGG+F I+          
Sbjct  292   GRLEAWRERGGATEGLGYRFELIPDGSSGAGIVLAESNISSHKGGKFVIELGSSTSINGG  351

Query  562   NARKHS--------ASSLSP---------------VRGFVMCSSV--EGKNGFLSVQVAV  458
               R HS        + S SP                RGFVM ++V  EGK     V+V+V
Sbjct  352   TKRSHSRGSGSGAASPSCSPRGSGDFGFGLWPWCLYRGFVMSATVEGEGKCSKPCVEVSV  411

Query  457   NHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
              HV CM DAA +VALSAAIDLSMDAC+LF+ +LRKE  H 
Sbjct  412   QHVTCMEDAAAYVALSAAIDLSMDACRLFNQRLRKELSHQ  451



>ref|XP_004501082.1| PREDICTED: uncharacterized protein LOC101496773 [Cicer arietinum]
Length=453

 Score =   389 bits (998),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 224/454 (49%), Positives = 298/454 (66%), Gaps = 52/454 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K+P A+KPA   VHPS++PC+ K+K  +FP  +A++P    +P 
Sbjct  1     MDPCPFVRLTVGNLALKIPVASKPARSVVHPSSSPCFCKIKLKNFPLHSAVVPF---IPP  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEK-----PVALKLSVFAGRMGQTCGITSGKLLG  1223
             D++   +     A  FHL  + L +L+ K      + LK+S++ GR G TCG+ SG+LLG
Sbjct  58    DNNFPDSQIQPIAATFHLSKTDLDKLAGKSLFVKKLCLKISIYTGRRGTTCGVNSGRLLG  117

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG-ADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V ++L+G  ++  VF +GW  +G          H+ V++EPDPRFVF+F GEPECSP
Sbjct  118   EVSVPLNLAGTVTKATVFHNGWITVGKDTKGSSAQFHLNVKAEPDPRFVFRFDGEPECSP  177

Query  1045  VVFQIQGSIRQPVFSCKFS-----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKER  881
              VFQIQG+I QPVF+CKFS      +RN R+RSL SD +  SR W+ +F  +R+R GKER
Sbjct  178   QVFQIQGNISQPVFTCKFSFRNNGCDRNQRSRSLQSD-AGGSRSWLSSFGSERERSGKER  236

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRL  701
             KGW I ++DLSGS VAAASM+TPFV SPGSDRVS SNPG+WLILRP      +WKPWGRL
Sbjct  237   KGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLILRPGD---GTWKPWGRL  293

Query  700   EAWRERGSVDGLGYKFELV--TDAGFTS-GIPIAEGAMNVKKGGRFCID----------N  560
             EAWRERG  DGLGY+FEL+  T+ G ++ G+ I E  +++ KGG+F ID          N
Sbjct  294   EAWRERGGSDGLGYRFELMPDTNGGMSAGGMVITESTLSLNKGGKFVIDLSSRCGGGGSN  353

Query  559   ARKHSASSLSPV-------------------RGFVMCSSVEGKN--GFLSVQVAVNHVNC  443
              R    ++ SP                    RGFVM +SVEG+      +V+V+V HVNC
Sbjct  354   GRATPGNASSPACSPRGSGDYGYGLWPYCVYRGFVMSASVEGEGRCSKPTVEVSVPHVNC  413

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEFCH  341
               DAA FVAL+AA+DLS+DAC+LFS +LRKE C 
Sbjct  414   TEDAAAFVALAAAVDLSVDACRLFSQRLRKELCQ  447



>ref|XP_010692653.1| PREDICTED: uncharacterized protein LOC104905738 [Beta vulgaris 
subsp. vulgaris]
Length=461

 Score =   389 bits (998),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 222/463 (48%), Positives = 292/463 (63%), Gaps = 58/463 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+KLP  TKPA   +HP+++PC+ K+K   FP+ TA++P    +P 
Sbjct  1     MDPCPFVRLTVGNLALKLPVPTKPARTVIHPTSSPCFCKIKLKGFPTHTAVIPY---IPP  57

Query  1387  DDSSSPTDSFAS----AEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGIT-S  1238
             ++++S   +       A  FHL    L +L +K +      LK+S+F GR+G +CG+  S
Sbjct  58    ENTNSDATNHPYPQPIAATFHLSVEDLNKLLKKSIFGGSLVLKISIFTGRIGGSCGVKKS  117

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP---MLHVVVRSEPDPRFVFQFG  1067
             G+LLG V V +DL G++ + VVF +GW  +G    D+      H+ VR++PDPRFVFQF 
Sbjct  118   GRLLGKVTVPLDLKGSEIKGVVFYNGWICIGKESKDESCVSQFHLNVRADPDPRFVFQFD  177

Query  1066  GEPECSPVVFQIQGSIRQPVFSCKFSAERN---NRTRSLPSDFSLNSRGWMRTFSGDRDR  896
             GEPECSP V  I+G+IRQPVF+C FS   N   N  R   S    + RGW+ TF  +R+R
Sbjct  178   GEPECSPQVLMIKGNIRQPVFTCNFSFRSNTSSNHHRRSRSSEQGSGRGWLSTFGSERER  237

Query  895   PGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWK  716
             PGKERKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WK
Sbjct  238   PGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---EGTWK  294

Query  715   PWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID---------  563
             PWGRLEAWRERG+ DGLGYKFEL++D     G+ +AE  +N  KGG+F ID         
Sbjct  295   PWGRLEAWRERGANDGLGYKFELISDMNANVGVVLAESTLNTSKGGKFSIDLGCAQFNNS  354

Query  562   --------NARKHSASSLSP-----------------VRGFVMCSSV--EGKNGFLSVQV  464
                     + R   +   SP                  RGFVM + V  EGK    +V+V
Sbjct  355   NSNSNASGSNRGTRSPGCSPRRGGSGDFGTSLWPYNAYRGFVMAARVEGEGKCSKPTVEV  414

Query  463   AVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDE  335
             +V HV+C  D A +VAL+AA+DLS+DAC+LFS KLRKE C + 
Sbjct  415   SVQHVSCTEDVAAYVALAAAVDLSIDACRLFSQKLRKELCQNN  457



>gb|EYU34216.1| hypothetical protein MIMGU_mgv1a006107mg [Erythranthe guttata]
Length=457

 Score =   386 bits (991),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 230/454 (51%), Positives = 301/454 (66%), Gaps = 53/454 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL + ++A+K+P A KP    VHPS++PC+  +K ++FP Q A +P    +P 
Sbjct  1     MDPCPFVRLTVGNLALKIPVAAKPVRSAVHPSSSPCFCVIKLNNFPIQNAAVPY---IPP  57

Query  1387  DDSSSPT-DSFASAEGFHLDPSALRRL---------SEKPVALKLSVFAGRMGQTCGITS  1238
             + +  P  +S A A  FHL+ S + RL         S+KP  LK+SV++G  G TCG++S
Sbjct  58    ESTQFPDGNSQALAATFHLNKSDVDRLTGKSSLFPTSKKP-QLKISVYSGPQGATCGVSS  116

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGG-GGADKPMLHVVVRSEPDPRFVFQFGGE  1061
             G+LL  + + +DL+ A+S+ VVF +GW  +G    +     H+ V++EPDPRFVFQF G 
Sbjct  117   GRLLAKICMELDLAAAESKAVVFHNGWINVGKENKSSVSQFHLNVKAEPDPRFVFQFDGA  176

Query  1060  PECSPVVFQIQGSIRQPVFSCKFS---AERNNRTRSLPSDFSLN---SRGWMRTFSGDRD  899
             PECSP VFQI+G+IRQPVF+CKFS   A+RN R+RSLP++ S     +R W+ +   +R+
Sbjct  177   PECSPQVFQIRGNIRQPVFTCKFSFRTADRNQRSRSLPTEHSGGGGVARRWLSSLGSERE  236

Query  898   RPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSW  719
             R  KERKGW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG WLILRP     S+W
Sbjct  237   RVVKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGCWLILRPGD---STW  293

Query  718   KPWGRLEAWRERGSVDGLGYKFELVTD-AGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA  542
             KPWGRLEAWRERGS D +GYKFEL+ D A   +GI +A+  ++  KGG+F IDN      
Sbjct  294   KPWGRLEAWRERGSADAIGYKFELIPDSASAAAGIVLADSKISCSKGGKFIIDNGNASGG  353

Query  541   SSL--SPV--------------------RGFVMCSSVEGK--NGFLS----VQVAVNHVN  446
              S   SPV                    RGFVM +SVEG+  NG  +    V+V+V  V 
Sbjct  354   GSNAGSPVCSPHGSGDFGYGLWPYCSMYRGFVMAASVEGEGYNGKTAAAPLVEVSVQQVK  413

Query  445   CMadaalfvalsaAIDLSMDACQLFSTKLRKEFC  344
             C+ DAA FVAL+AA+DLS+DAC+LFS KLRKE C
Sbjct  414   CLEDAAAFVALAAALDLSVDACRLFSRKLRKELC  447



>emb|CDY63745.1| BnaC05g07770D [Brassica napus]
Length=435

 Score =   385 bits (988),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 220/440 (50%), Positives = 291/440 (66%), Gaps = 38/440 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K P A K +   VHPS++ C+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTINNLALKAPQAAKTSSSVVHPSSSTCFCKIKLKNFPPQTAAVPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S + RLS + +      LK+ ++ GR G  CG+ SG+ L 
Sbjct  58    EATQFPEIQTLAAT-FHLSSSDVARLSSRSIFASKPCLKIFIYTGRAGAACGVNSGRPLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPV  1043
              V V +DL+GAQ +  VF +GW  +G G   +   H+ V++EPDPRFVFQF GEPECSP 
Sbjct  117   EVSVPLDLAGAQGKQCVFHNGWITVGKGAGKESSFHLNVKAEPDPRFVFQFEGEPECSPQ  176

Query  1042  VFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKG  875
             V QIQGSIRQPVF+CKFS     +R  R+RSLP + S+  R W+ +F  +R+RPGKERKG
Sbjct  177   VVQIQGSIRQPVFTCKFSCRNTGDRTMRSRSLPPETSV-PRSWLNSFGSERERPGKERKG  235

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEA  695
             W I ++DLSGS VA AS++TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGRLEA
Sbjct  236   WSITVHDLSGSPVAMASIVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWGRLEA  292

Query  694   WRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPVR-  521
             WRER G+ DGLGY+FEL+ D    +GI + E +++  +GG+F I+     +A S+S  R 
Sbjct  293   WRERGGATDGLGYRFELIPDGSSGAGIVLTESSISSHRGGKFSIELGSSPTAGSVSRTRR  352

Query  520   -----------------GFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAID  398
                              GFVM +SVEG+       V+V+V HV+CM DAA +VALSAAID
Sbjct  353   RGSGDYGYGLWLGSGYKGFVMSASVEGEGKCSKPCVEVSVQHVSCMEDAAAYVALSAAID  412

Query  397   LSMDACQLFSTKLRKEFCHD  338
             LSMDAC+LF+ ++RKE C +
Sbjct  413   LSMDACRLFNQRMRKELCSE  432



>ref|XP_009399078.1| PREDICTED: uncharacterized protein LOC103983571 [Musa acuminata 
subsp. malaccensis]
Length=472

 Score =   384 bits (986),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 233/472 (49%), Positives = 299/472 (63%), Gaps = 72/472 (15%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             M+PCPFVRL++ ++A+K+P A +PAG GVHPS +PC+AK++    P QT  +PL   +P 
Sbjct  1     MEPCPFVRLLVGNLALKIPVAARPAGAGVHPSASPCFAKIRLGKSPRQTVAVPL---VPS  57

Query  1387  DDSSSP----------TDSFASAEGFHLDPSALRRLSEKP----------VALKLSVFAG  1268
             DD ++           + S A A  FHL  + L R+S KP          V LK+SV+ G
Sbjct  58    DDHATADPPATPSSSASASGALAARFHLSKAELDRISAKPSLFAGGRGGRVKLKVSVYTG  117

Query  1267  RMGQTCGITSGKLLGVVQVAVDL----SGAQSRPVVFQSGWKKLGGGGADK---------  1127
             R G TCG++SG+LLG V V +DL     G  SR VVF SGW  LG               
Sbjct  118   RRGTTCGVSSGRLLGRVTVTLDLKGMADGGGSRAVVFHSGWVALGKKKTKAGAGKGSSSL  177

Query  1126  -PMLHVVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRS  962
                L++ V++ PDPRFVF+F GEPECSP VFQ+QG++RQPVF+CKFS     +RN  +RS
Sbjct  178   PAQLYLTVKAVPDPRFVFEFDGEPECSPQVFQVQGNLRQPVFTCKFSCRNAGDRNLNSRS  237

Query  961   LPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRV  782
             + S+   +SR W+ +F  +R+RPGKERKGW + ++DLSGS VA ASM+TPFV S G+DRV
Sbjct  238   MHSEPG-SSRSWISSFGSERERPGKERKGWSVTVHDLSGSPVALASMVTPFVASHGTDRV  296

Query  781   SRSNPGAWLILRPNGPSVSSWKPWGRLEAWRER---GSVDGLGYKFELVTDAGFTSGIPI  611
             SRSNPGAWL+LRP      +WKPWGRLEAWRER   G+ DGLGY+FEL+ DA   +GI +
Sbjct  297   SRSNPGAWLVLRPGD---GTWKPWGRLEAWRERGGSGASDGLGYRFELLPDAAMGAGINL  353

Query  610   AEGAMNVKKGGRFCID---NARKHSASSLSP-------------------VRGFVMCSSV  497
             AE  ++  KGG+F ID    A    + S SP                    RGFVM S+V
Sbjct  354   AESTLSATKGGKFTIDLTSAAGTPLSRSTSPGCSPRGSGDFGYALWPFPSYRGFVMSSTV  413

Query  496   --EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
               EG++G  +V+V V  V C  DAA FVAL+AAIDLSMDAC+LFS KLRKE 
Sbjct  414   AGEGRSGRPTVEVGVQQVGCTEDAAAFVALAAAIDLSMDACRLFSHKLRKEL  465



>emb|CDY57930.1| BnaA06g37990D [Brassica napus]
Length=437

 Score =   380 bits (975),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 218/441 (49%), Positives = 290/441 (66%), Gaps = 39/441 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K P A K +   VHPS +  + K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTINNLALKAPQAAKTSSSVVHPSPSTSFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             D +  P     +A  FHL  S + RLS + +      LK+ ++ GR G  CG+  G+ + 
Sbjct  58    DATQFPEIQTLAAT-FHLSSSDVARLSSRSIFASKPCLKIFIYTGRAGGACGVNPGRHVA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPV  1043
              V V +DL+GAQ +  VF +GW  +G G   +   H+ V++EPDPRFVFQF GEPECSP 
Sbjct  117   EVSVPLDLAGAQGKQCVFHNGWISVGKGAGKESSFHLNVKAEPDPRFVFQFEGEPECSPQ  176

Query  1042  VFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKG  875
             V QIQGSIRQPVF+CKFS    ++R  R+RSLP + S+  R W+ +F  +R+RPGKERKG
Sbjct  177   VVQIQGSIRQPVFTCKFSCRNTSDRTMRSRSLPPETSV-PRSWLNSFGSERERPGKERKG  235

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEA  695
             W I ++DLSGS VA AS++TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGRLEA
Sbjct  236   WSITVHDLSGSPVAMASIVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWGRLEA  292

Query  694   WRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPVR-  521
             WRER G+ DGLGY+FEL+ D    +GI + E +++  +GG+F I+     +A S+S  R 
Sbjct  293   WRERGGATDGLGYRFELIPDGSSGAGIVLTESSISSHRGGKFSIELGSSPTAGSVSRTRR  352

Query  520   ------------------GFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAI  401
                               GFVM +SVEG+       V+V+V+HV+CM DAA +VALSAAI
Sbjct  353   RSGSGDYGYGLWLGSGYKGFVMSASVEGEGKCSKPCVEVSVHHVSCMEDAAAYVALSAAI  412

Query  400   DLSMDACQLFSTKLRKEFCHD  338
             DLSMDAC+LF+ ++RKE C +
Sbjct  413   DLSMDACRLFNQRMRKELCSE  433



>ref|NP_172473.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC34331.1| Unknown protein [Arabidopsis thaliana]
 gb|AAR92283.1| At1g10020 [Arabidopsis thaliana]
 gb|AAS99692.1| At1g10020 [Arabidopsis thaliana]
 gb|AEE28529.1| uncharacterized protein AT1G10020 [Arabidopsis thaliana]
Length=461

 Score =   379 bits (974),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 224/466 (48%), Positives = 299/466 (64%), Gaps = 64/466 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K+P A K     VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTIGNLALKVPLAAKTTSSVVHPSSSPCFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S ++RL+ + +      LK+ ++ GR G  CG+ SG+LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSSSDIQRLASRSIFTSKPCLKILIYTGRAGAACGVHSGRLLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG---ADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
              V V +DLSG QS+P VF +GW  +G G    +     H+ V++EPDPRFVFQF GEPEC
Sbjct  117   KVSVPLDLSGTQSKPCVFHNGWISVGKGAGKSSSSAQFHLNVKAEPDPRFVFQFDGEPEC  176

Query  1051  SPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             SP V QIQG+IRQPVF+CKFS     +R  R+RSLP++ S+ SR W+ +F  +R+RPGKE
Sbjct  177   SPQVVQIQGNIRQPVFTCKFSCRHTGDRTQRSRSLPTETSV-SRSWLNSFGSERERPGKE  235

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I ++DLSGS VA AS++TPFV SPG+DRVSRSNPG+WLILRP      +W+PWGR
Sbjct  236   RKGWSITVHDLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGD---CTWRPWGR  292

Query  703   LEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP  527
             LEAWRER G+ DGLGY+FEL+ D    +GI +AE  ++  +GG+F I+     S+SS + 
Sbjct  293   LEAWRERGGATDGLGYRFELIPDGSSGAGIVLAESTISSHRGGKFSIELGSSPSSSSPTS  352

Query  526   V-----------------------------------------RGFVMCSSV--EGKNGFL  476
             V                                         +GFVM +SV  EGK    
Sbjct  353   VVNRSRSRRGGSSGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKP  412

Query  475   SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
              V+V+V HV+CM DAA +VALSAAIDLSMDAC+LF+ ++RKE CH+
Sbjct  413   CVEVSVQHVSCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCHE  458



>ref|XP_010458327.1| PREDICTED: uncharacterized protein LOC104739608 isoform X2 [Camelina 
sativa]
 ref|XP_010475861.1| PREDICTED: uncharacterized protein LOC104755214 [Camelina sativa]
Length=461

 Score =   379 bits (973),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 226/466 (48%), Positives = 299/466 (64%), Gaps = 64/466 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K+P A K     VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTIGNLALKVPLAAKTTSSVVHPSSSPCFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S + RL+ + +      LK+ ++ GR G  CG+ SG+LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSSSDIERLASRSIFASKPCLKILIYTGRAGAACGVHSGRLLA  116

Query  1222  VVQVAVDLSGAQSRP-VVFQSGWKKLGGGG---ADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
              V V +DLSG QS+P VVF +GW  +G G    +     H+ V++EPDPRFVFQF GEPE
Sbjct  117   KVSVPLDLSGTQSKPCVVFHNGWISVGKGAGKSSSSAQFHLNVKAEPDPRFVFQFDGEPE  176

Query  1054  CSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             CSP V QIQG+IRQPVF+CKFS     +R  R+RSLP+D S+ SR W+ +F  +R+RPGK
Sbjct  177   CSPQVVQIQGNIRQPVFTCKFSFRHTGDRTQRSRSLPTDTSV-SRSWLNSFGSERERPGK  235

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I ++DLSGS VA AS++TPFV SPGSDRVSRSNPG+WLILRP      +W+PWG
Sbjct  236   ERKGWSITVHDLSGSPVAMASIVTPFVASPGSDRVSRSNPGSWLILRPGD---CTWRPWG  292

Query  706   RLEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-----------  563
             RLEAWRER G+ DGLGY+FEL+ D    +GI +AE  ++  KGG+F I+           
Sbjct  293   RLEAWRERGGATDGLGYRFELIPDGSSGAGIVLAESTISSHKGGKFSIELGSSSSSSPTG  352

Query  562   -------------NARKHSASSLSP----------------VRGFVMCSSV--EGKNGFL  476
                           +   ++ + SP                 +GFVM +SV  EGK    
Sbjct  353   GVNRSRSRRGGSGGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKP  412

Query  475   SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
              V+V+V HV+CM DAA +VALSAAIDLSMDAC+LF+ ++RKE CH+
Sbjct  413   CVEVSVQHVSCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCHE  458



>ref|XP_010490593.1| PREDICTED: uncharacterized protein LOC104768341 [Camelina sativa]
Length=461

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 223/466 (48%), Positives = 296/466 (64%), Gaps = 64/466 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K+P A K     VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTIGNLALKVPLAAKTTSSVVHPSSSPCFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S + RL+ + +      LK+ ++ GR G  CG+ SG+LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSSSDIERLASRSIFASKPCLKILIYTGRAGAACGVHSGRLLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG---ADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
              V V +DL+G QS+P VF +GW  +G G    +     H+ V++EPDPRFVFQF GEPEC
Sbjct  117   KVSVPLDLTGTQSKPCVFHNGWISVGKGAGKSSSSAQFHLNVKAEPDPRFVFQFDGEPEC  176

Query  1051  SPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             SP V QIQG+IRQPVF+CKFS     +R  R+RSLP+D S+  R W+ +F  +R+RPGKE
Sbjct  177   SPQVVQIQGNIRQPVFTCKFSFRHTGDRTQRSRSLPTDTSV-PRSWLNSFGSERERPGKE  235

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I ++DLSGS VA AS++TPFV SPGSDRVSRSNPG+WLILRP      +W+PWGR
Sbjct  236   RKGWSITVHDLSGSPVAMASIVTPFVASPGSDRVSRSNPGSWLILRPGD---CTWRPWGR  292

Query  703   LEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID------------  563
             LEAWRER G+ DGLGY+FEL+ D    +GI +AE  ++  KGG+F I+            
Sbjct  293   LEAWRERGGATDGLGYRFELIPDGSSGAGIVLAESTISSHKGGKFSIELGSSSSSSSPTG  352

Query  562   ----------------------NARKHSASSL-------SPVRGFVMCSSV--EGKNGFL  476
                                   N+ K  +          +  +GFVM +SV  EGK    
Sbjct  353   GVYRSRSRRGGSGGSGGGASPANSPKGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKP  412

Query  475   SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
              V+V+V HV+CM DAA +VALSAAIDLSMDAC+LF+ ++RKE CH+
Sbjct  413   CVEVSVQHVSCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCHE  458



>ref|XP_003557619.1| PREDICTED: uncharacterized protein LOC100825031 [Brachypodium 
distachyon]
Length=463

 Score =   378 bits (970),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 223/469 (48%), Positives = 298/469 (64%), Gaps = 63/469 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG--VHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCP+VR+++ ++A+K+P A +PAG G  VHP+T+PCY +++ +  P QTA  PL   L
Sbjct  1     MDPCPYVRVLVGNLALKMPVAPRPAGAGAGVHPTTSPCYCRIRLNKLPLQTAAAPL---L  57

Query  1393  PKDDSSS---PTDSFASAEGFHLDPSALRRLSEKP-------VALKLSVFAGRMGQTCGI  1244
             P DD+S    P  + A A  FHL  + L R + KP         LK++V+AGR G TCG+
Sbjct  58    PSDDASQGQGPATTGALAAAFHLSKADLDRATAKPSLFGTRSARLKVAVYAGRRGVTCGV  117

Query  1243  TSGKLLGVVQVAVDLSGAQSRPVVFQSGW----KKLGGG---GADKPMLHVVVRSEPDPR  1085
              SG+LLG V + +DL  A  +PVVF SGW    K+   G   G  +  L++ VR+EPDPR
Sbjct  118   NSGRLLGKVVIPLDLKSAAGKPVVFHSGWLCIPKRGASGRKSGVAQAQLNLTVRAEPDPR  177

Query  1084  FVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN--RTRSLPSDFSLNSRGWMRTFS  911
             FVF+F GEPECSP V Q+QG+++QP+F+CKFS   N+  R+RS+ SD    +R W+ +F 
Sbjct  178   FVFEFDGEPECSPQVLQVQGAMKQPMFTCKFSCRTNSDLRSRSMHSD--PGTRNWLTSFG  235

Query  910   GDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPS  731
              DR+R GKERKGW + ++DLSGS VA ASM+TPFV  PGSDRVSRSNPGAWL+LRP    
Sbjct  236   SDRERLGKERKGWSVTVHDLSGSPVALASMVTPFVAIPGSDRVSRSNPGAWLVLRPGD--  293

Query  730   VSSWKPWGRLEAWRERGSV----DGLGYKFELVT---DAGFTSGIPIAEGAMNVKKGGRF  572
               +WKPWGRLE WRERG+     D LGY+FEL+      G  +G+ +AE A+   +GGRF
Sbjct  294   -GTWKPWGRLECWRERGASAAGGDSLGYRFELLLPDHPTGMGTGVSVAESAIPSSRGGRF  352

Query  571   CID---------------------NARKHSASSLSPV----RGFVMCSSV--EGKNGFLS  473
              ID                     +   ++A++L        GFVM ++V  EG+    +
Sbjct  353   AIDLTAAQPFGRSGSPACSPRGSGDLTGYAAAALGSCCHGRGGFVMSAAVQGEGRCSRPT  412

Query  472   VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDS  326
             V+V V HV C  DAA FVAL+AA+DLSMDAC+LFS +LR+E      DS
Sbjct  413   VEVGVAHVGCAEDAAAFVALAAAVDLSMDACRLFSHRLRRELSSTRSDS  461



>gb|EPS64751.1| hypothetical protein M569_10025 [Genlisea aurea]
Length=454

 Score =   377 bits (967),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 218/464 (47%), Positives = 287/464 (62%), Gaps = 58/464 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCS----  1400
             MDPCPFVR+ + ++ +K+P AT  A   +HPS++P +   K   FP Q A +P  S    
Sbjct  1     MDPCPFVRITVRNLGLKIPVATMSARSAIHPSSSPFFCVFKMKDFPLQNAAVPYISPENT  60

Query  1399  ALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVA--------LKLSVFAGRMGQTCGI  1244
               P+  S SP      A  FHL  S + RL+ K           + +SV++GR G TCG+
Sbjct  61    QFPEGASQSP------AASFHLRKSDVDRLTGKSSLFSTAKRPRMTISVYSGRRGATCGL  114

Query  1243  TSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGG  1064
              SG+LLG + V +DL+ A+SR VVF SGW  +G  G  K   H+ V++EP+PRFVF+F G
Sbjct  115   KSGRLLGKIYVPLDLATAESRTVVFHSGWISMGAEGKAKAEFHLNVKAEPEPRFVFEFDG  174

Query  1063  EPECSPVVFQIQGSIRQPVFSCKF---SAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             EPECSP +FQI+G+ RQPVF+CKF   S +RN R+RS+P+D     RGW+ +F  +R+R 
Sbjct  175   EPECSPQIFQIRGNSRQPVFTCKFSFRSGDRNQRSRSVPADSRGGGRGWLSSFGSERERA  234

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
             GKERKGW + I+DLSGS VA ASM+TPFV SPGSDRVSRSNPG WLILRP      +WKP
Sbjct  235   GKERKGWSVTIHDLSGSPVAVASMVTPFVASPGSDRVSRSNPGCWLILRPGD---GTWKP  291

Query  712   WGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHS---A  542
             WGRLEAWRERG+ D LGY+FE++ +    + + +AE  +N  KGG F ID +   +   A
Sbjct  292   WGRLEAWRERGTADVLGYRFEIIPELASAAVVVLAESTLNCGKGGNFVIDLSSSRTGTPA  351

Query  541   SSLSP--------------------------VRGFVMCSSVEG----KNGFLSVQVAVNH  452
              S +P                           RGFVM + V+G    K    + +++V H
Sbjct  352   GSATPRSAAASPGCSPCGSGDYGHGLWPYCLYRGFVMAAHVDGEGRSKRTAPTAEISVQH  411

Query  451   VNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDSYF  320
             VNC  DAA+FVAL+AA DLS+ AC LFS KL KE C  + DS+F
Sbjct  412   VNCTEDAAVFVALAAAADLSVKACTLFSQKLPKELCAPQ-DSHF  454



>ref|XP_006417503.1| hypothetical protein EUTSA_v10007581mg [Eutrema salsugineum]
 gb|ESQ35856.1| hypothetical protein EUTSA_v10007581mg [Eutrema salsugineum]
Length=461

 Score =   377 bits (967),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 225/463 (49%), Positives = 296/463 (64%), Gaps = 62/463 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K+P A K     VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTIGNLALKVPLAAKTTSSVVHPSSSPCFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S + RL+ + +      LK+ ++ GR G  CG+ SG+LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSSSDIGRLASRSIFASKPCLKIFIYTGRAGAACGVHSGRLLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG--ADKPMLHVVVRSEPDPRFVFQFGGEPECS  1049
              V V +DL+G QS+P VF +GW  +G G   A     H+ V++EPDPRFVFQF GEPECS
Sbjct  117   KVSVPLDLAGTQSKPCVFHNGWIAVGKGAGKASSAQFHLNVKAEPDPRFVFQFDGEPECS  176

Query  1048  PVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKER  881
             P V QIQG+IRQPVF+CKFS     +R  RTRSLP + S+  R W+ +F  +R+RPGKER
Sbjct  177   PQVVQIQGNIRQPVFTCKFSCRHTGDRTMRTRSLPPETSV-PRSWLNSFGSERERPGKER  235

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRL  701
             KGW I ++DLSGS VA AS++TPFV SPG+DRVSRSNPG+WLILRP      +WKPWGRL
Sbjct  236   KGWSITVHDLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGD---CTWKPWGRL  292

Query  700   EAWRERGSV-DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-------------  563
             EAWRERG V DGLGY+FEL+ D    +GI +AE  ++  +GG+F I+             
Sbjct  293   EAWRERGGVTDGLGYRFELIPDGSSGAGIVLAESTISSHRGGKFSIELRSSSSSPPGGVN  352

Query  562   ------------NARKHSASSLSP---------------VRGFVMCSSV--EGKNGFLSV  470
                         ++   ++ S SP                +GFVM +SV  EGK     V
Sbjct  353   RSRSRSGGSGGGSSGGGASPSNSPRGSGDYGNGVWPWSVYKGFVMSASVEAEGKCSKPCV  412

Query  469   QVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCH  341
             +V+V HV+CM DAA +VALSAAIDLSMDAC+LF+ ++RKE CH
Sbjct  413   EVSVQHVSCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCH  455



>ref|XP_006307457.1| hypothetical protein CARUB_v10009083mg [Capsella rubella]
 gb|EOA40355.1| hypothetical protein CARUB_v10009083mg [Capsella rubella]
Length=460

 Score =   377 bits (967),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 222/465 (48%), Positives = 297/465 (64%), Gaps = 63/465 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K+P A K     VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTIGNLALKVPLAAKTTSSVVHPSSSPCFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S + RL+ + +      LK+ ++ GR G  CG+ SG+LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSSSDIERLASRSIFASKPCLKILIYTGRGGAACGVHSGRLLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG---ADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
              V V +DLSG QS+P VF +GW  +G G    +     H+ V++EPDPRFVFQF GEPEC
Sbjct  117   KVSVPLDLSGTQSKPCVFHNGWISVGKGAGKSSSSAQFHLNVKAEPDPRFVFQFDGEPEC  176

Query  1051  SPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             SP V QIQG+IRQPVF+CKFS     +R  R+RSLP++ S+  R W+ +F  +R+RPGKE
Sbjct  177   SPQVVQIQGNIRQPVFTCKFSFRHTGDRTQRSRSLPTETSV-PRSWLNSFGSERERPGKE  235

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I ++DLSGS VA AS++TPFV SPG+DRVSRSNPG+WLILRP      +W+PWGR
Sbjct  236   RKGWSITVHDLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGD---CTWRPWGR  292

Query  703   LEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID------------  563
             LEAWRER G+ DGLGY+FEL+ D    +GI +AE  ++  KGG+F I+            
Sbjct  293   LEAWRERGGATDGLGYRFELIPDGSSGAGIVLAESTISSHKGGKFSIELGSSSSSSPTGG  352

Query  562   ------------NARKHSASSLSP----------------VRGFVMCSSV--EGKNGFLS  473
                          +   ++ + SP                 +GFVM +SV  EGK     
Sbjct  353   VNRSRSRRGGSGGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKPC  412

Query  472   VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
             V+V+V HV+CM DAA +VALSAAIDLSMDAC+LF+ ++RKE CH+
Sbjct  413   VEVSVQHVSCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCHE  457



>dbj|BAF00981.1| hypothetical protein [Arabidopsis thaliana]
Length=461

 Score =   377 bits (967),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 223/466 (48%), Positives = 298/466 (64%), Gaps = 64/466 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K+P A K     VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTIGNLALKVPLAAKTTSSVVHPSSSPCFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S ++RL+ + +      LK+ ++ GR G  CG+ SG+LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSSSDIQRLASRSIFTSKPCLKILIYTGRAGAACGVHSGRLLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG---ADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
              V V +DLSG QS+P VF +GW  +G G    +     H+ V++EPDPRFVFQF GEPEC
Sbjct  117   KVSVPLDLSGTQSKPCVFHNGWISVGKGAGKSSSSAQFHLNVKAEPDPRFVFQFDGEPEC  176

Query  1051  SPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             SP V QIQG+IRQPVF+CKFS     +R  R+RSLP++ S+ SR W+ +F  +R+RPGKE
Sbjct  177   SPQVVQIQGNIRQPVFTCKFSCRHTGDRTQRSRSLPTETSV-SRSWLNSFGSERERPGKE  235

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I ++DLSGS VA AS++TPFV  PG+DRVSRSNPG+WLILRP      +W+PWGR
Sbjct  236   RKGWSITVHDLSGSPVAMASIVTPFVAFPGTDRVSRSNPGSWLILRPGD---CTWRPWGR  292

Query  703   LEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP  527
             LEAWRER G+ DGLGY+FEL+ D    +GI +AE  ++  +GG+F I+     S+SS + 
Sbjct  293   LEAWRERGGATDGLGYRFELIPDGSSGAGIVLAESTISSHRGGKFSIELGSSPSSSSPTS  352

Query  526   V-----------------------------------------RGFVMCSSV--EGKNGFL  476
             V                                         +GFVM +SV  EGK    
Sbjct  353   VVNRSRSRRGGSSGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKP  412

Query  475   SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
              V+V+V HV+CM DAA +VALSAAIDLSMDAC+LF+ ++RKE CH+
Sbjct  413   CVEVSVQHVSCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCHE  458



>ref|XP_009144481.1| PREDICTED: uncharacterized protein LOC103868126 [Brassica rapa]
Length=447

 Score =   375 bits (964),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 220/449 (49%), Positives = 294/449 (65%), Gaps = 48/449 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+KLP A K +   VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTISNLALKLPLAAKSSSSAVHPSSSPCFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S ++RL+ + +     +LK+ ++ G  G  CG+ SG LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSSSDIKRLASRSIFASKPSLKIFIYTGSAGAACGVNSGGLLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP-----MLHVVVRSEPDPRFVFQFGGEP  1058
              V V +DL+G QS+P VF +GW  +G G            H+ V++EPDPRFVFQF GEP
Sbjct  117   EVSVPLDLAGTQSKPCVFHNGWISVGKGAGAGKASSAAQFHLNVKAEPDPRFVFQFDGEP  176

Query  1057  ECSPVVFQIQGSIRQPVFSCKFS-----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             ECSP V QIQGSIRQPVF+CKFS      +R  R+RSLP++ S+  R W+ +F  +R+RP
Sbjct  177   ECSPQVVQIQGSIRQPVFTCKFSCRNTTGDRTIRSRSLPTETSV-PRSWLNSFGSERERP  235

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
             GKERKGW I ++DLSGS VA AS++TPFV SPG+DRVSRSNPG+WLILRP      +WKP
Sbjct  236   GKERKGWSITVHDLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGD---GTWKP  292

Query  712   WGRLEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARK-----  551
             WGRLEAWRER G+ DGLGY+FEL+ D    +GI +AE +++  +GG+F I+         
Sbjct  293   WGRLEAWRERGGATDGLGYRFELILDGSSGAGIVLAESSISSHRGGKFSIELGSSPTGGG  352

Query  550   -----------------HSASSLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaa  428
                              +S    S  +GFVM +SV  EGK     V+V+V HV+CM DAA
Sbjct  353   VGRTRSRGGGSGGASPANSPRGGSVQKGFVMAASVEGEGKCSKPCVEVSVQHVSCMEDAA  412

Query  427   lfvalsaAIDLSMDACQLFSTKLRKEFCH  341
              +VALSAA+DLSMDAC+LF+ ++RKE C+
Sbjct  413   AYVALSAAVDLSMDACRLFNQRMRKELCY  441



>ref|XP_010266771.1| PREDICTED: uncharacterized protein LOC104604209 [Nelumbo nucifera]
Length=448

 Score =   375 bits (963),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 221/450 (49%), Positives = 291/450 (65%), Gaps = 42/450 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFV L++ ++A+K+P A+KPA  G+HP+++PC+ K++F++FP QTA++PL    P+
Sbjct  1     MDPCPFVHLLVGNLALKIPMASKPARSGIHPASSPCFCKIRFNNFPQQTAIVPLIP--PQ  58

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             +           A  FHL  + L +L  K        LK++++ GR G TCG+ SG+LLG
Sbjct  59    NQFPDGQQPQTLAASFHLSKADLEKLDGKSFFSGKPCLKIAIYTGRRGTTCGVNSGRLLG  118

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG-ADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V + ++L GA+ +  VF +GW  +G         LH+ VR+EPDPRFVFQF GEPE SP
Sbjct  119   RVSLPLELVGAECKASVFHNGWISVGKDAKGSSSQLHLNVRAEPDPRFVFQFDGEPERSP  178

Query  1045  VVFQIQGSIRQPVFSCKFSAERN----NRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
              VFQI+G+IRQPVF+CKFS   +    N+        S +SR W+ + + +R+R G+ERK
Sbjct  179   QVFQIRGNIRQPVFTCKFSFRNSGGDRNQLSRSSQLESSSSRSWLSSLASERERSGRERK  238

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I ++DLSGS VA ASM+TPFV SPGSDRVSRSNPGAWLILRP      +WKPWGRLE
Sbjct  239   GWSITVHDLSGSPVAVASMVTPFVASPGSDRVSRSNPGAWLILRPGD---GTWKPWGRLE  295

Query  697   AWRERGSVDGLGYKFELVTDAGFT---SGIPIAEGAMNVKKGGRFCIDNA---RKHSASS  536
             AWRERG  DGLGY+FEL+ D   +   +GI +AE  +   KGG+F ID +   R   A+S
Sbjct  296   AWRERGGSDGLGYRFELMPDTNGSMSAAGIVLAESTLGTSKGGKFVIDTSGFGRSTPANS  355

Query  535   LSPV-------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfv  419
              SP                    RGFVM S+V  EGK     V+V+V HVNC  DAA FV
Sbjct  356   SSPACSPRCSGDFGYGLWPYCMYRGFVMSSTVVGEGKCSKPVVEVSVQHVNCTEDAAAFV  415

Query  418   alsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             AL+AA+DLSMDAC+LFS K+R+E C    D
Sbjct  416   ALAAAVDLSMDACRLFSQKVRRELCQRRQD  445



>emb|CDY31054.1| BnaA08g26040D [Brassica napus]
Length=447

 Score =   375 bits (963),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 219/449 (49%), Positives = 294/449 (65%), Gaps = 48/449 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+KLP A K +   VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTISNLALKLPLAAKSSSSAVHPSSSPCFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S ++RL+ + +     +LK+ ++ G  G  CG+ SG LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSSSDIKRLASRSIFASKPSLKIFIYTGSAGSACGVNSGGLLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP-----MLHVVVRSEPDPRFVFQFGGEP  1058
              V V +DL+G QS+P VF +GW  +G G            H+ V++EPDPRFVFQF GEP
Sbjct  117   EVSVPLDLAGTQSKPCVFHNGWISVGKGAGAGKASSAAQFHLNVKAEPDPRFVFQFDGEP  176

Query  1057  ECSPVVFQIQGSIRQPVFSCKFS-----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             ECSP V QIQGSIRQPVF+CKFS      +R  R+RSLP++ S+  R W+ +F  +R+RP
Sbjct  177   ECSPQVVQIQGSIRQPVFTCKFSCRNTTGDRTIRSRSLPTETSV-PRSWLNSFGSERERP  235

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
             GKERKGW I ++DLSGS VA AS++TPFV SPG+DRVSRSNPG+WLILRP      +W P
Sbjct  236   GKERKGWSITVHDLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGD---GTWNP  292

Query  712   WGRLEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASS  536
             WGRLEAWRER G+ DGLGY+FEL+ D    +GI +AE +++  +GG+F I+     + S 
Sbjct  293   WGRLEAWRERGGATDGLGYRFELILDGSSGAGIVLAESSISSHRGGKFSIELGSSPTGSG  352

Query  535   L----------------------SPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaa  428
             +                      S  +GFVM +SV  EGK     V+V+V HV+CM DAA
Sbjct  353   VGRTRSRGGGSGGASPANSPRGGSVQKGFVMAASVEGEGKCSKPCVEVSVQHVSCMEDAA  412

Query  427   lfvalsaAIDLSMDACQLFSTKLRKEFCH  341
              +VALSAA+DLSMDAC+LF+ ++RKE C+
Sbjct  413   AYVALSAAVDLSMDACRLFNQRMRKELCY  441



>ref|XP_010458326.1| PREDICTED: uncharacterized protein LOC104739608 isoform X1 [Camelina 
sativa]
Length=462

 Score =   375 bits (964),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 224/467 (48%), Positives = 297/467 (64%), Gaps = 65/467 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K+P A K     VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTIGNLALKVPLAAKTTSSVVHPSSSPCFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S + RL+ + +      LK+ ++ GR G  CG+ SG+LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSSSDIERLASRSIFASKPCLKILIYTGRAGAACGVHSGRLLA  116

Query  1222  VVQVAVDLSGAQSRP-VVFQSGWKKLGGGG---ADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
              V V +DLSG QS+P VVF +GW  +G G    +     H+ V++EPDPRFVFQF GEPE
Sbjct  117   KVSVPLDLSGTQSKPCVVFHNGWISVGKGAGKSSSSAQFHLNVKAEPDPRFVFQFDGEPE  176

Query  1054  CSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             CSP V QIQG+IRQPVF+CKFS     +R  R+RSLP+D S+  R W+ +F  +R+RPGK
Sbjct  177   CSPQVVQIQGNIRQPVFTCKFSFRHTGDRTQRSRSLPTDTSV-PRSWLNSFGSERERPGK  235

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I ++DLSGS VA AS++TPFV SPGSDRV RSNPG+WLILRP      +W+PWG
Sbjct  236   ERKGWSITVHDLSGSPVAMASIVTPFVASPGSDRVRRSNPGSWLILRPGD---CTWRPWG  292

Query  706   RLEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-----------  563
             RLEAWRER G+ DGLGY+FEL+ D    +GI +AE  +N  +GG+F I+           
Sbjct  293   RLEAWRERGGATDGLGYRFELIPDGSSGAGIVLAESTINSHRGGKFSIELGSSSSSSSPT  352

Query  562   --------------NARKHSASSLSP----------------VRGFVMCSSV--EGKNGF  479
                            +   ++ + SP                 +GFVM +SV  EGK   
Sbjct  353   GGVNRSRSRRGGSGGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSK  412

Query  478   LSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
               V+V+V HV+CM DAA +VALSAAIDLSMDAC+LF+ ++RKE CH+
Sbjct  413   PCVEVSVQHVSCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCHE  459



>gb|KFK43302.1| hypothetical protein AALP_AA1G106600 [Arabis alpina]
Length=462

 Score =   375 bits (962),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 222/468 (47%), Positives = 295/468 (63%), Gaps = 62/468 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K+P  TK     VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTIGNLALKVPLTTKTTSSVVHPSSSPCFCKIKLKNFPPQTATIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S + RL+ + +     +LK+ ++ GR G  CG+ SG+LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSNSDIERLASRSIFTSKPSLKILIYTGRAGAACGVHSGRLLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG---ADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
              V V +DL+G QS+P VF +GW  +G G    +     H+ V++EPDPRFVFQF GEPEC
Sbjct  117   KVSVPLDLTGTQSKPCVFHNGWISVGKGAGKSSTSAQFHLNVKAEPDPRFVFQFDGEPEC  176

Query  1051  SPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             SP V QIQG+IRQPVF+CKFS     +R  R+RSLP + S+  R W+ +F  +R+RPGKE
Sbjct  177   SPQVVQIQGNIRQPVFTCKFSCRNTGDRTMRSRSLPPESSI-PRSWLNSFGSERERPGKE  235

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I ++DLSGS VA AS++TPFV SPG+DRVSRSNPG+WLILRP      +WKPWGR
Sbjct  236   RKGWSITVHDLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGD---GTWKPWGR  292

Query  703   LEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID------------  563
             LEAWRER G+ DGLGY+FEL+ D    +GI +AE  ++  +GG+F I+            
Sbjct  293   LEAWRERGGATDGLGYRFELIPDGSSGAGIVLAESTISSHRGGKFSIELGSSPTSGVNRT  352

Query  562   --------------------NARKHSASSL-------SPVRGFVMCSSV--EGKNGFLSV  470
                                 N+ +  +          S  +GFVM +SV  EGK     V
Sbjct  353   RSRRGGSSGSGGSGGGASPANSPRGGSGDYGYGLWPWSVYKGFVMSASVEGEGKCSKPCV  412

Query  469   QVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDS  326
             +V+V HV CM DAA +VALSAAIDLSMDAC+LF+ K+RKE C +   S
Sbjct  413   EVSVQHVICMEDAAAYVALSAAIDLSMDACRLFNQKMRKELCQNSESS  460



>dbj|BAJ89011.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   373 bits (958),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 222/460 (48%), Positives = 289/460 (63%), Gaps = 53/460 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG--VHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+K+P A +PAG G  VHP+T+PCY  ++ +  P Q+A  PL   L
Sbjct  1     MDPCPFVRVLVGNLALKMPVAPRPAGAGAGVHPTTSPCYCTIRLNKLPLQSAAAPL---L  57

Query  1393  PKDD-SSSPTDSFASAEGFHLDPSALRRLSEKP-------VALKLSVFAGRMGQTCGITS  1238
             P DD +  P  + A A  FHL  + L R++ KP         LK++V+AGR G TCG+ S
Sbjct  58    PSDDMTQGPAATGALAAAFHLSKADLDRVTAKPSLFVARSARLKVAVYAGRRGTTCGVNS  117

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGG------ADKPMLHVVVRSEPDPRFVF  1076
             G+LLG V + +DL  A  +P+VF SGW  +   G      +    L++ VR+EPDPRFVF
Sbjct  118   GRLLGKVVIPLDLKTAVGKPIVFHSGWVPINKRGRKASAVSGSAQLNLTVRAEPDPRFVF  177

Query  1075  QFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN--RTRSLPSDFSLNSRGWMRTFSGDR  902
             QF GEPECSP V Q+QG + QP+F+CKFS   N+  R+RS+ SD     R W+ +F  DR
Sbjct  178   QFDGEPECSPQVLQVQGGMMQPMFTCKFSCRSNSDLRSRSMHSDPGSGGRNWLMSFGSDR  237

Query  901   DRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSS  722
             +R GKERKGW + ++DLSGS VA ASM+TPFV SPGSDRVSRSNPGAWL+LRP      +
Sbjct  238   ERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGSDRVSRSNPGAWLVLRPGD---GT  294

Query  721   WKPWGRLEAWRERG---SVDGLGYKFELVT--DAGFTSGIPIAEGAMNVKKGGRFCID-N  560
             WKPWGRLE WRERG   + D LGY+FEL+     G   G+ +AE  +   +GGRF ID  
Sbjct  295   WKPWGRLECWRERGAGAAGDSLGYRFELLIPDPTGMGVGVSVAESNVPTSRGGRFVIDLT  354

Query  559   ARKHSASSLSP---------------------VRGFVMCSSV--EGKNGFLSVQVAVNHV  449
             A +    S SP                      RGFVM ++V  EG+    +V+V V HV
Sbjct  355   AAQPFGRSGSPGCSPRGSGDFSGGYGLWPFGSYRGFVMSAAVQGEGRCSRPTVEVGVPHV  414

Query  448   NCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
              C  DAA FVAL+AA+DLSMDAC+LFS +LR+E      D
Sbjct  415   GCAEDAAAFVALAAAVDLSMDACRLFSHRLRRELSSTRSD  454



>ref|NP_001058837.1| Os07g0133500 [Oryza sativa Japonica Group]
 dbj|BAC78571.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAC82946.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30606.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20751.1| Os07g0133500 [Oryza sativa Japonica Group]
 gb|EAZ38604.1| hypothetical protein OsJ_22992 [Oryza sativa Japonica Group]
 dbj|BAG97653.1| unnamed protein product [Oryza sativa Japonica Group]
Length=462

 Score =   373 bits (957),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 223/462 (48%), Positives = 289/462 (63%), Gaps = 52/462 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG--VHPSTTPCYAKLKFSSFPSQTALLPLC---  1403
             MDPCPFVR+++ ++++K+P A +PAG G  VHPST+PCY K++ +  P QTA  PL    
Sbjct  1     MDPCPFVRVLVGNLSLKMPVAPRPAGAGAGVHPSTSPCYCKIRLNKLPYQTADAPLLLPP  60

Query  1402  SALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKP-------VALKLSVFAGRMGQTCGI  1244
             S       +    + A A  FHL  + L RL+ KP         LK+ V+AGR G TCG+
Sbjct  61    SPEASAAPAPAPATGALAAAFHLSKADLDRLTAKPSLFGSRTARLKIVVYAGRRGTTCGV  120

Query  1243  T--SGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGG-------ADKPMLHVVVRSEPD  1091
                SG+LLG V + +DL GA ++PVV+ S W  +G  G       A    L++ VR+EPD
Sbjct  121   GGGSGRLLGKVVIPLDLKGASAKPVVYHSSWICIGKRGRKPSSVSAANAQLNITVRAEPD  180

Query  1090  PRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN--RTRSLPSDFSLNSRGWMRT  917
             PRFVF+F GEPECSP V Q+QGS++QP+F+CKFS   N+  R+RS+P+D     R W+  
Sbjct  181   PRFVFEFDGEPECSPQVLQVQGSMKQPMFTCKFSCRSNSDLRSRSMPADMGSGGRNWLTA  240

Query  916   FSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG  737
             F  DR+R GKERKGW + ++DLSGS VA ASM+TPFV SPG+DRVS+SNPGAWL+LRP  
Sbjct  241   FGSDRERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSKSNPGAWLVLRPGD  300

Query  736   PSVSSWKPWGRLEAWRERG----SVDGLGYKFELV--TDAGFTSGIPIAEGAMNVKKGGR  575
                 +WKPWGRLE WRERG    + D LGY+FELV     G   G+ +AE  +   KGGR
Sbjct  301   ---GTWKPWGRLECWRERGAGAAAGDSLGYRFELVLPDPTGMGVGVSVAESTIPASKGGR  357

Query  574   FCID-NARKHSASSLSPV-----------------RGFVMCSSV--EGKNGFLSVQVAVN  455
             F ID  A +    S SP                  RGFVM ++V  EGK    +V+V V 
Sbjct  358   FAIDLTATQQFGRSGSPACSPCGSGDYGMWPFGSCRGFVMSAAVQGEGKCSRPAVEVGVQ  417

Query  454   HVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             +V C  DAA FVAL+AA+DLSMDAC+LFS +LR+E      D
Sbjct  418   NVGCAEDAAAFVALAAAVDLSMDACRLFSHRLRRELSASRSD  459



>ref|XP_002892543.1| hypothetical protein ARALYDRAFT_888260 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68802.1| hypothetical protein ARALYDRAFT_888260 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   372 bits (956),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 219/466 (47%), Positives = 296/466 (64%), Gaps = 64/466 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K+P A K     VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTIGNLALKVPLAAKTTSSVVHPSSSPCFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S ++RL+ + +      LK+ ++ GR G  CG+ SG+LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSSSDIQRLASRSIFTSKPCLKILIYTGRAGAACGVHSGRLLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG---ADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
              V V +DLSG  S+P VF +GW  +G G    +     H+ V++EPDPRFVFQF GEPEC
Sbjct  117   KVSVPLDLSGTLSKPCVFHNGWISVGKGAGKSSSSAQFHLNVKTEPDPRFVFQFDGEPEC  176

Query  1051  SPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             SP V QIQG+IRQPVF+CKFS     +R  R+RSLP++ S+  R W+ +F  +R+RPGKE
Sbjct  177   SPQVVQIQGNIRQPVFTCKFSCRHTGDRTQRSRSLPTETSV-PRSWLNSFGSERERPGKE  235

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW I ++DLSGS VA AS++TPFV SPG+DRVSRSNPG+WLILRP      +W+PWGR
Sbjct  236   RKGWSITVHDLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGD---CTWRPWGR  292

Query  703   LEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID------------  563
             LEAWRER G+ DGLGY+FEL+ D    +GI +AE  ++  +GG+F I+            
Sbjct  293   LEAWRERGGATDGLGYRFELIPDGSSGAGIVLAESTISSHRGGKFSIELGSSSSSSSPTS  352

Query  562   ----------------------NARKHSASSL-------SPVRGFVMCSSV--EGKNGFL  476
                                   N+ +  +          +  +GFVM +SV  EGK    
Sbjct  353   GVNRSRSHRGGSSGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKP  412

Query  475   SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
              V+V+V HV+CM DAA +VALSAAIDLSMDAC+LF+ ++RKE CH+
Sbjct  413   CVEVSVQHVSCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCHE  458



>ref|XP_009148322.1| PREDICTED: uncharacterized protein LOC103871783 [Brassica rapa]
Length=451

 Score =   372 bits (955),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 217/456 (48%), Positives = 289/456 (63%), Gaps = 54/456 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+K P A K +   VHPS +  + K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTINNLALKAPQAAKTSSSVVHPSPSTSFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             D +  P     +A  FHL  S + RLS + +      LK+ ++ GR G  CG+  G+ + 
Sbjct  58    DATQFPEIQTLAAT-FHLSSSDVARLSSRSIFGSKPCLKIFIYTGRAGGACGVNPGRHVA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPV  1043
              V V +DL+GAQ +  VF +GW  +G G   +   H+ V++EPDPRFVFQF GEPECSP 
Sbjct  117   EVSVPLDLAGAQGKQCVFHNGWISVGKGAGKESSFHLNVKAEPDPRFVFQFEGEPECSPQ  176

Query  1042  VFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKG  875
             V QIQGSIRQPVF+CKFS    ++R  R+RSLP + S+  R W+ +F  +R+RPGKERKG
Sbjct  177   VVQIQGSIRQPVFTCKFSCRNTSDRTMRSRSLPPETSV-PRSWLNSFGSERERPGKERKG  235

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEA  695
             W I ++DLSGS VA AS++TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGRLEA
Sbjct  236   WSITVHDLSGSPVAMASIVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWGRLEA  292

Query  694   WRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSL-----  533
             WRER G+ DGLGY+FEL+ D    +GI + E +++  +GG+F I+     +A S+     
Sbjct  293   WRERGGATDGLGYRFELIPDGSSGAGIVLTESSISSHRGGKFSIELGSSPTAGSVSRTRR  352

Query  532   -----------------------------SPVRGFVMCSSVEGKNGFLS--VQVAVNHVN  446
                                          S  +GFVM +SVEG+       V+V+V HV+
Sbjct  353   RSGGSSGGTSPASSPRGGSGDYGYGLWLGSGYKGFVMSASVEGEGKCSKPCVEVSVQHVS  412

Query  445   CMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHD  338
             CM DAA +VALSAAIDLSMDAC+LF+ ++RKE C +
Sbjct  413   CMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCSE  448



>gb|EAZ02678.1| hypothetical protein OsI_24791 [Oryza sativa Indica Group]
Length=462

 Score =   372 bits (954),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 223/462 (48%), Positives = 288/462 (62%), Gaps = 52/462 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG--VHPSTTPCYAKLKFSSFPSQTALLPLC---  1403
             MDPCPFVR+++ ++++K+P A +PAG G  VHPST+PCY K++ +  P QTA  PL    
Sbjct  1     MDPCPFVRVLVGNLSLKMPVAPRPAGAGAGVHPSTSPCYCKIRLNKLPYQTADAPLLLPP  60

Query  1402  SALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKP-------VALKLSVFAGRMGQTCGI  1244
             S       +    + A A  FHL  + L RL+ KP         LK+ V+AGR G TCG+
Sbjct  61    SPEASAAPAPAPATGALAAAFHLSKADLDRLTAKPSLFGSRTARLKIVVYAGRRGTTCGV  120

Query  1243  T--SGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGG-------ADKPMLHVVVRSEPD  1091
                SG+LLG V + +DL GA ++PVV+ S W  +G  G       A    L++ VR+EPD
Sbjct  121   GGGSGRLLGKVVIPLDLKGASAKPVVYHSSWICIGKRGRKPSSVSAANAQLNITVRAEPD  180

Query  1090  PRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN--RTRSLPSDFSLNSRGWMRT  917
             PRFVF+F GEPECSP V Q+QGS++QP+F+CKFS   N+  R+RS+P+D     R W+  
Sbjct  181   PRFVFEFDGEPECSPQVLQVQGSMKQPMFTCKFSCRSNSDLRSRSMPADMGSGGRNWLTA  240

Query  916   FSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG  737
             F  DR+R GKERKGW + ++DLSGS VA ASM+TPFV SPG+DRVS+SNPGAWL+LRP  
Sbjct  241   FGSDRERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSKSNPGAWLVLRPGD  300

Query  736   PSVSSWKPWGRLEAWRERG----SVDGLGYKFELV--TDAGFTSGIPIAEGAMNVKKGGR  575
                 +WKPWGRLE WRERG    + D LGY+FELV     G   G+ +AE  +   KGGR
Sbjct  301   ---GTWKPWGRLECWRERGAGAAAGDSLGYRFELVLPDPTGMGVGVSVAESTIPASKGGR  357

Query  574   FCID-NARKHSASSLSPV-----------------RGFVMCSSV--EGKNGFLSVQVAVN  455
             F ID  A +    S SP                  RGFVM  +V  EGK    +V+V V 
Sbjct  358   FAIDLTATQQFGRSGSPACSPCGSGDYGMWPFGSCRGFVMSPAVQGEGKCSRPAVEVGVQ  417

Query  454   HVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             +V C  DAA FVAL+AA+DLSMDAC+LFS +LR+E      D
Sbjct  418   NVGCAEDAAAFVALAAAVDLSMDACRLFSHRLRRELSASRSD  459



>emb|CDY20666.1| BnaC08g13920D [Brassica napus]
Length=447

 Score =   369 bits (948),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 218/449 (49%), Positives = 291/449 (65%), Gaps = 48/449 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+RL I ++A+KLP A K +   VHPS++PC+ K+K  +FP QTA +P    +P 
Sbjct  1     MDPCPFIRLTISNLALKLPLAAKSSSSAVHPSSSPCFCKIKLKNFPPQTAAIPY---IPL  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             + +  P     +A  FHL  S ++RL+ + +     +LK+ ++ G  G  CG+ SG LL 
Sbjct  58    ETTQFPEIQTLAAT-FHLSSSDIKRLASRSIFASKPSLKIFIYTGSAGAACGVNSGGLLA  116

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP-----MLHVVVRSEPDPRFVFQFGGEP  1058
              V V +DL+G QS+P VF  GW  +G G            H+ V++EPDPRFVFQF GEP
Sbjct  117   EVSVPLDLAGTQSKPCVFHDGWIAVGKGAGAGKASSAAQFHLNVKAEPDPRFVFQFDGEP  176

Query  1057  ECSPVVFQIQGSIRQPVFSCKFS-----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             ECSP V QIQGSI QPVF+CKFS      +R  R+RSLP++ S+  R W+ +F  +R+RP
Sbjct  177   ECSPQVVQIQGSIPQPVFTCKFSCRNTTGDRTIRSRSLPTETSV-PRSWLNSFGSERERP  235

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              KERKGW I ++DLSGS VA AS++TPFV SPG+DRVSRSNPG+WLILRP      +WKP
Sbjct  236   NKERKGWSITVHDLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGD---GTWKP  292

Query  712   WGRLEAWRER-GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASS  536
             WGRLEAWRER G+ DGLGY+FEL+ D    +GI +AE +++  +GG+F I+     + S 
Sbjct  293   WGRLEAWRERGGATDGLGYRFELILDGSSGAGIVLAESSISSHRGGKFSIELGSSPTGSG  352

Query  535   L----------------------SPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaa  428
             +                      S  +GFVM +SV  EGK     V+V+V HV+CM DAA
Sbjct  353   VGRTRSRGGGSGGASPANSPRGGSVQKGFVMAASVEGEGKCSKPCVEVSVQHVSCMEDAA  412

Query  427   lfvalsaAIDLSMDACQLFSTKLRKEFCH  341
              +VALSAA+DLSMDAC+LF+ ++RKE  H
Sbjct  413   AYVALSAAVDLSMDACRLFNQRMRKELSH  441



>gb|EAY75765.1| hypothetical protein OsI_03678 [Oryza sativa Indica Group]
Length=446

 Score =   363 bits (931),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 229/453 (51%), Positives = 292/453 (64%), Gaps = 47/453 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPA--GPGVHPSTTPCYAKLKFSSFPS-----QTALLP  1409
             MDPC FVRL ++ + +KLPS  +P+    GVHPST+PC+  L     PS     +TA LP
Sbjct  1     MDPCAFVRLTVDQLLLKLPSVPRPSSGAAGVHPSTSPCFCTLHLQDHPSAGSHSRTAQLP  60

Query  1408  LCSALPKDDSSSPTDSFASAEG--FHLDPSALRRLSEKPVA-LKLSVFAGRMGQT-CGIT  1241
             L S      S SP    A+ E     LD +A++RLS +P A L +SV AG+ G   CG++
Sbjct  61    LAS------SESP-GPVAAGEPVVISLDAAAVQRLSARPAAELVVSVHAGQKGNAGCGMS  113

Query  1240  SGKLLGVVQVAVDLS-GAQSRPVVFQSGWKKLG-------GGGADKPMLHVVVRSEPDPR  1085
             +G+ LG V+V VD++  A    VV + GW  +G         G  +  +H+VVR+EPDPR
Sbjct  114   AGRALGRVRVPVDVARAAAGETVVARDGWVDVGKPAAAAASHGHARAQIHMVVRAEPDPR  173

Query  1084  FVFQFGGEPECSPVVFQIQGSI-----RQPVFSCKFSA-ERNNRTRSLPSDFSLNS----  935
             +VFQFGGEPEC PVV+Q+ G       RQPVF+C+FSA  R  RTRSL S+ S+      
Sbjct  174   YVFQFGGEPECGPVVYQVPGGAAGGGQRQPVFTCRFSAGRRATRTRSLTSESSMTRSTSR  233

Query  934   --RGWMRTFSGDRDRPGK--ERKGWMIIIYDLSGSSVAAASMITPFVPSP-GSDRVSRSN  770
               R W+ T  GDRD   +  +RKGW + I+DLSGS VA ASM+TPFVPSP GS RVSR+N
Sbjct  234   KLRSWLSTLHGDRDAQARREQRKGWTVTIHDLSGSPVAMASMVTPFVPSPAGSGRVSRAN  293

Query  769   PGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTS-GIPIAEGAMN  593
             PGAWLIL+P G   +SWKPW RLEAWRERG VD LGY+ ELV D+G T   +PIAE +++
Sbjct  294   PGAWLILQPTGAGPASWKPWARLEAWRERGPVDALGYRLELVFDSGPTECAVPIAESSIS  353

Query  592   VKKGGRFCIDNAR--KHSASSLSP-VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaa  428
              K+GG+F ID A     +A +  P   GFVM S+   EG+    +VQV V H  CM D A
Sbjct  354   TKRGGQFVIDPATFPVGAAGAAWPFAGGFVMGSTAEGEGRASRPTVQVGVQHATCMGDVA  413

Query  427   lfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             LFVAL+AA+DL MDAC+LFS +LRKE CHD+ D
Sbjct  414   LFVALAAAVDLCMDACKLFSQRLRKELCHDQED  446



>ref|XP_009407691.1| PREDICTED: uncharacterized protein LOC103990325 [Musa acuminata 
subsp. malaccensis]
Length=455

 Score =   362 bits (928),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 224/454 (49%), Positives = 297/454 (65%), Gaps = 57/454 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAG-PGVHPSTTPCYAKLKFSSFPSQ-TALLPLCSAL  1394
             MDPCPFVR+++ ++A+K P A +PAG  GVHPS  PC+A ++    PS+ T  +PL   L
Sbjct  1     MDPCPFVRVLVGNLALKSPVAARPAGGAGVHPSAHPCFATVRLDKHPSRHTVPVPL---L  57

Query  1393  PKDDSSSPTDSFASAE--GFHLDPSALRRLSEKPV------------ALKLSVFAGRMGQ  1256
             P D + +   + A++   GFHL  + L R++ + +             LK+++++GRMG 
Sbjct  58    PPDHADANPPAAAASLAAGFHLSKADLDRIAGRSLFSAASASGAGTAKLKVAIYSGRMGT  117

Query  1255  TCGITSGKLLGVVQVAVDL-SGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFV  1079
             TCG+ SG+LLG V + +DL   A+   VVF SGW  LG G A K  +++ V++E +PRFV
Sbjct  118   TCGVRSGRLLGKVSLPLDLREAAEGTAVVFHSGWIGLGKGAA-KAQMYLTVKAEAEPRFV  176

Query  1078  FQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN-----RTRSLPSDFSLNSRGWMRTF  914
             F+F GEPECSP VFQ+QG+ RQPVF+C FS   N      R+RS  S+ S + R W  +F
Sbjct  177   FEFDGEPECSPQVFQVQGNRRQPVFTCSFSCRHNFGDWNWRSRSTQSEPS-SPRRWRSSF  235

Query  913   SGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGP  734
               +R+RPGKERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWLILRP   
Sbjct  236   GSERERPGKERKGWSVKVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRPVD-  294

Query  733   SVSSWKPWGRLEAWRERG--SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-  563
                +W+PWGRLEAWRERG  + DGLGY+FEL+ D     G+ +AE  ++  KGG+F ID 
Sbjct  295   --GTWQPWGRLEAWRERGGPAGDGLGYRFELLPDTAVGPGVSLAESTISASKGGKFAIDL  352

Query  562   -------NARKHSAS----------SLSP-----VRGFVMCSSV--EGKNGFLSVQVAVN  455
                     AR  S+S          SLSP      RGFVM S+V  EG++G  +V+V V 
Sbjct  353   TGAGGNPLARTSSSSGRGGKLGRGLSLSPSPSPAYRGFVMSSTVIGEGRSGRPAVEVGVQ  412

Query  454   HVNCMadaalfvalsaAIDLSMDACQLFSTKLRK  353
             HV C  DAA FVAL+AA+DLSMDAC+LFS KLR+
Sbjct  413   HVGCAEDAAAFVALAAAVDLSMDACRLFSHKLRR  446



>ref|XP_008372951.1| PREDICTED: uncharacterized protein LOC103436305 [Malus domestica]
Length=485

 Score =   362 bits (930),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 210/451 (47%), Positives = 277/451 (61%), Gaps = 61/451 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++  + +K P A++P+   VHPS++PC+ K+K S+FP Q + +PL  A   
Sbjct  49    MDPCPFVRILVGDLTLKFPMASRPSSATVHPSSSPCFCKIKLSNFPHQVSTVPLI-ANDG  107

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
               + + T + + A  F+L+ + +  LS K   LK++V+ GR+G TCG+ S KLLG V V 
Sbjct  108   QAAQTATHNHSLAACFNLNKTQIETLSSKRSILKIAVYTGRVGATCGLNSAKLLGRVNVP  167

Query  1207  V-DLSGAQSRPVVFQSGW------KKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECS  1049
             + +L  A+SRPVV+Q+GW      KK  G G+    L++ VR+EPDPRF+FQF GEPECS
Sbjct  168   LSELGVAESRPVVYQNGWIAIGGKKKSNGNGSSSAELYLSVRAEPDPRFIFQFDGEPECS  227

Query  1048  PVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWM  869
             P VFQ+QG+++QPVF+CKF    + ++RS+ S      R W+      +++  KERKGW 
Sbjct  228   PQVFQVQGNVKQPVFTCKFGFRNDLQSRSMSSQPG-TPRNWLPFGGTHKEQXAKERKGWS  286

Query  868   IIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWR  689
             I I+DLSGS VAAASM+TPFV SPGS RVSRSNPGAWLILRPN     +W+PWGRLEAW 
Sbjct  287   ITIHDLSGSPVAAASMVTPFVASPGSHRVSRSNPGAWLILRPNE---GTWQPWGRLEAWL  343

Query  688   ERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPV-----  524
             ERG  D +GY+FEL           +A   +  K GG+F ID       SSL+P      
Sbjct  344   ERGGSDNVGYRFELQNST-------LANSTLGAKNGGKFSID-----LTSSLTPANSPHS  391

Query  523   ------------------------------RGFVMCSSVE--GKNGFLSVQVAVNHVNCM  440
                                           RGFVM S+VE  GK     V+V V HV C 
Sbjct  392   SFDLGSGSSSRPGSGSGSDFGFGLLPSLVQRGFVMSSTVEGVGKCSKPEVEVGVQHVTCT  451

Query  439   adaalfvalsaAIDLSMDACQLFSTKLRKEF  347
              DAA +VAL+AA+DLSMDAC+ FS KLRKE 
Sbjct  452   EDAAAYVALAAAMDLSMDACRPFSQKLRKEL  482



>dbj|BAJ91729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 223/445 (50%), Positives = 283/445 (64%), Gaps = 37/445 (8%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPA--GPGVHPSTTPCYAKLKFSSFPS---QTALLPLC  1403
             MDPC FVRL ++ + +KLP+  +P+    GVHPST+PC+  L     PS   +TA LPL 
Sbjct  1     MDPCAFVRLTVDQLLLKLPAVPRPSSGAAGVHPSTSPCFCTLHLQDHPSSLSRTAPLPLA  60

Query  1402  SALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGR-MGQT---CGITSG  1235
             SA     +        S     LD +A++RLS +P  L ++V AG+  G T   CG+ + 
Sbjct  61    SACLPSGAGGGDPVVIS-----LDVAAVQRLSGRPAELVVTVHAGQSKGSTSTGCGVGAS  115

Query  1234  KLLG-VVQVAVDLSGAQSRPVVFQSGWKKLG--GGGADKPMLHVVVRSEPDPRFVFQFGG  1064
             + LG V         A    VV + GW  +G     A +  +H++VR+EPDPR+VFQFGG
Sbjct  116   RALGKVRVAVDVARAAAGETVVARDGWVDVGKPASSAARAQIHMLVRAEPDPRYVFQFGG  175

Query  1063  EPECSPVVFQI-----QGSIRQPVFSCKFSA-ERNNRTRSLPSDFSLNS------RGWMR  920
             EPEC PVV+Q+      G  RQPVF+C+FSA  R  RTRSL S+ S+        R W+ 
Sbjct  176   EPECGPVVYQVPGGSAGGGQRQPVFTCRFSAGRRAARTRSLTSESSMTRSPSRRLRSWLS  235

Query  919   TFSGDRDRPGK--ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILR  746
             T  GD D   +  +RKGWM+ I+DLSGS VAAASM+TPFVPSPGS RVSR+NPGAWLIL+
Sbjct  236   TLHGDADARAQRDQRKGWMVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPGAWLILQ  295

Query  745   PNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAG-FTSGIPIAEGAMNVKKGGRFC  569
             P G   SSWKPW RLEAWRERG VD LGY+ ELV D+G     +PIAE +++ K+GG+F 
Sbjct  296   PTGAGASSWKPWARLEAWRERGPVDALGYRLELVFDSGPVECAVPIAESSISAKRGGQFV  355

Query  568   IDNAR--KHSASSLSP-VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaA  404
             ID A   + SA +  P   GFVM S+V  EGK    +VQV V HV CM D A+FVALSAA
Sbjct  356   IDPATFPEGSAGAAWPFAGGFVMGSTVEGEGKASRPTVQVGVQHVACMGDVAVFVALSAA  415

Query  403   IDLSMDACQLFSTKLRKEFCHDEHD  329
             +DL MDAC+LFS +LRKE C D+ D
Sbjct  416   VDLCMDACKLFSHRLRKELCQDQDD  440



>emb|CDM84004.1| unnamed protein product [Triticum aestivum]
Length=440

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 224/446 (50%), Positives = 287/446 (64%), Gaps = 39/446 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPA--GPGVHPSTTPCYAKLKFSSFPS---QTALLPLC  1403
             MDPC FVRL ++ + +KLP+  +P+    GVHPST+PC+  L     PS   +TA LPL 
Sbjct  1     MDPCAFVRLTVDQLLLKLPAVPRPSSGAAGVHPSTSPCFCTLHLQDHPSSLSRTAPLPLA  60

Query  1402  SA-LPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGR-MGQT---CGITS  1238
             SA LP   S    D         LD +A+++LS +PV L ++V AG+  G T   CG+ +
Sbjct  61    SACLPGGASGG--DPVV----LSLDAAAVQKLSGRPVELVVTVHAGQSKGSTSTGCGVGA  114

Query  1237  GKLLG-VVQVAVDLSGAQSRPVVFQSGWKKLG--GGGADKPMLHVVVRSEPDPRFVFQFG  1067
              + LG V         A    VV + GW  +G     A +  +H++VR+EPDPR+VFQFG
Sbjct  115   SRALGKVRVAVDVARAAAGETVVARDGWMDVGKPASSAARAQIHMLVRTEPDPRYVFQFG  174

Query  1066  GEPECSPVVFQI-----QGSIRQPVFSCKFSAERNN-RTRSLPSDFSLNS------RGWM  923
             GEPEC PVV+Q+      G  RQPVF+C+FSA R   RTRSL S+ S+        R W+
Sbjct  175   GEPECGPVVYQVPGGSAGGGQRQPVFTCRFSAGRRAVRTRSLTSESSMTRSPSRRLRSWL  234

Query  922   RTFSGDRDRPGK--ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLIL  749
              T  GD D+  +  +RKGWM+ I+DLSGS VAAASM+TPFVPSPGS RVSR+NPGAWLIL
Sbjct  235   STLHGDGDKRTQRDQRKGWMVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPGAWLIL  294

Query  748   RPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAG-FTSGIPIAEGAMNVKKGGRF  572
             +P G   SSWKPW RLEAWRERG VD LGY+ ELV D+G     +PIA+ +++ K+GG+F
Sbjct  295   QPTGAGPSSWKPWARLEAWRERGPVDALGYRLELVFDSGPVECAVPIAQSSISAKRGGQF  354

Query  571   CIDNAR--KHSASSLSP-VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsa  407
              ID A   + SA +  P   GFVM S+V  EGK    +VQV V HV CM D A+F+ALSA
Sbjct  355   VIDPATFPEGSAGAAWPFAGGFVMGSTVEGEGKASRPTVQVGVQHVACMGDVAVFIALSA  414

Query  406   AIDLSMDACQLFSTKLRKEFCHDEHD  329
             A+DL MDAC+LFS +LRKE C D+ D
Sbjct  415   AVDLCMDACKLFSHRLRKELCQDQDD  440



>ref|XP_004955420.1| PREDICTED: uncharacterized protein LOC101777215 [Setaria italica]
Length=471

 Score =   358 bits (919),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 220/468 (47%), Positives = 285/468 (61%), Gaps = 67/468 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSAT--------KPAGPGVHPSTTPCYAKLKFSSFPSQTALL  1412
             MDPCPFVR+++ ++AVK+P+A           +G GVHP+T PCY +++ +  P QTA  
Sbjct  1     MDPCPFVRVLVGNLAVKMPAAAPRGGGTGGSSSGAGVHPTTAPCYCRIRLNKLPYQTASA  60

Query  1411  PLCSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVA--------LKLSVFAGRMGQ  1256
             PL   LP  +    + + A A  FH+  + L R + KP          LK++V+AGR G 
Sbjct  61    PL---LPPAEEGPASCTGAFAAAFHVSKADLDRAAAKPALFGARRTARLKVAVYAGRRGS  117

Query  1255  TCGITSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP----------------  1124
             TCG++SG+LLG V V +DL  A ++PVVF SGW  +G   A +                 
Sbjct  118   TCGVSSGRLLGKVVVPLDLRAAAAKPVVFHSGWVAIGKRRAGRKPAAAGAAFGGAAAGHA  177

Query  1123  MLHVVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN--RTRSLPSD  950
              L++ VR+EPDPRFVF+F GEPECSP V Q+QG +RQP+F+CKFS   N+  R+RS+ SD
Sbjct  178   QLNLTVRAEPDPRFVFEFDGEPECSPQVLQVQGRMRQPMFTCKFSCRSNSDLRSRSVQSD  237

Query  949   FSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSN  770
                  R W+  F  +R+R GKERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSN
Sbjct  238   PGNGGRNWLAKFGSERERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSN  297

Query  769   PGAWLILRPNGPSVSSWKPWGRLEAWRER----GSVDGLGYKFELVTDAGFTS-GIPIAE  605
             PG WLILRP      +W PWGRLE WRER       D LGY+FELV D   +  G+ +AE
Sbjct  298   PGGWLILRPVD---GTWTPWGRLECWRERGGAGAGGDSLGYRFELVPDHTNSGVGVCVAE  354

Query  604   GAMNVKKGGRFCID-NARKHSASSLSP-------------------VRGFVMCSSV--EG  491
               + V KGGRF ID  A +    S SP                    RGFVM ++V  EG
Sbjct  355   SGVPVSKGGRFAIDLTAAQPFGRSGSPGCSPRGSGDFGHGLWPFGSFRGFVMSAAVQGEG  414

Query  490   KNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             +    +V+V V HV C  DAA FVAL+AA+DLSMDAC+LFS KLR+E 
Sbjct  415   RCSKPTVEVGVAHVGCAEDAAAFVALAAAVDLSMDACRLFSCKLRREL  462



>emb|CBI19337.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   358 bits (919),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 234/327 (72%), Gaps = 17/327 (5%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL++ ++A+K+P A+KPA   VHPS++PC+ K+K  +FP QTA++P    +P 
Sbjct  1     MDPCPFVRLLVGNLALKVPVASKPARSVVHPSSSPCFCKIKLKNFPLQTAVVPF---IPP  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV-----ALKLSVFAGRMGQTCGITSGKLLG  1223
             ++          A  FHL  + L +L+ K +      LK++V+ GR G TCG+ SG+LLG
Sbjct  58    ENQFPDGQVQTLAASFHLSKADLEKLAAKSIFAGKLCLKIAVYTGRRGTTCGVNSGRLLG  117

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGG-ADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +DL+G ++RP VF +GW  +G G        H+ V+SEPDPRFVFQF GEPEC+P
Sbjct  118   RVTVPLDLAGTETRPCVFHNGWISVGKGTKGSSAQFHLNVKSEPDPRFVFQFDGEPECNP  177

Query  1045  VVFQIQGSIRQPVFSCKFSAER----NNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
              VFQIQGSIRQPVF+CKFS       N R+RSL S+ +++SR W+ +F  +R+RPG+ERK
Sbjct  178   QVFQIQGSIRQPVFTCKFSFRNTGGPNQRSRSLQSE-TISSRTWLSSFGSERERPGRERK  236

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I ++DLSGS VAAASM+TPFV SPGSDRVSRSNPG+WLILRP      +WKPWGRLE
Sbjct  237   GWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPGD---GTWKPWGRLE  293

Query  697   AWRERGSVDGLGYKFELVTDAGFTSGI  617
             AWRERGS DGLGY+FEL+ D     G+
Sbjct  294   AWRERGSSDGLGYRFELIPDTNGGMGV  320



>ref|XP_004969897.1| PREDICTED: uncharacterized protein LOC101784603 [Setaria italica]
Length=448

 Score =   355 bits (912),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 226/452 (50%), Positives = 291/452 (64%), Gaps = 43/452 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPA-GPGVHPSTTPCYAKLKFSSFP---SQTALLPLCS  1400
             MDPC FVRL ++ + +KLP+  +P+ G GVHPST+PC+  L     P   S+TALLPL S
Sbjct  1     MDPCAFVRLTVDQLLLKLPAVQRPSSGAGVHPSTSPCFCTLSLQDHPASLSRTALLPLAS  60

Query  1399  ALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGV  1220
             A     +++  D         LD  A+RRLS +P  L +SV AG+ G  CGI++ + LG 
Sbjct  61    AAGAAAAAAHADPVV----LSLDAEAVRRLSARPAELVVSVHAGQTGTNCGISAARALGR  116

Query  1219  VQVAVDLS-GAQSRPVVFQSGWKKLGGGGAD-----------KPMLHVVVRSEPDPRFVF  1076
             V+V+VD++  A    VV + GW  +G  G+            +  +H+VVR+EPDPR+VF
Sbjct  117   VRVSVDVARAAAGETVVARDGWVDVGKPGSASSASSAAAASARAQIHMVVRAEPDPRYVF  176

Query  1075  QFGGEPECSPVVFQI-----QGSIRQPVFSCKFSA-ERNNRTRSLPSDFSLNS------R  932
             QFGGEPEC PVV+Q+      G  RQPVF+C+FSA  R  R+RSL    S+        R
Sbjct  177   QFGGEPECGPVVYQVPGGAAGGGQRQPVFTCRFSAGRRATRSRSLTPQSSMTRSTSRRLR  236

Query  931   GWMR-TFSGD-RD--RPGKE-RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNP  767
              W+  T  GD RD  R  +E RKGW + I+DLSGS VAAASM+TPFVPSPGS RVSR+NP
Sbjct  237   SWLSGTLHGDGRDGSRASREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANP  296

Query  766   GAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAG-FTSGIPIAEGAMNV  590
             G+WLIL+  G   SSWKPW RLEAWRERG VD LGY+ ELV D+G     +PIAE +++ 
Sbjct  297   GSWLILQATGAGPSSWKPWARLEAWRERGPVDALGYRLELVFDSGPHECAVPIAESSIST  356

Query  589   KKGGRFCIDNAR--KHSASSLSPVR-GFVMCSSV--EGKNGFLSVQVAVNHVNCMadaal  425
             K+GG+F ID A   + +A +  P   GFVM S+V  EG+    +VQV V  V CM D A+
Sbjct  357   KRGGQFVIDPATFPEATAGAAWPFAGGFVMGSTVEGEGRASRPTVQVGVQRVTCMGDVAV  416

Query  424   fvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             FVALSAA+DL MDAC+LFS +LRKE C D+ D
Sbjct  417   FVALSAAVDLCMDACKLFSQRLRKELCQDQDD  448



>ref|XP_010232287.1| PREDICTED: uncharacterized protein LOC100822437 [Brachypodium 
distachyon]
Length=450

 Score =   354 bits (909),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 220/454 (48%), Positives = 285/454 (63%), Gaps = 45/454 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKP--AGPGVHPSTTPCYAKLKFSSFPS---QTALLPLC  1403
             M+PC FVRL ++ + +KLPS  +P  A  GVHPST+PC+  L     PS   +TA LPL 
Sbjct  1     MEPCAFVRLTVDQLLLKLPSVPRPNSAAAGVHPSTSPCFCTLHLHDHPSSLSRTAPLPLA  60

Query  1402  SALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCG------IT  1241
             SA   +         A      LD +A++RLS +P  L ++V AG+ G +        + 
Sbjct  61    SACAANRVPGADPVVA----LSLDAAAVQRLSARPAELVVTVHAGQAGGSAAAAGCGMMG  116

Query  1240  SGKLLGVVQVAVDLS-GAQSRPVVFQSGWKKLG-------GGGADKPMLHVVVRSEPDPR  1085
             +G+ LG V+V VD++  A    VV + GW  +G            +  +H+VVR+EPDPR
Sbjct  117   AGRALGRVRVPVDVARAAAGETVVARDGWVDVGKKQQSSASASHGRAQIHMVVRAEPDPR  176

Query  1084  FVFQFGGEPECSPVVFQIQGSI-----RQPVFSCKFSA-ERNNRTRSLPSDFSLNS----  935
             +VFQFGGEPEC PVV+Q+ G       RQPVF+C+FSA  R +RTRSL S+ S+      
Sbjct  177   YVFQFGGEPECGPVVYQVPGGGAGAGQRQPVFTCRFSAGRRADRTRSLTSESSMTRSTSR  236

Query  934   --RGWMRTF----SGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRS  773
               R W+ T      GD     ++RKGWM+ I+DLSGS VAAASM+TPFVPSPGS RVSR+
Sbjct  237   RLRSWLSTLHGGDGGDARARREQRKGWMVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRA  296

Query  772   NPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAG-FTSGIPIAEGAM  596
             NPGAWLIL+P G   SSWKPW RLEAWRERG +D LGY+ ELV D+G     +PIAE ++
Sbjct  297   NPGAWLILQPTGAGPSSWKPWARLEAWRERGPIDALGYRLELVFDSGPVECAVPIAESSI  356

Query  595   NVKKGGRFCIDNA---RKHSASSLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMada  431
             + K+GG+F ID A      + +S     GFVM S+V  EGK    +VQV V H +CM D 
Sbjct  357   STKRGGQFVIDPATFPEGAAGASWPFAGGFVMGSTVEGEGKASRPTVQVGVQHASCMGDV  416

Query  430   alfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             A+FVALSAA+DL MDAC+LFS +LRKE C D+ D
Sbjct  417   AVFVALSAAVDLCMDACKLFSQRLRKELCQDQDD  450



>gb|KHG07926.1| hypothetical protein F383_34968 [Gossypium arboreum]
Length=464

 Score =   354 bits (909),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 218/466 (47%), Positives = 281/466 (60%), Gaps = 58/466 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++ ++A++LP +TKP+   +HPST+PCY K+K  +FP Q   +PL  A  +
Sbjct  1     MDPCPFVRILVGNLALRLPLSTKPSLSRIHPSTSPCYCKIKLKNFPHQVGSIPLIHANTQ  60

Query  1387  D-DSSSPTDSFASAEGFHLDPSALRRLSEK---PVALKLSVFAGRMGQTCGITSGKLLGV  1220
             + +S + +   + A  F L    + R+  K      L + V+A   G TCG+ SGKLLG 
Sbjct  61    NPESCNFSLQKSLAACFSLSKFQVDRIISKGGSSYKLSIEVYADPDGSTCGLASGKLLGK  120

Query  1219  VQVAVDLSGAQSRPVVFQSGWKKLGGGGADK----PMLHVVVRSEPDPRFVFQFGGEPEC  1052
             V V +DL GA+SRP V  +GW  +G   ++K      L + +R+EPDPRFVFQFGGEPEC
Sbjct  121   VTVPLDLRGAESRPSVAHNGWVDIGRNKSNKNGSSAQLFLTIRTEPDPRFVFQFGGEPEC  180

Query  1051  SPVVFQIQGSIRQPVFSCKF----SAERNNRTR-SLPSDFSLNSRGWMRTFSGDRDRPGK  887
             SP VFQ+QGS++Q VF+CKF    S++RN  +R SLP   S  SR W+ +   D+D+  K
Sbjct  181   SPQVFQVQGSVKQAVFTCKFGFRSSSDRNLGSRTSLPE--SNTSRNWLPSLKTDKDQSAK  238

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I ++DLSGS VA ASM+TPFVPSPGSDRVSRSNPGAW ILRP      +WKPWG
Sbjct  239   ERKGWSITVHDLSGSPVAMASMVTPFVPSPGSDRVSRSNPGAWSILRPE---CGTWKPWG  295

Query  706   RLEAWRERGSVDGLGYKFELVTD--AGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSL  533
             RLEAWRE G  D LGY+F+L  D      +   +A   ++ K GG+F +D     S  S+
Sbjct  296   RLEAWREPGFTDALGYRFDLFHDDIVATGTTTTVASSTLSTKLGGKFTMDMTTNISTPSI  355

Query  532   SPVR------------------------------------GFVMCSSVE--GKNGFLSVQ  467
             SP                                      GFVM S+VE  GK     V+
Sbjct  356   SPQSSCDLGSGSRPGSRPGSGSGSDFGFGLPLSPQSMYRGGFVMSSTVEGVGKCSKPEVE  415

Query  466   VAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             V V HV C  DAA FVAL+AA+DLSMDACQ FS KLRKE     H+
Sbjct  416   VGVKHVTCTEDAAAFVALAAAMDLSMDACQSFSQKLRKELRQQSHN  461



>ref|XP_010095633.1| hypothetical protein L484_003734 [Morus notabilis]
 gb|EXB61540.1| hypothetical protein L484_003734 [Morus notabilis]
Length=438

 Score =   353 bits (906),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 216/454 (48%), Positives = 275/454 (61%), Gaps = 65/454 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-VHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDPCPFVR++I  +A+KLP A+KP+  G VHPS +PC+ K+K  +FP Q A +PL     
Sbjct  1     MDPCPFVRILIGDLALKLPVASKPSFSGTVHPSASPCFCKIKLKNFPHQFAAIPL-----  55

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQV  1211
                 +   +S + A  F LD +    L+ KP  LK+ V+ GR G TCG+ + KLLG V V
Sbjct  56    ----NRDANSRSLAACFSLDKAQFESLAAKPQCLKIKVYTGRRGSTCGLNASKLLGKVSV  111

Query  1210  AVDLSGAQSRPVVFQSGWKKLGGGGADKPM------LHVVVRSEPDPRFVFQFGGEPECS  1049
              +DL  A+SRP VFQ+GW  +G     + +      L + VR+EPDPRFVFQF GEPECS
Sbjct  112   PLDLRVAESRPYVFQNGWVSIGKKDNKESLNLSSSQLRLCVRAEPDPRFVFQFDGEPECS  171

Query  1048  PVVFQIQGSIRQPVFSCKF----SAERNNRTRSLPSDFSLNSRGWM--RTFSGDRDRPGK  887
             P VFQ+QGS++QPVF+CKF    S++  N + + P+     SR W           +  K
Sbjct  172   PQVFQVQGSVKQPVFTCKFDFRSSSDLKNSSVTEPN----TSRSWFVPSLKIQKEQKYTK  227

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW + I+DLSGS VA ASM+TPFV SPGSDRVSRSNPGAWLILRP      +WKPWG
Sbjct  228   ERKGWSVTIHDLSGSPVAVASMVTPFVASPGSDRVSRSNPGAWLILRPGE---GTWKPWG  284

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-NARKHSASSLS  530
             RLEAWRERG  D +GY+FEL+ D    +   +A  A++   GG+F ID  +   S+ ++S
Sbjct  285   RLEAWRERGGTDSVGYRFELLGDDA--TPATLACSAVSAAAGGKFSIDVTSSIVSSPAIS  342

Query  529   PV-------------------------------RGFVMCSSVE--GKNGFLSVQVAVNHV  449
             P                                RGFVM S+VE  GK     V+V V HV
Sbjct  343   PQSSIDLGSGSGSRPGSRAGSGSGSDFGVGLSNRGFVMSSTVEGVGKKSKPEVEVGVQHV  402

Query  448   NCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
              C  DAA FVAL+AA+DLSMDAC+LFS KL KE 
Sbjct  403   TCSEDAAAFVALAAAMDLSMDACRLFSQKLPKEL  436



>ref|XP_009408582.1| PREDICTED: uncharacterized protein LOC103990981 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   353 bits (907),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 224/465 (48%), Positives = 296/465 (64%), Gaps = 65/465 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++ ++A+K+  A  PAG GVHPS  PC+AK++   FP QT  +PL   +P 
Sbjct  1     MDPCPFVRVVVGNLALKVAVAAPPAGAGVHPSAAPCFAKIRLDKFPRQTLAVPL---VPH  57

Query  1387  DDS-SSPTDSFASAEGFHLDPSALRRLSEKPV---------ALKLSVFAGRMGQTCGITS  1238
             D+  ++PT   + A  FHL    L R++ KP           LK+SV+ GR G+TCG++S
Sbjct  58    DEPPATPTSDASVAARFHLSKDDLARIAGKPSFFASHGGCSRLKVSVYTGRRGRTCGVSS  117

Query  1237  GKLLGVVQVAVDLSGAQS-----RPVVFQSGWKKLGGG------------GADKPMLHVV  1109
             G+LLG V + +DL GA +     +PV F SGW  LG               + +  L++ 
Sbjct  118   GRLLGKVTMPLDLKGALAESGAGKPVAFHSGWVSLGKNKFRLAKGTSSSPSSSEAHLYLT  177

Query  1108  VRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSL  941
             V++E DPRFVF+F GEPECSP VFQ+QG++RQPVF+CKFS     +  + TRS+ S+   
Sbjct  178   VKAEQDPRFVFEFDGEPECSPQVFQVQGNMRQPVFTCKFSCRIAGDGKSSTRSVLSEPG-  236

Query  940   NSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGA  761
             NSR W+ +F  +R+RP KERKGW + ++DLSGS VA ASM+TPFVPS G+DRVSRSNPGA
Sbjct  237   NSRSWLTSFGSERERPVKERKGWSVTVHDLSGSPVALASMVTPFVPSSGTDRVSRSNPGA  296

Query  760   WLILRPNGPSVSSWKPWGRLEAWRER---GSVDGLGYKFELVTDAGFTSGIPIAEGAMNV  590
             WL+LRP      +WKPWGRLEAWRER   GS DGLGY+FEL+ +A   +G+ +AE  ++ 
Sbjct  297   WLVLRPG---EGTWKPWGRLEAWRERGGAGSGDGLGYRFELLPEAAMGAGVTLAESTLSA  353

Query  589   KKGGRFCIDNARKHS---ASSLSP-------------------VRGFVMCSSVEG--KNG  482
              KGG+F ID         + S+SP                    RGFVM S+V G  ++G
Sbjct  354   AKGGQFTIDLIEVSGTPVSRSVSPGCSPRVGGDLGYALWPCSSYRGFVMSSTVSGERRSG  413

Query  481   FLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
               +V+V V HV C  DAA FVAL AA+DLSMDAC+LFS  LRKE 
Sbjct  414   RPTVEVGVQHVGCSEDAAAFVALGAAVDLSMDACRLFSHNLRKEL  458



>ref|XP_002456333.1| hypothetical protein SORBIDRAFT_03g034120 [Sorghum bicolor]
 gb|EES01453.1| hypothetical protein SORBIDRAFT_03g034120 [Sorghum bicolor]
Length=450

 Score =   350 bits (898),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 209/450 (46%), Positives = 279/450 (62%), Gaps = 37/450 (8%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPA-GPGVHPSTTPCYAKLKFSSFPSQT---ALLPLCS  1400
             MDPC FVRL ++ + +KLP+  +P+ G GVHPS +PC+  L     PS +     L   +
Sbjct  1     MDPCAFVRLTVDQLLLKLPAVPRPSSGAGVHPSNSPCFCTLTLQDHPSSSLSRTALLPLA  60

Query  1399  ALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGV  1220
             +           ++A      LD  A+RRLS +P  L +SV AG  G +CG+++ + LG 
Sbjct  61    SASAASGPGAAAAYADPVVLSLDAEAVRRLSARPAELVVSVHAGPTGSSCGVSASRALGR  120

Query  1219  VQVAVDLS-GAQSRPVVFQSGWKKLG--------GGGADKPMLHVVVRSEPDPRFVFQFG  1067
             V+VA+D++  A    VV + GW  +G           + +  +H+VVR+EPDPR+VFQFG
Sbjct  121   VRVAIDVARAAAGETVVARDGWVDVGKPASSASSSAVSVRAQIHMVVRAEPDPRYVFQFG  180

Query  1066  GEPECSPVVFQI------QGSIRQPVFSCKFSA-ERNNRTRSLPSDFSLNS------RGW  926
             GEPEC PVV+Q+       G  RQPVF+C+FSA  R  R+RSL    S+        R W
Sbjct  181   GEPECGPVVYQVPGGAAGGGQQRQPVFTCRFSAGRRAARSRSLTPQSSMTRSTSRRLRSW  240

Query  925   MRTFSGDRDRPG-----KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGA  761
             + +      R G     ++RKGW + I+DLSGS VAAASM+TPFVPSPGS RVSR+NPG+
Sbjct  241   LSSTLHGEGRDGAHSRREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPGS  300

Query  760   WLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAG-FTSGIPIAEGAMNVKK  584
             WLIL+  G   SSWKPW RLEAWRERG VD LGY+ ELV D+G     +PIAE +++ K+
Sbjct  301   WLILQATGAGPSSWKPWARLEAWRERGPVDALGYRLELVFDSGPHECAVPIAESSISTKR  360

Query  583   GGRFCIDNA---RKHSASSLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfv  419
             GG+F ID A      + ++     GFVM S+V  EG+    +VQV V HV CM D A+FV
Sbjct  361   GGQFVIDPATFPEAAAGAAWPFAGGFVMGSTVEGEGRASRPTVQVGVQHVTCMGDVAVFV  420

Query  418   alsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             ALSAA+DL MDAC+LFS +LRKE C D+ +
Sbjct  421   ALSAAVDLCMDACKLFSQRLRKELCQDQDE  450



>ref|XP_006486865.1| PREDICTED: uncharacterized protein LOC102617316 [Citrus sinensis]
Length=468

 Score =   350 bits (898),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 213/475 (45%), Positives = 285/475 (60%), Gaps = 70/475 (15%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSAT-KPAGPG-VHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+K P+ T KP+    +HPS++ CY K+K  SFP + A +PL    
Sbjct  1     MDPCPFVRILVGNLALKFPTVTSKPSFLSRIHPSSSSCYCKIKLKSFPDEIATVPLV---  57

Query  1393  PKDDSSSPTD---SFASAEGFHLDPSALRRLSEKP---------VALKLSVFAGRMGQTC  1250
                D ++P +   S + A  F+L+ + + ++ EK          ++L++ V+ G  G +C
Sbjct  58    --QDETTPANGNLSHSLAACFNLNKAQIDKILEKSKSPKSNSGVISLRVDVYTGSNGMSC  115

Query  1249  GITSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLG-GGGADKPMLHVVVRSEPDPRFVFQ  1073
              +T+ KLLG V V +DL GA+SRP V  +GW  +G      +  L++ V+SEPDPRFVFQ
Sbjct  116   -VTTDKLLGRVSVPLDLRGAESRPSVIHNGWAGIGENKKGSQAQLYLTVKSEPDPRFVFQ  174

Query  1072  FGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNS----RGWMRTFSGD  905
             F GEPECSP VFQ+QGS++Q VF+CKF    +N  R+L S  S+      R W+  F  +
Sbjct  175   FDGEPECSPQVFQVQGSVKQAVFTCKFGFRNSNNDRNLVSRTSMTENSTPRSWLSAFGSE  234

Query  904   RDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVS  725
             RD+  KERKGW I I+DLSGS VA ASM+TPFVPSPGSDRVSRSNPGAWLILRP      
Sbjct  235   RDQSSKERKGWSITIHDLSGSPVAMASMVTPFVPSPGSDRVSRSNPGAWLILRPGN---C  291

Query  724   SWKPWGRLEAWRERGSVDGLGYKFELVTD--AGFTSGIPIAEGAMNVKKGGRFCIDNARK  551
             +WKPWGRLEAWRE G+ D LGY+F+L+ D  +  +S   +A   ++  KGG+F ID A  
Sbjct  292   TWKPWGRLEAWREPGNSDLLGYRFDLLHDTISSNSSSTTVANANISSTKGGKFTIDMANS  351

Query  550   HSASSLS-----------------------------------PV---RGFVMCSSVE--G  491
              S + +                                    P+   RGFVM ++VE  G
Sbjct  352   VSTTPVHSPQSSCDFGSGSWSGPGSRPGSGSGSDFAFCCTGPPILQSRGFVMSATVEGGG  411

Query  490   KNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDS  326
             K     V+V V HV C  DAA FVAL+AA+DLS+DAC LFS KLRKE       S
Sbjct  412   KCSKPEVEVGVQHVTCTEDAAAFVALAAAMDLSVDACTLFSHKLRKELRQQSQQS  466



>ref|XP_002274843.1| PREDICTED: uncharacterized protein LOC100254836 [Vitis vinifera]
Length=423

 Score =   347 bits (891),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 214/439 (49%), Positives = 284/439 (65%), Gaps = 42/439 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSA--TKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPF+R+++ ++A+K P+   +K A   VHPS++P + K+K  +FPSQ A +PL   +
Sbjct  1     MDPCPFLRILVGNLALKSPALIPSKSAFSLVHPSSSPFFCKIKLGNFPSQFATVPL---V  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPV------ALKLSVFAGRMGQTCGITSGK  1232
             P++  +S  D   S   F L    + +L EK +       L++ V+ GR G++CG ++GK
Sbjct  58    PQETHTS--DDVVS---FTLTRKDIEKLGEKSLFSTKEPRLQILVYTGRRGRSCGFSAGK  112

Query  1231  LLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
             LLG V V +DL GA  R  VF +GW  +GG   +   L++ VR+EPDPRFVFQFGGEPEC
Sbjct  113   LLGRVTVGLDLKGAVGRACVFHNGWVSVGG---ESSQLYLSVRAEPDPRFVFQFGGEPEC  169

Query  1051  SPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGW  872
             SP VFQIQG++RQPVF+CKFS  RN+  RSL S  S++     R++   +D   KERKGW
Sbjct  170   SPQVFQIQGNLRQPVFTCKFSF-RNSGDRSLRSRSSISEASTSRSWFSSKDEDSKERKGW  228

Query  871   MIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAW  692
              I I+DLSG  VAAASM  PFVPSPGS RV RSNPGAWLILRP      +WKPWGRLEAW
Sbjct  229   SITIHDLSGCPVAAASMTNPFVPSPGSGRVKRSNPGAWLILRPED---GTWKPWGRLEAW  285

Query  691   RERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSL-------  533
             RE    DGLG++FEL+ DA     + +A   ++ KKGG+F ID++ ++  ++        
Sbjct  286   RE---PDGLGHRFELLPDATGGPAVLLASSTLSTKKGGKFTIDSSSRNFPATTPRGACES  342

Query  532   -------SPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDAC  380
                    S  RGFVM S+V  EG+     V+V V HV C  DAA FVAL+AA+DLSMDAC
Sbjct  343   GTRSWVESVYRGFVMSSTVGGEGRCSTPEVEVGVKHVTCTEDAAAFVALAAAMDLSMDAC  402

Query  379   QLFSTKLRKEFCHDEHDSY  323
             +LFS KLRKE    + + +
Sbjct  403   KLFSQKLRKELRRQQSEEF  421



>gb|KDO49502.1| hypothetical protein CISIN_1g012226mg [Citrus sinensis]
Length=468

 Score =   349 bits (895),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 214/478 (45%), Positives = 286/478 (60%), Gaps = 76/478 (16%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSAT-KPAGPG-VHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+K P+ T KP+    +HPS++ CY K+K  SFP + A +PL    
Sbjct  1     MDPCPFVRILVGNLALKFPTVTSKPSFLSRIHPSSSSCYCKIKLKSFPDEIATVPLV---  57

Query  1393  PKDDSSSPTD---SFASAEGFHLDPSALRRLSEKP---------VALKLSVFAGRMGQTC  1250
                D ++P +   S + A  F+L+ + + ++ EK          ++L++ V+ G  G +C
Sbjct  58    --QDETTPANGNLSHSLAACFNLNKAQIDKILEKSKSPKSNSGVISLRVDVYTGSNGMSC  115

Query  1249  GITSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLG-GGGADKPMLHVVVRSEPDPRFVFQ  1073
              +T+ KLLG V V +DL GA+SRP V  +GW  +G      +  L++ V+SEPDPRFVFQ
Sbjct  116   -VTTDKLLGRVSVPLDLRGAESRPSVIHNGWAGIGENKKGSQAQLYLTVKSEPDPRFVFQ  174

Query  1072  FGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNS----RGWMRTFSGD  905
             F GEPECSP VFQ+QGS++Q VF+CKF    +N  R+L S  S+      R W+  F  +
Sbjct  175   FDGEPECSPQVFQVQGSVKQAVFTCKFGFRNSNNDRNLVSRTSMTENSTPRSWLSAFGSE  234

Query  904   RDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVS  725
             +D+  KERKGW I I+DLSGS VA ASM+TPFVPSPGSDRVSRSNPGAWLILRP      
Sbjct  235   KDQSSKERKGWSITIHDLSGSPVAMASMVTPFVPSPGSDRVSRSNPGAWLILRPGN---C  291

Query  724   SWKPWGRLEAWRERGSVDGLGYKFELVTD--AGFTSGIPIAEGAMNVKKGGRFCIDNARK  551
             +WKPWGRLEAWRE G+ D LGY+F+L+ D  +  +S   +A   ++  KGG+F ID A  
Sbjct  292   TWKPWGRLEAWREPGNSDLLGYRFDLLHDTISSNSSSTTVANANISSTKGGKFTIDMA--  349

Query  550   HSASSLSPV-----------------------------------------RGFVMCSSVE  494
              S+ S +PV                                         RGFVM ++VE
Sbjct  350   -SSVSTTPVHSPQSSCDFGSGSWSGPGSRPGSGSGSDFAFCCTGPPILQSRGFVMSATVE  408

Query  493   --GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDS  326
               GK     V+V V HV C  DAA FVAL+AA+DLS+DAC LFS KLRKE       S
Sbjct  409   GGGKCSKPEVEVGVQHVTCTEDAAAFVALAAAMDLSVDACTLFSHKLRKELRQQSQQS  466



>ref|XP_004292055.1| PREDICTED: uncharacterized protein LOC101308741 [Fragaria vesca 
subsp. vesca]
Length=438

 Score =   348 bits (892),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 208/453 (46%), Positives = 275/453 (61%), Gaps = 63/453 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLC---SA  1397
             MDPCPFVR++I  + +K PS +KP+   VHPS++PC+ K+K ++FP Q + +PL    SA
Sbjct  1     MDPCPFVRILIGDLTLKFPSVSKPSFSTVHPSSSPCFCKIKLTNFPFQFSAVPLVLPSSA  60

Query  1396  LPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVV  1217
               + D +S   S  +   F+L    +  L+ K  +L +S++ GR G TCG+ S KLLG V
Sbjct  61    GAQPDPNSRAHSLNAC--FNLSKPQIEALASKKPSLSISIYTGRRGATCGLNSAKLLGRV  118

Query  1216  QVAV-DLSGAQSRPVVFQSGWKKLGG--GGADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V + +L+ A++RPVV+Q+GW  +GG   G+ +    + VR+EPDPRFVF+F GEPECSP
Sbjct  119   TVPLAELAAAETRPVVYQNGWIGIGGKKNGSGQSQFFLSVRAEPDPRFVFKFDGEPECSP  178

Query  1045  VVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSG--DRDRPGKERKGW  872
              VFQ+QG+++QPVF+CKF     +  +S         R W+  F G   +++  KERKGW
Sbjct  179   QVFQVQGNVKQPVFTCKFGFRNASDMQSRSMSEQGTPRNWLVPFMGSNQKEQSAKERKGW  238

Query  871   MIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAW  692
              + I+DLSGS VAAASM+TPFV SPGS RVSRSNPGAWLILRP      +WKPWGRLEAW
Sbjct  239   SLTIHDLSGSPVAAASMVTPFVASPGSQRVSRSNPGAWLILRPED---GTWKPWGRLEAW  295

Query  691   RERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPV----  524
              ERG  D +GYKFEL++         +A   ++   GG+F ID       SSL+PV    
Sbjct  296   LERGGSDTVGYKFELLSTI-------LANSTVSASNGGKFTID-----LTSSLTPVNSPH  343

Query  523   --------------------------------RGFVMCSSVE--GKNGFLSVQVAVNHVN  446
                                             RGFVM S+VE  GK     V+V V HV 
Sbjct  344   SSFDFGSGSGSSRPGSGSGSDFGFGLIPQLLQRGFVMSSTVEGIGKCSKPEVEVGVQHVT  403

Query  445   CMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             C  DAA +VAL+AA+DLSMDAC+ FS KLRKE 
Sbjct  404   CTEDAAAYVALAAAMDLSMDACRPFSQKLRKEL  436



>ref|XP_006422727.1| hypothetical protein CICLE_v10028366mg [Citrus clementina]
 gb|ESR35967.1| hypothetical protein CICLE_v10028366mg [Citrus clementina]
Length=469

 Score =   348 bits (894),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 212/471 (45%), Positives = 285/471 (61%), Gaps = 76/471 (16%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSAT-KPAGPG-VHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+K P+ T KP+    +HPS++ CY K+K  SFP + A +PL    
Sbjct  1     MDPCPFVRILVGNLALKFPTVTSKPSFLSRIHPSSSSCYCKIKLKSFPDEIATVPLV---  57

Query  1393  PKDDSSSPTD---SFASAEGFHLDPSALRRLSEKP---------VALKLSVFAGRMGQTC  1250
                D ++P +   S + A  F+L+ + + ++ EK          ++L++ V+ G  G +C
Sbjct  58    --QDETTPANGNLSHSLAACFNLNKAQIDKILEKSKSSKSNNGVISLRVDVYTGSNGMSC  115

Query  1249  GITSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLG-GGGADKPMLHVVVRSEPDPRFVFQ  1073
              +T+ KLLG V V +D+ GA+SRP V  +GW  +G      +  L++ V+SEPDPRFVFQ
Sbjct  116   -VTTDKLLGRVSVPLDMRGAESRPSVIHNGWAGIGENKKGSQAQLYLTVKSEPDPRFVFQ  174

Query  1072  FGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNS----RGWMRTFSGD  905
             F GEPECSP VFQ+QGS++Q VF+CKF    +N  R+L S  S+      R W+  F  +
Sbjct  175   FDGEPECSPQVFQVQGSVKQAVFTCKFGFRNSNNDRNLVSRTSMTENSTPRSWLSAFGSE  234

Query  904   RDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVS  725
             +D+  KERKGW I I+DLSGS VA ASM+TPFVPSPGSDRVSRSNPGAWLILRP      
Sbjct  235   KDQSSKERKGWSITIHDLSGSPVAMASMVTPFVPSPGSDRVSRSNPGAWLILRPGN---C  291

Query  724   SWKPWGRLEAWRERGSVDGLGYKFELVTD--AGFTSGIPIAEGAMNVKKGGRFCIDNARK  551
             +WKPWGRLEAWRE G+ D LGY+F+L+ D  +  +S   +A   ++  KGG+F ID A  
Sbjct  292   TWKPWGRLEAWREPGNSDLLGYRFDLLHDTISSNSSSTTVANANISSTKGGKFTIDMA--  349

Query  550   HSASSLSPV-----------------------------------------RGFVMCSSVE  494
              S+ S +PV                                         RGFVM ++VE
Sbjct  350   -SSVSTTPVHSPQSSCDFGSGSWSGPGSRPGSGSGSDFAFCCTGPPILQSRGFVMSATVE  408

Query  493   --GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
               GK     V+V V HV C  DAA FVAL+AA+DLS+DAC LFS KLRKE 
Sbjct  409   GGGKCSKPEVEVGVQHVTCTEDAAAFVALAAAMDLSVDACTLFSHKLRKEL  459



>emb|CBI25109.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   346 bits (887),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 214/431 (50%), Positives = 281/431 (65%), Gaps = 42/431 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSA--TKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPF+R+++ ++A+K P+   +K A   VHPS++P + K+K  +FPSQ A +PL   +
Sbjct  1     MDPCPFLRILVGNLALKSPALIPSKSAFSLVHPSSSPFFCKIKLGNFPSQFATVPL---V  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKPV------ALKLSVFAGRMGQTCGITSGK  1232
             P++  +S  D   S   F L    + +L EK +       L++ V+ GR G++CG ++GK
Sbjct  58    PQETHTS--DDVVS---FTLTRKDIEKLGEKSLFSTKEPRLQILVYTGRRGRSCGFSAGK  112

Query  1231  LLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPEC  1052
             LLG V V +DL GA  R  VF +GW  +GG   +   L++ VR+EPDPRFVFQFGGEPEC
Sbjct  113   LLGRVTVGLDLKGAVGRACVFHNGWVSVGG---ESSQLYLSVRAEPDPRFVFQFGGEPEC  169

Query  1051  SPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGW  872
             SP VFQIQG++RQPVF+CKFS  RN+  RSL S  S++     R++   +D   KERKGW
Sbjct  170   SPQVFQIQGNLRQPVFTCKFSF-RNSGDRSLRSRSSISEASTSRSWFSSKDEDSKERKGW  228

Query  871   MIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAW  692
              I I+DLSG  VAAASM  PFVPSPGS RV RSNPGAWLILRP      +WKPWGRLEAW
Sbjct  229   SITIHDLSGCPVAAASMTNPFVPSPGSGRVKRSNPGAWLILRPED---GTWKPWGRLEAW  285

Query  691   RERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSL-------  533
             RE    DGLG++FEL+ DA     + +A   ++ KKGG+F ID++ ++  ++        
Sbjct  286   RE---PDGLGHRFELLPDATGGPAVLLASSTLSTKKGGKFTIDSSSRNFPATTPRGACES  342

Query  532   -------SPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDAC  380
                    S  RGFVM S+V  EG+     V+V V HV C  DAA FVAL+AA+DLSMDAC
Sbjct  343   GTRSWVESVYRGFVMSSTVGGEGRCSTPEVEVGVKHVTCTEDAAAFVALAAAMDLSMDAC  402

Query  379   QLFSTKLRKEF  347
             +LFS KLRKE 
Sbjct  403   KLFSQKLRKEL  413



>ref|XP_008454429.1| PREDICTED: uncharacterized protein LOC103494838 [Cucumis melo]
Length=452

 Score =   347 bits (889),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 218/458 (48%), Positives = 285/458 (62%), Gaps = 59/458 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPL------  1406
             MDPCPF+R+++ ++A+K P A KP+  GVHPST+PC+ K+K + FP+Q   +PL      
Sbjct  1     MDPCPFLRILVGNLALKFPVAAKPSFSGVHPSTSPCFCKIKLNDFPTQFVTIPLLVDGEI  60

Query  1405  --CSALPKDDSSSPTDSFASAEGFHLDPSALRRL-SEKPVALKLSVFAGRMG-QTCGI--  1244
                ++     S S     + A  F L+ S + +L   K  ++K+ V+ GR+G  TC    
Sbjct  61    SGAASSSSSSSVSSQSHSSLAACFSLNKSQIEKLVKRKDASVKIEVYTGRLGPATCSGDV  120

Query  1243  --TSGKLLGVVQVAVDLSG-AQSRPVVFQSGWKKLGGG--GADKPMLHVVVRSEPDPRFV  1079
               +S KLLG + V V  SG ++++P VFQ+GW  +G G  G     LH+ VRSEPDPRFV
Sbjct  121   FGSSAKLLGRITVPVTGSGLSETKPCVFQNGWTGIGEGKKGYSSAQLHLTVRSEPDPRFV  180

Query  1078  FQFGGEPECSPVVFQIQGSIRQPVFSCKFS--AERN-NRTRSLPSDFSLNSRGWMRTFSG  908
             F+F GEPECSP VFQ+QGS++QPVF+CKF    ER+ +R+RS  ++ S  S+ W+     
Sbjct  181   FRFDGEPECSPQVFQVQGSVQQPVFTCKFGFRNERDWDRSRSSITEQSSTSKSWLPKIRS  240

Query  907   DRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSV  728
             +RD+  KERKGW I I+DLSGS VAAASM+TPFVPSPGS RVSRSNPGAWLILRP     
Sbjct  241   ERDQSAKERKGWSITIHDLSGSPVAAASMVTPFVPSPGSHRVSRSNPGAWLILRPVD---  297

Query  727   SSWKPWGRLEAWRERGSVDGLGYKFELV--TDAGFTSGIPIAEGAMNVKKGGRFCIDNAR  554
              SW+PWGRLEAWRE G  D +GY+FEL+  T A  T    +A   ++   GGRF ID   
Sbjct  298   GSWRPWGRLEAWRESGGSDSIGYRFELLPATSAAAT----LANSTISSGSGGRFTIDMTG  353

Query  553   KHSASSLSP--------------------------VRGFVMCSSVEG---KNGFLSVQVA  461
               S  ++SP                           +GFVM + VEG   K+    V+V 
Sbjct  354   SASP-AISPNGSFDLGSGTGSRPGSGDFGYLTGYQYKGFVMSTMVEGMKKKSRRPEVEVG  412

Query  460   VNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             V HV C  DAA+FVAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  413   VQHVTCTEDAAVFVALAAAVDLSMDACRLFSQKLRKEL  450



>ref|XP_002522078.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40278.1| conserved hypothetical protein [Ricinus communis]
Length=448

 Score =   346 bits (887),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 207/451 (46%), Positives = 282/451 (63%), Gaps = 56/451 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLC-----  1403
             MDPCPFVR+++ ++A+K P++++ +   V  ST+ C+ K+K  +FP+Q A +PL      
Sbjct  1     MDPCPFVRILVGNLAIKFPTSSRSS---VSRSTSSCFCKIKLKNFPTQQATIPLLHQQEP  57

Query  1402  SALPKDDSSSPTDSFASAEGFHLDPSALRRL--SEKPVALKLSVFAGRMGQTCGITSGKL  1229
              A  ++++   ++S A+   F+LD + + ++  S +P +L L ++ G    TCG ++GKL
Sbjct  58    QAQSQENNYCISNSLAAC--FNLDKTQINKITSSTRPTSLILEIYTGGEA-TCGFSNGKL  114

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECS  1049
             LG V V +DL  A+SRP V  +GW  +G G  +K   ++ VR+EPDPR+VFQFGGEPECS
Sbjct  115   LGKVTVPLDLKKAESRPCVIHNGW--IGIGEKNKVEFYLCVRAEPDPRYVFQFGGEPECS  172

Query  1048  PVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSL----NSRGWMRTFSGDRDRPGKER  881
             P VFQ+QGS+RQ VF+CKFS  RN   R+L    S+     SR W+ +   ++D+  KER
Sbjct  173   PQVFQVQGSVRQAVFTCKFSL-RNPGDRNLGQRQSMLEPSTSRNWLPSLGAEKDQSVKER  231

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRL  701
             KGW I I+DLSGS VA A+M+TPFVPSPGSDRVSRSNPGAWLILR   PS+ +WKPWGRL
Sbjct  232   KGWTITIHDLSGSPVAMAAMVTPFVPSPGSDRVSRSNPGAWLILR---PSLGTWKPWGRL  288

Query  700   EAWRERGSVDGLGYKFELVTD--AGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP  527
             EAWRE    + LGY+FEL+ D      +   +    +N K GG+F ID     +    SP
Sbjct  289   EAWREHPKTNELGYRFELIHDTATATPTTTTLVNSLVNSKNGGKFTIDTTNSVTTPVCSP  348

Query  526   -----------------------------VRGFVMCSSVEGKNGFL--SVQVAVNHVNCM  440
                                           RGFVM S+V+G +      V++ V HVNC 
Sbjct  349   HSSCDFGSGSGSGSWSGSEFGAGLFSQFLYRGFVMSSTVKGNSNCSKPEVEIGVQHVNCT  408

Query  439   adaalfvalsaAIDLSMDACQLFSTKLRKEF  347
              DAA FVAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  409   EDAAAFVALAAAMDLSMDACRLFSQKLRKEL  439



>dbj|BAJ85980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=396

 Score =   340 bits (872),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 237/358 (66%), Gaps = 29/358 (8%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG--VHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+K+P A +PAG G  VHP+T+PCY  ++ +  P Q+A  PL   L
Sbjct  1     MDPCPFVRVLVGNLALKMPVAPRPAGAGAGVHPTTSPCYCTIRLNKLPLQSAAAPL---L  57

Query  1393  PKDD-SSSPTDSFASAEGFHLDPSALRRLSEKP-------VALKLSVFAGRMGQTCGITS  1238
             P DD +  P  + A A  FHL  + L R++ KP         LK++V+AGR G TCG+ S
Sbjct  58    PSDDMTQGPAATGALAAAFHLSKADLDRVTAKPSLFVARSARLKVAVYAGRRGTTCGVNS  117

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGG------ADKPMLHVVVRSEPDPRFVF  1076
             G+LLG V + +DL  A  +P+VF SGW  +   G      +    L++ VR+EPDPRFVF
Sbjct  118   GRLLGKVVIPLDLKTAVGKPIVFHSGWVPINKRGRKASAVSGSAQLNLTVRAEPDPRFVF  177

Query  1075  QFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN--RTRSLPSDFSLNSRGWMRTFSGDR  902
             QF GEPECSP V Q+QG + QP+F+CKFS   N+  R+RS+ SD     R W+ +F  DR
Sbjct  178   QFDGEPECSPQVLQVQGGMMQPMFTCKFSCRSNSDLRSRSMHSDPGSGGRNWLMSFGSDR  237

Query  901   DRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSS  722
             +R GKERKGW + ++DLSGS VA ASM+TPFV SPGSDRVSRSNPGAWL+LRP      +
Sbjct  238   ERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGSDRVSRSNPGAWLVLRPGD---GT  294

Query  721   WKPWGRLEAWRERG---SVDGLGYKFELVT--DAGFTSGIPIAEGAMNVKKGGRFCID  563
             WKPWGRLE WRERG   + D LGY+FEL+     G   G+ +AE  +   +GGRF ID
Sbjct  295   WKPWGRLECWRERGAGAAGDSLGYRFELLIPDPTGMGVGVSVAESNVPTSRGGRFVID  352



>ref|XP_003558723.1| PREDICTED: uncharacterized protein LOC100826176 [Brachypodium 
distachyon]
Length=442

 Score =   340 bits (871),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 213/457 (47%), Positives = 274/457 (60%), Gaps = 62/457 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGV--HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A   AG G   HPST+PCY K++    P QTA  PL   L
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPAAGAGAGVHPSTSPCYCKIRLGKMPCQTANAPLL-LL  59

Query  1393  PKD--DSSSPTDSFASAEGFHLDPSALRRLSEKP---------VALKLSVFAGRMGQTCG  1247
             P D  + + P  S A A  FHL  S L   + KP           LK+SV+AGR G TCG
Sbjct  60    PSDGGEQTPPASSGALAAAFHLSKSDLEWFARKPSLFCPSRGAAVLKVSVYAGRKGTTCG  119

Query  1246  ITSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPM------LHVVVRSEPDPR  1085
             +++G+LLG   V++DL GA+++P V  SGW  +G              L + VR+EPDPR
Sbjct  120   VSTGRLLGKATVSLDLKGAEAKPAVLHSGWISIGKRAGGGKGGNAAAELSLTVRAEPDPR  179

Query  1084  FVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRS--LPSDFSLNSRGWMRTFS  911
             FVF+F GEPECSP V Q++GS++QP+F+CKF    N+  R   +P               
Sbjct  180   FVFEFDGEPECSPQVMQVRGSMKQPMFTCKFGCRTNSDLRRSMVPKT-------------  226

Query  910   GDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPS  731
              +R+  GKERKGW + ++DLSGS VA ASM+TPFV S GSDRVSRSNPGAWLILRP G  
Sbjct  227   -EREAAGKERKGWSVTVHDLSGSPVALASMVTPFVASSGSDRVSRSNPGAWLILRPAGD-  284

Query  730   VSSWKPWGRLEAWRER---GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDN  560
               +W+PWGRLE WRER   GS D LGY+F+L+   G    +PIA+  +   KGG+F +D 
Sbjct  285   -GAWEPWGRLECWRERGGAGSSDSLGYRFDLLV-PGVDHAVPIADSTIAASKGGKFALDL  342

Query  559   ARKHSASS------------------LSPVRGFVMCSSVEGKN--GFLSVQVAVNHVNCM  440
                H  S                   L   RGFVM ++VEG+      +V+V V HV C 
Sbjct  343   TAAHPLSRGGTPGCSPRGSGDLSQWPLGSYRGFVMSAAVEGEGRCSKPTVEVGVAHVGCA  402

Query  439   adaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
              DAA FVAL+AA+DLSMDAC+LFS KLRKE  H   D
Sbjct  403   EDAAAFVALAAAVDLSMDACRLFSHKLRKELSHLRSD  439



>ref|XP_007041415.1| Gb:AAC34331.1 [Theobroma cacao]
 gb|EOX97246.1| Gb:AAC34331.1 [Theobroma cacao]
Length=464

 Score =   338 bits (868),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 212/459 (46%), Positives = 276/459 (60%), Gaps = 56/459 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++ ++A+K P +TKP+   +HPST+ CY K+K  +FP Q A +P   +   
Sbjct  1     MDPCPFVRILVGNLALKFPVSTKPSLSRIHPSTSSCYCKIKLKNFPHQVATIPFIQSQED  60

Query  1387  DDSSSPTDSFAS---AEGFHLDPSALRRLSEK---PVALKLSVFAGRMGQTCGITSGKLL  1226
               +SS + S      A  F L  S + R+  +      L + V+A   G +CG+T GKLL
Sbjct  61    SSTSSSSSSSFQKSLAACFSLSKSQIDRIVSRGSSSYKLSIEVYADPDGSSCGLTYGKLL  120

Query  1225  GVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK----PMLHVVVRSEPDPRFVFQFGGEP  1058
             G V V +DL GA+SRP V  +GW  +G   ++K      L + VR+EPDPRFVFQFGGEP
Sbjct  121   GKVSVPLDLRGAESRPSVVHNGWIAIGRNRSNKNGSSAQLCLTVRTEPDPRFVFQFGGEP  180

Query  1057  ECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSL----NSRGWMRTFSGDRDRPG  890
             ECSP VFQ+QG ++Q VF+CKF   RN   R+L S  SL     +R W+ +   ++++  
Sbjct  181   ECSPQVFQVQGGLKQAVFTCKFGF-RNTSDRNLGSRSSLPESNTTRNWLPSLKTEKEQSS  239

Query  889   KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPW  710
             KERKGW I ++DLSGS VA ASM+TPFVPSPGSDRVSRSNPGAWLILRP      +WKPW
Sbjct  240   KERKGWSITVHDLSGSPVAMASMVTPFVPSPGSDRVSRSNPGAWLILRPG---CGTWKPW  296

Query  709   GRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGA---MNVKKGGRFCIDNARKHSAS  539
             GRLEAWRE G  D LGY+F+L  D    +    A  A   ++ K GG+F +D     +A+
Sbjct  297   GRLEAWREPGFTDALGYRFDLFHDDYIAATSTTATLASSILSTKLGGKFTMDMTTNVAAT  356

Query  538   -----------------------------SLSPVR----GFVMCSSVE--GKNGFLSVQV  464
                                          S+SP      GFVM S+VE  GK     V+V
Sbjct  357   PSTSPQSSCDFGSGSRPGSGSGSDFGFAASISPQSLYRGGFVMSSTVEGAGKCSKPEVEV  416

Query  463   AVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
              V HV C  DAA+FVAL+AA+DLS+DAC+ FS KLRKE 
Sbjct  417   GVQHVTCTEDAAVFVALAAAMDLSVDACRSFSQKLRKEL  455



>gb|KDP37617.1| hypothetical protein JCGZ_06960 [Jatropha curcas]
Length=448

 Score =   338 bits (867),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 203/455 (45%), Positives = 278/455 (61%), Gaps = 64/455 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+R++I ++A+K P  ++        + + CY K+K  +F ++ A +PL +   +
Sbjct  1     MDPCPFIRILIGNLAIKFPYNSR--------TVSSCYCKIKLKNFQTKQATIPLINQNQQ  52

Query  1387  DDSSSPTDSFAS---AEGFHLDPSALRRL--SEKPVALKLSVFAGRMGQTCG-ITSGKLL  1226
               S +P +S  S   A  F+LD   + ++  S+K  +L + +++G  G +CG  + GKLL
Sbjct  53    QRSQNPENSNLSNSLAACFNLDKIQIDKILASKKLKSLNIEIYSGGDGVSCGGWSDGKLL  112

Query  1225  GVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
             G V V++DL  A+SRP V Q+GW  +G    DK  +++ VR+EPDPR+VFQFGGEPECSP
Sbjct  113   GKVTVSLDLKKAESRPCVMQNGWIGIG----DKAEVYLSVRAEPDPRYVFQFGGEPECSP  168

Query  1045  VVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLN---SRGWMRTFSGDRDRPGKERKG  875
              +FQ+QGS+RQ VF+CKFS  RN   R+L    SL    SR W+ +   ++D+  KERKG
Sbjct  169   QIFQVQGSVRQAVFTCKFSF-RNPGDRNLGPRQSLEQSTSRNWLPSLGAEKDQSTKERKG  227

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEA  695
             W I I+DLSGS VA ASM+TPFVPSPGSD+VSRSNPGAWLILR   PS+ +WKPWGRLEA
Sbjct  228   WTITIHDLSGSPVAMASMVTPFVPSPGSDQVSRSNPGAWLILR---PSLGTWKPWGRLEA  284

Query  694   WRERGSVDGLGYKFELVTD--AGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP--  527
             WRE  + + LGY+FEL+ D      +   +A   ++ K GG+F ID     +    SP  
Sbjct  285   WREYPNTNELGYRFELIHDTVTATPTTSTLANSVISTKNGGKFTIDTTNSVTTPVCSPHS  344

Query  526   ---------------------------------VRGFVMCSSVEGKNGFL--SVQVAVNH  452
                                               RGF+M S+V+G N      V++ V H
Sbjct  345   SCDFGSGSGSGSGSGSGSWSGSEFGAGLFSQFMYRGFIMSSTVKGSNNCSKPEVEIGVQH  404

Query  451   VNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             VNC  DAA FVAL+AA+DLS +AC+LFS KLRKE 
Sbjct  405   VNCTEDAAAFVALAAAMDLSTEACRLFSHKLRKEL  439



>ref|XP_004150270.1| PREDICTED: uncharacterized protein LOC101221491 [Cucumis sativus]
Length=454

 Score =   338 bits (867),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 216/460 (47%), Positives = 286/460 (62%), Gaps = 61/460 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLC-----  1403
             MDPCPF+R+++ ++A+K P A +P+   VHPST+PCY K+K + FP+Q   +PL      
Sbjct  1     MDPCPFLRILVGNLALKFPVAARPSFSAVHPSTSPCYCKIKLNDFPTQFVTIPLLVDGET  60

Query  1402  -----SALPKDDSSSPTDSFASAEGFHLDPSALRRL-SEKPVALKLSVFAGRMG-QTCGI  1244
                  ++     SSS     + +  F L+ S + +L   K  ++K+ V+ GR+G  +C  
Sbjct  61    SGAATTSSTSSSSSSTQSHSSISASFSLNKSQIEKLVKRKDPSVKIEVYTGRLGPASCSG  120

Query  1243  ----TSGKLLGVVQVAVDLSG-AQSRPVVFQSGWKKLGGG--GADKPMLHVVVRSEPDPR  1085
                 +S KLLG + V V  SG ++++P VFQ+GW  +G G  G     LH+ VRSEPDPR
Sbjct  121   DVFGSSAKLLGRITVPVTGSGLSETKPCVFQNGWTGIGEGKKGYSSAQLHLTVRSEPDPR  180

Query  1084  FVFQFGGEPECSPVVFQIQGSIRQPVFSCKFS--AERN-NRTRSLPSDFSLNSRGWMRTF  914
             FVF+F GEPECSP VFQ+QGS++QPVF+CKF    ER+ +R+RS  ++ S  S+ W+   
Sbjct  181   FVFRFDGEPECSPQVFQVQGSVQQPVFTCKFGFRNERDWDRSRSSITEQSSTSKSWLPKI  240

Query  913   SGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGP  734
               +RD+  KERKGW I I+DLSGS VAAASM+TPFVPSPGS RVSRSNPGAWLILRP   
Sbjct  241   RSERDQSAKERKGWSITIHDLSGSPVAAASMVTPFVPSPGSHRVSRSNPGAWLILRPVD-  299

Query  733   SVSSWKPWGRLEAWRERGSVDGLGYKFELV--TDAGFTSGIPIAEGAMNVKKGGRFCIDN  560
                SW+PWGRLEAWRE G  D +GY+FEL+  T A  T    +A   ++   GG+F ID 
Sbjct  300   --GSWRPWGRLEAWRESGGSDSIGYRFELLPATSAAAT----LANSTISSGSGGKFTIDM  353

Query  559   ARKHSASSLSP--------------------------VRGFVMCSSVEG---KNGFLSVQ  467
                 S  ++SP                           +GFVM + VEG   K+    V+
Sbjct  354   TGSASP-AISPNGSFDLGSGTGSRPGSGDFGYLTGYQYKGFVMSTMVEGMKKKSRRPEVE  412

Query  466   VAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             VAV HV C  DAA+FVAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  413   VAVQHVTCTEDAAVFVALAAAVDLSMDACRLFSQKLRKEL  452



>ref|NP_001141500.1| uncharacterized protein LOC100273612 [Zea mays]
 gb|ACF86502.1| unknown [Zea mays]
 gb|ACF87818.1| unknown [Zea mays]
Length=437

 Score =   337 bits (864),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 204/454 (45%), Positives = 269/454 (59%), Gaps = 61/454 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSA--TKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A     AG GVHPST+ CY K++    P Q+   PL   +
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPASGAGAGVHPSTSACYCKIRLGKMPVQSVPAPL---V  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKP-----------VALKLSVFAGRMGQTCG  1247
               D       S A A  FHL  + L     KP            +LK+SV+AGR G  CG
Sbjct  58    VTDGGEQTPASGALAAAFHLSKADLEWFDGKPSLFSSRRGAGDASLKVSVYAGRKGSACG  117

Query  1246  ITSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLG-----GGGADKPMLHVVVRSEPDPRF  1082
             ++SG+LLG   V +DL GA+++P V  SGW  +G     G  A    L + VR+EPDPRF
Sbjct  118   VSSGRLLGKATVPLDLKGAEAKPAVLHSGWISIGKRAGKGSPAAAAELCLTVRAEPDPRF  177

Query  1081  VFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDR  902
             VF+F GEPECSP V Q++GS+RQP+F+CKF    N+  R          R  MR     R
Sbjct  178   VFEFDGEPECSPQVLQVRGSMRQPMFTCKFGCRSNSDLR----------RPGMR-----R  222

Query  901   DRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSS  722
             +R  KERKGW + ++DL GS VA ASM+TPFVPSPG+DRVSRSNPGAWLILRP   +  +
Sbjct  223   ERDAKERKGWSVTVHDLKGSPVAMASMVTPFVPSPGTDRVSRSNPGAWLILRPA--ADGA  280

Query  721   WKPWGRLEAWRER---GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARK  551
             W+PW RLE WR+R   G+ D LGY+F+L+      + + +A+ ++   KGG+F ID    
Sbjct  281   WEPWARLECWRDRRGAGASDSLGYRFDLLVPGVDHAAVALADSSIPSSKGGKFAIDLTAA  340

Query  550   HSASS------------------LSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMada  431
                S                   L   RGFVM ++V  EG+    +V+V V HV C  DA
Sbjct  341   QPLSRGGTPGCSPRGSGDLSKWPLGNYRGFVMSAAVQGEGRCSKPTVEVGVAHVGCAEDA  400

Query  430   alfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             A FVAL+AA+DLSMDAC+LFS +LRKE  H + D
Sbjct  401   AAFVALAAAVDLSMDACRLFSHRLRKELSHPQAD  434



>gb|KGN52731.1| hypothetical protein Csa_4G000030 [Cucumis sativus]
Length=458

 Score =   337 bits (863),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 216/464 (47%), Positives = 285/464 (61%), Gaps = 65/464 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLC-----  1403
             MDPCPF+R+++ ++A+K P A +P+   VHPST+PCY K+K + FP+Q   +PL      
Sbjct  1     MDPCPFLRILVGNLALKFPVAARPSFSAVHPSTSPCYCKIKLNDFPTQFVTIPLLVDGET  60

Query  1402  ---------SALPKDDSSSPTDSFASAEGFHLDPSALRRL-SEKPVALKLSVFAGRMG-Q  1256
                      S+     S S     + +  F L+ S + +L   K  ++K+ V+ GR+G  
Sbjct  61    SGAATTSSTSSSSSSSSVSTQSHSSISASFSLNKSQIEKLVKRKDPSVKIEVYTGRLGPA  120

Query  1255  TCGI----TSGKLLGVVQVAVDLSG-AQSRPVVFQSGWKKLGGG--GADKPMLHVVVRSE  1097
             +C      +S KLLG + V V  SG ++++P VFQ+GW  +G G  G     LH+ VRSE
Sbjct  121   SCSGDVFGSSAKLLGRITVPVTGSGLSETKPCVFQNGWTGIGEGKKGYSSAQLHLTVRSE  180

Query  1096  PDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFS--AERN-NRTRSLPSDFSLNSRGW  926
             PDPRFVF+F GEPECSP VFQ+QGS++QPVF+CKF    ER+ +R+RS  ++ S  S+ W
Sbjct  181   PDPRFVFRFDGEPECSPQVFQVQGSVQQPVFTCKFGFRNERDWDRSRSSITEQSSTSKSW  240

Query  925   MRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILR  746
             +     +RD+  KERKGW I I+DLSGS VAAASM+TPFVPSPGS RVSRSNPGAWLILR
Sbjct  241   LPKIRSERDQSAKERKGWSITIHDLSGSPVAAASMVTPFVPSPGSHRVSRSNPGAWLILR  300

Query  745   PNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELV--TDAGFTSGIPIAEGAMNVKKGGRF  572
             P      SW+PWGRLEAWRE G  D +GY+FEL+  T A  T    +A   ++   GG+F
Sbjct  301   PVD---GSWRPWGRLEAWRESGGSDSIGYRFELLPATSAAAT----LANSTISSGSGGKF  353

Query  571   CIDNARKHSASSLSP--------------------------VRGFVMCSSVEG---KNGF  479
              ID     S  ++SP                           +GFVM + VEG   K+  
Sbjct  354   TIDMTGSASP-AISPNGSFDLGSGTGSRPGSGDFGYLTGYQYKGFVMSTMVEGMKKKSRR  412

Query  478   LSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
               V+VAV HV C  DAA+FVAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  413   PEVEVAVQHVTCTEDAAVFVALAAAVDLSMDACRLFSQKLRKEL  456



>ref|XP_011002550.1| PREDICTED: uncharacterized protein LOC105109515 [Populus euphratica]
Length=449

 Score =   336 bits (861),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 203/451 (45%), Positives = 271/451 (60%), Gaps = 54/451 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPC FVR+++ ++A+K P ++KP+   +      C+ K+K  +FP+Q A +PL +   +
Sbjct  1     MDPCSFVRILVGNLALKFPVSSKPSLLSLQ-----CFCKIKLKNFPTQKATIPLVNNQNQ  55

Query  1387  DDSSSPTDSFAS---AEGFHLDPSALRRL--SEKPVALKLSVFAGRMGQTCGITSGKLLG  1223
               + +P  +  S   A  + LD + +      +KP +L++ V++   G TCG+  GKLLG
Sbjct  56    QGNQNPESNSLSNSLAASYSLDKTQIDNFLSRKKPNSLEIEVYSRDNGATCGLKDGKLLG  115

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLG-GGGADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +DL   +SRP V  +GW  +G     +    ++ VR EPD R+VFQFGG+PECSP
Sbjct  116   KVTVPLDLRKTESRPCVMHNGWIDIGENKKGESTQFYLCVRVEPDSRYVFQFGGDPECSP  175

Query  1045  VVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLN----SRGWMRTFSGDRDRPGKERK  878
              VFQ+QGS+RQ VF+CKFS  RN   R+L S  S+     SR W+ +   D+D P KERK
Sbjct  176   QVFQVQGSVRQAVFTCKFSL-RNPGDRNLVSMPSMTEPTPSRNWLLSLGADKDPPAKERK  234

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW III+DLSGS VA ASM+TPFVPSPGSD VSRSNPGAWLIL P   S  +WKPWGRLE
Sbjct  235   GWSIIIHDLSGSPVAMASMVTPFVPSPGSDHVSRSNPGAWLILLP---SHGTWKPWGRLE  291

Query  697   AWRERGSVDGLGYKFELVTDAGFTS--GIPIAEGAMNVKKGGRFCIDNARKHSASSLSP-  527
             AWRER + + LGY+FEL+ D+   S     +    +N K GG+F ID     S  + SP 
Sbjct  292   AWRERNA-NALGYRFELLHDSVSASPTTTTLVNSVINAKNGGKFTIDMTNSVSTPASSPH  350

Query  526   ----------------------------VRGFVMCSSVEGKNGFLS---VQVAVNHVNCM  440
                                          +GFVM S+V   NG  +   V+V V HVNC 
Sbjct  351   SSCDFGSGPGSGSWSGSEFGLGLLSPFVYKGFVMQSTVNNGNGRCNKTEVEVGVQHVNCT  410

Query  439   adaalfvalsaAIDLSMDACQLFSTKLRKEF  347
              DAA FVAL+AA+DLS+DAC+ F+ KLRKE 
Sbjct  411   EDAAAFVALAAAVDLSVDACKSFTHKLRKEL  441



>ref|NP_001143291.1| hypothetical protein [Zea mays]
 gb|ACG30371.1| hypothetical protein [Zea mays]
 tpg|DAA57717.1| TPA: hypothetical protein ZEAMMB73_937139 [Zea mays]
Length=447

 Score =   335 bits (858),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 217/451 (48%), Positives = 285/451 (63%), Gaps = 42/451 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAG-PGVHPSTTPCYAKLKFSSFPS---QTALLPLCS  1400
             MDPC FVR+ ++ + +KLP+  +P+   GV+PS +PC+  L     PS   +TALLPL  
Sbjct  1     MDPCAFVRVTVDQLLLKLPAVPRPSSSAGVYPSNSPCFCTLTLQDHPSSLSRTALLPLAC  60

Query  1399  ALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVA-LKLSVFAGRMGQTCGITSGKLLG  1223
             A     +++  D         LD  A+RRLS +P A L +SV AG  G TCG+ + + LG
Sbjct  61    ASGPAAAAAHADPVV----LSLDADAVRRLSARPAAELVVSVHAGPTGTTCGMGASRALG  116

Query  1222  VVQVAVDLSGAQS-RPVVFQSGWKKLG--GGGADKP-------MLHVVVRSEPDPRFVFQ  1073
              V+VAVD++ A +   VV + GW  +G    G   P        +H+VVR+EPDPR+VFQ
Sbjct  117   RVRVAVDVARAAAGETVVARDGWVDVGKPASGPSAPPRASARAQIHMVVRAEPDPRYVFQ  176

Query  1072  FGGEPECSPVVFQI-----QGSIRQPVFSCKFSA-ERNNRTRSLPSDFSLNSRG------  929
             FGGEPEC PVV+Q+     +G  RQPVF+C+FSA  R  R+RSL    S++         
Sbjct  177   FGGEPECGPVVYQVPGGAARGGQRQPVFTCRFSAGRRAARSRSLTPQSSMSRSTSRRLRS  236

Query  928   WMRTFSGDRDRPG-----KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPG  764
             W+ +      R G     ++RKGW + I+DLSGS VAAASM+TPFVPSPGS RVSR+NPG
Sbjct  237   WLSSTLHGEGRDGAHSRREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPG  296

Query  763   AWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAG-FTSGIPIAEGAMNVK  587
             AWLIL+  G   SSWKPW RLEAWRERG VD LGY+ ELV D+G     +PIAE +++ K
Sbjct  297   AWLILQATGAGPSSWKPWARLEAWRERGPVDALGYRLELVFDSGAHECAVPIAESSISTK  356

Query  586   KGGRFCIDNA---RKHSASSLSPVRGFVMCSSVEG--KNGFLSVQVAVNHVNCMadaalf  422
             +GG+F ID A      + ++     GFVM S+VEG  +    +VQV V HV CM D A+F
Sbjct  357   RGGQFVIDPATFPEAAAGAAWPLAGGFVMGSTVEGERRASRPTVQVGVQHVACMGDVAVF  416

Query  421   valsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             VALSAA+DL MDAC+LFS +LRKE C D+ +
Sbjct  417   VALSAAVDLCMDACRLFSQRLRKELCQDQDE  447



>ref|XP_004156872.1| PREDICTED: uncharacterized LOC101221491 [Cucumis sativus]
Length=458

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 212/462 (46%), Positives = 284/462 (61%), Gaps = 61/462 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLC-----  1403
             MDPCPF+R+++ ++A+K P A +P+   VHPST+PC+ K+K + FP+Q   +PL      
Sbjct  1     MDPCPFLRILVGNLALKFPVAARPSFSAVHPSTSPCFCKIKLNDFPTQFVTIPLLVDGET  60

Query  1402  ---------SALPKDDSSSPTDSFASAEGFHLDPSALRRL-SEKPVALKLSVFAGRMG-Q  1256
                      S+     S S     + +  F L+ S + +L   K  ++K+ V+ GR+G  
Sbjct  61    SGAATTSSTSSSSSSSSVSTQSHSSISASFSLNKSQIEKLVKRKDPSVKIEVYTGRLGPA  120

Query  1255  TCGI----TSGKLLGVVQVAVDLSG-AQSRPVVFQSGWKKLGGG--GADKPMLHVVVRSE  1097
             +C      +S KLLG + V V  SG ++++P VFQ+GW  +G G  G     LH+ VRSE
Sbjct  121   SCSGDVFGSSAKLLGRITVPVTGSGLSETKPCVFQNGWTGIGEGKKGYSSAQLHLTVRSE  180

Query  1096  PDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFS--AERN-NRTRSLPSDFSLNSRGW  926
             PDPRFVF+F GEPECSP VFQ+QGS++QPVF+CKF    ER+ +R+RS  ++ S  S+ W
Sbjct  181   PDPRFVFRFDGEPECSPQVFQVQGSVQQPVFTCKFGFRNERDWDRSRSSITEQSSTSKSW  240

Query  925   MRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILR  746
             +     +RD+  KERKGW I I+DLSGS VAAASM+TPFVPSPGS RVSRSNPGAWLILR
Sbjct  241   LPKIRSERDQSAKERKGWSITIHDLSGSPVAAASMVTPFVPSPGSHRVSRSNPGAWLILR  300

Query  745   PNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCI  566
             P      SW+PWGRLEAWRE G  D +GY+FEL+     ++   +A   ++   GG+F I
Sbjct  301   PVD---GSWRPWGRLEAWRESGGSDSIGYRFELL--PATSAAATLANSTISSGSGGKFTI  355

Query  565   DNARKHSASSLSP--------------------------VRGFVMCSSVEG---KNGFLS  473
             D     S  ++SP                           +GFVM + VEG   K+    
Sbjct  356   DMTGSASP-AISPNGSFDLGSGTGSRPGSGDFGYLTGYQYKGFVMSTMVEGMKKKSRRPE  414

Query  472   VQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             V+VAV HV C  DAA+FVAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  415   VEVAVQHVTCTEDAAVFVALAAAVDLSMDACRLFSQKLRKEL  456



>ref|XP_002313199.1| hypothetical protein POPTR_0009s08730g [Populus trichocarpa]
 gb|EEE87154.1| hypothetical protein POPTR_0009s08730g [Populus trichocarpa]
Length=449

 Score =   334 bits (856),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 203/451 (45%), Positives = 270/451 (60%), Gaps = 54/451 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPC FVR+++ S+A+K P ++KP+   +      C+ K+K  +FP+Q A +PL +   +
Sbjct  1     MDPCSFVRILVGSLALKFPVSSKPSLLSLQ-----CFCKIKLKNFPTQKATIPLVNNQNQ  55

Query  1387  DDSSSPTDSFAS---AEGFHLDPSALRRL--SEKPVALKLSVFAGRMGQTCGITSGKLLG  1223
               + +P  +  S   A  + LD + +      +KP +L++ V++   G TCG+  GKLLG
Sbjct  56    QGNHNPESNSLSNSLAACYSLDKTQIDNFLSRKKPKSLEIEVYSRDNGATCGLKDGKLLG  115

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLG-GGGADKPMLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +DL   +SRP V  +GW  +G     +    ++ VR EPD R+VFQFGG+PECSP
Sbjct  116   KVTVPLDLRKTESRPCVMHNGWIDIGENKKGESTQFYLCVRVEPDSRYVFQFGGDPECSP  175

Query  1045  VVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLN----SRGWMRTFSGDRDRPGKERK  878
              VFQ+QGS+RQ VF+CKFS  RN   R+L S  S+     SR W+ +   D+D P KERK
Sbjct  176   QVFQVQGSVRQAVFTCKFSL-RNPGDRNLVSMPSMTEPTPSRNWLPSLGADKDPPAKERK  234

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I I+DLSGS VA ASM+TPFVPSPGSD VSRSNPGAWLIL P   S  +WKPWGRLE
Sbjct  235   GWSITIHDLSGSPVAMASMVTPFVPSPGSDHVSRSNPGAWLILLP---SHGTWKPWGRLE  291

Query  697   AWRERGSVDGLGYKFELVTDAGFTS--GIPIAEGAMNVKKGGRFCIDNARKHSASSLSP-  527
             AWRER + + LGY+FEL+ D+   S     +    +N K GG+F ID     S  + SP 
Sbjct  292   AWRERNA-NALGYRFELLHDSVSASPTTTTLVNSVINAKNGGKFTIDMTNSVSTPASSPH  350

Query  526   ----------------------------VRGFVMCSSVEGKNGFLS---VQVAVNHVNCM  440
                                          +GFVM SSV   NG  +   V++ V HVNC 
Sbjct  351   SSCDFGSGPGSGSWSGSEFGLGLLSPFVYKGFVMQSSVNNGNGRCNKTEVEIGVQHVNCT  410

Query  439   adaalfvalsaAIDLSMDACQLFSTKLRKEF  347
              DAA FVAL+AA+DLS+DAC+ F+ KLRKE 
Sbjct  411   EDAAAFVALAAAVDLSVDACKSFTHKLRKEL  441



>ref|XP_002298796.1| hypothetical protein POPTR_0001s29590g [Populus trichocarpa]
 gb|EEE83601.1| hypothetical protein POPTR_0001s29590g [Populus trichocarpa]
Length=447

 Score =   332 bits (850),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 200/449 (45%), Positives = 267/449 (59%), Gaps = 52/449 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++ ++A+K P ++KP+   V      C+ K+K  +FP+Q A +PL +   +
Sbjct  1     MDPCPFVRILVGNLALKFPVSSKPSLLSVQ-----CFCKIKLKNFPTQKATIPLVNNKKQ  55

Query  1387  DDSSSPTD---SFASAEGFHLDPSALRRL--SEKPVALKLSVFAGRMGQTCGITSGKLLG  1223
              ++  P     S + A  + LD + +  L   +KP  L++ V+    G TCG+  GK+LG
Sbjct  56    QENQKPEGNPLSSSLAACYSLDKTQIDDLLSCKKPKNLEIEVYIRDNGVTCGLKDGKMLG  115

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP-MLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +++  ++SRP V  + W  +G     +P   +  VR EPDPR+ FQFGG+PECSP
Sbjct  116   RVTVPLEMRKSESRPCVMHNEWIDIGENKKGEPTQFYFCVRVEPDPRYAFQFGGDPECSP  175

Query  1045  VVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLN----SRGWMRTFSGDRDRPGKERK  878
              VFQ+QGS+RQ VF+CKFS  RN   R+L S  S+     SR W+ +   D+D   KERK
Sbjct  176   QVFQVQGSVRQAVFTCKFSL-RNPGDRNLVSMPSMTEPAPSRNWLPSLEADKDPSAKERK  234

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I I+DLSGS VA ASM+TPFVPSPGS+ VSRSNPGAWLIL P   +  +WKPWGRLE
Sbjct  235   GWSITIHDLSGSPVAMASMVTPFVPSPGSNHVSRSNPGAWLILHP---AQGTWKPWGRLE  291

Query  697   AWRERGSVDGLGYKFELVTDAGFTS--GIPIAEGAMNVKKGGRFCIDNARKHSASSLSP-  527
             AWRER + + LGY FEL+ D+   S    P+    +N K GG+F ID     S    SP 
Sbjct  292   AWRERNA-NALGYHFELLHDSVSASPTTTPLVNCVINAKNGGKFTIDTTNSVSTPVSSPH  350

Query  526   --------------------------VRGFVMCSSVEGKNGFLS---VQVAVNHVNCMad  434
                                        +GFVM SSV   N   S   V++ V HVNC  D
Sbjct  351   SSCDFGSGPGSGSWSGSEFGLFSPFVYKGFVMQSSVNNGNDQSSKPEVEIGVQHVNCTED  410

Query  433   aalfvalsaAIDLSMDACQLFSTKLRKEF  347
             AA FVAL+AA+DLS+DAC+ F+ KLRKE 
Sbjct  411   AAAFVALAAAVDLSVDACKSFTRKLRKEL  439



>gb|EAY92004.1| hypothetical protein OsI_13693 [Oryza sativa Indica Group]
Length=444

 Score =   326 bits (836),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 212/458 (46%), Positives = 268/458 (59%), Gaps = 62/458 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGV--HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A   AG G   HPST PCY K++    P Q A  PL  A 
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPAAGAGAGVHPSTAPCYCKIRLGRMPWQVAAAPLVVA-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKP-------------VALKLSVFAGRMGQT  1253
                D      S A A  FHL  + L   + KP               LK++V+AGR G T
Sbjct  60    ---DGGEQAPSGALAAAFHLSKADLEWFARKPSLLFSSSSSSRGPATLKVAVYAGRKGTT  116

Query  1252  CGITSGKLLGVVQVAVDLSGAQSRPVVFQSGW-----KKLGGGGADKPMLHVVVRSEPDP  1088
             CG++SG+L+G   + VDL GA+++  V  SGW     K  G GG+    L + VR+EPDP
Sbjct  117   CGVSSGRLIGKATIPVDLKGAEAKAAVVHSGWICVGKKSGGKGGSAAAELSLTVRAEPDP  176

Query  1087  RFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSG  908
             RFVF+F GEPECSP V Q++GS++QP+F+CKF    N+  R          R  ++T   
Sbjct  177   RFVFEFDGEPECSPQVLQVRGSMKQPMFTCKFGCRSNSDLR----------RSVVQTERD  226

Query  907   DRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSV  728
                  GKERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWLILRP G   
Sbjct  227   AAAAAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRPAGD--  284

Query  727   SSWKPWGRLEAWRERGSV---DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNA  557
              SW+PWGRLE WRERG     D LGY+F+L+   G    +P+AE ++   KGG+F ID  
Sbjct  285   GSWEPWGRLECWRERGGAGASDSLGYRFDLLL-PGVDHAVPLAESSIAASKGGKFAIDLT  343

Query  556   RKHSAS--------------------SLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNC  443
                  S                    S    RGFVM SSV  EG+    +V+V V HV C
Sbjct  344   SMQPQSRGGTPGCSPRGSGDFSQWPLSSYSYRGFVMSSSVQGEGRCSKPTVEVGVPHVGC  403

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
               DAA FVAL+AA+DLSMDAC+LFS KLRKE  H   D
Sbjct  404   AEDAAAFVALAAAVDLSMDACRLFSHKLRKELSHLRSD  441



>gb|EAZ28736.1| hypothetical protein OsJ_12756 [Oryza sativa Japonica Group]
Length=444

 Score =   326 bits (836),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 213/458 (47%), Positives = 269/458 (59%), Gaps = 62/458 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGV--HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A   AG G   HPST PCY K++    P Q A  PL  A 
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPAAGAGAGVHPSTAPCYCKIRLGRMPWQVAAAPLVVA-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKP-------------VALKLSVFAGRMGQT  1253
                D      S A A  FHL  + L   + KP               LK++V+AGR G T
Sbjct  60    ---DGGEQAPSGALAAAFHLSKADLEWFARKPSLLFSSSSSSRGPATLKVAVYAGRKGTT  116

Query  1252  CGITSGKLLGVVQVAVDLSGAQSRPVVFQSGW-----KKLGGGGADKPMLHVVVRSEPDP  1088
             CG++SG+L+G   + VDL GA+++  V  SGW     K  G GG+    L + VR+EPDP
Sbjct  117   CGVSSGRLIGKATIPVDLKGAEAKAAVVHSGWICVGKKSGGKGGSAAAELSLTVRAEPDP  176

Query  1087  RFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSG  908
             RFVF+F GEPECSP V Q++GS++QP+F+CKF    N+  R          R  ++T   
Sbjct  177   RFVFEFDGEPECSPQVLQVRGSMKQPMFTCKFGCRSNSDLR----------RSVVQTERD  226

Query  907   DRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSV  728
                  GKERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWLILRP G   
Sbjct  227   AAAAAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRPAGD--  284

Query  727   SSWKPWGRLEAWRERGSV---DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNA  557
              SW+PWGRLE WRERG     D LGY+F+L+   G    +P+AE ++   KGG+F ID  
Sbjct  285   GSWEPWGRLECWRERGGAGASDSLGYRFDLLL-PGVDHAVPLAESSIAASKGGKFAIDLT  343

Query  556   RKHSAS-----SLSP---------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNC  443
                  S       SP                RGFVM SSV  EG+    +V+V V HV C
Sbjct  344   SMQPQSRGGTPGCSPRGSGDFSQWPLASYSYRGFVMSSSVQGEGRCSKPTVEVGVPHVGC  403

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
               DAA FVAL+AA+DLSMDAC+LFS KLRKE  H   D
Sbjct  404   AEDAAAFVALAAAVDLSMDACRLFSHKLRKELSHLRSD  441



>gb|AET05166.2| DUF1005 family protein [Medicago truncatula]
Length=364

 Score =   323 bits (828),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 197/355 (55%), Positives = 230/355 (65%), Gaps = 27/355 (8%)
 Frame = -2

Query  1363  SFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVAVDLSGAQS  1184
             S  SA  FHLD +AL RLS K + L + V+ G +G+ CG+ + KLLG V + + L  + S
Sbjct  29    STTSAPAFHLDYAALHRLSGKLLTLSIFVYNGPIGRNCGVRNAKLLGRVLLPIQLPTSFS  88

Query  1183  RPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQP  1010
              P  F +GW KL     DKP  +LHV+VRSEPD RFVF FGGEPECSPV+FQIQ +I+QP
Sbjct  89    SPNTFHNGWFKLNHEMDDKPSHLLHVMVRSEPDSRFVFHFGGEPECSPVIFQIQENIKQP  148

Query  1009  VFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAA  830
             +FSCKFS +RN +  S P      +    R       RP             L GS VAA
Sbjct  149   IFSCKFSVDRNYKPHSQPLSSDSTNNNSSRW-----RRP-------------LRGSPVAA  190

Query  829   ASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSV---SSWKPWGRLEAWRERGSVDGLGY  659
             ASMITPFVPSP SDRVSRSN GAW+ILR  G S     SWK WG LEAWRERG +DGLGY
Sbjct  191   ASMITPFVPSPSSDRVSRSNAGAWVILRAIGGSTVSSCSWKSWGHLEAWRERGPIDGLGY  250

Query  658   KFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPVRGFVMCSSV--EGKN  485
             K EL +D G  + IPIAEG ++VKKGG+FCID+A     S   P  GFVM S+V  EGK 
Sbjct  251   KVELFSDNGPVNAIPIAEGTVSVKKGGKFCIDSAIL--GSKWLPGEGFVMGSTVSGEGKV  308

Query  484   GFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDSYF  320
                 VQV V HV CM DAALF+ALSAAIDLSMDAC+ FS KLRKE C D+    F
Sbjct  309   SKPVVQVGVRHVTCMPDAALFIALSAAIDLSMDACKFFSHKLRKELCPDQQYYSF  363



>gb|ACF82838.1| unknown [Zea mays]
Length=435

 Score =   325 bits (833),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 204/451 (45%), Positives = 268/451 (59%), Gaps = 57/451 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGV--HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A   AG G   HPST+PCY K++    P Q+   PL   +
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPAAGAGAGVHPSTSPCYCKIRLGKMPVQSVPAPL---V  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKP--------VALKLSVFAGRMGQTCGITS  1238
               D       S A A  FHL  + L   + KP         +LK+SV+AGR G  CG++S
Sbjct  58    VSDGGEQTPASGALAAAFHLSKADLEWFNGKPSLFSSRGEASLKVSVYAGRKGSACGVSS  117

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGW----KKLGGGGADKPMLHVVVRSEPDPRFVFQF  1070
             G+LLG   +A+DL GA+++P V  SGW    K+ G G      L + VR+EPDPRFVF+F
Sbjct  118   GRLLGKATIALDLKGAEAKPAVLHSGWISIGKRSGKGSTAATELSLTVRAEPDPRFVFEF  177

Query  1069  GGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP-  893
              GEPECSP V Q++GS++QP+F+CKF    N+  R          R  M+    +RD   
Sbjct  178   DGEPECSPQVLQVRGSMKQPMFTCKFGCRSNSDLR----------RPGMQP---ERDAAS  224

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              KERKGW + ++DL GS+VA ASM+TPFVPSPG+DRVSRSNPGAWLILRP G    SW+P
Sbjct  225   AKERKGWSVTVHDLKGSAVAMASMVTPFVPSPGTDRVSRSNPGAWLILRPAGD--GSWEP  282

Query  712   WGRLEAWRERGSV---DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA  542
             W RLE WRERG     D LGY F L+   G    + +A+ ++    GG+F ID       
Sbjct  283   WARLECWRERGGAGASDSLGYHFALLV-PGADHAVALADSSIPSSNGGKFAIDLTAAQPL  341

Query  541   SS------------------LSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalf  422
             S                   L   RGFVM ++V  EG+    +V+V V H+ C  DAA F
Sbjct  342   SRGGTPGCSPRGSGDLSNWPLGNYRGFVMSAAVQGEGRCSKPTVEVGVAHIGCAEDAAAF  401

Query  421   valsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             VAL+AA+DLSMDAC+LFS +LRKE  H + D
Sbjct  402   VALAAAVDLSMDACRLFSHRLRKELSHLQAD  432



>ref|XP_011030280.1| PREDICTED: uncharacterized protein LOC105129770 [Populus euphratica]
Length=443

 Score =   325 bits (832),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 196/445 (44%), Positives = 266/445 (60%), Gaps = 48/445 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++ ++A+K P ++KP+   V      C+ K+K  +FP+Q A +PL +   +
Sbjct  1     MDPCPFVRILVGNLALKFPVSSKPSMLSVQ-----CFCKIKLKNFPTQKATIPLVNNKKQ  55

Query  1387  DDSSSPTD---SFASAEGFHLDPSALRRL--SEKPVALKLSVFAGRMGQTCGITSGKLLG  1223
             +++  P     S + A  + LD + +  L   +KP  L++ V+    G TCG+  GK+LG
Sbjct  56    EENQKPEGNPLSSSLAACYSLDKTQIDELLSCKKPKNLEIEVYLRDNGVTCGLKDGKMLG  115

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP-MLHVVVRSEPDPRFVFQFGGEPECSP  1046
              V V +D+  ++SRP V  + W  +G     +P   ++ V+ EPDPR+ FQFGG+P CSP
Sbjct  116   RVTVPLDMRKSESRPCVMHNEWIDIGENKKGEPTQFYLCVKVEPDPRYAFQFGGDPGCSP  175

Query  1045  VVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLN----SRGWMRTFSGDRDRPGKERK  878
              VFQ+QGS+R+ VF+CKFS  RN   R+L S  S+     SR W+ +   D+    KERK
Sbjct  176   QVFQVQGSVREAVFTCKFSL-RNPGDRNLVSMPSMTEPAPSRNWLPSLEADKGPSAKERK  234

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I I+DLSGS VA ASM+TPFVPSPGS+ VSRSNPGAWLIL    P+  +WKPWGRLE
Sbjct  235   GWSITIHDLSGSPVAMASMVTPFVPSPGSNHVSRSNPGAWLILH---PAQGTWKPWGRLE  291

Query  697   AWRERGSVDGLGYKFELVTDAGFTS--GIPIAEGAMNVKKGGRFCIDNARKHSASSLSP-  527
             AWRER + + LGY FEL+ D+   S     +    +N K GG+F ID     S    SP 
Sbjct  292   AWRERNA-NALGYHFELLHDSVSASPTTTTLVNCVINAKNGGKFTIDMTNSVSTPVSSPH  350

Query  526   ----------------------VRGFVMCSSVEGKN---GFLSVQVAVNHVNCMadaalf  422
                                    +GFVM SSV   N   G   V++ V HVNC  DAA F
Sbjct  351   SSCDFGSGSWSGSEFGLLSPFVYKGFVMQSSVNNGNDQSGKPEVEIGVQHVNCTEDAAAF  410

Query  421   valsaAIDLSMDACQLFSTKLRKEF  347
             VAL+AA+DLS+DAC+ F+ KLRKE 
Sbjct  411   VALAAAVDLSVDACKSFTRKLRKEL  435



>ref|XP_004981601.1| PREDICTED: uncharacterized protein LOC101765126 [Setaria italica]
Length=435

 Score =   324 bits (831),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 205/450 (46%), Positives = 269/450 (60%), Gaps = 55/450 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGV--HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A   AG G   HPST+PC+ K++    P+Q    PL    
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPAAGAGAGVHPSTSPCHCKIRLGKMPAQLVPAPLA---  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKP--------VALKLSVFAGRMGQTCGITS  1238
             P D       S A A  FHL  + L   + KP          LK++V+AGR G TCG++S
Sbjct  58    PFDGGEQAPASGALAAAFHLSKADLEWFNGKPSLFSSRGEACLKVAVYAGRKGSTCGVSS  117

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGG-GGADKPM---LHVVVRSEPDPRFVFQF  1070
             G+LLG   + +DL GA+++P V  SGW  +G  GG   P    L + VR+EPDPRFVF+F
Sbjct  118   GRLLGKATIPLDLKGAEAKPAVLHSGWISIGKRGGKGSPAAAELSLTVRAEPDPRFVFEF  177

Query  1069  GGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPG  890
              GEPECSP V Q++GS++QP+F+CKF    N+          L   G      G     G
Sbjct  178   DGEPECSPQVLQVRGSMKQPMFTCKFGCRSNS---------DLRRPGMQPEREGAS---G  225

Query  889   KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPW  710
             KERKGW + ++DLSGS VA ASM+TPFVPSPG+DRVSRSNPGAWLILRP G    +W+PW
Sbjct  226   KERKGWSVTVHDLSGSPVAMASMVTPFVPSPGTDRVSRSNPGAWLILRPAGD--GAWEPW  283

Query  709   GRLEAWRERGSV---DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSAS  539
              RLE WRERG     D LGY+F+L+   G    +P+A+ ++   KGG+F ID       S
Sbjct  284   ARLECWRERGGAGASDSLGYRFDLLL-PGVDHAVPLADSSIPSSKGGKFAIDLTAAQPLS  342

Query  538   S------------------LSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfv  419
                                L   RGFVM ++V  EG+    +V+V V H+ C  DAA FV
Sbjct  343   RGGTPGCSPRGSGDFSNWPLGNYRGFVMSAAVQGEGRCSKPTVEVGVAHIGCAEDAAAFV  402

Query  418   alsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             AL+AA+DLSMDAC+LFS +LRKE  H + D
Sbjct  403   ALAAAVDLSMDACRLFSHRLRKELSHPQAD  432



>tpg|DAA51652.1| TPA: hypothetical protein ZEAMMB73_809833 [Zea mays]
Length=435

 Score =   324 bits (830),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 203/451 (45%), Positives = 268/451 (59%), Gaps = 57/451 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGV--HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A   AG G   HPST+PCY K++    P Q+   PL   +
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPAAGAGAGVHPSTSPCYCKIRLGKMPVQSVPAPL---V  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKP--------VALKLSVFAGRMGQTCGITS  1238
               D       S A A  FHL  + L   + KP         +LK+SV+AGR G  CG++S
Sbjct  58    VSDGGEQTPASGALAAAFHLSKADLEWFNGKPSLFSSRGEASLKVSVYAGRKGSACGVSS  117

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGW----KKLGGGGADKPMLHVVVRSEPDPRFVFQF  1070
             G+LLG   +A+DL GA+++P V  SGW    K+ G G      L + VR+EPDPRFVF+F
Sbjct  118   GRLLGKATIALDLKGAEAKPAVLHSGWISIGKRSGKGSTAATELSLTVRAEPDPRFVFEF  177

Query  1069  GGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP-  893
              GEPECSP V Q++GS++QP+F+CKF    N+  R          R  M+    +RD   
Sbjct  178   DGEPECSPQVLQVRGSMKQPMFTCKFGCRSNSDLR----------RPGMQP---ERDAAS  224

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              KERKGW + ++DL GS+VA ASM+TPFVPSPG+DRVSRSNPGAWLILRP G    +W+P
Sbjct  225   AKERKGWSVTVHDLKGSAVAMASMVTPFVPSPGTDRVSRSNPGAWLILRPAGD--GAWEP  282

Query  712   WGRLEAWRERGSV---DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA  542
             W RLE WRERG     D LGY F L+   G    + +A+ ++    GG+F ID       
Sbjct  283   WARLECWRERGGAGASDSLGYHFALLV-PGADHAVALADSSIPSSNGGKFVIDLTAAQPL  341

Query  541   SS------------------LSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalf  422
             S                   L   RGFVM ++V  EG+    +V+V V H+ C  DAA F
Sbjct  342   SRGGTPGCSPRGSGDLSNWPLGNYRGFVMSAAVQGEGRCSKPTVEVGVAHIGCAEDAAAF  401

Query  421   valsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             VAL+AA+DLSMDAC+LFS +LRKE  H + D
Sbjct  402   VALAAAVDLSMDACRLFSHRLRKELSHLQAD  432



>ref|NP_001051414.1| Os03g0773000 [Oryza sativa Japonica Group]
 gb|AAP68895.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99103.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13328.1| Os03g0773000 [Oryza sativa Japonica Group]
Length=444

 Score =   324 bits (831),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 212/458 (46%), Positives = 269/458 (59%), Gaps = 62/458 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGV--HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A   AG G   HPST PCY K++    P Q A  PL  A 
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPAAGAGAGVHPSTAPCYCKIRLGRMPWQVAAAPLVVA-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKP-------------VALKLSVFAGRMGQT  1253
                D      S A A  FHL  + L   + KP               LK++V+AGR G T
Sbjct  60    ---DGGEQAPSGALAAAFHLSKADLEWFARKPSLLFSSSSSSRGPATLKVAVYAGRKGTT  116

Query  1252  CGITSGKLLGVVQVAVDLSGAQSRPVVFQSGW-----KKLGGGGADKPMLHVVVRSEPDP  1088
             CG++SG+L+G   + VDL GA+++  V  SGW     K  G GG+    L + VR+EPDP
Sbjct  117   CGVSSGRLIGKATIPVDLKGAEAKAAVVHSGWICVGKKSGGKGGSAAAELSLTVRAEPDP  176

Query  1087  RFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSG  908
             RFVF+F GEPECSP V Q++GS++QP+F+CKF    N+  R          R  ++T   
Sbjct  177   RFVFEFDGEPECSPQVLQVRGSMKQPMFTCKFGCRSNSDLR----------RSVVQTERD  226

Query  907   DRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSV  728
                  GKERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWLILRP G   
Sbjct  227   AAAAAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRPAGD--  284

Query  727   SSWKPWGRLEAWRERGSV---DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNA  557
              SW+PWGRLE WRERG     + LGY+F+L+   G    +P+AE ++   KGG+F ID  
Sbjct  285   GSWEPWGRLECWRERGGAGASNSLGYRFDLLL-PGVDHAVPLAESSIAASKGGKFAIDLT  343

Query  556   RKHSAS-----SLSP---------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNC  443
                  S       SP                RGFVM SSV  EG+    +V+V V HV C
Sbjct  344   SMQPQSRGGTPGCSPRGSGDFSQWPLASYSYRGFVMSSSVQGEGRCSKPTVEVGVPHVGC  403

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
               DAA FVAL+AA+DLSMDAC+LFS KLRKE  H   D
Sbjct  404   AEDAAAFVALAAAVDLSMDACRLFSHKLRKELSHLRSD  441



>ref|XP_002461423.1| hypothetical protein SORBIDRAFT_02g002380 [Sorghum bicolor]
 gb|EER97944.1| hypothetical protein SORBIDRAFT_02g002380 [Sorghum bicolor]
Length=470

 Score =   325 bits (832),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 212/469 (45%), Positives = 282/469 (60%), Gaps = 70/469 (15%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKP------AGPGVHPSTTPCYAKLKFSSFPSQTALLPL  1406
             MDPCPFVR+++ ++A+K+P++T        +G GVHP+T PCY +++ +  P QTA  PL
Sbjct  1     MDPCPFVRVLVGNLALKMPASTTAPRSTAASGSGVHPTTAPCYCRIRLNKLPYQTASAPL  60

Query  1405  CSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVAL------------KLSVFAGRM  1262
                LP  +    + + A A  FH+  + L R + KP  L            K++V+AGR 
Sbjct  61    ---LPPTEEGPASCTGAFAAAFHVSKADLDRAAAKPALLLGARLRRRTARLKVAVYAGRG  117

Query  1261  GQTCGITSGK------LLGVVQVAVDLSGAQSRPVVFQSGWKKLG-------GGGADKPM  1121
             G       G       L+G + V +DL  A ++PVVF SGW  +G       G  A +  
Sbjct  118   GGASCGGGGGGVNSGRLIGKLVVPLDLGAAMAKPVVFHSGWVAIGKRRSGGRGKTAARAQ  177

Query  1120  LHVVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN--RTRSLPSD-  950
             L++ VR+EPDPRFVF+F GEPECSP V Q++GS++QP+F+CKFS   N+  R+RS+ SD 
Sbjct  178   LNLTVRAEPDPRFVFEFDGEPECSPQVLQVKGSMKQPMFTCKFSCRSNSDLRSRSVQSDP  237

Query  949   FSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSN  770
              +   R W+  F  DR+R GKERKGW + ++DLSGS VA ASM+TPFV S G+DRVSRSN
Sbjct  238   GTAGPRNWLAKFGSDRERAGKERKGWSVTVHDLSGSPVALASMVTPFVASRGTDRVSRSN  297

Query  769   PGAWLILRPNGPSVSSWKPWGRLEAWRER----GSVDGLGYKFELVTDAGFT-SGIPIAE  605
             PG WLILRP      +W PWGRLE WRER    G  D LGY+FELV   G T +G+ +AE
Sbjct  298   PGGWLILRPVD---GTWTPWGRLECWRERSGSGGGGDTLGYRFELVP--GHTNAGVCVAE  352

Query  604   GAMNVKKGGRFCID--NARKHSASSLSP-------------------VRGFVMCSSV--E  494
               +   +GGRF ID   A+   +   SP                    RGFVM ++V  E
Sbjct  353   SGLPASRGGRFAIDLTAAQPFGSPGCSPRGSGDLGHYHGGGVWPFGTFRGFVMSAAVQGE  412

Query  493   GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             G+    +V+V V HV C  DAA FVAL+AA+DLSMDAC+LFS KLR+E 
Sbjct  413   GRCSRPTVEVGVGHVGCAEDAAAFVALAAAVDLSMDACRLFSCKLRREL  461



>ref|XP_002980096.1| hypothetical protein SELMODRAFT_111932 [Selaginella moellendorffii]
 gb|EFJ18966.1| hypothetical protein SELMODRAFT_111932 [Selaginella moellendorffii]
Length=435

 Score =   323 bits (827),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 199/451 (44%), Positives = 262/451 (58%), Gaps = 54/451 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDP  FV++ I ++ +++P A+K A  GVH S+ PCY ++    FP QTA +PL +A   
Sbjct  1     MDPQAFVKVSIAALGLRIPIASKAARVGVHASSIPCYCEISLPGFPVQTAPVPLITA---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRL--------SEKPV-ALKLSVFAGRMGQTCGITSG  1235
               ++   DS   A  F+LD S+LR+L        S K    LK+ VF GR G  CG+  G
Sbjct  58    --TAPEPDSRNVAAVFYLDHSSLRKLLAVQCCLGSRKAAPCLKVVVFTGRQGSCCGVREG  115

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGG-GGADKPMLHVVVRSEPDPRFVFQFGGEP  1058
               LG   +AVD       P+     W  +G  GG+     H+  R E DPRFVFQF G+ 
Sbjct  116   SFLGKFSIAVDSEWLSGNPLQLYDSWASIGKKGGSPGAEFHLNARIEADPRFVFQFDGDT  175

Query  1057  ECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
                P + QIQGS+RQP+FSCKFS +RN   +S           W    +GDR+R  KERK
Sbjct  176   ASGPQIIQIQGSLRQPIFSCKFSRDRNTPAKS-----------WSTPLTGDRERERKERK  224

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW+++I+DLSGS VAAAS++TPFVPS GSD VSRSNPGAWLILRP+   V SW+PWGRLE
Sbjct  225   GWLVMIHDLSGSPVAAASIVTPFVPSSGSDYVSRSNPGAWLILRPDSTGVDSWEPWGRLE  284

Query  697   AWRERGSVDGLGYKFELVTDAG----FTSGIPIAEGAMNVKKGGRFCIDNARKHSASS--  536
             AWRE+G   GLG +F+LV + G      SGI ++E  ++ + GG F ID  R    ++  
Sbjct  285   AWREKGGKGGLGLRFQLVAEGGGITSVGSGILVSETVISTQSGGEFSIDTVRLRVEAASS  344

Query  535   ------------------LSPVRGFVMCSSVEGK----NGFLSVQVAVNHVNCMadaalf  422
                                    GFVM   V G+    N    +Q+AV HV C+ DAA+F
Sbjct  345   SSSTESPHSSGDGFLGLGFQVAGGFVMSCPVHGERNKTNKGRCIQMAVRHVTCVEDAAVF  404

Query  421   valsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             +AL+AA DLSMDACQ FS KLR+E C+ + +
Sbjct  405   MALAAAADLSMDACQPFSRKLRRELCYQQGE  435



>ref|XP_002992680.1| hypothetical protein SELMODRAFT_135747 [Selaginella moellendorffii]
 gb|EFJ06265.1| hypothetical protein SELMODRAFT_135747 [Selaginella moellendorffii]
Length=435

 Score =   322 bits (824),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 198/451 (44%), Positives = 262/451 (58%), Gaps = 54/451 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDP  FV++ I ++ +++P A+K A  GVH S+ PCY ++    FP QTA +PL +A   
Sbjct  1     MDPQAFVKVSIAALGLRIPIASKAARVGVHSSSIPCYCEISLPGFPVQTAPVPLITA---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRL--------SEKPV-ALKLSVFAGRMGQTCGITSG  1235
               ++   DS   A  F+LD S+LR+L        S K    LK+ VF GR G  CG+  G
Sbjct  58    --TAPEPDSRNVAAVFYLDHSSLRKLLAVHCCLGSRKAAPCLKVVVFTGRQGSCCGVREG  115

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGG-GGADKPMLHVVVRSEPDPRFVFQFGGEP  1058
               LG   + VD       P+     W  +G  GG+     H+  R E DPRFVFQF G+ 
Sbjct  116   SFLGKFSIPVDSEWLSGNPLQLYDSWASIGKKGGSPGAEFHLNARIEADPRFVFQFDGDT  175

Query  1057  ECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
                P + QIQGS+RQP+FSCKFS +RN   +S           W  + +GDR+R  KERK
Sbjct  176   ASGPQIIQIQGSLRQPIFSCKFSRDRNTPAKS-----------WSTSLTGDRERERKERK  224

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW+++I+DLSGS VAAAS++TPFVPS GSD VSRSNPGAWLILRP+   V SW+PWGRLE
Sbjct  225   GWLVMIHDLSGSPVAAASIVTPFVPSSGSDYVSRSNPGAWLILRPDSTGVDSWEPWGRLE  284

Query  697   AWRERGSVDGLGYKFELVTDAG----FTSGIPIAEGAMNVKKGGRFCIDNARKHSASS--  536
             AWRE+G   GLG +F+LV + G      SGI ++E  ++ + GG F ID  R    ++  
Sbjct  285   AWREKGGKGGLGLRFQLVAEGGGITSVGSGILVSETVISTQSGGEFSIDTVRLRVEAASS  344

Query  535   ------------------LSPVRGFVMCSSVEGK----NGFLSVQVAVNHVNCMadaalf  422
                                    GFVM   V G+    N    +Q+AV HV C+ DAA+F
Sbjct  345   SSSTESPHSSGDGFLGLGFQVAGGFVMSCPVHGERNKTNKGRCIQMAVRHVTCVEDAAVF  404

Query  421   valsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             +AL+AA DLSMDACQ FS KLR+E C+ + +
Sbjct  405   MALAAAADLSMDACQPFSRKLRRELCYQQGE  435



>gb|ACG44256.1| hypothetical protein [Zea mays]
Length=435

 Score =   321 bits (823),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 202/451 (45%), Positives = 267/451 (59%), Gaps = 57/451 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGV--HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A   AG G   HPST+PCY K++    P Q+   PL   +
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPAAGAGAGVHPSTSPCYCKIRLGKMPVQSVPAPL---V  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEK--------PVALKLSVFAGRMGQTCGITS  1238
               D       S A A  FHL  + L   + K          +LK+SV+AGR G  CG++S
Sbjct  58    VSDGGEQTPASGALAAAFHLSKADLEWFNGKXSLFSSRGEASLKVSVYAGRKGSACGVSS  117

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGW----KKLGGGGADKPMLHVVVRSEPDPRFVFQF  1070
             G+LLG   +A+DL GA+++P V  SGW    K+ G G      L + VR+EPDPRFVF+F
Sbjct  118   GRLLGKATIALDLKGAEAKPAVLHSGWISIGKRSGKGSTAATELSLTVRAEPDPRFVFEF  177

Query  1069  GGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP-  893
              GEPECSP V Q++GS++QP+F+CKF    N+  R          R  M+    +RD   
Sbjct  178   DGEPECSPQVLQVRGSMKQPMFTCKFGCRSNSDLR----------RPGMQP---ERDAAS  224

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              KERKGW + ++DL GS+VA ASM+TPFVPSPG+DRVSRSNPGAWLILRP G    +W+P
Sbjct  225   AKERKGWSVTVHDLKGSAVAMASMVTPFVPSPGTDRVSRSNPGAWLILRPAGD--GAWEP  282

Query  712   WGRLEAWRERGSV---DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA  542
             W RLE WRERG     D LGY F L+   G    + +A+ ++    GG+F ID       
Sbjct  283   WARLECWRERGGAGASDSLGYHFALLI-PGADHAVALADSSIPSSNGGKFAIDLTAAQPL  341

Query  541   SS------------------LSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalf  422
             S                   L   RGFVM ++V  EG+    +V+V V H+ C  DAA F
Sbjct  342   SRGGTPGCSPRGSGDLSNWPLGNYRGFVMSAAVQGEGRCSKPTVEVGVAHIGCAEDAAAF  401

Query  421   valsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             VAL+AA+DLSMDAC+LFS +LRKE  H + D
Sbjct  402   VALAAAVDLSMDACRLFSHRLRKELSHLQAD  432



>ref|XP_002463817.1| hypothetical protein SORBIDRAFT_01g006730 [Sorghum bicolor]
 gb|EER90815.1| hypothetical protein SORBIDRAFT_01g006730 [Sorghum bicolor]
Length=436

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 201/450 (45%), Positives = 264/450 (59%), Gaps = 54/450 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGV--HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A   AG G   HPST+PCY K++    P Q+   PL  + 
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPAAGAGAGVHPSTSPCYCKIRLGKMPVQSVPAPLVVS-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKP--------VALKLSVFAGRMGQTCGITS  1238
               D       S A A  FHL  + L   + KP         +LK+SV+AGR G TCG++S
Sbjct  60    --DGGEQTPASGALAAAFHLSKADLEWFNGKPSLFSSRGEASLKVSVYAGRKGSTCGVSS  117

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGW----KKLGGGGADKPMLHVVVRSEPDPRFVFQF  1070
             G+LLG   + +DL GA+++P V  SGW    K+ G G      L + VR+EPDPRFVF+F
Sbjct  118   GRLLGKATIPLDLKGAEAKPAVLHSGWISIGKRAGKGNPAATELSLTVRAEPDPRFVFEF  177

Query  1069  GGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPG  890
              GEPECSP V Q+  +++QP+F+CKF    N+  R          R  M+    D     
Sbjct  178   DGEPECSPQVLQVGSAMKQPMFTCKFGCRSNSDLR----------RPGMQP-ERDAGASA  226

Query  889   KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPW  710
             KERKGW + ++DL GS VA ASM+TPFVPSPG+DRVSRSNPGAWLILRP G    +W+PW
Sbjct  227   KERKGWSVTVHDLKGSPVAMASMVTPFVPSPGTDRVSRSNPGAWLILRPAGD--GAWEPW  284

Query  709   GRLEAWRERGSV---DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSAS  539
              RLE WRERG     D LGY F+L+   G    + +A+ ++   KGG+F ID       S
Sbjct  285   ARLECWRERGGAGASDSLGYHFDLLV-PGADHAVALADSSIPSSKGGKFAIDLTAAQPLS  343

Query  538   S------------------LSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfv  419
                                L   RGFVM ++V  EG+    +V+V V H+ C  DAA FV
Sbjct  344   RGGTPGCSPRGSGDLSNWPLGNYRGFVMSAAVQGEGRCSKPTVEVGVAHIGCAEDAAAFV  403

Query  418   alsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             AL+AA+DLSMDAC+LFS +LRKE  H   D
Sbjct  404   ALAAAVDLSMDACRLFSHRLRKELSHLRAD  433



>ref|XP_008236238.1| PREDICTED: uncharacterized protein LOC103335027 [Prunus mume]
Length=421

 Score =   317 bits (811),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 200/450 (44%), Positives = 270/450 (60%), Gaps = 75/450 (17%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++  + VK P+A++P+   VHPS++PC+ K+K ++FP Q++ +PL  +  +
Sbjct  1     MDPCPFVRILVGDLTVKYPTASRPSSATVHPSSSPCFCKIKLTNFPHQSSTVPLILSNGQ  60

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
             +  ++  D   SA  F+L+ + +  L+ K   LKLS++ G +G TCG+ SGKLLG V V 
Sbjct  61    NLDTTTHDHSLSA-CFNLNKTQIESLASKRPCLKLSIYTGGVGATCGLHSGKLLGRVIVP  119

Query  1207  V-DLSGAQSRPVVFQSGWKKLGGGGADK-----PMLHVVVRSEPDPRFVFQFGGEPECSP  1046
             + +L  A+SRPVV+Q+GW  +GGG  +        L + VR+EPDPRFVFQF GEPECSP
Sbjct  120   LSELGLAESRPVVYQNGWVAIGGGKKNGSGSSSAQLFLSVRAEPDPRFVFQFDGEPECSP  179

Query  1045  VVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMI  866
              VFQ+QG+++QPVF+CKF   R+ ++RS+ S+     R W+      +++  KERKGW I
Sbjct  180   QVFQVQGNVKQPVFTCKFGF-RDMQSRSMSSEPG-TPRNWLPFGGAPKEQSAKERKGWSI  237

Query  865   IIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRE  686
              I+DLSGS VAAASM+TPFV SPGS  VSRSNPGAWLILRPN     +W+PWGR E+W  
Sbjct  238   TIHDLSGSPVAAASMVTPFVASPGSHCVSRSNPGAWLILRPNE---GTWQPWGRRESW--  292

Query  685   RGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPV------  524
                                 +  P+A   +  K GG+F ID       SSL+P       
Sbjct  293   -------------------PTNTPLANSTLGAKTGGKFSID-----LTSSLTPANSPHSS  328

Query  523   -----------------------------RGFVMCSSVE--GKNGFLSVQVAVNHVNCMa  437
                                          RGFVM S+VE  GK     V+V V HV C  
Sbjct  329   FDFGSGTGSRPGSGSGSDFGFGLFPQLIQRGFVMSSTVEGVGKCSKPEVEVGVQHVTCTE  388

Query  436   daalfvalsaAIDLSMDACQLFSTKLRKEF  347
             DAA +VAL+AA+DLSMDAC+ FS KLRKE 
Sbjct  389   DAAAYVALAAAMDLSMDACRPFSRKLRKEL  418



>emb|CDX95423.1| BnaC01g33150D [Brassica napus]
Length=442

 Score =   317 bits (811),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 201/449 (45%), Positives = 270/449 (60%), Gaps = 58/449 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGP------GVHPSTTPCYAKLKFSSFPSQTALLPL  1406
             MDPC FVR+I+ ++ V+ P+ +  +        G++PST  CY K++F +FP Q A +P+
Sbjct  1     MDPCSFVRIILGNLTVRFPATSPSSSSSEPSVSGINPSTPNCYCKIRFKNFPRQIASVPV  60

Query  1405  CSALPKDDSSSPTDSFAS----AEGFHLDPSALRRLSEKPVALKLSVFA------GRMGQ  1256
                + + +S S T S  +    A  F L  + ++   +KP    LS+        G  G 
Sbjct  61    ---MFRTESESETRSSGNISTVAACFSLSKAQIQVALKKPNWSVLSIETYSRVGDGVSGA  117

Query  1255  TCGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGWKKL-----GGGGADKPMLHVVVRSE  1097
             +CG+ SG  KLLG  +V++DL  A+++  +  +GW  L     GG     P LHV VR E
Sbjct  118   SCGLASGSEKLLGRFEVSIDLKSAETKTCLAHNGWVALRRSQRGGKSGSDPELHVTVRVE  177

Query  1096  PDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRT  917
             PDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF A  +N       D +      MR+
Sbjct  178   PDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGARSSN-----SGDRNQLGSSSMRS  232

Query  916   FSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG  737
                ++++P KERKGW + ++DLSGS VA ASM+TPFVPSPGS+RV+RS+PGAWLILRP+G
Sbjct  233   ---EKEQPSKERKGWSVTVHDLSGSPVAMASMVTPFVPSPGSNRVNRSSPGAWLILRPDG  289

Query  736   PSVSSWKPWGRLEAWRERG-SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDN  560
                 +WKPWGRLEAWRE G S D LGY+FEL  D G  + +  +  ++ +K GG F ID 
Sbjct  290   ---CTWKPWGRLEAWRESGYSSDALGYRFELFQD-GIATAVSTSS-SVGLKNGGSFVIDV  344

Query  559   ARKHS----------------ASSLSPVRGFVMCSSVE--GKNGFLSVQVAVNHVNCMad  434
                ++                 S  S  RGFVM +SVE  GK     V+V V HV C  D
Sbjct  345   TGGNTTAASTPTTSPQGSWDLGSGSSAGRGFVMSASVEGVGKRSKPEVEVGVTHVTCTED  404

Query  433   aalfvalsaAIDLSMDACQLFSTKLRKEF  347
             AA  VAL+AA+DLS+DAC+LFS KLRKE 
Sbjct  405   AAAHVALAAAVDLSLDACRLFSQKLRKEL  433



>tpg|DAA51653.1| TPA: hypothetical protein ZEAMMB73_809833 [Zea mays]
Length=725

 Score =   325 bits (832),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 203/451 (45%), Positives = 268/451 (59%), Gaps = 57/451 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGV--HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A   AG G   HPST+PCY K++    P Q+   PL   +
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPAAGAGAGVHPSTSPCYCKIRLGKMPVQSVPAPL---V  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKP--------VALKLSVFAGRMGQTCGITS  1238
               D       S A A  FHL  + L   + KP         +LK+SV+AGR G  CG++S
Sbjct  58    VSDGGEQTPASGALAAAFHLSKADLEWFNGKPSLFSSRGEASLKVSVYAGRKGSACGVSS  117

Query  1237  GKLLGVVQVAVDLSGAQSRPVVFQSGW----KKLGGGGADKPMLHVVVRSEPDPRFVFQF  1070
             G+LLG   +A+DL GA+++P V  SGW    K+ G G      L + VR+EPDPRFVF+F
Sbjct  118   GRLLGKATIALDLKGAEAKPAVLHSGWISIGKRSGKGSTAATELSLTVRAEPDPRFVFEF  177

Query  1069  GGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP-  893
              GEPECSP V Q++GS++QP+F+CKF    N+  R          R  M+    +RD   
Sbjct  178   DGEPECSPQVLQVRGSMKQPMFTCKFGCRSNSDLR----------RPGMQP---ERDAAS  224

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              KERKGW + ++DL GS+VA ASM+TPFVPSPG+DRVSRSNPGAWLILRP G    +W+P
Sbjct  225   AKERKGWSVTVHDLKGSAVAMASMVTPFVPSPGTDRVSRSNPGAWLILRPAGD--GAWEP  282

Query  712   WGRLEAWRERGSV---DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA  542
             W RLE WRERG     D LGY F L+   G    + +A+ ++    GG+F ID       
Sbjct  283   WARLECWRERGGAGASDSLGYHFALLV-PGADHAVALADSSIPSSNGGKFVIDLTAAQPL  341

Query  541   SS------------------LSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalf  422
             S                   L   RGFVM ++V  EG+    +V+V V H+ C  DAA F
Sbjct  342   SRGGTPGCSPRGSGDLSNWPLGNYRGFVMSAAVQGEGRCSKPTVEVGVAHIGCAEDAAAF  401

Query  421   valsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             VAL+AA+DLSMDAC+LFS +LRKE  H + D
Sbjct  402   VALAAAVDLSMDACRLFSHRLRKELSHLQAD  432



>emb|CDO97321.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   315 bits (808),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 214/454 (47%), Positives = 272/454 (60%), Gaps = 60/454 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR++I ++A++LP  +  +      +TT CY K+K   FP+Q + +P  S    
Sbjct  1     MDPCPFVRIVIGNLALRLPPPSSWSK--STTTTTLCYCKIKLKGFPTQYSTVPWLS----  54

Query  1387  DDSSSPTDSFAS--AEGFHLDPSALRRLSEKPVA------LKLSVFAGRMGQT---CGIT  1241
                 S TD+  +    GF+       +L EK  A      LK+ ++ G+ G T   CG  
Sbjct  55    --QESGTDAIENRIHAGFNFKKLEFEKLVEKSGARGGTCGLKIEIYTGKGGNTTAACGWK  112

Query  1240  -SGKLLGVVQVAVDLSGAQ--SRPVVFQSGWKKLGGGGADKPM-LHVVVRSEPDPRFVFQ  1073
               GKLLG V V +DL   +  ++  V Q GW    GGG+ K + LHV VR+EPDPRFVFQ
Sbjct  113   LGGKLLGSVSVQLDLKATEHSNKGCVIQDGWIGTVGGGSGKGVELHVNVRAEPDPRFVFQ  172

Query  1072  FGGEPECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGD  905
             F GEPECSP VFQ+ G+++QPVFSCKF      ERN R+RS  S+ +  +  +  +F  +
Sbjct  173   FDGEPECSPQVFQVNGNVKQPVFSCKFGFRSCGERNLRSRSSMSEPNTRTGCFSASFPAE  232

Query  904   RDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVS  725
             ++RP KERKGW I I+DLSGS VAAASM+TPFV SPGSDRVSRSNPGAWLILRP      
Sbjct  233   KERPLKERKGWSITIHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGAWLILRPGH---G  289

Query  724   SWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHS  545
             +WKPWGRLEAWRER   D LGY+FEL+ D G    I +A  + + KKGG+F ID A   S
Sbjct  290   TWKPWGRLEAWRERNGGDHLGYRFELIPD-GSIDTITLANSSFSTKKGGKFSIDIA-SGS  347

Query  544   ASSLSP--------------------------VRGFVMCSSVE--GKNGFLSVQVAVNHV  449
                 SP                           RGFVM S+VE  GK     V++ V HV
Sbjct  348   TPLTSPNSSFDFSSASSGSGSGSGSGSWGQLLYRGFVMSSTVEGDGKCSKPEVEIGVQHV  407

Query  448   NCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
              C  DAA FVAL+AA+DLSMDAC+ FS K+R+E 
Sbjct  408   TCTEDAAAFVALAAAVDLSMDACRSFSQKIRREL  441



>ref|XP_007201076.1| hypothetical protein PRUPE_ppa006838mg [Prunus persica]
 gb|EMJ02275.1| hypothetical protein PRUPE_ppa006838mg [Prunus persica]
Length=393

 Score =   313 bits (803),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 199/450 (44%), Positives = 259/450 (58%), Gaps = 103/450 (23%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++  + VK P+A++P+   VHPS++PC+ K+K ++FP Q++          
Sbjct  1     MDPCPFVRILVGDLTVKYPTASRPSSATVHPSSSPCFCKIKLTNFPHQSS----------  50

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                                               LS++ G +G TCG+ SGKLLG V V 
Sbjct  51    ---------------------------------TLSIYTGGVGATCGLHSGKLLGRVIVP  77

Query  1207  V-DLSGAQSRPVVFQSGWKKLGGGGADK-----PMLHVVVRSEPDPRFVFQFGGEPECSP  1046
             + +L  A+SRPVV+Q+GW  +GGG  +        L + VR+EPDPRFVFQF GEPECSP
Sbjct  78    LSELVLAESRPVVYQNGWVAIGGGKKNGSGSSSAQLFLSVRAEPDPRFVFQFDGEPECSP  137

Query  1045  VVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMI  866
              VFQ+QG+++QPVF+CKF   R+ ++RS+ S+     R W+      +++ GKERKGW I
Sbjct  138   QVFQVQGTVKQPVFTCKFGF-RDMQSRSMSSEPG-TPRNWLPFGGAHKEQSGKERKGWSI  195

Query  865   IIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRE  686
              I+DLSGS VAAASM+TPFV SPGS  VSRSNPGAWLILRPN     +W+PWGRLE+W E
Sbjct  196   TIHDLSGSPVAAASMVTPFVASPGSHCVSRSNPGAWLILRPNE---GTWQPWGRLESWLE  252

Query  685   RGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPV------  524
             RG  D +GY+FEL           +A   +  K GG+F ID       SSL+P       
Sbjct  253   RGGSDTVGYRFEL-------QNTTLANSTLGAKTGGKFSID-----LTSSLTPANSPHSS  300

Query  523   -----------------------------RGFVMCSSVE--GKNGFLSVQVAVNHVNCMa  437
                                          RGFVM S+VE  GK     V+V V HV C  
Sbjct  301   FDFGSGTGSRPGSGSGSDFGFGLFPQLIQRGFVMSSTVEGVGKCSKPEVEVGVQHVTCTE  360

Query  436   daalfvalsaAIDLSMDACQLFSTKLRKEF  347
             DAA +VAL+AA+DLSMDAC+ FS KLRKE 
Sbjct  361   DAAAYVALAAAMDLSMDACRPFSQKLRKEL  390



>ref|XP_002962295.1| hypothetical protein SELMODRAFT_77561 [Selaginella moellendorffii]
 gb|EFJ37555.1| hypothetical protein SELMODRAFT_77561 [Selaginella moellendorffii]
Length=436

 Score =   314 bits (805),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 196/449 (44%), Positives = 262/449 (58%), Gaps = 56/449 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDP  FV+L + ++ V++P A+KPA  GVH ST+P + +++   +P QT  +PL S    
Sbjct  1     MDPRAFVKLSVSALGVRVPLASKPARTGVHSSTSPFFCEVRLPGYPVQTTPVPLVSP---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLS-------VFAGRMGQTCGITSGKL  1229
                +SP      A  F+LD SAL +L       K S       V+ GR G  CG+  GKL
Sbjct  58    ---TSPPPDRGIAANFYLDESALDKLLSPTSCFKSSFPCLEVLVYTGRQGTRCGVKEGKL  114

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGAD--KP--MLHVVVRSEPDPRFVFQFGGE  1061
             +G   + V     + +P+   SGW  +G G +   KP   LH+V++ E DPR++FQF GE
Sbjct  115   MGTFSLPVSSQWMEGKPIQLHSGWTGIGKGNSTDGKPGAELHLVIKVEADPRYIFQFDGE  174

Query  1060  PECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKER  881
                SP + QIQG I QP+FSCKFS +R +R        S  +  W     G   +  KER
Sbjct  175   TVASPQIVQIQGKITQPLFSCKFSRDRLSR--------SSGAGKWSGPLGGHDHKERKER  226

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRL  701
             KGW+I+I+DLSGS VAAASM+TPFVPS GSDRVSRSNPGAWLILRP+  S  SW+PWGRL
Sbjct  227   KGWLIMIHDLSGSPVAAASMVTPFVPSAGSDRVSRSNPGAWLILRPDSTSGDSWEPWGRL  286

Query  700   EAWRERGSVDGLGYKFELVTDAGFTSGIP-----IAEGAMNVKKGGRFCIDNARKHSAS-  539
             EAW+ERGS  GLG +F+LV + G           ++E  ++   GG F ID AR   A+ 
Sbjct  287   EAWKERGSKGGLGLRFQLVAENGGGGTANVGGALVSETVISSHSGGEFSIDTARFRPATP  346

Query  538   --SLSPVR-------------------GFVMCSSVEGK----NGFLSVQVAVNHVNCMad  434
               + +PV+                   GFVM  +  G+    +G   VQ+A+ H+ C  D
Sbjct  347   SPARTPVQSPRSSGDCNFINVGLPASGGFVMSCTTRGERQSSSGRPLVQLAMRHITCAED  406

Query  433   aalfvalsaAIDLSMDACQLFSTKLRKEF  347
             AA+F+AL+AA+DLS+DACQ FS KLRKE 
Sbjct  407   AAVFMALAAAVDLSIDACQPFSRKLRKEL  435



>ref|XP_004157897.1| PREDICTED: uncharacterized LOC101219082, partial [Cucumis sativus]
Length=228

 Score =   306 bits (785),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 186/227 (82%), Gaps = 7/227 (3%)
 Frame = -2

Query  979  NNRTRSLPSDFSLNSRG--WMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFV  806
            N+  RSLPSDFS NS    WMRTFSG+R++PG+ERKGWMI++YDLSGS VAAASMITPFV
Sbjct  1    NDPNRSLPSDFSFNSTKGKWMRTFSGEREKPGRERKGWMIMVYDLSGSPVAAASMITPFV  60

Query  805  PSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFT  626
            PSPG+DRVSRSNPGAWLILRP+G SVSSWKPWGRLEAWRERG +DGLGYKFELV D G  
Sbjct  61   PSPGTDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPIDGLGYKFELVADTGLA  120

Query  625  SGIPIAEGAMNVKKGGRFCID--NARKHSASSLSPVRG-FVMCSSVEGKNGFLS--VQVA  461
            +GIPIAE  M+VKKGG+FCID    R  + +S S V+G FVM SSVEG+       VQV 
Sbjct  121  TGIPIAEATMSVKKGGQFCIDRKTVRDLTINSKSTVKGSFVMASSVEGEGKVSKPIVQVG  180

Query  460  VNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDSYF  320
            V HV CMADAALFVALSAAIDLSMDAC+ F+ KLR+E CHDEHDS F
Sbjct  181  VQHVTCMADAALFVALSAAIDLSMDACRHFTQKLRRELCHDEHDSSF  227



>ref|XP_002965215.1| hypothetical protein SELMODRAFT_230537 [Selaginella moellendorffii]
 gb|EFJ34053.1| hypothetical protein SELMODRAFT_230537 [Selaginella moellendorffii]
Length=436

 Score =   314 bits (804),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 195/449 (43%), Positives = 262/449 (58%), Gaps = 56/449 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDP  F++L + ++ V++P A+KPA  GVH ST+P + +++   +P QT  +PL S    
Sbjct  1     MDPRAFIKLSVSALGVRVPLASKPARTGVHSSTSPFFCEVRLPGYPVQTTPVPLVSP---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLS-------VFAGRMGQTCGITSGKL  1229
                +SP      A  F+LD SAL +L       K S       V+ GR G  CG+  GKL
Sbjct  58    ---TSPPPDRGIAANFYLDESALDKLLSPTSCFKSSFPCLEVLVYTGRQGTRCGVKEGKL  114

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGAD--KP--MLHVVVRSEPDPRFVFQFGGE  1061
             +G   + V     + +P+   SGW  +G G +   KP   LH+V++ E DPR++FQF GE
Sbjct  115   MGTFSLPVSSQWMEGKPIQLHSGWTGIGKGNSTDGKPGAELHLVIKVEADPRYIFQFDGE  174

Query  1060  PECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKER  881
                SP + QIQG I QP+FSCKFS +R +R        S  +  W     G   +  KER
Sbjct  175   TVASPQIVQIQGKITQPLFSCKFSRDRLSR--------SSGAGKWSGPLGGHDHKERKER  226

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRL  701
             KGW+I+I+DLSGS VAAASM+TPFVPS GSDRVSRSNPGAWLILRP+  S  SW+PWGRL
Sbjct  227   KGWLIMIHDLSGSPVAAASMVTPFVPSAGSDRVSRSNPGAWLILRPDSTSGDSWEPWGRL  286

Query  700   EAWRERGSVDGLGYKFELVTDAGFTSGIP-----IAEGAMNVKKGGRFCIDNARKHSAS-  539
             EAW+ERGS  GLG +F+LV + G           ++E  ++   GG F ID AR   A+ 
Sbjct  287   EAWKERGSKGGLGLRFQLVAENGGGGTANVGGALVSETVISSHSGGEFSIDTARFRPATP  346

Query  538   --SLSPVR-------------------GFVMCSSVEGK----NGFLSVQVAVNHVNCMad  434
               + +PV+                   GFVM  +  G+    +G   VQ+A+ H+ C  D
Sbjct  347   SPARTPVQSPRSSGDCNFINVGLPASGGFVMSCTTRGERQSSSGRPLVQLAMRHITCAED  406

Query  433   aalfvalsaAIDLSMDACQLFSTKLRKEF  347
             AA+F+AL+AA+DLS+DACQ FS KLRKE 
Sbjct  407   AAVFMALAAAVDLSIDACQPFSRKLRKEL  435



>ref|XP_008671026.1| PREDICTED: uncharacterized protein LOC103648311 [Zea mays]
 tpg|DAA42726.1| TPA: hypothetical protein ZEAMMB73_556847 [Zea mays]
Length=455

 Score =   314 bits (804),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 199/453 (44%), Positives = 272/453 (60%), Gaps = 54/453 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGP-----GVHPSTTPCYAKLKFSSFPSQTALLPLC  1403
             MDPCPFVR+++ ++A+K+P++  PA P     GVHP+   C+ +++ +  P QTA  PL 
Sbjct  1     MDPCPFVRVLVGNLALKMPASASPATPRASGSGVHPTAARCHCRIRLNKMPYQTASAPL-  59

Query  1402  SALPKDDSSSPTDSFASAEGFHLDPSAL-------------RRLSEKPVALKLSVFAGRM  1262
               LP  +    + + A A  FH+  + L                  +   LK++V+AGR 
Sbjct  60    --LPATEDGPASCTAAFAAAFHVSKADLDRAAARPAAALLLAARRRRTARLKVAVYAGRG  117

Query  1261  G---QTCG---ITSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP--------  1124
             G    +CG    TSG+LLG V + +DL  A ++PVVF SGW  +G               
Sbjct  118   GGVSASCGGGGATSGRLLGKVVLPLDLRAAMAKPVVFHSGWVAVGSRRGKAAAAASSSAR  177

Query  1123  -MLHVVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDF  947
               L + VR+EPDPRFVFQF GEPECSP V Q++GS++QP+F+C+FS   ++  RS     
Sbjct  178   AQLSITVRAEPDPRFVFQFDGEPECSPQVLQVKGSMKQPMFTCRFSCRSSSDLRSRSVQS  237

Query  946   SLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNP  767
                +R W+     +R+R GKERKGW + ++DLSGS VA ASM+TPFV SPG+D VSRS+P
Sbjct  238   DPGARNWLAKLGSERERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDHVSRSSP  297

Query  766   GAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELV-TDAGFTSGIPIAEGAMNV  590
             GAWLILR   P+  +W PWGRLE WR RG  D LGY+FELV   A   +G+ +AE ++  
Sbjct  298   GAWLILR---PADGTWAPWGRLECWRGRG--DTLGYRFELVPGHATGGAGVCVAEASVPA  352

Query  589   KKGGRFCID----------NARKHSASSLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVN  446
              +GGRF ID          ++       + P  GFVM ++V  EG+    +V+V V HV 
Sbjct  353   SRGGRFAIDLTAAAQPFWCSSSGDMGHGIWPFGGFVMSAAVQGEGRCSRPTVEVGVAHVG  412

Query  445   CMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             C  DAA FVAL+AA+DLSMDAC+LFS KLR+E 
Sbjct  413   CAEDAAAFVALAAAVDLSMDACRLFSCKLRREL  445



>ref|XP_006658256.1| PREDICTED: uncharacterized protein LOC102703230 [Oryza brachyantha]
Length=356

 Score =   310 bits (793),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 170/340 (50%), Positives = 224/340 (66%), Gaps = 34/340 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG--VHPSTTPCYAKLKFSSFPSQTALLPLC---  1403
             MDPCPFVR+++ ++++K+P   +PAG G  VHPST+PCY K++ +  P QTA  PL    
Sbjct  1     MDPCPFVRVLVGNLSLKMPVTPRPAGAGAGVHPSTSPCYCKIRLNKLPYQTADAPLVMLS  60

Query  1402  --SALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKP-------VALKLSVFAGRMGQTC  1250
               S+  +   +    + A A  FHL  + L R   KP         LK++V+AGR G TC
Sbjct  61    SSSSSDEQAQAPAPATGALAAAFHLSKADLARHMAKPSLFGSRTARLKVAVYAGRRGTTC  120

Query  1249  GI--TSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP-------MLHVVVRSE  1097
             G+  +SG+LLG V + +DL GA ++PVV+ S W  +G  G  KP        L + VR+E
Sbjct  121   GVGGSSGRLLGKVVIPLDLKGAAAKPVVYHSSWICIGKRG-RKPSSVSAANELSLTVRAE  179

Query  1096  PDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN--RTRSLPSDFSLNSRGWM  923
             PDPRFVF+F GEPECSP V Q+QGS++QP+F+CKFS   N+  R+RS+P+D     R W+
Sbjct  180   PDPRFVFEFDGEPECSPQVLQVQGSMKQPMFTCKFSCRSNSDLRSRSMPADTGSGGRNWL  239

Query  922   RTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRP  743
               F  DR+R GKERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWL+LRP
Sbjct  240   TAFGSDRERTGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLVLRP  299

Query  742   NGPSVSSWKPWGRLEAWRERG----SVDGLGYKFELVTDA  635
                   +WKPWGRLE WRERG    + D LGY+ +L  DA
Sbjct  300   GD---GTWKPWGRLECWRERGAGAATGDSLGYR-DLSMDA  335



>ref|XP_004511326.1| PREDICTED: uncharacterized protein LOC101500065 [Cicer arietinum]
Length=420

 Score =   310 bits (795),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 190/446 (43%), Positives = 260/446 (58%), Gaps = 67/446 (15%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-VHPSTTPCYAKLKF---SSFPSQTALLPLCS  1400
             MDPCPFVR++I ++A+K P+++KP+  G VHPS++PCY ++K     S P   A +PL S
Sbjct  1     MDPCPFVRILIGNLAIKSPASSKPSFSGKVHPSSSPCYCEIKLKGIDSPPCHVATVPLIS  60

Query  1399  ALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGV  1220
                  DS +   S A++  F    + + ++  K   +++SV+  R   +C   S KLLG 
Sbjct  61    -----DSDTHPQSLAAS--FDFSKTQINKI--KNPLIQISVYKARTNPSCAFNSAKLLGK  111

Query  1219  VQVAVDLSGAQSRPVVFQSGWKKLGGGG-------ADKPMLHVVVRSEPDPRFVFQFGGE  1061
             + V +DL+  +SRP  F +GW  L           A   +LH+ VR+EPDPRFVF+F GE
Sbjct  112   ISVPIDLTLVESRPCSFHNGWVTLSNNNSKNRDPSAQAQLLHLTVRAEPDPRFVFRFDGE  171

Query  1060  PECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKER  881
             PECSP VFQ++G ++QPVF+CKFS    N     P  F   +   + T          +R
Sbjct  172   PECSPQVFQVKGDVKQPVFTCKFSFRDRN-----PVQFPSTNANHLAT----------DR  216

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRL  701
             KGW I ++DLSGS VA ASM+TPFVPSPGS RVS+SNPGAWLI+RP G    +WKPWGRL
Sbjct  217   KGWSITVHDLSGSPVACASMVTPFVPSPGSQRVSKSNPGAWLIIRPEGD--GTWKPWGRL  274

Query  700   EAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP--  527
             EAWRE G+ + +GY+F+++     T  + +A   ++ + GG+F ID     + +S     
Sbjct  275   EAWREPGNSNAVGYRFDVL--PATTDPVTLAACTISSQNGGKFTIDVTSGITPASTPNGS  332

Query  526   ------------------------VRGFVMCSSVEG--KNGFLSVQVAVNHVNCMadaal  425
                                      RGFVM +  +G  K     V+V V HV C  DAA 
Sbjct  333   WDLGSSSRTESGFGSDFMLDHQFLYRGFVMSAKFDGEKKCSKPEVEVGVKHVTCAEDAAA  392

Query  424   fvalsaAIDLSMDACQLFSTKLRKEF  347
             FVAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  393   FVALAAAMDLSMDACKLFSQKLRKEL  418



>gb|KHG13181.1| hypothetical protein F383_01774 [Gossypium arboreum]
Length=445

 Score =   309 bits (792),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 200/457 (44%), Positives = 266/457 (58%), Gaps = 56/457 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPC FVR+++ ++A+K PS           S++ CY K+K  +FP Q A +P       
Sbjct  1     MDPCHFVRILVGNLALKFPSTQ---------SSSSCYCKIKLKNFPHQVATIPHQDIETN  51

Query  1387  DDSSS-PTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQV  1211
             + SS  P  +  S     +D    +  S   V++++       G TCG++SGKLLG V V
Sbjct  52    NCSSQKPLAACFSLSKSQIDNIVSKWGSSYKVSIEVYTGGSGSGSTCGLSSGKLLGKVSV  111

Query  1210  AVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPVVFQI  1031
              +DL GA+SRP V  +GW  +G  G+    L + VR+E DPRFVFQFGGEPECSP VFQ+
Sbjct  112   PLDLLGAESRPCVAHNGWVTIGKNGSSL-QLCLTVRTERDPRFVFQFGGEPECSPQVFQV  170

Query  1030  QGSIRQPVFSCKFSAERNNRTRSLPSDFSLNS----RGWMRTFSGDRDRPGKERKGWMII  863
             QG+++Q VF+CKF   RN   R+L S  SL+     R W+ +   D+D+P KERKGW I 
Sbjct  171   QGNVKQAVFTCKFGF-RNTSDRNLGSRSSLSESKAPRKWLPSLKTDKDQPSKERKGWSIT  229

Query  862   IYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRER  683
             I++L+GS VA ASM+TPFVPSPGSDRV++SNPGAWLILRP      +WKPWGRLEAWRE 
Sbjct  230   IHNLTGSPVAMASMVTPFVPSPGSDRVTKSNPGAWLILRPG---CGTWKPWGRLEAWREP  286

Query  682   GSVDGLGYKFELVTDAGFTSG---IPIAEGAMNVKKGGRFCIDNARKHSASSLSPVR---  521
                D +G++F+L  D   T+      +A   +N K GG+F +D     S  S+SP     
Sbjct  287   SFTDAIGFRFDLFHDDITTAASVTSTVASSTINTKLGGKFTMDMTTSLSTPSISPQSSGD  346

Query  520   -----------------------------GFVMCSSVE--GKNGFLSVQVAVNHVNCMad  434
                                          GFVM S+VE  GK     V+V V+HV C  D
Sbjct  347   FGSGSRSGSRPGSGSGSDFGFSPQNQFRGGFVMSSTVEGTGKCSKPEVEVGVHHVTCTED  406

Query  433   aalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDSY  323
             AA FVAL+AA+DLSMDAC+ F+ KLRKE    +  ++
Sbjct  407   AAAFVALAAAMDLSMDACRSFNQKLRKELRQQQTQNF  443



>emb|CDY51694.1| BnaA05g36810D [Brassica napus]
Length=449

 Score =   308 bits (788),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 203/452 (45%), Positives = 269/452 (60%), Gaps = 57/452 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGP-----GVHPSTTP---CYAKLKFSSFPSQTALL  1412
             MDPC FVR+I+ ++AV+ P+ +          G+  S+T    CY K+KF SFP Q   +
Sbjct  1     MDPCSFVRIIVGNLAVRFPAPSSSTSSEPSVSGIKTSSTSAPNCYCKIKFKSFPRQIVTV  60

Query  1411  PLCSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRM--------GQ  1256
             P+   + + +S S T     A  F L  + +    +KP   KLSV +           G 
Sbjct  61    PV---IFRTESESETRCSTVAACFSLSKAQIEASLKKP---KLSVLSVETYSRGNDVTGA  114

Query  1255  TCGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK----PMLHVVVRSEP  1094
             +CG+ S   KLLG  +V++DL  A+++  +  +GW  L G   +K    P LHV VR EP
Sbjct  115   SCGLASASEKLLGRFEVSLDLKAAETKTCLAHNGWVALSGKRRNKTGSDPELHVSVRVEP  174

Query  1093  DPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRT--RSLPSDFSLNSR---G  929
             DPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF A RN+ +  R+L    S+ S     
Sbjct  175   DPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGA-RNSGSGDRNLLHSSSMMSETRSS  233

Query  928   WMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLIL  749
              + +   ++++P KERKGW + ++DLSGS VA ASM+TPFVPSPGS+RV+RS+PGAWLIL
Sbjct  234   CISSMKSEKEQPSKERKGWSVTVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLIL  293

Query  748   RPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFC  569
             RP+G    +WKPWGRLEAWRE G  D LGY+FEL  D G  + +  A  ++++K GG F 
Sbjct  294   RPDG---CTWKPWGRLEAWREAGYSDSLGYRFELFQD-GIATEVS-ASSSISLKNGGSFV  348

Query  568   ID----------------NARKHSASSLSPVRGFVMCSSVE--GKNGFLSVQVAVNHVNC  443
             ID                       S  S  RGFVM +SVE  GK     V+V V HV C
Sbjct  349   IDVTGGTTTVGSTPTTSPQGSLDLGSGSSSGRGFVMSASVEGVGKQSKPEVEVGVTHVTC  408

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
               DAA  VAL+AA+DLS+DAC+LFS KLRKE 
Sbjct  409   TEDAAAHVALAAAVDLSLDACRLFSQKLRKEL  440



>ref|XP_006406471.1| hypothetical protein EUTSA_v10020590mg [Eutrema salsugineum]
 gb|ESQ47924.1| hypothetical protein EUTSA_v10020590mg [Eutrema salsugineum]
Length=494

 Score =   308 bits (789),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 206/491 (42%), Positives = 280/491 (57%), Gaps = 90/491 (18%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGP---GVHPST--TP-CYAKLKFSSFPSQTALLPL  1406
             MDPC FVR+I+ ++AV+ P+++  + P   GVHPS+  TP CY K++F SFP Q   +P+
Sbjct  1     MDPCSFVRIIVGNLAVRFPASSSSSEPSVSGVHPSSVSTPNCYCKIRFKSFPRQVVSVPV  60

Query  1405  CSALPKDDSSSPTDSFAS--AEGFHLDPSALRRLSEKPVALKLSVFA----------GRM  1262
                   D S +      S  A  F L  + +    +KP    LSV A          G  
Sbjct  61    MYRSESDQSETRCSGNISTVAACFSLSKTQIEASLKKPKWSVLSVEAYSRGNSDGGDGVS  120

Query  1261  GQTCGIT--SGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGG--GGADK-------PMLH  1115
             G +CG+   S KLLG  +V++DL  A+++  +  +GW  LG   GG  +       P LH
Sbjct  121   GASCGLALASEKLLGRFEVSLDLKSAETKTCLAHNGWVALGSKKGGKSRRNKAGSDPELH  180

Query  1114  VVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKF------SAERN-NRTRSLP  956
             V +R EPDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF      S +RN   + S+ 
Sbjct  181   VSLRVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSSSVDRNLIHSSSMM  240

Query  955   SDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSR  776
             S+  +++R  + +   ++++P KERKGW I ++DLSGS VA ASM+TPFVPSPGS+RV+R
Sbjct  241   SEL-ISTRSCISSMKSEKEQPSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSNRVTR  299

Query  775   SNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAM  596
             S+PGAWLILRP+G    +WKPWGRLEAWRE G  D LGY+FEL  D G  + +  A  ++
Sbjct  300   SSPGAWLILRPDG---CTWKPWGRLEAWRETGYSDSLGYRFELFQD-GIATAVS-ASSSI  354

Query  595   NVKKGGRFCIDNAR----------------------------------------------  554
             ++K GG F ID                                                 
Sbjct  355   SLKNGGSFAIDVTGGTTTAASTPTTSPQGSWDLGSGSSSGSRPASRPGSGSGSDFGYLLP  414

Query  553   KHSASSLSPVRGFVMCSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDAC  380
             +H +++ +  RGFVM ++VE  GK     V+V V HV C  DAA  VAL+AA+DLS+DAC
Sbjct  415   QHPSAAAAQNRGFVMSATVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDAC  474

Query  379   QLFSTKLRKEF  347
             +LFS KLRKE 
Sbjct  475   RLFSHKLRKEL  485



>ref|XP_009605701.1| PREDICTED: uncharacterized protein LOC104100222 [Nicotiana tomentosiformis]
Length=434

 Score =   306 bits (783),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 271/460 (59%), Gaps = 71/460 (15%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR++I S+A+K P+ +KP      P T     K+K   F + +  +P   A  +
Sbjct  1     MDPCPFVRIVIGSLALKFPAESKP------PPTATFDCKIKLKGFLTHSTTIP---AFIQ  51

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEK------PVALKLSVFAGRMGQTCGITSGKLL  1226
             +  +   +   +   F+   S L +L EK      P +LK+ ++   MG  C    G+LL
Sbjct  52    EKDAILDNRIHAC--FNFSKSELMKLVEKSNNRGKPCSLKIEIYEDNMGFGC-FNGGRLL  108

Query  1225  GVVQVAVDLSGAQS---RPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
             G V V +DL   ++   R V+ Q+GW  +GG    +  L++ VR+EPDPRFVFQF GEPE
Sbjct  109   GSVLVPLDLKSLENIGHRGVIIQNGWVSVGGSSTAE--LNLNVRAEPDPRFVFQFDGEPE  166

Query  1054  CSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             CSP VFQ+ G  +QPVF+CKFS    ++RN R+RS  S+ S ++      FS D++RP K
Sbjct  167   CSPQVFQVNGKNKQPVFTCKFSFRNSSDRNLRSRSSLSEPSTSTS----CFSSDKERPVK  222

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I ++DLSGS VAAASM+TPFVPS GSDRVS+SNPG+WLILRP     ++WKPWG
Sbjct  223   ERKGWSITVHDLSGSPVAAASMVTPFVPSQGSDRVSKSNPGSWLILRPGD---NTWKPWG  279

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP  527
             RLEAWRE  S   LGY+FE++ D G T  I +    ++ KKGG+  ID    + A+ LS 
Sbjct  280   RLEAWRE--SNGELGYRFEIIPD-GATDAITLVNSTISTKKGGKIGIDIV--NGATPLSS  334

Query  526   ------------------------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNC  443
                                            RGFVM S+V  +GK     V+V V HV+C
Sbjct  335   PNSSFDLSSGSGSGSDFGSQPGSGSWAHLLYRGFVMSSTVGGDGKCSKPEVEVGVQHVSC  394

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDSY  323
               DAA FVAL+AA+DLSMDAC+ FS KLRKE    + + +
Sbjct  395   AEDAAAFVALAAAMDLSMDACRSFSQKLRKELRQQDQELW  434



>ref|XP_009111603.1| PREDICTED: uncharacterized protein LOC103837023 [Brassica rapa]
Length=469

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 201/476 (42%), Positives = 271/476 (57%), Gaps = 85/476 (18%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGP-------GVHPSTTPCYAKLKFSSFPSQTALLP  1409
             MDPC FVR+I+ ++ V+ P+ +  +         G++PST  CY K++F +FP Q A +P
Sbjct  1     MDPCSFVRIIVGNLTVRFPATSPSSSSSSEPSVSGINPSTPNCYCKIRFKNFPRQIASVP  60

Query  1408  LCSALPKDDSSSPTDSFAS----AEGFHLDPSALRRLSEKPVALKLSVFA------GRMG  1259
             +   + + +S S T S  +    A  F L  + +    +KP    LS+        G  G
Sbjct  61    V---MLRTESESETRSSGNISTVAACFSLSKAQIEAALKKPNWSVLSIETYSRVGDGVSG  117

Query  1258  QTCGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGW-----KKLGGGGADKPMLHVVVRS  1100
              +CG+ SG  KLLG  +V++DL  A+++  +  +GW      K GG     P LH+ VR 
Sbjct  118   ASCGLASGSEKLLGRFEVSIDLKSAETKTCLAHNGWVALRRSKKGGKSGSDPELHLTVRV  177

Query  1099  EPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMR  920
             EPDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF A  +N       D +      MR
Sbjct  178   EPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGARSSN-----SGDRNQLGSSSMR  232

Query  919   TFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPN  740
             +   ++++P KERKGW + ++DLSGS VA ASM+TPFVPSPGS+RV+RS+PGAWLILRP+
Sbjct  233   S---EKEQPSKERKGWSVTVHDLSGSPVAMASMVTPFVPSPGSNRVNRSSPGAWLILRPD  289

Query  739   GPSVSSWKPWGRLEAWRERG-SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID  563
             G    +WKPWGRLEAWRE G S D LGY+FEL  D G  + +  A  ++++K GG F ID
Sbjct  290   G---CTWKPWGRLEAWRESGYSSDALGYRFELFQD-GIATAVS-ASSSISLKNGGSFVID  344

Query  562   --------------------NARKHSASSLSPV----------------------RGFVM  509
                                 +    S++   P                       RGFVM
Sbjct  345   VTGGNTTAASTPTTSPQGSWDLGSGSSAGSRPASRPGSGSGSDFGYLLPQHPAQSRGFVM  404

Query  508   CSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
              +SVE  GK     V+V V HV C  DAA  VAL+AA+DLS+DAC+LFS KLRKE 
Sbjct  405   SASVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACRLFSQKLRKEL  460



>gb|AFW87787.1| hypothetical protein ZEAMMB73_393258 [Zea mays]
Length=439

 Score =   305 bits (780),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 197/448 (44%), Positives = 260/448 (58%), Gaps = 59/448 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGV--HPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVR+++ ++A+++P A   AG G   HPS + CY K++    P Q+   PL   +
Sbjct  1     MDPCPFVRVLVGNLALRMPVAPPAAGAGAGVHPSMSACYCKIRLGKMPVQSVPAPL---V  57

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKP-----------VALKLSVFAGRMGQTCG  1247
               D       S A A  FHL  + L     KP            +LK+SV+AGR G  CG
Sbjct  58    VSDGGEQTPASGALAAAFHLSKADLEWFDGKPSLFSSRRGAGEASLKVSVYAGRKGSACG  117

Query  1246  ITSGKLLGVVQVAVDLSGAQSRPVVFQSGW----KKLGGGGADKPMLHVVVRSEPDPRFV  1079
             ++SG LLG   V +DL GA+++P V  SGW    K+ G G      L + VR+EPDPRFV
Sbjct  118   VSSGGLLGKATVPLDLKGAEAKPAVLHSGWISIGKRAGKGSPSAAELCLTVRAEPDPRFV  177

Query  1078  FQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRD  899
             F+F GEPECSP V Q++GS+RQP+F+CKF    N+  R          R  MR    +RD
Sbjct  178   FEFDGEPECSPQVLQVRGSMRQPMFTCKFGCRSNSDLR----------RPGMRR---ERD  224

Query  898   RP-GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSS  722
                 KERKGW + ++DL GS VA ASM+TPFV SPG+DRVSRSN GAWLILRP   +  +
Sbjct  225   AASAKERKGWSVTVHDLKGSPVAMASMVTPFVSSPGTDRVSRSNLGAWLILRPA--ADGA  282

Query  721   WKPWGRLEAWRER---GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARK  551
             W+ W RLE WR+R   G+ D LGY+F+L+      + + +A+ ++   KGG+F ID    
Sbjct  283   WEAWARLECWRDRRGSGASDSLGYRFDLLVPGVDHAAVALADSSIPSSKGGKFAIDLTAA  342

Query  550   HSASS------------------LSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMada  431
                S                   L   RGFVM ++V  EG+    +V+V V HV C  DA
Sbjct  343   QPLSRGGTPGCSPRGSGDLSKWPLGNYRGFVMSAAVQGEGRCSKPTVEVGVAHVGCAEDA  402

Query  430   alfvalsaAIDLSMDACQLFSTKLRKEF  347
             A FVAL+AA+DLSMDAC+LFS +LRKE 
Sbjct  403   AAFVALAAAVDLSMDACRLFSHRLRKEL  430



>emb|CDY24620.1| BnaC05g33040D [Brassica napus]
Length=450

 Score =   305 bits (781),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 204/453 (45%), Positives = 269/453 (59%), Gaps = 58/453 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGP------GVHPSTTP---CYAKLKFSSFPSQTAL  1415
             MDPC FVR+I+ ++AV+ P+ +  +        G+  S+T    CY K+KF SFP Q   
Sbjct  1     MDPCSFVRIIVGNLAVRFPAPSSSSSSSAPSVSGISTSSTSPPNCYCKIKFKSFPRQIVS  60

Query  1414  LPLCSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFA--------GRMG  1259
              P+   + + +S S T     A  F L    ++    KP   KLSV +        G  G
Sbjct  61    APV---IFRTESESETRCSTVAAFFSLSKYQIKASLNKP---KLSVLSVETYSRGEGVTG  114

Query  1258  QTCGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK----PMLHVVVRSE  1097
              +CG+ S   KLLG  +V++DL  A+++  +  +GW  L G   +K    P LHV VR E
Sbjct  115   ASCGLASASEKLLGRFEVSLDLKAAETKTCLAHNGWVALRGKRRNKTGPDPELHVSVRVE  174

Query  1096  PDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRT--RSLPSDFSLNSR---  932
             PDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF A RN+ +  R+L    S+ S    
Sbjct  175   PDPRFVFQFYGEPECSPQVFQVQGNTKQAVFTCKFGA-RNSGSGDRNLLHSSSMMSETRS  233

Query  931   GWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLI  752
               + +   ++++P KERKGW + ++DLSGS VA ASM+TPFVPSPGS+RV+RS+PGAWLI
Sbjct  234   SCISSMKSEKEQPSKERKGWSVTVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLI  293

Query  751   LRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRF  572
             LRP+G    +WKPWGRLEAWRE G  D LGY+FEL  D G  + +  A  ++++K GG F
Sbjct  294   LRPDG---CTWKPWGRLEAWREAGYSDSLGYRFELFQD-GIATEVS-ASSSISLKNGGSF  348

Query  571   CID----------------NARKHSASSLSPVRGFVMCSSVE--GKNGFLSVQVAVNHVN  446
              ID                       S  S  RGFVM +SVE  GK     V+V V HV 
Sbjct  349   VIDVTGGTTTAGSTPTTSPQGSLDLGSGSSSGRGFVMSASVEGVGKQSKPEVEVGVTHVT  408

Query  445   CMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             C  DAA  VAL+AA+DLS+DAC+LFS KLRKE 
Sbjct  409   CTEDAAAHVALAAAVDLSLDACRLFSQKLRKEL  441



>ref|XP_009145758.1| PREDICTED: uncharacterized protein LOC103869426 [Brassica rapa]
Length=471

 Score =   305 bits (782),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 202/478 (42%), Positives = 271/478 (57%), Gaps = 87/478 (18%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-----VHPSTTP---CYAKLKFSSFPSQTALL  1412
             MDPC FVR+I+ ++AV+ P+ +           ++ S+T    CY K+KF SFP Q   +
Sbjct  1     MDPCSFVRIIVGNLAVRFPAQSSSTSSEPSVSEINTSSTSAPNCYCKIKFKSFPRQIVTV  60

Query  1411  PLCSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRM--------GQ  1256
             P+   + + +S S +     A  F L  + +    +KP   KLSV +           G 
Sbjct  61    PV---IFRTESESESRCSTVAACFSLSKAQIEASLKKP---KLSVLSVETYSRGNDVTGA  114

Query  1255  TCGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK----PMLHVVVRSEP  1094
             +CG+ S   KLLG  +V++DL  A+++  +  +GW  L G   +K    P LHV VR EP
Sbjct  115   SCGLASASEKLLGRFEVSLDLKAAETKTCLAHNGWVALRGKRRNKTGSDPELHVSVRVEP  174

Query  1093  DPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRT--RSLPSDFSLNSR---G  929
             DPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF A RN+ +  R+L    S+ S     
Sbjct  175   DPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGA-RNSSSGDRNLLHSSSMMSETRSS  233

Query  928   WMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLIL  749
              + +   ++++P KERKGW + ++DLSGS VA ASM+TPFVPSPGS+RV+RS+PGAWLIL
Sbjct  234   CISSMKSEKEQPSKERKGWSVTVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLIL  293

Query  748   RPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFC  569
             RP+G    +WKPWGRLEAWRE G  D LGY+FEL  D G  + +  A  ++++K GG F 
Sbjct  294   RPDG---CTWKPWGRLEAWREAGYSDSLGYRFELFQD-GIATEVS-ASSSISLKNGGSFV  348

Query  568   IDNAR------------------------------------------KHSASSLSPVRGF  515
             ID                                             +H A S    RGF
Sbjct  349   IDVTGGTTTVGSTPTTSPQGSLDLGSGSSSGSRPGSGSGSDFGYLLPQHPAQS----RGF  404

Query  514   VMCSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             VM +SVE  GK     V+V V HV C  DAA  VAL+AA+DLS+DAC+LFS KLRKE 
Sbjct  405   VMSASVEGVGKQSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACRLFSQKLRKEL  462



>ref|XP_010557540.1| PREDICTED: uncharacterized protein LOC104826503 [Tarenaya hassleriana]
Length=476

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 201/474 (42%), Positives = 268/474 (57%), Gaps = 74/474 (16%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGP-----GVHPS---TTPCYAKLKFSSFPSQTALL  1412
             MDPC FVR+++ ++AV+ P ++          G++PS   +  CY K+KF +FP Q   +
Sbjct  1     MDPCSFVRIVVGNLAVRFPGSSSSPSYDPSISGINPSPESSPSCYCKIKFKNFPRQIVTV  60

Query  1411  P-LCSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFA-------GRMGQ  1256
             P L    P+ ++ SP ++ + A  F L  + +    +KP    LSV A       G    
Sbjct  61    PVLHRPEPESETRSPGNASSVAACFSLSKTQIEAYDKKPKWSVLSVEAYSRDGGDGDGAP  120

Query  1255  TCGITS--GKLLGVVQVAVDLSGAQSRPVVFQSGWKKLG--------GGGADKPMLHVVV  1106
              CG+ +  GKLLG  +V++DL  A++R  +   GW  LG           +  P LH +V
Sbjct  121   ACGLAAAGGKLLGRFKVSLDLKAAETRACLAHKGWVALGSRKLAMKKNKYSSDPELHAIV  180

Query  1105  RSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLN----  938
             R E DPRFVFQF GEPECSP VFQ+QG+ +Q VFSCKF   RN+  R+  S  S++    
Sbjct  181   RVERDPRFVFQFDGEPECSPQVFQVQGNTKQAVFSCKFGF-RNSADRNQMSSLSMSEPST  239

Query  937   SRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAW  758
             SR W+ T   +  +P KERKGW I I+DLSGS VA ASM+TPFVPSPGS+RV+RS+PGAW
Sbjct  240   SRTWLSTIKTEEQQP-KERKGWSITIHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAW  298

Query  757   LILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGG  578
             LILRP+G    +W PW RLEAWRE G  D LGY+ EL  D   T+    A  ++++KKGG
Sbjct  299   LILRPDG---FTWNPWARLEAWREPGFSDALGYRLELYQDCVATA--VSASSSISMKKGG  353

Query  577   RFCIDNARKHSASSLSPV-----------------------------------RGFVMCS  503
             +F ID   K  +   +P                                    +GFVM +
Sbjct  354   KFVIDVTNKCGSLVSTPSSSPHGSWDLGSGSSSGSRPGSGSESDFLFVLPQRHKGFVMSA  413

Query  502   SV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             +V   GKN    V+V V HV C  DAA  VAL+AA+DLSMDAC++FS KLRKE 
Sbjct  414   TVGGVGKNSKPVVEVGVGHVTCTEDAAAHVALAAAMDLSMDACRIFSHKLRKEL  467



>gb|EYU30689.1| hypothetical protein MIMGU_mgv1a0070432mg, partial [Erythranthe 
guttata]
Length=220

 Score =   294 bits (753),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 184/219 (84%), Gaps = 7/219 (3%)
 Frame = -2

Query  964  SLPSDFSLNSRGWMRTFSGDRD--RPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGS  791
            SLPSDF+ ++R W RTFSG+RD  R G+ERKGWM I+YDLSGS+VAAASM+TPFVPSPGS
Sbjct  1    SLPSDFNTSNRVWARTFSGERDNNRVGRERKGWMFIVYDLSGSAVAAASMVTPFVPSPGS  60

Query  790  DRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPI  611
            DRVSRSNPGAWLIL PNG S+SSWKPWGRLEAWRERG  DGL YKFEL+TDAG TSG PI
Sbjct  61   DRVSRSNPGAWLILCPNGVSISSWKPWGRLEAWRERGPTDGLRYKFELITDAGLTSGAPI  120

Query  610  AEGAMNVKKGGRFCIDNARKHSASS-LSPVRGFVMCSSVEGKNGFLS---VQVAVNHVNC  443
            AEG ++VKKGG F IDN+R  SA S L   RGFVM SSVEG+ G +S   VQV V HV C
Sbjct  121  AEGTVSVKKGGEFSIDNSRSDSALSFLLKNRGFVMGSSVEGE-GKVSKPVVQVGVQHVTC  179

Query  442  MadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDS  326
            MADAALFVAL+AA+DLSMDAC+LFS KLRKEFCHDE +S
Sbjct  180  MADAALFVALAAAVDLSMDACRLFSRKLRKEFCHDEQES  218



>ref|XP_009761264.1| PREDICTED: uncharacterized protein LOC104213456 [Nicotiana sylvestris]
Length=435

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 200/460 (43%), Positives = 270/460 (59%), Gaps = 70/460 (15%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR++I S+A+K  + +KP      P T     K+K   F +Q+  +P  + + +
Sbjct  1     MDPCPFVRIVIGSLALKFSAESKP------PPTATFDCKIKLKGFLTQSTTIP--AFIQE  52

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEK------PVALKLSVFAGRMGQTCGITSGKLL  1226
              D+   +   A    F+   S L +L +K      P +LK+ ++   MG  C    GKLL
Sbjct  53    KDAILDSRIHAC---FNFSKSELVKLVDKSNSRGKPCSLKIEIYGDNMGFGC-FNGGKLL  108

Query  1225  GVVQVAVDLSGAQS---RPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
             G V V +DL   ++   R VV ++GW  +GG  +    L++ VR+EPDPRFVFQF G+PE
Sbjct  109   GSVLVPLDLKSLENIGHRGVVIKNGWVSVGGSSSTAE-LNLNVRAEPDPRFVFQFDGQPE  167

Query  1054  CSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             CSP VFQ+ G  +QPVF+CKFS     +RN R+RS  S+ S ++      FS D++ P K
Sbjct  168   CSPQVFQVNGKNKQPVFTCKFSFRNSGDRNLRSRSSLSEPSTSTS----CFSSDKETPVK  223

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I ++DLSGS VAAASM+TPFVPS GSDRVS+SNPG+WLILRP     ++WKPWG
Sbjct  224   ERKGWSITVHDLSGSPVAAASMVTPFVPSQGSDRVSKSNPGSWLILRPGD---NTWKPWG  280

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP  527
             RLEAWRE  S   LGY+FE++ D G T  I +    ++ KKGG+  ID    + A+ L+ 
Sbjct  281   RLEAWRE--SNGELGYRFEIIPD-GATDAITLVNSTISTKKGGKISIDIV--NGATPLTS  335

Query  526   ------------------------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNC  443
                                            RGFVM S+V  +GK     V+V V HV+C
Sbjct  336   PNSSFDLSSGSGSGSDFGSQPGSGSWAHLLYRGFVMSSTVGGDGKCSKPEVEVGVQHVSC  395

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDSY  323
               DAA FVAL+AA+DLSMDAC+ FS KLRKE    + + +
Sbjct  396   AEDAAAFVALAAAMDLSMDACRSFSQKLRKELRQQDQELW  435



>ref|XP_011092476.1| PREDICTED: uncharacterized protein LOC105172657 [Sesamum indicum]
Length=435

 Score =   298 bits (763),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 203/452 (45%), Positives = 262/452 (58%), Gaps = 68/452 (15%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPC FVR++I ++A+K P  +       H S+   Y K K   FP+Q + +   +A   
Sbjct  1     MDPCSFVRIVIGNLALKFPERS-------HLSSLSFYCKFKLKGFPTQVSDVSFLAA---  50

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRL---SEKPVALKLSVFAGRMGQT--CG-ITSGKLL  1226
                S   DS   +  F L    L +L   S K   LK+ V+    G +  CG + SGKLL
Sbjct  51    --ESDAVDSRIQS-CFSLRKQELEKLVDKSSKFSCLKIEVYRRSSGGSSSCGFVKSGKLL  107

Query  1225  GVVQVAVDL-----SGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGE  1061
             G V + +DL     S   +R  + Q+GW  +GG       LH+ VR+EPDPRFVFQF GE
Sbjct  108   GCVALQLDLKSVLESNGNNRGFLIQNGWILVGGSDVK---LHLNVRAEPDPRFVFQFDGE  164

Query  1060  PECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             PECSP VFQ+ G+++QPVF+CKFS     +R +R+R   S    +S     +   D ++P
Sbjct  165   PECSPQVFQVNGNVKQPVFTCKFSFRSSGDRISRSRCSVSGARSSSFSCFSSSKDDNEQP  224

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              KERKGW I I+DLSGS VAAASM+TPFVPSPGSD VSRSNPGAWLILRP     ++WKP
Sbjct  225   LKERKGWSITIHDLSGSPVAAASMVTPFVPSPGSDMVSRSNPGAWLILRPGQ---NTWKP  281

Query  712   WGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID----------  563
             WGRLEAWR+    + LGY+FEL+ D G    IP+A  +++ K GG+F ID          
Sbjct  282   WGRLEAWRD---CNDLGYRFELIPDGG-VDPIPLANSSISTKTGGKFSIDITTGPTPVAS  337

Query  562   ------------------NARKHSASSLSPVRGFVMCSSVEG--KNGFLSVQVAVNHVNC  443
                               +A    + +    RGFVM S+VEG  K     V+V V HVNC
Sbjct  338   ASSSFDLSSGCGSGSDFGSAAGSGSWAHLLYRGFVMSSTVEGDGKCSKPEVEVGVQHVNC  397

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
               DAA FVAL+AA+DLS+DAC+LFS KLRKE 
Sbjct  398   TEDAAAFVALAAAMDLSLDACRLFSQKLRKEL  429



>ref|XP_011088149.1| PREDICTED: uncharacterized protein LOC105169457 [Sesamum indicum]
Length=426

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 197/447 (44%), Positives = 260/447 (58%), Gaps = 67/447 (15%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR++I ++A+  P  T+        ST   Y K K   FP+Q + +P  ++   
Sbjct  1     MDPCPFVRIVIGNLALMFPDKTRF-------STLSFYCKFKLKGFPAQVSDVPFLAS---  50

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPV---ALKLSVF--AGRMGQTCGITSGKLLG  1223
                S   DS      F +  + L RL+EK     +LK+ +   + R    C +    L  
Sbjct  51    --ESDAVDSRIHG-CFAMGRAELERLAEKSSKFSSLKIEIHRRSSRGNSGCVVVQLDLKS  107

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPV  1043
             +++     +   SR    Q+GW  +GG       LH+ VR+EPDPRFVF+F GEPECSP 
Sbjct  108   ILE-----NNGNSRACAIQNGWVWIGGSDVK---LHLNVRAEPDPRFVFRFDGEPECSPQ  159

Query  1042  VFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLN----SRGWMRTFSGDRDRPGKERKG  875
             VFQ+ G+++QPVF+CKFS  RN+  R+L S  SL+    S     + + D ++P KERKG
Sbjct  160   VFQVNGNVKQPVFTCKFSF-RNSGERTLRSRSSLSEPSTSTSCFSSGAADNEQPLKERKG  218

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEA  695
             W I I+DLSGS VAAASM+TPFVPSPG++RVSRSNPGAWLILRP      +WKPWGRLEA
Sbjct  219   WSITIHDLSGSPVAAASMVTPFVPSPGTNRVSRSNPGAWLILRPGH---GTWKPWGRLEA  275

Query  694   WRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP----  527
             WRER + D LGY+F+L+ D G  + IP+A  +++ K GG+F ID     +  + SP    
Sbjct  276   WRERSNGDHLGYRFDLIPDGGIDT-IPLANSSISTKTGGKFSIDITTGPTPMT-SPNSSF  333

Query  526   -------------------------VRGFVMCSSVE--GKNGFLSVQVAVNHVNCMadaa  428
                                       RGFVM S+VE  GK     V+V V HV+C  DAA
Sbjct  334   DLSSGSGSGSDLGSTSGSGSWAHLLYRGFVMSSTVEGDGKCSKPDVEVGVQHVSCTEDAA  393

Query  427   lfvalsaAIDLSMDACQLFSTKLRKEF  347
              FVAL+AA+DLSMDAC+ FS KLRKE 
Sbjct  394   AFVALAAAMDLSMDACRSFSQKLRKEL  420



>tpg|DAA59484.1| TPA: hypothetical protein ZEAMMB73_809167 [Zea mays]
Length=447

 Score =   296 bits (758),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 204/453 (45%), Positives = 269/453 (59%), Gaps = 54/453 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-----VHPSTTPCY-AKLKFSSFPSQTALLPL  1406
             MDPCPFVR+++ ++A+K+P++  PA        VHP+T PCY  +++ +  P QTA  PL
Sbjct  1     MDPCPFVRVLVGNLALKMPASAPPAAAAASGSGVHPATPPCYYCRIRLNKLPYQTAPAPL  60

Query  1405  CSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVA----------LKLSVFAGRMGQ  1256
                LP  +  S     + A  FH   + L R + +P            LK++V+AGR G 
Sbjct  61    ---LPATEEGSAPAPASCAAAFHASKADLDRAAARPALFLGGRLRTARLKVAVYAGRGGG  117

Query  1255  TCGITSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKP--------MLHVVVRS  1100
               G      L       DL  A + P VF SGW  +G  GA KP         L++ V  
Sbjct  118   EGGGRLLGKL---VFRFDLRRAVAEPFVFLSGWFDIGKRGAGKPAAANAARAQLNLTVLG  174

Query  1099  EPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN--RTRSLPSDF-SLNSRG  929
             EPDPRFVF+F GEPECSP V Q++GS++QP+F+CKFS   N+  R+RS+ SD  ++  R 
Sbjct  175   EPDPRFVFEFDGEPECSPQVLQVKGSMKQPMFTCKFSCRSNSDLRSRSVQSDSGAVGPRN  234

Query  928   WMRTF--SGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWL  755
             W+       +R+R GKERKGW + ++DLSGS VA ASM+TPFV SPG+DRV RSNPG WL
Sbjct  235   WLAKLWSERERERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVGRSNPGGWL  294

Query  754   ILRPNGPSVSSWKPWGRLEAWRERGSVDG---LGYKFELVTDAGFT---SGIPIAEGAMN  593
             ILR       +W PWGRLE WR+RG   G   LGY+FELV D       SG+ +AE  + 
Sbjct  295   ILRRR--VDGTWTPWGRLECWRDRGGSAGDAQLGYRFELVPDHNSNVTGSGVCVAESGVP  352

Query  592   VKKGGRFCID---------NARKHSASSLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVN  446
               +GGRF ID          + + S  +L P  GFVM ++V  EG+ G  SV++ V HV 
Sbjct  353   AARGGRFAIDLTTAGSPGRGSGELSRHALWPPGGFVMSAAVQGEGRRGRPSVEIGVAHVG  412

Query  445   CMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             C  DAA FVAL+AA+DLSMDAC+LFS KLR+E 
Sbjct  413   CAEDAAAFVALAAAVDLSMDACRLFSCKLRREL  445



>ref|XP_009801206.1| PREDICTED: uncharacterized protein LOC104246980 [Nicotiana sylvestris]
Length=435

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 201/459 (44%), Positives = 262/459 (57%), Gaps = 70/459 (15%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR++I ++A+K P+  K +      S+T    K K   F +Q + +   SA  +
Sbjct  1     MDPCPFVRIVIGNLALKFPAEHKLS------SSTVFDCKFKLRGFSTQVSTI---SAFVQ  51

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVA------LKLSVFAGRMGQTCGITSGKLL  1226
             D    P     +   F+L+ + L +L EK  A      LK+ +FA + G           
Sbjct  52    D----PILDNRTHSCFNLNKTELDKLVEKSTAKGKTCSLKIEIFARKKG-IGCGLLNGGK  106

Query  1225  GVVQVAVDLSGAQS---RPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
              +  V VDL G +S   R VV Q+ W  L GG +    LH+ V++EPDPRFVFQF GEPE
Sbjct  107   LLGSVIVDLKGLESDGRRGVVIQNEWV-LVGGSSTAAQLHLNVKAEPDPRFVFQFDGEPE  165

Query  1054  CSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             CSP VFQ+ G+++QPVF+CKFS     +RN R+RS  S  S ++  +    S     P K
Sbjct  166   CSPQVFQVNGNVKQPVFTCKFSFRNNGDRNLRSRSSLSKPSTSTSCFNSCTSDKESSPLK  225

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRP-NGPSVSSWKPW  710
             ERKGW I I+DLSGS +AAASM+TPFVPS GS  VSRSNPGAWLILRP NG    +WKPW
Sbjct  226   ERKGWSITIHDLSGSPIAAASMVTPFVPSQGSSNVSRSNPGAWLILRPGNG----TWKPW  281

Query  709   GRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLS  530
             GRLEAW+ERG    LGY+FE++ D G T  I ++   ++ K GG+F +D    + A+ L+
Sbjct  282   GRLEAWQERGG--DLGYRFEIIPD-GATDAITLSNSTISTKNGGKFGVDIT--NGATPLT  336

Query  529   P------------------------------VRGFVMCSSVEG--KNGFLSVQVAVNHVN  446
                                             RGFVM S+VEG  K     V V V HVN
Sbjct  337   SPNSSFDLCSGSGSGSDFGSAPGSGSWAQLLYRGFVMSSTVEGEGKCSKPEVVVGVQHVN  396

Query  445   CMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             C+ DAA FVAL+AA+DLSMDACQ F+ KLRKE    + +
Sbjct  397   CVEDAAAFVALAAAMDLSMDACQSFTKKLRKELRQSDQE  435



>ref|XP_006297520.1| hypothetical protein CARUB_v10013544mg [Capsella rubella]
 gb|EOA30418.1| hypothetical protein CARUB_v10013544mg [Capsella rubella]
Length=490

 Score =   293 bits (751),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 200/489 (41%), Positives = 275/489 (56%), Gaps = 90/489 (18%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-------VHPSTTPCYAKLKFSSFPSQTALLP  1409
             MDPC FVR+I+ ++AV+ PS++ P+          + PS   CY K++F +FP +   +P
Sbjct  1     MDPCSFVRIIVGNLAVRFPSSSSPSSSSSGPSVSGITPSPPNCYCKIRFKNFPREIVSVP  60

Query  1408  LCSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFA----------GRMG  1259
             +     + +S + + S   A  F L  S L    +KP    LSV A             G
Sbjct  61    VL-FRSESESDARSSSTTVAACFSLSKSQLEASLKKPKWSVLSVEAYSRGYSDADDAVTG  119

Query  1258  QTCGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGG-----------GGADKPML  1118
              +CG+ S   KLLG  +V++DL  A+++  +  +GW  LG             G+D P L
Sbjct  120   ASCGLASAGEKLLGRFEVSLDLKSAETKTCLAHNGWVALGSKKGSGKSNRSKAGSD-PEL  178

Query  1117  HVVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN-------RTRSL  959
             HV VR EPDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF +  +N        + S+
Sbjct  179   HVCVRVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLLNSSSM  238

Query  958   PSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVS  779
              S+  +++R  + +   ++++P KERKGW + ++DLSGS VA ASM+TPFVPSPGS+RV+
Sbjct  239   MSEL-ISTRSCISSLKSEKEQPSKERKGWSVTVHDLSGSPVAMASMVTPFVPSPGSNRVT  297

Query  778   RSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGA  599
             RS+PGAWLILRP+G    +WKPWGRLEAWRE G  D LGY+F+L  D G  + +  A  +
Sbjct  298   RSSPGAWLILRPDG---CTWKPWGRLEAWREAGYSDTLGYRFDLFQD-GIATAVS-ASSS  352

Query  598   MNVKKGGRFCID--------------------------------NARKHSASS-----LS  530
             +++K GG F ID                                 +R  S S      L 
Sbjct  353   ISLKNGGSFVIDVTGGTTTTASTPTTSPQGSWDLGSGSSSGSRPASRPGSGSGSDFGYLL  412

Query  529   PV------RGFVMCSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQL  374
             P       RGFVM ++VE  GK     V++ V HV C  DAA  VAL+AA+DLS+DAC+L
Sbjct  413   PQHPSAQNRGFVMSATVEGVGKRSKPEVEIGVTHVTCTEDAAAHVALAAAVDLSLDACRL  472

Query  373   FSTKLRKEF  347
             FS KLRKE 
Sbjct  473   FSDKLRKEL  481



>gb|AAL60032.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   293 bits (749),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 198/490 (40%), Positives = 273/490 (56%), Gaps = 91/490 (19%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-------VHPSTTPCYAKLKFSSFPSQTALLP  1409
             MDPC FVR+I+ ++AV+ PS++  +          ++P++  CY K++F +FP +   +P
Sbjct  1     MDPCSFVRIIVGNLAVRFPSSSSSSSSSSGPSVSGINPTSPNCYCKIRFKNFPREIVSVP  60

Query  1408  LCSALPKDDSSSPTDSFAS------AEGFHLDPSALRRLSEKPVALKLSVFA--------  1271
             +   + + +S S T   +S      A  F L  + +    +KP    LSV A        
Sbjct  61    V---MFRTESESETRCSSSGNVSTVAACFSLSKAQIEASLKKPKFSVLSVEAYSRGNSDG  117

Query  1270  --GRMGQTCGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGW-----KKLGGGGADKPML  1118
               G  G +CG+ +   KLLG  +V++DL  A+++  +  +GW     KK        P L
Sbjct  118   DDGVSGASCGLATAGEKLLGRFEVSLDLKSAETKSFLAHNGWVALPSKKTKSKTGSDPEL  177

Query  1117  HVVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKF------SAERNNRTRSLP  956
             HV VR EPDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF      S +RN    S  
Sbjct  178   HVSVRVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLLHSSSM  237

Query  955   SDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSR  776
                  ++R  + + + ++++P KERKGW I ++DLSGS VA ASM+TPFVPSPGS+RV+R
Sbjct  238   MSEISSTRSCISSMNSEKEQPSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSNRVTR  297

Query  775   SNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAM  596
             S+PGAWLILRP+G    +WKPWGRLEAWRE G  D LGY+FEL  D G  + +  A  ++
Sbjct  298   SSPGAWLILRPDG---CTWKPWGRLEAWREAGYSDTLGYRFELFQD-GIATAVS-ASSSI  352

Query  595   NVKKGGRFCID----------------------------NARKHSA--------------  542
             ++K GG F ID                             +R  S               
Sbjct  353   SLKNGGSFVIDVTGGTSTTASTPTTSPQGSWDLGSGSSAGSRPASRPGSGSGSDFGYLLP  412

Query  541   ---SSLSPVRGFVMCSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQ  377
                S+ +  RGFVM ++VE  GK     V+V V HV C  DAA  VAL+AA+DLS+DAC+
Sbjct  413   QHPSAAAQNRGFVMSATVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACR  472

Query  376   LFSTKLRKEF  347
             LFS KLRKE 
Sbjct  473   LFSHKLRKEL  482



>ref|NP_188602.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02555.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN12962.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF02152.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAE99219.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76275.1| uncharacterized protein AT3G19680 [Arabidopsis thaliana]
Length=491

 Score =   292 bits (748),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 198/490 (40%), Positives = 272/490 (56%), Gaps = 91/490 (19%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-------VHPSTTPCYAKLKFSSFPSQTALLP  1409
             MDPC FVR+I+ ++AV+ PS++  +          ++P+   CY K++F +FP +   +P
Sbjct  1     MDPCSFVRIIVGNLAVRFPSSSSSSSSSSGPSVSGINPTAPNCYCKIRFKNFPREIVSVP  60

Query  1408  LCSALPKDDSSSPTDSFAS------AEGFHLDPSALRRLSEKPVALKLSVFA--------  1271
             +   + + +S S T   +S      A  F L  + +    +KP    LSV A        
Sbjct  61    V---MFRTESESETRCSSSGNVSTVAACFSLSKAQIEASLKKPKFSVLSVEAYSRGNSDG  117

Query  1270  --GRMGQTCGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGW-----KKLGGGGADKPML  1118
               G  G +CG+ +   KLLG  +V++DL  A+++  +  +GW     KK        P L
Sbjct  118   DDGVSGASCGLATAGEKLLGRFEVSLDLKSAETKSFLAHNGWVALPSKKTKSKTGSDPEL  177

Query  1117  HVVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKF------SAERNNRTRSLP  956
             HV VR EPDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF      S +RN    S  
Sbjct  178   HVSVRVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLLHSSSM  237

Query  955   SDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSR  776
                  ++R  + + + ++++P KERKGW I ++DLSGS VA ASM+TPFVPSPGS+RV+R
Sbjct  238   MSEISSTRSCISSMNSEKEQPSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSNRVTR  297

Query  775   SNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAM  596
             S+PGAWLILRP+G    +WKPWGRLEAWRE G  D LGY+FEL  D G  + +  A  ++
Sbjct  298   SSPGAWLILRPDG---CTWKPWGRLEAWREAGYSDTLGYRFELFQD-GIATAVS-ASSSI  352

Query  595   NVKKGGRFCID----------------------------NARKHSA--------------  542
             ++K GG F ID                             +R  S               
Sbjct  353   SLKNGGSFVIDVTGGTSTTASTPTTSPQGSWDLGSGSSAGSRPASRPGSGSGSDFGYLLP  412

Query  541   ---SSLSPVRGFVMCSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQ  377
                S+ +  RGFVM ++VE  GK     V+V V HV C  DAA  VAL+AA+DLS+DAC+
Sbjct  413   QHPSAAAQNRGFVMSATVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACR  472

Query  376   LFSTKLRKEF  347
             LFS KLRKE 
Sbjct  473   LFSHKLRKEL  482



>ref|XP_010487913.1| PREDICTED: uncharacterized protein LOC104765839 [Camelina sativa]
Length=496

 Score =   292 bits (747),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 195/493 (40%), Positives = 274/493 (56%), Gaps = 92/493 (19%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG------VHPSTTPCYAKLKFSSFPSQTALLP-  1409
             MDPC FVR+I+ ++AV+ PS++  +         ++P++  CY K++F +FP +    P 
Sbjct  1     MDPCSFVRIIVGNLAVRFPSSSSSSSSSGPSVSGINPTSPNCYCKIRFKNFPREIVSTPV  60

Query  1408  LCSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQT--------  1253
             +      D  +  + S   A  F L  S +    +KP    LSV A   G T        
Sbjct  61    MFRTESSDSETRSSSSSTVAACFSLSKSQIEASLKKPKWSVLSVEAFSRGNTDGHDDGVT  120

Query  1252  ----CGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGW----KKLGGGGADK------PM  1121
                 CG+ +   KLLG  +V++DL  A+++  +  +GW     K GG  ++K      P 
Sbjct  121   TGASCGLATAGEKLLGRFEVSLDLKSAETKTCLAHNGWVPLGSKKGGSKSNKSKTGSDPE  180

Query  1120  LHVVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN-------RTRS  962
             LHV VR EPDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF +  +N        + S
Sbjct  181   LHVTVRVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLLHSSS  240

Query  961   LPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRV  782
             + S+  +++R  + +   ++++P KERKGW + ++DLSGS VA ASM+TPFVPSPGS+RV
Sbjct  241   MMSEL-ISTRSLISSMKSEKEQPSKERKGWSVTVHDLSGSPVAMASMVTPFVPSPGSNRV  299

Query  781   SRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEG  602
             +RS+PGAWLILRP+G    +WKPWGRLEAWRE G  D LGY+F+L  D G  + +  A  
Sbjct  300   TRSSPGAWLILRPDG---CTWKPWGRLEAWREAGYSDTLGYRFDLFQD-GIATAVS-ASS  354

Query  601   AMNVKKGGRFCIDNAR--------------------------------------------  554
             ++++K GG F ID                                               
Sbjct  355   SISLKNGGSFVIDVTGGTTTTASTPTTSPQGSWDLGSGSSSGSRPASRPGSGSGSDFGYL  414

Query  553   --KHSASSLSPVRGFVMCSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMD  386
               +H +S+ +  RGFVM ++VE  GK     V+V V HV C  DAA  VAL+AA+DLS+D
Sbjct  415   LPQHPSSAAAQNRGFVMSATVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLD  474

Query  385   ACQLFSTKLRKEF  347
             AC+LFS KLRKE 
Sbjct  475   ACRLFSHKLRKEL  487



>ref|XP_010466129.1| PREDICTED: uncharacterized protein LOC104746366 [Camelina sativa]
Length=496

 Score =   291 bits (746),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 198/493 (40%), Positives = 278/493 (56%), Gaps = 92/493 (19%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-----VHPSTTPCYAKLKFSSFPSQTALLPLC  1403
             MDPC FVR+I+ ++AV+ PS++  A  G     ++P++  CY K++F +FP +    P+ 
Sbjct  1     MDPCSFVRIIVGNLAVRFPSSSSSASSGPSVSGINPTSPNCYCKIRFKNFPREIVSTPVT  60

Query  1402  --SALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCG----IT  1241
               +     +++  + S   A  F L  S +    +KP    LSV A   G T G    IT
Sbjct  61    FRTESSDSETTRSSSSSTVAACFSLSKSQIEASLKKPKWSVLSVEAYSRGYTDGHDDGIT  120

Query  1240  SG----------KLLGVVQVAVDLSGAQSRPVVFQSGW----KKLGGGGADK------PM  1121
             +G          KLLG  +V++DL  A+++  +  +GW     K GG  ++K      P 
Sbjct  121   TGASCGLATAGEKLLGRFEVSLDLKLAETKTCLAHNGWVPLGSKKGGSKSNKSKTGSDPE  180

Query  1120  LHVVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN-------RTRS  962
             LHV VR EPDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF +  +N        + S
Sbjct  181   LHVTVRVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLLHSSS  240

Query  961   LPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRV  782
             + S+  +++R  + +   ++++P KERKGW + ++DLSGS VA ASM+TPFVPSPGS+RV
Sbjct  241   MISEL-ISTRSLISSMKSEKEQPSKERKGWSVTVHDLSGSPVAMASMVTPFVPSPGSNRV  299

Query  781   SRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEG  602
             +RS+PGAWLILRP+G    +WKPWGRLEAWRE G  D LGY+F+L  D G  + +  A  
Sbjct  300   TRSSPGAWLILRPDG---CTWKPWGRLEAWREAGYSDTLGYRFDLFQD-GIATAVS-ASS  354

Query  601   AMNVKKGGRFCIDNAR--------------------------------------------  554
             ++++K GG F ID                                               
Sbjct  355   SISLKNGGSFVIDVTGGTTTTASTPTTSPQGSWDLGSGSSSGSRPASRPGSGSGSDFGYL  414

Query  553   --KHSASSLSPVRGFVMCSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMD  386
               +H +S+ +  RGFVM ++VE  GK     V+V V HV C  DAA  VAL+AA+DLS+D
Sbjct  415   LPQHPSSAAAHNRGFVMSATVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLD  474

Query  385   ACQLFSTKLRKEF  347
             AC+LFS KLRKE 
Sbjct  475   ACRLFSHKLRKEL  487



>ref|XP_010030891.1| PREDICTED: uncharacterized protein LOC104420809, partial [Eucalyptus 
grandis]
Length=480

 Score =   291 bits (744),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 195/453 (43%), Positives = 257/453 (57%), Gaps = 58/453 (13%)
 Frame = -2

Query  1555  PFVRLIIESMAVKLPSATKPAGPGVHPSTTPC-----------YAKLKFSSFPSQTALLP  1409
             PF+R+++ ++++KLP  +  +     PS++             + K+K ++ P Q A LP
Sbjct  27    PFLRILVGNLSLKLPQPSSSSPSSAAPSSSSSSTTVHPSSSSFFCKVKLANLPPQHASLP  86

Query  1408  LCSALPKDDSSSPTDSFAS-AEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSG-  1235
             L S  P D S  P  S    A  F L    L +L+ +   L++ V  GR G  CG+  G 
Sbjct  87    LTS--PPDRSPEPHPSSQPLAACFSLPKPLLEKLALQNPTLRIEVHRGRFGGACGLVGGS  144

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
             KL+G V V +DL  A++R     SGW  +G    +K  L+V VR+EPDPRFVF+F  EPE
Sbjct  145   KLIGKVSVPLDLRRAEARAASVHSGWVDIGRKSGEK--LYVSVRAEPDPRFVFEFEKEPE  202

Query  1054  CSPVVFQIQGSIRQPVFSCKFSAERNN-----RTRSLPSDFSLNSRGWMRTFSG-DRDRP  893
             CSP VFQ+QGS++QPVF+C FS  RNN              +  SR W+ +  G D+D  
Sbjct  203   CSPQVFQVQGSVKQPVFTCNFSF-RNNVGDRSLRSRSSLSETSTSRSWIPSLVGSDKDSH  261

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              KERKGW + I+DLSGS VAAASM+TPFVPSPGSDRVSRSNPGAWLI+RP      +W+P
Sbjct  262   SKERKGWSVTIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLIIRPEH---GTWRP  318

Query  712   WGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSL  533
             WGRLEAW E GS D L ++FEL+ +    +   +A  ++++K GG+F ID     S  S 
Sbjct  319   WGRLEAWLEHGSSDMLSHRFELLPNTTTATTGTVANSSISIKNGGKFTIDLTNSVSPMSS  378

Query  532   SPVR-----------------------------GFVMCSSVEGKNGFL--SVQVAVNHVN  446
                                              GFVM S+++G N      V+V V HV 
Sbjct  379   PSSSMDLGGGSWSGSGSGSDFVGLGLWPNSVPGGFVMSSTMQGVNKASKPQVEVGVQHVT  438

Query  445   CMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             C  DAA FVAL+AAIDLSMDAC+LFS KLR E 
Sbjct  439   CTEDAAAFVALAAAIDLSMDACKLFSRKLRTEL  471



>ref|XP_006307458.1| hypothetical protein CARUB_v10009084mg [Capsella rubella]
 gb|EOA40356.1| hypothetical protein CARUB_v10009084mg [Capsella rubella]
Length=459

 Score =   289 bits (740),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 202/470 (43%), Positives = 260/470 (55%), Gaps = 83/470 (18%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTP-----CYAKLKFSSFPSQTALLPLC  1403
             MDPC FVR+I+ ++AV+ P +   +     PS +      CY K+KF SFP +   +P+ 
Sbjct  1     MDPCSFVRIIVGNLAVRFPISPSSSSSSSGPSVSDVSSGNCYCKIKFKSFPRKIVSVPV-  59

Query  1402  SALPKDDSSSPTDSFAS------AEGFHLDPSALRRLSEKPVALKLSV-FAGRMGQTCGI  1244
               L + +S S +    S      A  F L  S +    +KP    LSV    R G +CG 
Sbjct  60    --LLRTESESESRCCFSGNVSTVAACFSLSKSQIETCLKKPKWSVLSVEVYSRSGASCGF  117

Query  1243  ---TSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLG--------GGGADKPMLHVVVRSE  1097
                +  KL+G  +V++DL  A+++  +  +GW  LG          G+D P  HV VR+E
Sbjct  118   LAPSGEKLIGRFEVSLDLKAAETKTCLAHNGWVSLGTNSKKKNKKSGSD-PEFHVSVRAE  176

Query  1096  PDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRT  917
             PDPRFVFQF GEPECSP VFQ+QGS +Q VF+CKF   RN+  R+L    S        +
Sbjct  177   PDPRFVFQFDGEPECSPQVFQVQGSTKQAVFTCKFGF-RNSGDRNLNPSLS-------SS  228

Query  916   FSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNG  737
             F   ++   KERKGW I I+DLSGS VA ASM+TPFVPSPGS+RVSRS+PGAWLILRP+G
Sbjct  229   FKSGKELSLKERKGWTITIHDLSGSPVAMASMVTPFVPSPGSNRVSRSSPGAWLILRPDG  288

Query  736   PSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGA---MNVKKGGRFCI  566
                 +WKPWGRL+AWRE G  D LGY+FEL  D     GI +A  A   +N K GG F I
Sbjct  289   ---YTWKPWGRLQAWREPGVSDVLGYRFELYQD-----GIAVAVSASSSINTKLGGSFII  340

Query  565   DNARKHSASSLSPVR-----------------------------------GFVMCSSVEG  491
             D +   + + L+                                      GFVM + VEG
Sbjct  341   DGSTTSTTAPLTISEGSFDLSSRSSVGSSRTGSGSGSDFGLSLPQAQQKLGFVMSTKVEG  400

Query  490   --KNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
               K     V+V V +V C  DAA  VAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  401   VEKQSKPKVEVGVKYVTCTEDAAAHVALAAAVDLSMDACRLFSRKLRKEL  450



>ref|XP_009381291.1| PREDICTED: uncharacterized protein LOC103969480 [Musa acuminata 
subsp. malaccensis]
Length=455

 Score =   288 bits (738),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 202/455 (44%), Positives = 270/455 (59%), Gaps = 59/455 (13%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAG-PGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDPCPFVR+++ ++A+K P A +PAG  GVHPS  PC+A ++    PS+           
Sbjct  1     MDPCPFVRVLVGNLALKGPVAARPAGGSGVHPSAHPCFATVRLDKHPSRHTAAVPLLPPD  60

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLS------------EKPVALKLSVFAGRMGQTCG  1247
               D+  P  + + A GFHL  + L R++                 LK+++++G  G TC 
Sbjct  61    DADAPPPPAAASLAAGFHLSKADLDRIAGGSFFSPASASGAGTAKLKVAIYSGGRGTTCL  120

Query  1246  ITSGKLLGVVQVAVDL-SGAQSRPVVFQSGWKKLGGGGADKP--MLHVVVRSEPDPRFVF  1076
             + S +LLG V + +DL   A+ R VVF SGW  LG G +      L++ V++E DPRFVF
Sbjct  121   LRSRRLLGRVSLPLDLRETAEGRAVVFHSGWVALGKGASAAAKAQLYLTVKAEVDPRFVF  180

Query  1075  QFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSG----  908
             +F GEPE +P VFQ+QG+ RQPV++C F    ++       D++  SR      S     
Sbjct  181   EFDGEPERNPQVFQVQGNRRQPVYTCSFGCRHHS------GDWNWGSRSAQSEPSSSRRW  234

Query  907   ------DRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILR  746
                   +R+R GKERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWLILR
Sbjct  235   RSSMGSERERLGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILR  294

Query  745   PNGPSVSSWKPWGRLEAWRER---GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGR  575
             P      +W+PWGRLEAWRER    + DGLGY+FEL+ D     G+ +AE  ++  KGG+
Sbjct  295   PGD---GTWQPWGRLEAWRERGGGPAGDGLGYRFELLPDTAAGPGVTLAESTISASKGGK  351

Query  574   FCID--------NARKHSASSLS-----------PVRGFVMCSSV--EGKNGFLSVQVAV  458
             F ID         AR  S+S  S             RGFVM S+V  EG  G  +V+V V
Sbjct  352   FAIDLTGAGGNPLARTPSSSGRSGELVRRPSPCRGYRGFVMSSTVASEGTGGPPAVEVGV  411

Query  457   NHVNCMadaalfvalsaAIDLSMDACQLFSTKLRK  353
              HV C  DAA FVAL+AA+DLSM+AC+LFS KLR+
Sbjct  412   QHVGCAEDAAAFVALAAAVDLSMNACRLFSHKLRR  446



>gb|AAP68894.1| unknown protein [Oryza sativa Japonica Group]
Length=404

 Score =   287 bits (734),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 196/456 (43%), Positives = 247/456 (54%), Gaps = 98/456 (21%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++ +                                      LPL  A   
Sbjct  1     MDPCPFVRVLVGN--------------------------------------LPLVVA---  19

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKP-------------VALKLSVFAGRMGQTCG  1247
              D      S A A  FHL  + L   + KP               LK++V+AGR G TCG
Sbjct  20    -DGGEQAPSGALAAAFHLSKADLEWFARKPSLLFSSSSSSRGPATLKVAVYAGRKGTTCG  78

Query  1246  ITSGKLLGVVQVAVDLSGAQSRPVVFQSGW-----KKLGGGGADKPMLHVVVRSEPDPRF  1082
             ++SG+L+G   + VDL GA+++  V  SGW     K  G GG+    L + VR+EPDPRF
Sbjct  79    VSSGRLIGKATIPVDLKGAEAKAAVVHSGWICVGKKSGGKGGSAAAELSLTVRAEPDPRF  138

Query  1081  VFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDR  902
             VF+F GEPECSP V Q++GS++QP+F+CKF    N+  R          R  ++T     
Sbjct  139   VFEFDGEPECSPQVLQVRGSMKQPMFTCKFGCRSNSDLR----------RSVVQTERDAA  188

Query  901   DRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSS  722
                GKERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWLILRP G    S
Sbjct  189   AAAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRPAGD--GS  246

Query  721   WKPWGRLEAWRERGSV---DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARK  551
             W+PWGRLE WRERG     + LGY+F+L+   G    +P+AE ++   KGG+F ID    
Sbjct  247   WEPWGRLECWRERGGAGASNSLGYRFDLLL-PGVDHAVPLAESSIAASKGGKFAIDLTSM  305

Query  550   HSAS-----SLSP---------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMa  437
                S       SP                RGFVM SSV  EG+    +V+V V HV C  
Sbjct  306   QPQSRGGTPGCSPRGSGDFSQWPLASYSYRGFVMSSSVQGEGRCSKPTVEVGVPHVGCAE  365

Query  436   daalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             DAA FVAL+AA+DLSMDAC+LFS KLRKE  H   D
Sbjct  366   DAAAFVALAAAVDLSMDACRLFSHKLRKELSHLRSD  401



>gb|KFK39297.1| hypothetical protein AALP_AA3G226300 [Arabis alpina]
Length=489

 Score =   289 bits (740),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 198/485 (41%), Positives = 269/485 (55%), Gaps = 83/485 (17%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-----VHPSTTPCYAKLKFSSFPSQTALLPLC  1403
             MDPC FVR+I+ ++AV+ P+ +  +  G     +  S   C+ K++F SFP Q   +P+ 
Sbjct  1     MDPCSFVRIIVGNLAVRFPTTSSSSSSGPSVSGITASAPNCFCKIRFKSFPRQIVTVPVM  60

Query  1402  SALPKDDSSSPTDSFAS--AEGFHLDPSALRRLSEKPVALKLSVFA---------GRMGQ  1256
                  +  +S      S  A  F L  + +    +KP    LSV           G  G 
Sbjct  61    FRTESESETSRCSGNISTVAACFSLSKTQIEASLKKPRWSVLSVETYSRGSSDGDGLSGA  120

Query  1255  TCGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGG--GGADK------PMLHVVV  1106
             +CG+ +   KL+G  +V+VDL  A+++  +  +GW  LG   GG  +      P LHV V
Sbjct  121   SCGLATANEKLIGRFEVSVDLKAAETKTCLAHNGWVALGSKKGGKSRNKAGSDPELHVSV  180

Query  1105  RSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNR-TRSLPSDFSL----  941
             R EPDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF +  +N   R+L    S+    
Sbjct  181   RVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLIHSCSMMSDS  240

Query  940   -NSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPG  764
              +SR  + +   ++++P KERKGW I ++DLSGS VA ASM+TPFVPSPGS+RV+RS+PG
Sbjct  241   ISSRSCISSMKSEKEQPSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPG  300

Query  763   AWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKK  584
             AWLILRP+G    +WKPWGRLEAWRE G  D LGY+FEL  D G  + +  A  ++++K 
Sbjct  301   AWLILRPDG---CTWKPWGRLEAWRETGYSDTLGYRFELFQD-GIATAVS-ASSSISLKN  355

Query  583   GGRFCIDNARKHSASSL-------------------------------------------  533
             GG F ID     +A+S                                            
Sbjct  356   GGSFAIDVTGGTTAASTPSTSPQGSWDLGSGSSAGSRPASRPGSGSGSDFGYLLPQHPSL  415

Query  532   -SPVRGFVMCSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTK  362
              +  RGFVM ++VE  GK     V+V V HV C  DAA  VAL+AA+DLS+DAC+LFS K
Sbjct  416   AAQNRGFVMSATVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACRLFSHK  475

Query  361   LRKEF  347
             LRKE 
Sbjct  476   LRKEL  480



>ref|XP_004173988.1| PREDICTED: uncharacterized protein LOC101228095 [Cucumis sativus]
Length=208

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 163/203 (80%), Gaps = 7/203 (3%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVRL+++S+A+ LP AT+PAG  VHPS TPC+ K+   +FPSQTALLPL S    
Sbjct  1     MDPCPFVRLMVDSLALNLPQATRPAGAAVHPSATPCFCKISIKNFPSQTALLPLSSV---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGVVQVA  1208
                 SP DS AS+ GFHLDPS+LRRLS KPV + LSVFAGRMG TCG+ SGKLLG V++ 
Sbjct  58    -SGDSPPDSAASSAGFHLDPSSLRRLSGKPVVMCLSVFAGRMGHTCGVNSGKLLGRVRIT  116

Query  1207  VDLSGAQSRPVVFQSGWKKLGGGGADK--PMLHVVVRSEPDPRFVFQFGGEPECSPVVFQ  1034
             V + GA+S+P VFQ+GW KL G G DK    LH+VVRSEPDPRFVFQFG EPECSPVVFQ
Sbjct  117   VSIDGAESKPKVFQNGWVKL-GKGEDKISARLHLVVRSEPDPRFVFQFGSEPECSPVVFQ  175

Query  1033  IQGSIRQPVFSCKFSAERNNRTR  965
             IQG+IRQPVFSCKFSA+RN+RTR
Sbjct  176   IQGNIRQPVFSCKFSADRNSRTR  198



>ref|XP_008367920.1| PREDICTED: uncharacterized protein LOC103431533 [Malus domestica]
Length=239

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 182/228 (80%), Gaps = 10/228 (4%)
 Frame = -2

Query  985  ERNNRTRSLPSDFSL--NSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITP  812
             +N    SL SD++   N+RGWMRT SG++  P +ERKGWMI I+DLSGS VAAASMITP
Sbjct  14   NKNMDVLSLQSDYTTINNNRGWMRTLSGEK--PWRERKGWMITIHDLSGSPVAAASMITP  71

Query  811  FVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAG  632
            FVPSPG+DRVSRSNPGAWLILRP+G S+SSWKPWGRLEAWRERG +DGLGYKFELVTD G
Sbjct  72   FVPSPGTDRVSRSNPGAWLILRPHGFSISSWKPWGRLEAWRERGPIDGLGYKFELVTDNG  131

Query  631  FTSGIPIAEGAMNVKKGGRFCIDN--ARKHSASSLSPVRGFVMCSSVEGKNGFLS---VQ  467
             +S I IAEG M+VKKGG+FCID+   R     S SPV+GFV  S+VEG  G +S   VQ
Sbjct  132  PSSSITIAEGTMSVKKGGQFCIDSRLNRDSGLKSRSPVKGFVTGSTVEGX-GKVSKPVVQ  190

Query  466  VAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDSY  323
            V V HV CMADAALFVALSAAIDLSMDAC+LFS KLR+E CHDE + +
Sbjct  191  VGVQHVTCMADAALFVALSAAIDLSMDACRLFSHKLRRELCHDEQNCF  238



>ref|XP_010042246.1| PREDICTED: uncharacterized protein LOC104431287 [Eucalyptus grandis]
Length=297

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 173/219 (79%), Gaps = 7/219 (3%)
 Frame = -2

Query  973  RTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPG  794
             TRSL SDF  +SRGWMRT S +R+R  +E KGWM+ I+DLSGS VAAASM+TPFVPSPG
Sbjct  83   ETRSLASDFP-SSRGWMRTLSRERERHSREPKGWMVTIHDLSGSPVAAASMVTPFVPSPG  141

Query  793  SDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIP  614
            SD VSRSNPGAWLILRPNG S+SSWKPWGRLEAWRERG  DGLGYKFELVT+ G T GIP
Sbjct  142  SDLVSRSNPGAWLILRPNGYSISSWKPWGRLEAWRERGPTDGLGYKFELVTEGGPTRGIP  201

Query  613  IAEGAMNVKKGGRFCIDNARKHSASSLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCM  440
            IAE  M+VKKGG+F ID      +S  SPV+GFVM S+V  EGK    +VQV V HV CM
Sbjct  202  IAEATMSVKKGGQFSIDVG----SSLKSPVKGFVMASTVEAEGKTSKPAVQVGVQHVTCM  257

Query  439  adaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHDSY  323
             DAALF+ALSAA DLSMDACQLFS KLRKE CHD+   Y
Sbjct  258  PDAALFIALSAAFDLSMDACQLFSHKLRKELCHDDQHCY  296



>gb|KCW56839.1| hypothetical protein EUGRSUZ_I02507, partial [Eucalyptus grandis]
Length=408

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 186/407 (46%), Positives = 235/407 (58%), Gaps = 47/407 (12%)
 Frame = -2

Query  1450  LKFSSFPSQTALLPLCSALPKDDSSSPTDSFAS-AEGFHLDPSALRRLSEKPVALKLSVF  1274
             +K ++ P Q A LPL S  P D S  P  S    A  F L    L +L+ +   L++ V 
Sbjct  1     VKLANLPPQHASLPLTS--PPDRSPEPHPSSQPLAACFSLPKPLLEKLALQNPTLRIEVH  58

Query  1273  AGRMGQTCGITSG-KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSE  1097
              GR G  CG+  G KL+G V V +DL  A++R     SGW  +G    +K  L+V VR+E
Sbjct  59    RGRFGGACGLVGGSKLIGKVSVPLDLRRAEARAASVHSGWVDIGRKSGEK--LYVSVRAE  116

Query  1096  PDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN-----RTRSLPSDFSLNSR  932
             PDPRFVF+F  EPECSP VFQ+QGS++QPVF+C FS  RNN              +  SR
Sbjct  117   PDPRFVFEFEKEPECSPQVFQVQGSVKQPVFTCNFSF-RNNVGDRSLRSRSSLSETSTSR  175

Query  931   GWMRTFSG-DRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWL  755
              W+ +  G D+D   KERKGW + I+DLSGS VAAASM+TPFVPSPGSDRVSRSNPGAWL
Sbjct  176   SWIPSLVGSDKDSHSKERKGWSVTIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWL  235

Query  754   ILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGR  575
             I+RP      +W+PWGRLEAW E GS D L ++FEL+ +    +   +A  ++++K GG+
Sbjct  236   IIRPEH---GTWRPWGRLEAWLEHGSSDMLSHRFELLPNTTTATTGTVANSSISIKNGGK  292

Query  574   FCIDNARKHSASSLSPVR-----------------------------GFVMCSSVEGKNG  482
             F ID     S  S                                  GFVM S+++G N 
Sbjct  293   FTIDLTNSVSPMSSPSSSMDLGGGSWSGSGSGSDFVGLGLWPNSVPGGFVMSSTMQGVNK  352

Query  481   FL--SVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
                  V+V V HV C  DAA FVAL+AAIDLSMDAC+LFS KLR E 
Sbjct  353   ASKPQVEVGVQHVTCTEDAAAFVALAAAIDLSMDACKLFSRKLRTEL  399



>ref|XP_010541837.1| PREDICTED: uncharacterized protein LOC104815217 [Tarenaya hassleriana]
Length=480

 Score =   288 bits (736),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 196/478 (41%), Positives = 268/478 (56%), Gaps = 78/478 (16%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTP-------CYAKLKFSSFPSQTALLP  1409
             MDPC FVR+++ ++AV+ P ++  +         P       CY K++F +FP Q   +P
Sbjct  1     MDPCSFVRILVGNLAVRFPGSSSSSSGPSVSGKNPSSASSPNCYCKIRFKNFPRQIVTVP  60

Query  1408  LCSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFA-----GRMGQTCGI  1244
             + S  P+ D+ +  ++ + A  F L  + +    +KP    LSV A     G  G +CG+
Sbjct  61    ILSR-PESDARTAGNTSSIAACFSLCKTQIETYLKKPKWSVLSVEAFSREGGDGGASCGL  119

Query  1243  TSG--KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGA----------DKPMLHVVVRS  1100
               G  K LG  +V++DL  A++R  +  SGW  LG   A            P LHV VR 
Sbjct  120   ADGGEKFLGRFEVSLDLKTAETRACLAHSGWVALGSKKAGMMKKKNKPGSDPELHVRVRV  179

Query  1099  EPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKF----SAERNNRTRSLPSDFSLNSR  932
             EPDPRFVFQF GEPECSP VFQ+QG+ +Q VFSCKF    S +RN  + S  S+    SR
Sbjct  180   EPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFSCKFGFRNSGDRNLMSSSSMSE-LSASR  238

Query  931   GWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLI  752
               + +   ++++  KERKGW I I+DLSGS VA ASM+TPFVPSPGS+RV+RS+PG+WLI
Sbjct  239   SCLSSLKTEKEQQSKERKGWSITIHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGSWLI  298

Query  751   LRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRF  572
             LRP+G    +WKPW RLEAWRE G  D LGY+ EL  D G ++ +  +  ++ +KKGG+F
Sbjct  299   LRPDG---FTWKPWCRLEAWREPGFSDNLGYRLELFHD-GVSTAV-SSSSSITMKKGGKF  353

Query  571   CIDNARKHSASSLSPV-----------------------------------------RGF  515
              ID      + + +P                                          +GF
Sbjct  354   FIDLTNSGGSLASTPSTSPNESWDLGSGSSSGSRPGSRPGSGSGSDFGFLLPPQQQNKGF  413

Query  514   VMCSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             VM ++V   G+   L V+V V HV C  DAA+ VAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  414   VMSATVGGVGERSRLEVEVGVGHVTCTEDAAVHVALAAAVDLSMDACRLFSHKLRKEL  471



>ref|XP_002883199.1| hypothetical protein ARALYDRAFT_479485 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59458.1| hypothetical protein ARALYDRAFT_479485 [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score =   288 bits (736),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 197/485 (41%), Positives = 273/485 (56%), Gaps = 84/485 (17%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG----VHPSTTPCYAKLKFSSFPSQTALLPLCS  1400
             MDPC FVR+I+ ++AV+  S++  +       ++PS   CY K++F +FP +   +P+  
Sbjct  1     MDPCSFVRIIVGNLAVRFQSSSSSSSGPSVSGINPSAPNCYCKIRFKNFPREIVSIPVMF  60

Query  1399  ALPKDDSSSPTDSFAS--AEGFHLDPSALRRLSEKPVALKLSVFA----------GRMGQ  1256
                 +  +  +    S  A  F L  + +    +KP    LSV A          G  G 
Sbjct  61    RTESESETRSSSGNVSTVAACFSLSKAQIEASLKKPKLSVLSVEAFSRGNCDGDDGVSGA  120

Query  1255  TCGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGWKKL------GGGGADKPMLHVVVRS  1100
             +CG+ +   KLLG  +V++DL  A+++  +  +GW  L         G+D P LHV VR 
Sbjct  121   SCGLATAGEKLLGRFEVSLDLKSAETKSCLAHNGWVALPSKKSKSKSGSD-PELHVSVRV  179

Query  1099  EPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKF------SAERNNRTRSLPSDFSLN  938
             EPDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF      S +RN    S     S +
Sbjct  180   EPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLLHSSSMMSESSS  239

Query  937   SRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAW  758
             +R  + + + ++++P KERKGW I ++DLSGS VA ASM+TPFVPSPGS+RV+RS+PGAW
Sbjct  240   TRSCISSMNSEKEQPSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAW  299

Query  757   LILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGG  578
             LILRP+G    +WKPWGRLEAWRE G  D LGY+FEL  D G  + +  A  ++++K GG
Sbjct  300   LILRPDG---CTWKPWGRLEAWREAGYSDTLGYRFELFQD-GIATAVS-ASSSISLKNGG  354

Query  577   RFCID----------------------------NAR------------------KHSASS  536
              F ID                            ++R                  +H +S+
Sbjct  355   SFVIDVTGGTTTTASTPTTSPQGSWDLGSGSSADSRPASRPGSGSGSDFGYLLPQHPSSA  414

Query  535   LSPVRGFVMCSSVE--GKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTK  362
              +  RGFVM ++VE  GK     V+V V HV C  DAA  VAL+AA+DLS+DAC+LFS K
Sbjct  415   AAQNRGFVMSATVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACRLFSHK  474

Query  361   LRKEF  347
             LRKE 
Sbjct  475   LRKEL  479



>ref|XP_004230673.1| PREDICTED: uncharacterized protein LOC101258701 [Solanum lycopersicum]
Length=436

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 198/458 (43%), Positives = 262/458 (57%), Gaps = 67/458 (15%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR++I  +A+K PS +    P  + ST  C  KL+  S  S T      SA  +
Sbjct  1     MDPCPFVRIVIGGLALKFPSESSKILP--NNSTFDCKIKLRGCSAQSSTI-----SAFVQ  53

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEK------PVALKLSVFAGRMGQTCGITSGKLL  1226
             +      +       F+   S L +  EK      P  LK+ ++ G++G   G  S +LL
Sbjct  54    EREVILDNRIHGC--FNFSKSELVKFVEKSNVRGNPSCLKIEIYGGKVG--FGYGSKRLL  109

Query  1225  GVVQVAVDLSGAQS---RPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
             G V V +DL   ++   R  V  +GW  +G G   +  L++ VR+EPDPRFVFQF GEPE
Sbjct  110   GSVVVPLDLKSLENIGHRGFVIHNGWVSVGCGSTAE--LNLNVRAEPDPRFVFQFDGEPE  167

Query  1054  CSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             CSP VFQ+ G+++QPVF+CKFS     +RN R+RS  S+ S  S     + + DR+   K
Sbjct  168   CSPQVFQVNGNVKQPVFTCKFSFRNSGDRNLRSRSSLSEPS-TSTSCFGSCTSDREISVK  226

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I ++DLSGS VAAASM+TPFVPS GSDRVS+SNPG+WLILRP     ++WKPWG
Sbjct  227   ERKGWSITVHDLSGSPVAAASMVTPFVPSQGSDRVSKSNPGSWLILRPGD---NTWKPWG  283

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP  527
             RLEAWRER     LGY+FE++ D G T  I +    ++ KKGG+  ID    + A+ L+ 
Sbjct  284   RLEAWRERNGE--LGYRFEIIPD-GATDAITLVNSTISTKKGGKIGIDII--NGATPLTS  338

Query  526   ------------------------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNC  443
                                            RGFVM  +V  EGK     V+V V HV+C
Sbjct  339   PNSSFDLSSGSGSGSDFGSQPGSGSWAQLLYRGFVMSGTVGGEGKCTKPEVEVGVQHVSC  398

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
               DAA FVAL+AA+DLS+DAC+ FS KLRKE    + +
Sbjct  399   AEDAAAFVALAAAMDLSIDACRSFSQKLRKELRQQDQE  436



>ref|XP_006646307.1| PREDICTED: uncharacterized protein LOC102706623 [Oryza brachyantha]
Length=356

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 162/286 (57%), Positives = 202/286 (71%), Gaps = 21/286 (7%)
 Frame = -2

Query  1123  MLHVVVRSEPDPRFVFQFGGEPECSPVVFQI-----QGSIRQPVFSCKFSA-ERNNRTRS  962
              +H+VVR+EPDPR+VFQFGGEPEC PVV+Q+      G  RQPVF+C+FSA  R  RTRS
Sbjct  71    QIHMVVRAEPDPRYVFQFGGEPECGPVVYQVPGGAGGGGQRQPVFTCRFSAGRRATRTRS  130

Query  961   LPSDFSLNS------RGWMRTFSGDRDRPGK--ERKGWMIIIYDLSGSSVAAASMITPFV  806
             L S+ S+        R W+ T  GDRD   +  +RKGW + I+DLSGS VAAASM+TPFV
Sbjct  131   LTSESSMTRSTGRKLRSWLSTLHGDRDAQARREQRKGWTVTIHDLSGSPVAAASMVTPFV  190

Query  805   PSP-GSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGF  629
             PSP GS RVSR+NPG+WLIL+P G   +SWKPW RLEAWRERG VD LGY+ ELV D+G 
Sbjct  191   PSPAGSGRVSRANPGSWLILQPTGAGPASWKPWARLEAWRERGPVDALGYRLELVFDSGP  250

Query  628   TS-GIPIAEGAMNVKKGGRFCIDNARKHSASSLSP---VRGFVMCSSV--EGKNGFLSVQ  467
             T   +PIAE +++ K+GG+F ID A     ++ +P     GFVM S+V  EG+    ++Q
Sbjct  251   TECAVPIAESSISTKRGGQFVIDPATFPVGAAGAPWPFSGGFVMGSTVEGEGRTSRPTLQ  310

Query  466   VAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             V V H  CM D ALFVAL+AA+DL MDAC+LFS +LRKE  HD+ D
Sbjct  311   VGVQHATCMGDVALFVALAAAVDLCMDACKLFSQRLRKELYHDQED  356



>ref|XP_007157186.1| hypothetical protein PHAVU_002G049700g [Phaseolus vulgaris]
 gb|ESW29180.1| hypothetical protein PHAVU_002G049700g [Phaseolus vulgaris]
Length=416

 Score =   282 bits (722),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 188/441 (43%), Positives = 257/441 (58%), Gaps = 61/441 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG--VHPSTTP--CYAKLKFSSFPSQTALLPLCS  1400
             MDPCPF R+++ ++AVK P+++KP+     VHPST+P  C  +LK   +    +   +CS
Sbjct  1     MDPCPFQRILVGNLAVKSPASSKPSSFSGKVHPSTSPLFCKIQLKGVDWDDSVSCSNVCS  60

Query  1399  ALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLGV  1220
                  +      S A++  F      + ++S+K   +K+SV+ G    +C   S KL+G 
Sbjct  61    VPVITEWDPQPRSLAAS--FDFSKPKIVKVSKK-AQIKISVYKGAATPSCVFNSAKLIGK  117

Query  1219  VQVAVDLSGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECSPVV  1040
             + + VDL+ A+SRP  F +GW  L         LH+ VR +PDPRFVF+F GEPECSP V
Sbjct  118   ISIPVDLTLAESRPCTFHNGWLPLTKTTNQAQFLHLTVRVDPDPRFVFRFDGEPECSPQV  177

Query  1039  FQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIII  860
             FQI+G ++QPVF+CKFS  R+      PS  + NS                ERKGW I +
Sbjct  178   FQIKGDVKQPVFTCKFSF-RDKNPAHFPSPNNANSSA--------------ERKGWSITV  222

Query  859   YDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERG  680
             +DLSGS VAAASM TPFVPSPGS RVSRSNPGAWLI+RP+G    +WKPWGRLEAWRE  
Sbjct  223   HDLSGSPVAAASMATPFVPSPGSQRVSRSNPGAWLIIRPDGD--GTWKPWGRLEAWREPN  280

Query  679   SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPV--------  524
             + + +GY+F+++        + +A   ++ + GG+F ID     + S ++P+        
Sbjct  281   NSNAVGYRFQIL--PATADPVTLAASTISSQHGGKFTID-----ATSGVTPLSTPRGSWD  333

Query  523   --------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvals  410
                                 +GFVM ++V  EGK     V+V V HV C  DAA FVAL+
Sbjct  334   LGSGSGSSLDSGLEAIPFFSKGFVMSATVDGEGKCSKPEVEVGVQHVTCTEDAAAFVALA  393

Query  409   aAIDLSMDACQLFSTKLRKEF  347
             AA+DLSMDAC+LFS KLRKE 
Sbjct  394   AALDLSMDACKLFSQKLRKEL  414



>ref|XP_008777938.1| PREDICTED: uncharacterized protein LOC103697788 [Phoenix dactylifera]
 ref|XP_008777939.1| PREDICTED: uncharacterized protein LOC103697788 [Phoenix dactylifera]
 ref|XP_008777940.1| PREDICTED: uncharacterized protein LOC103697788 [Phoenix dactylifera]
Length=431

 Score =   282 bits (721),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 182/439 (41%), Positives = 255/439 (58%), Gaps = 42/439 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDP  FVRL I S+ +++P     A  GV  +++ C  +++   FP QTA +P+ S    
Sbjct  1     MDPQAFVRLSIASLGLRIPMEASKALRGVIHASSQCLCEIRLRGFPVQTASVPVIST---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLS-----EKPVA-LKLSVFAGRMGQTCGITSGKL-  1229
                +SP D   +A  F+L+ S ++ L      + P A L++ VF GR G  CG+TS K  
Sbjct  58    -PEASP-DLHGNATIFYLEKSDVKALMAPGCFQPPQAYLEIVVFMGRQGSHCGVTSRKQQ  115

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK----PMLHVVVRSEPDPRFVFQFGGE  1061
             +G  +V V     + +P +  +GW  +G    D     P LH+ V+ +PDPR+VFQF  E
Sbjct  116   IGTFRVEVGPEWGEGKPALLHNGWIGIGKNKQDAGKPGPELHLRVKLDPDPRYVFQFQDE  175

Query  1060  PECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKER  881
                SP + Q+QG+I+QP+FSCKFS +R        S        W+ +   D+D   +ER
Sbjct  176   TALSPQIVQLQGTIKQPIFSCKFSRDRR------ASQLDTVGNNWLSSNCEDQDADRRER  229

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRL  701
             KGW I+I+DLSGS+VAAA M TPFVPS G DRV+RSNPGAWLILRP+    S W PWGRL
Sbjct  230   KGWKIMIHDLSGSAVAAAFMATPFVPSMGCDRVARSNPGAWLILRPDAAGSSGWHPWGRL  289

Query  700   EAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARK----------  551
             EAWRE GS D +  +  L+ + G  +G+ ++E  ++ +KGG F ID  R+          
Sbjct  290   EAWRETGSRDSVCLRLHLLPE-GQEAGVLVSEALISSEKGGEFYIDMDRQTPVGTPVPSS  348

Query  550   -----HSASSLSPVR--GFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAID  398
                  +  +SL+ +   GFVM   V  EGK    SVQ+A+ HV C+ DAA+F+AL+AA+D
Sbjct  349   QGGTGYFTTSLAGLMAGGFVMNCRVQGEGKISKPSVQLAMRHVTCVEDAAIFMALAAAVD  408

Query  397   LSMDACQLFSTKLRKEFCH  341
             LS+ AC+ F    RK F H
Sbjct  409   LSIKACRPFRRNARKGFRH  427



>ref|XP_009610822.1| PREDICTED: uncharacterized protein LOC104104441 [Nicotiana tomentosiformis]
Length=437

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 201/461 (44%), Positives = 264/461 (57%), Gaps = 72/461 (16%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR++I ++A+K P+  K +      S+T    K K   F +Q + +P   A  +
Sbjct  1     MDPCPFVRIVIGNLALKFPAEHKLS------SSTVFDCKFKLRGFSTQISTIP---AFIQ  51

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEK------PVALKLSVFAGRMGQTCGITSGKLL  1226
             D    P     +   F+L+ + L +L EK        +LK+ +FA + G  CG+  G  L
Sbjct  52    D----PILENRTHSCFNLNKTELDKLVEKSSIRGKTCSLKIEIFARKKGIGCGLLKGGKL  107

Query  1225  GV-VQVAVDLSGAQS---RPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEP  1058
                V V +DL G +S   R VV Q  W  L G  +    LH+ V++EPDPRFVFQF GEP
Sbjct  108   LGSVLVPLDLKGLESNGRRGVVIQDEWV-LVGRSSTAAQLHLNVKAEPDPRFVFQFDGEP  166

Query  1057  ECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLN----SRGWMRTFSGDRDRPG  890
             ECSP V+Q+ G+++QPVF+CKFS  RNN  R+L S  SL+    S     + + D++   
Sbjct  167   ECSPQVYQVNGNVKQPVFTCKFSF-RNNGDRNLRSRSSLSEPSTSTSCFNSCTADKELSS  225

Query  889   -KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRP-NGPSVSSWK  716
               ERKGW I I+DLSGS +AAASM+TPFVPS GS+ VSRSNPGAWLILRP NG    +WK
Sbjct  226   LTERKGWSITIHDLSGSPIAAASMVTPFVPSQGSNNVSRSNPGAWLILRPGNG----TWK  281

Query  715   PWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASS  536
             PWGRLEAWRE G    LGY+FE++ D G T  I ++   ++ K GG+F +D    + A+ 
Sbjct  282   PWGRLEAWREHGG--DLGYRFEIIPD-GATDAITLSNSTISTKNGGKFSVDIT--NGATP  336

Query  535   LSP------------------------------VRGFVMCSSVE--GKNGFLSVQVAVNH  452
             L+                                RGFVM S+VE  GK     V V V H
Sbjct  337   LTSPNSSFDLCSGSGSGSDFGSAPGSGSWAQLLYRGFVMSSTVEGDGKCSKPEVVVGVQH  396

Query  451   VNCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
             VNC  DAA FVAL+AA+DLSMDA Q F+ KLRKE    + +
Sbjct  397   VNCAEDAAAFVALAAAMDLSMDASQSFTKKLRKELRQSDQE  437



>dbj|BAJ89116.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 166/340 (49%), Positives = 214/340 (63%), Gaps = 45/340 (13%)
 Frame = -2

Query  1261  GQTCGITSGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLG----GG--GADKPMLHVVVRS  1100
             G TCG++SG+LLG   +++DL GA+++P V  SGW  +G    GG  G+    L + VR+
Sbjct  2     GTTCGVSSGRLLGKATISLDLKGAEAKPAVLHSGWISVGRRGVGGKAGSAAAELSLTVRA  61

Query  1099  EPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMR  920
             EPDPRFVF+F GEPECSP V Q++GS++QP+F+CKF    N+  R          R   +
Sbjct  62    EPDPRFVFEFDGEPECSPQVMQVRGSMKQPMFTCKFGCRTNSDLR----------RSVAQ  111

Query  919   TFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPN  740
             T   +R+  GKERKGW + ++DLSGS VA ASM+TPFV SPG+DRVSRSNPGAWLILRP 
Sbjct  112   T---EREAAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRPA  168

Query  739   GPSVSSWKPWGRLEAWRER---GSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFC  569
             G    +W+PWGRLE WRER   GS D LGY+F+L+   G    +PIA+  +   KGG+F 
Sbjct  169   GD--GAWEPWGRLECWRERGGAGSSDSLGYRFDLLV-PGVDHAVPIADSTIAASKGGKFA  225

Query  568   IDNARKHSASS------------------LSPVRGFVMCSSVEGKN--GFLSVQVAVNHV  449
             +D       S                   L   RGFVM ++VEG+      +V+V V HV
Sbjct  226   LDLTAAQPLSRGSTPGCSPRGSGDFSQWPLGNYRGFVMSAAVEGEGRCSKPTVEVGVAHV  285

Query  448   NCMadaalfvalsaAIDLSMDACQLFSTKLRKEFCHDEHD  329
              C  DAA FVAL+AA+DLSMDAC+LFS KLRK+  H   D
Sbjct  286   GCAEDAAAFVALAAAVDLSMDACRLFSHKLRKKLSHLRSD  325



>ref|XP_001760212.1| predicted protein [Physcomitrella patens]
 gb|EDQ74968.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   280 bits (716),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 178/432 (41%), Positives = 253/432 (59%), Gaps = 41/432 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             M+  PF+R+ +  + V++P + K +  GVH + +PC  ++    FP++T  + L S    
Sbjct  1     MESRPFIRVAVCGLGVRIPISAKASRGGVHAAASPCECEISLPHFPTETVPISLVSP---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRL-------SEKPVALKLSVFAGRMGQTCGITSGKL  1229
              +SS+  D   +A  F+LD SAL +L             L+++VF  +          + 
Sbjct  58    -NSSATPDFNDTAASFYLDESALEKLLLPSCMPRRTIPCLEVAVFLRK----------QK  106

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGAD--KP----MLHVVVRSEPDPRFVFQFG  1067
             LG  ++AV L  A+  P V  SGW  +G    D  KP     LHV V+ E DPR++FQF 
Sbjct  107   LGTFRLAVTLDWAEGNPAVLHSGWTSIGSAKVDGGKPGAGAELHVAVKVEADPRYMFQFD  166

Query  1066  GEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNS-RGWMRTFSGDRDRPG  890
                  SP + Q+    +Q +FSCKFS ++ +R R +   F ++S   W  +      R  
Sbjct  167   KVTALSPQIIQVSSKNQQSIFSCKFSRDKLSRCRLVLFSFDISSSTAWHTSLESREKR--  224

Query  889   KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPW  710
             KERKGW+++I+DLSGS VAAASM+TPFVPS GSD V+RSNPGAWLILRP  P   +W+PW
Sbjct  225   KERKGWLVMIHDLSGSPVAAASMVTPFVPSAGSDYVARSNPGAWLILRPESPGADNWRPW  284

Query  709   GRLEAWRERGSVDGLGYKFELVTDAGFTSGIP----IAEGAMNVKKGGRFCIDNARK---  551
             GRLEAWR+RG  D +G +F+L+ + G  +G+      +E  ++ KKGG F +D ARK   
Sbjct  285   GRLEAWRDRGGKD-MGCRFQLMAEGGGVTGVSSGVLTSEITLSAKKGGEFTMD-ARKFTQ  342

Query  550   HSASSLSPVRGFVMCSSVEGKNGFLS--VQVAVNHVNCMadaalfvalsaAIDLSMDACQ  377
              S+S +SPV  FVM   V G        VQVA+ HV+C+ D A+F+AL+AA+DLS+DACQ
Sbjct  343   ESSSGISPVEKFVMICGVRGDRDSSKPLVQVAMRHVSCVEDVAVFIALAAAVDLSVDACQ  402

Query  376   LFSTKLRKEFCH  341
              F  +LRKE   
Sbjct  403   PFKRRLRKELAE  414



>ref|XP_006393185.1| hypothetical protein EUTSA_v10011462mg [Eutrema salsugineum]
 gb|ESQ30471.1| hypothetical protein EUTSA_v10011462mg [Eutrema salsugineum]
Length=460

 Score =   281 bits (719),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 199/468 (43%), Positives = 254/468 (54%), Gaps = 78/468 (17%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKL-------PSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLP  1409
             MDPC FVR+I+ ++A++         S +         S+  CY K+KF SF  Q   +P
Sbjct  1     MDPCTFVRIIVGNLALRFRGSPSSSSSTSSSGPSVSDVSSGNCYCKIKFKSFSRQIVAVP  60

Query  1408  LCSALPKDDSSSPT----DSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGIT  1241
             +   L  +  S P     +  A A  F L   A+ R  +KP    +SV       +CGI 
Sbjct  61    V--LLRTESESEPRCCSGNVSAVAACFTLSK-AIERSLKKPKWSVVSVEVYSRVASCGIV  117

Query  1240  SG---KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGAD------KPMLHVVVRSEPDP  1088
             +G   KL+G  +V++DL  A++R  +  +GW KLG            P LH  +R EPDP
Sbjct  118   AGSGEKLIGRFEVSLDLKTAETRTCLAHNGWVKLGTKSKKKTKSGSDPELHATIRVEPDP  177

Query  1087  RFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSG  908
             RFVFQF GEPECSP V Q+QG+ +Q VF+CKF   RN+  R+L    S  S G  +T   
Sbjct  178   RFVFQFDGEPECSPQVLQVQGNTKQAVFTCKFGF-RNSGDRNLTPSLSSLSIGKEQTL--  234

Query  907   DRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSV  728
                   KERKGW I I+DLSGS VA ASM+TPFVPSPGS+RV+RS+PGAWLILRP+G ++
Sbjct  235   ------KERKGWSITIHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLILRPDGYTM  288

Query  727   SSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID----N  560
                KPWGRLEAWRE G  D LGY+FE   D   T+    A  +M+ K GG F ID     
Sbjct  289   ---KPWGRLEAWRESGISDVLGYRFEFFKDG--TATAISASSSMSTKHGGSFVIDGTITT  343

Query  559   ARKHSASSLS-----------------------------------PVRGFVMCSSVEG--  491
             A   +A+SLS                                      GFVM + VEG  
Sbjct  344   ASTMAAASLSLSDGSFDLSSCLSTGSSRTCSGSGSDFGFLVPQAQQNLGFVMSTMVEGVE  403

Query  490   KNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             K     V+V V HV C+ DAA  VAL+AA+DLS+DAC+LFS KLRKE 
Sbjct  404   KQSMPKVEVGVKHVTCLEDAAAHVALAAAVDLSLDACKLFSRKLRKEL  451



>ref|XP_006355293.1| PREDICTED: uncharacterized protein LOC102593921 [Solanum tuberosum]
Length=427

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 194/446 (43%), Positives = 260/446 (58%), Gaps = 64/446 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPF+R+II  +AV +P A +     V      C  KLK   FP+Q + +   +A  K
Sbjct  1     MDPCPFLRIIIADLAVMVP-ANRSLTSSV---LLDCNIKLK--GFPTQVSTI---NAFSK  51

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSE--KPVALKLSVFAGR-MGQTCGI-TSGKLLGV  1220
              D        AS   F+L+ + + + +   K   LK+ + A + MG  CG  T G++LG 
Sbjct  52    QDLVLENKIHAS---FNLNKTDIEKTNARGKTCCLKIEICAPKSMGIGCGYYTGGRILGS  108

Query  1219  VQVAVDLSGAQS---RPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPECS  1049
             V V +DL G +S   R VV ++GW  +G        +H+ V+ EPDPRFVFQF GEPECS
Sbjct  109   VFVELDLKGLESKGSRGVVIKNGWVLVG-----VAKVHLNVKVEPDPRFVFQFDGEPECS  163

Query  1048  PVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKER  881
             P VFQ+ G+++QPVF+CKFS     + N+ +RS  S+ S  S+     ++ D +   KER
Sbjct  164   PQVFQVNGNVKQPVFTCKFSFKNSGDWNSISRSSLSEGS-TSKSCFNCWTADNETRRKER  222

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRL  701
             KGW++ I+DLSGS +AAASM+TPFVPS GS++VSRSNPGAWLILRP+     +WKPWGRL
Sbjct  223   KGWLVTIHDLSGSPIAAASMVTPFVPSQGSNKVSRSNPGAWLILRPDQ---GTWKPWGRL  279

Query  700   EAWRERGSVDG-LGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-------NARKHS  545
             +AW E   + G LGY+FE++ D G    I +    ++ K GG+F ID        A  HS
Sbjct  280   QAWLE---ISGKLGYRFEIIPD-GANDAITLVNSTISTKNGGKFSIDISNVAIPMASAHS  335

Query  544   ASSLSPV------------------RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaal  425
             +   S V                  RGFVM S+V  +GK     V V   HV+C  DAA 
Sbjct  336   SFDFSSVSGSWSDFGSSGSWGQILYRGFVMSSTVKGDGKCSKPEVVVGAQHVSCSEDAAA  395

Query  424   fvalsaAIDLSMDACQLFSTKLRKEF  347
             FV L+AA+DLSMDAC+ FS  LRKE 
Sbjct  396   FVVLAAAMDLSMDACRSFSQTLRKEL  421



>ref|XP_003610647.1| hypothetical protein MTR_5g005420 [Medicago truncatula]
 gb|AES93605.1| DUF1005 family protein [Medicago truncatula]
Length=417

 Score =   277 bits (709),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 184/452 (41%), Positives = 251/452 (56%), Gaps = 82/452 (18%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-VHPSTTPCYAKLKFSSF----PSQTALLPLC  1403
             MDPC F+R++I ++A+K PS++KP+  G VHPS++ CY ++K        P   A +PL 
Sbjct  1     MDPCSFLRILIGNLAIKSPSSSKPSFSGKVHPSSSTCYCEIKLKGVDSPPPFHVATVPLI  60

Query  1402  SALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLG  1223
             S        S T   + A  F    S +     K   +K+SVF      +C   + KL+G
Sbjct  61    S-------ESETHPHSLAATFDFPKSQISNF--KNPLIKISVFKTNTNPSCVFNTAKLVG  111

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKL-----GGGGADKPMLHVVVRSEPDPRFVFQFGGEP  1058
              + + +DL+  +SRP  F +GW  L     G       +LH+ VR+EPDPRF+F+F GEP
Sbjct  112   QISIPLDLTLVESRPCSFHNGWTALTLNNTGKSSVQGQLLHLTVRAEPDPRFIFRFDGEP  171

Query  1057  ECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
             ECSP VFQ++G ++QPVF+CKFS    N +   P  F                 P  +RK
Sbjct  172   ECSPQVFQVKGEVKQPVFTCKFSFRDKNPSN--PVQF-----------------PSMDRK  212

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I I+DLSGS VA ASM+TPFVPSPGS RVS+SNPGAWLI++P+G    +WKPWGRLE
Sbjct  213   GWSITIHDLSGSPVACASMVTPFVPSPGSQRVSKSNPGAWLIIKPDGDG--TWKPWGRLE  270

Query  697   AWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPVR-  521
             AWRE G  + +GY+F+++        + +A  +++ + GG+F ID       S ++PV  
Sbjct  271   AWREPGYSNSVGYRFDVLPATA--DPVTLAGCSISSQNGGKFTID-----VTSGVTPVNT  323

Query  520   --------------------------------GFVMCSSVEG--KNGFLSVQVAVNHVNC  443
                                             GFVM +  +G  K     V+V V HV C
Sbjct  324   PNGSWDLGSGSGSRPGSGSGSDFSLENQFLYSGFVMSARFDGEKKCSKPEVEVGVKHVTC  383

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
               DAA FVAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  384   TEDAAAFVALAAAMDLSMDACKLFSQKLRKEL  415



>gb|AFK43684.1| unknown [Medicago truncatula]
Length=417

 Score =   277 bits (708),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 184/452 (41%), Positives = 251/452 (56%), Gaps = 82/452 (18%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPG-VHPSTTPCYAKLKFSSF----PSQTALLPLC  1403
             MDPC F+R++I ++A+K PS++KP+  G VHPS++ CY ++K        P   A +PL 
Sbjct  1     MDPCSFLRILIGNLAIKSPSSSKPSFSGKVHPSSSTCYCEIKLKGVDSPPPFHVAAVPLI  60

Query  1402  SALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFAGRMGQTCGITSGKLLG  1223
             S        S T   + A  F    S +     K   +K+SVF      +C   + KL+G
Sbjct  61    S-------ESETHPHSLAATFDFPKSQISNF--KNPLIKISVFKTNTNPSCVFNTAKLVG  111

Query  1222  VVQVAVDLSGAQSRPVVFQSGWKKL-----GGGGADKPMLHVVVRSEPDPRFVFQFGGEP  1058
              + + +DL+  +SRP  F +GW  L     G       +LH+ VR+EPDPRF+F+F GEP
Sbjct  112   QISIPLDLTLVESRPCSFHNGWTALTLNNTGKSSVQGQLLHLTVRAEPDPRFIFRFDGEP  171

Query  1057  ECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERK  878
             ECSP VFQ++G ++QPVF+CKFS    N +   P  F                 P  +RK
Sbjct  172   ECSPQVFQVKGEVKQPVFTCKFSFRDKNPSN--PVQF-----------------PSMDRK  212

Query  877   GWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLE  698
             GW I I+DLSGS VA ASM+TPFVPSPGS RVS+SNPGAWLI++P+G    +WKPWGRLE
Sbjct  213   GWSITIHDLSGSPVACASMVTPFVPSPGSQRVSKSNPGAWLIIKPDGDG--TWKPWGRLE  270

Query  697   AWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSPVR-  521
             AWRE G  + +GY+F+++        + +A  +++ + GG+F ID       S ++PV  
Sbjct  271   AWREPGYSNSVGYRFDVLPATA--DPVTLAGCSISSQNGGKFTID-----VTSGVTPVNT  323

Query  520   --------------------------------GFVMCSSVEG--KNGFLSVQVAVNHVNC  443
                                             GFVM +  +G  K     V+V V HV C
Sbjct  324   PNGSWDLGSGSGSRPGSGSGSDFSLENQFLYSGFVMSARFDGEKKCSKPEVEVGVKHVTC  383

Query  442   MadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
               DAA FVAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  384   TEDAAAFVALAAAMDLSMDACKLFSQKLRKEL  415



>ref|XP_010275162.1| PREDICTED: uncharacterized protein LOC104610306 [Nelumbo nucifera]
Length=432

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 176/433 (41%), Positives = 257/433 (59%), Gaps = 38/433 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGP-GVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDP  FVRL I S+ +++P A   AG  G+H S++PC  +++   FP QTA +PL S+  
Sbjct  1     MDPQAFVRLSIGSLGLRIPVAASKAGQIGIHASSSPCSCEIRLRGFPVQTAPVPLISS--  58

Query  1390  KDDSSSPTDSFASAEGFHLDPSALR------RLSEKPVALKLSVFAGRMGQTCGITSGKL  1229
                + +  D  + A  F+L+ S ++      RL      L++ VF G  G  CG+ S K 
Sbjct  59    ---AEATPDLHSIATIFYLEESDVKTLLGPGRLHPSRAYLEIIVFTGWKGFHCGVNSKKQ  115

Query  1228  -LGVVQVAVDLSGAQSRPVVFQSGWKKLG----GGGADKPMLHVVVRSEPDPRFVFQFGG  1064
              +G  ++ V     + + V+  +GW  +G     GG  +  LH+ V+ +PDPR+VFQF  
Sbjct  116   QIGKFRLQVSPEWGEGKSVLLHNGWTGIGKNKQDGGKPRAELHLRVKLDPDPRYVFQFED  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             E   SP + Q++G+I+QP+FSCKFS +R        S+  +++     T+  D+D   +E
Sbjct  176   ETALSPQIVQLRGTIKQPIFSCKFSRDRRASQLDSVSNHRVST-----TYGTDQDTDRRE  230

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW ++I+DLSGS+VAAA M TPFVPS G DRV+RSNPGAWLI+RP+     SW+PWG+
Sbjct  231   RKGWRVMIHDLSGSAVAAAFMATPFVPSMGCDRVARSNPGAWLIVRPDAFGPDSWQPWGK  290

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA------  542
             LEAWRERG  D +  +F L+++      + ++E  ++  KGG F ID  R+  +      
Sbjct  291   LEAWRERGIKDSICCRFHLLSEGQEGGDLLVSEILISADKGGVFFIDTERRTPSVTPLPS  350

Query  541   -------SSLSPV-RGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLS  392
                    +SL PV  GFVM   V  EGK+    VQ+A+ HV C+ DAA+F+AL+AA+DLS
Sbjct  351   PRSSGDFASLGPVFGGFVMNCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAVDLS  410

Query  391   MDACQLFSTKLRK  353
             M AC+ F  K +K
Sbjct  411   MVACRPFRRKPKK  423



>ref|XP_010691530.1| PREDICTED: uncharacterized protein LOC104904833 [Beta vulgaris 
subsp. vulgaris]
Length=479

 Score =   278 bits (712),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 200/483 (41%), Positives = 269/483 (56%), Gaps = 89/483 (18%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPC F+R++I ++A+K  ++T         S+T CY K+K S F  Q A +P+   +P 
Sbjct  1     MDPCQFLRIVIGNLAIKFSNSTCTT------SSTACYCKIKLSGFSEQAATVPI---VPT  51

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRL------------------SEKPVALKLSVFAGRM  1262
             D +         +  F+L  S L +L                  +   + LK+ V+  + 
Sbjct  52    DLAHPDAQIQTVSACFNLTKSDLEKLIKSKTTTTSKSRNTTTTTTTTRLNLKMDVYTTKS  111

Query  1261  GQTCGI-TSGKLLGVVQVAVDLSG---AQSRPVVFQSGWKKLGGGGAD--KPMLHVVVRS  1100
              + CG  +SGKLLG V + ++LS          + Q+GW  +G        P L++ V++
Sbjct  112   PEGCGFGSSGKLLGTVSIPLELSQQVLEGKTSTMMQNGWVLVGERKKKGLNPQLYLSVKA  171

Query  1099  EPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSR  932
             +PDPRFVF+F GEPECSP VFQ+QG+IRQPVF+CKFS    AE N R+ S  S+ S  SR
Sbjct  172   QPDPRFVFEFDGEPECSPQVFQVQGNIRQPVFTCKFSFRQPAEHNLRSSSAMSEPS-TSR  230

Query  931   GWMRTFSGDRDRPG------KERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSN  770
              W+ T   D+D         KERKGW I ++DLSGS VAAASM+TPFVPS GS++VS+SN
Sbjct  231   SWLSTLKPDKDHHHRNRHQVKERKGWSITVHDLSGSPVAAASMVTPFVPSQGSNKVSKSN  290

Query  769   PGAWLILRPNGPSVSSWKPWGRLEAWRERG--SVDGLGYKFELVTDAGFT------SGIP  614
             PGAWLILRP      +WKPWGRLEAWRER     +GLG++FEL+ DAG        +GI 
Sbjct  291   PGAWLILRPG---EGTWKPWGRLEAWRERTGPGSEGLGHRFELLPDAGPIATAMGPTGIT  347

Query  613   IAEGAMNVKKGGRFCID-----------------------NARKHSASSLSP--------  527
             +A+ ++  + GG+F ID                        +   S S + P        
Sbjct  348   LAQASIPARAGGKFSIDVTAGPSPAGSPNSSFDFGSWTGSGSTSSSGSEVGPGSGWWPGL  407

Query  526   -VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLR  356
               +GFV  S+V  EGK     V+V   HV C  DAA FVAL+AA+DLSMDAC+ FS KLR
Sbjct  408   LYKGFVTSSTVGGEGKGNKPVVEVGAQHVTCTEDAAAFVALAAAMDLSMDACRPFSQKLR  467

Query  355   KEF  347
             KE 
Sbjct  468   KEL  470



>gb|EYU37533.1| hypothetical protein MIMGU_mgv1a018154mg [Erythranthe guttata]
Length=439

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 193/451 (43%), Positives = 251/451 (56%), Gaps = 62/451 (14%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++ ++ + LP  +       + S    Y K K    PSQ + + L      
Sbjct  1     MDPCPFVRIVVGNLGLILPEKS-------NLSAFSFYCKFKLKGLPSQISDVSLLPGGEN  53

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSV-------FAGRMGQTCGITSGKL  1229
             D   +      +     L+  A +  S     LK+ +            G    ++ GKL
Sbjct  54    DAVDARIHGCFALSKLELEKLADKSGSSSSACLKIEIRRRIGIGRTSGGGGCGLVSGGKL  113

Query  1228  LGVVQVAVDLSGAQSR--PVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQFGGEPE  1055
             LG V V +DL          V Q+GW  +GG G     LH+ VR+EPDPRFVF F GEPE
Sbjct  114   LGSVAVQLDLKSILENMGKSVIQNGWVMIGGSGVK---LHLNVRAEPDPRFVFLFDGEPE  170

Query  1054  CSPVVFQIQGSIRQPVFSCKFS----AERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
             CSP VFQ+ G+++QPVF+CKFS     + N R+RS  S+ S ++  +    S + +   K
Sbjct  171   CSPQVFQVNGNVKQPVFTCKFSFRNSGDWNLRSRSGLSEPSTSTNCFN---SIENEHAAK  227

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW I I+DLSGS VAAASM+TPFVPSPG++RVSRSNPGAWLILR   P  S+WKPWG
Sbjct  228   ERKGWSITIHDLSGSPVAAASMVTPFVPSPGTNRVSRSNPGAWLILR---PVQSTWKPWG  284

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-----------N  560
             RLEAWR+R   D LGY+F+L++D G    IP+A   ++ K GG+F +D           N
Sbjct  285   RLEAWRDRTRGDRLGYRFDLLSDCG-VDAIPLASSDISTKNGGKFNVDITTGPTPLTSPN  343

Query  559   ARKHSASSLSP-----------------VRGFVMCSSVEGKNGFLS---VQVAVNHVNCM  440
             +     S                      RGFVM S+VEG +G  S   V+V V HV C 
Sbjct  344   SSFDLGSGSGSGSDLGSGYGSGSWANLLYRGFVMSSTVEG-DGRCSKPKVEVGVQHVACT  402

Query  439   adaalfvalsaAIDLSMDACQLFSTKLRKEF  347
              DAA FVAL+AA+DLSMDAC+ FS KLRKE 
Sbjct  403   EDAAAFVALAAAMDLSMDACRSFSRKLRKEL  433



>ref|XP_002891552.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67811.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=459

 Score =   277 bits (709),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 198/464 (43%), Positives = 250/464 (54%), Gaps = 71/464 (15%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTP-----CYAKLKFSSFPSQTALLPLC  1403
             MDPC FVR+I+ ++AV+ P ++  +     PS +      CY K+KF SFP Q   +P+ 
Sbjct  1     MDPCSFVRIIVGNLAVRFPRSSSSSSSSSGPSVSDVSSGNCYCKIKFKSFPRQIVSVPVL  60

Query  1402  SALPKDDSSSPTDSFAS--AEGFHLDPSALRRLSEKPVALKLSV-FAGRMGQTCGITSG-  1235
                  +  S       S  A  F L  S +    +KP    LSV    R G +CG  +  
Sbjct  61    LRTESESESRCCSGNVSTVAACFSLSKSQIETSLKKPKWSVLSVEVYSRGGASCGFVAAS  120

Query  1234  --KLLGVVQVAVDLSGAQSRPVVFQSGWKKLG------GGGADKPMLHVVVRSEPDPRFV  1079
               KL+G  +V +DL  A+++     +GW  LG            P LHV VR EPDPRFV
Sbjct  121   GEKLIGRFEVTLDLKAAETKTCFAHNGWVDLGTKSKNKKKSESDPELHVSVRVEPDPRFV  180

Query  1078  FQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRD  899
             FQF GEPECSP VFQ+QG+ +Q VF+CKF   RN+  R+L    S  + G        ++
Sbjct  181   FQFDGEPECSPQVFQVQGNTKQAVFTCKFGF-RNSGDRNLSLSLSSLTSG--------KE  231

Query  898   RPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSW  719
             +  KERKGW I I+DLSGS VA ASM+TPFVPSPGS+RVSRSNPGAWLILRP+G    +W
Sbjct  232   QFLKERKGWSITIHDLSGSPVAMASMVTPFVPSPGSNRVSRSNPGAWLILRPDG---YTW  288

Query  718   KPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNAR-----  554
             KPWGRL+AWRE G  D LGY+FEL  D    +    A  +++ K GG F ID +      
Sbjct  289   KPWGRLQAWREPGVSDVLGYRFELYKDG--IAIAVSASSSISTKFGGSFSIDGSTATTTT  346

Query  553   ---------------------------------KHSASSLSPVRGFVMCSSVEG--KNGF  479
                                              + S S      GFVM + VEG  K   
Sbjct  347   RTASLSSSEGSFDLSSWSSIRSSRTDSGSGSDFRFSLSQAQQNLGFVMSTRVEGVEKQSK  406

Query  478   LSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
               V+V V HV C  DAA  VAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  407   PKVEVGVKHVTCREDAAAHVALAAAVDLSMDACRLFSHKLRKEL  450



>ref|XP_010266416.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
 ref|XP_010266417.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
 ref|XP_010266418.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
 ref|XP_010266419.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
Length=431

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 173/438 (39%), Positives = 260/438 (59%), Gaps = 39/438 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKL-PSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDP  FVRL I S+ +++  SA K    G+H S++PC  +++   FP QTA +PL S+  
Sbjct  1     MDPQAFVRLSIGSLGLRITASAAKAGQSGIHASSSPCSCEIRLRGFPVQTASVPLISS--  58

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRL------SEKPVALKLSVFAGRMGQTCGITSGKL  1229
                + +  D  + A  F+L+ S +R L            L+++VF G  G  CG++S K 
Sbjct  59    ---AEATPDPHSIATSFYLEESDVRALLAPGCFHPSNAYLEIAVFTGWQGFHCGVSSKKQ  115

Query  1228  -LGVVQVAVDLSGAQSRPVVFQSGWKKLG----GGGADKPMLHVVVRSEPDPRFVFQFGG  1064
              +G  ++ V     + + ++   GW ++G      G  +  LH+ V+ +PDPR+VFQF  
Sbjct  116   QIGTFKLQVSPQWGEGKSLLLHHGWTRIGKNKQADGKPRAELHLRVKLDPDPRYVFQFED  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             E   SP + Q++G+++QP+FSCKFS +R        S++  ++R  M     D +   +E
Sbjct  176   ETTLSPQIVQLRGAVKQPIFSCKFSRDRRASQLDPMSNYWSSTRNGM-----DEEAERRE  230

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW ++IYDLSGS+VAAA M TPFVPS G DRV+RSNPGAWLI+RP+     SW+PWG+
Sbjct  231   RKGWKVMIYDLSGSAVAAAFMATPFVPSTGCDRVARSNPGAWLIVRPDACMPESWQPWGK  290

Query  703   LEAWRERGSV-DGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA-----  542
             LEAWRERG + D +  +F L+++     G+ ++E  ++  KGG F ID  R+  +     
Sbjct  291   LEAWRERGGIRDSICCRFHLLSEGQEGGGLLVSEKLISADKGGVFVIDTDRQTPSATPVP  350

Query  541   --------SSLSP-VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDL  395
                     +SL+P V GFVM   V  EGK+    VQ+A+ HV C+ DAA+F+AL+AA+DL
Sbjct  351   SPRSSGDFASLAPIVGGFVMNCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAVDL  410

Query  394   SMDACQLFSTKLRKEFCH  341
             S++AC+ F  K ++   H
Sbjct  411   SVEACRPFRRKSKRGTRH  428



>ref|XP_010056513.1| PREDICTED: uncharacterized protein LOC104444526 [Eucalyptus grandis]
 ref|XP_010056515.1| PREDICTED: uncharacterized protein LOC104444526 [Eucalyptus grandis]
 ref|XP_010056516.1| PREDICTED: uncharacterized protein LOC104444526 [Eucalyptus grandis]
 gb|KCW73287.1| hypothetical protein EUGRSUZ_E01747 [Eucalyptus grandis]
Length=431

 Score =   275 bits (702),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 172/435 (40%), Positives = 250/435 (57%), Gaps = 42/435 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSAT-KPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDP  F+RL I S+ +++P +T      G+ P  + C  +++   FP+QT  +PL S+  
Sbjct  1     MDPQAFIRLSIGSLGLRIPGSTLNSVKSGIQPFASSCLCEIRLRGFPAQTLTIPLVSS--  58

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLS------EKPVALKLSVFAGRMGQTCGITSGKL  1229
                  +  D  + A  F+L+ S L+ L+           L++SVF GR G  CG+ + + 
Sbjct  59    ---PEATPDCQSIASSFYLEESDLKALTATGCFYSSQAYLEISVFTGRKGSHCGVGNKRQ  115

Query  1228  -LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGAD--KP--MLHVVVRSEPDPRFVFQFGG  1064
              LG  ++ V     + +PV+  +GW  +G    D  KP   LH+ V+ +PDPR+VFQF  
Sbjct  116   QLGTFKLEVSPEWGEGKPVILYNGWIGIGKSKLDSGKPGAELHLRVKLDPDPRYVFQFED  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
                 SP + Q+QGSIRQP+FSCKFS +R  +   L       S  W      D++   +E
Sbjct  176   VTRLSPQIVQLQGSIRQPIFSCKFSQDRVTQVDPL-------STYWSAIEGSDQETERRE  228

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW + I+DLSGS+VAAA + TPFVPS G D V++SNPGAW+I+RP+     SW+PWG+
Sbjct  229   RKGWKVKIHDLSGSAVAAAFITTPFVPSNGCDWVAKSNPGAWVIVRPDPYRPESWQPWGK  288

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP-  527
             LEAWRERG  D +  +F L+++        ++E  +N +KGG F ID  R+  AS  +P 
Sbjct  289   LEAWRERGMRDSICCRFRLLSEGQEGGEFLVSEININAEKGGEFFIDTDRQMRASGPTPI  348

Query  526   ---------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAID  398
                            V GFVM   V  EGKN    VQ+A+ HV C+ DAA+F+AL+AA+D
Sbjct  349   PSPRSSGDFGGLSPVVGGFVMSCKVRGEGKNSKPLVQLAMRHVTCVEDAAIFMALAAAVD  408

Query  397   LSMDACQLFSTKLRK  353
             LS++AC+ F  K+R+
Sbjct  409   LSIEACRPFRRKIRR  423



>ref|XP_010905311.1| PREDICTED: uncharacterized protein LOC105032546 [Elaeis guineensis]
Length=432

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 180/440 (41%), Positives = 248/440 (56%), Gaps = 43/440 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDP  FVRL I S+ +++P     A  GV  S++ C  +++   FP QTA +PL S    
Sbjct  1     MDPQAFVRLSIGSLGLRIPVEASKALRGVTHSSSQCLCEIRLRGFPVQTASVPLIST---  57

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLS-----EKPVA-LKLSVFAGRMGQTCGITSGKL-  1229
                +SP D   +   F+L+ S ++ L      + P A L++ VF GR G  CG+T  K  
Sbjct  58    -PEASP-DPHGNDTVFYLEKSDVKALMAPGCFQPPQAYLEIVVFMGRQGSHCGVTGRKQQ  115

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGADK----PMLHVVVRSEPDPRFVFQFGGE  1061
             +G  +V V     + +  +  +GW  +G    D     P LH+ V+ +PDPR+VFQF  E
Sbjct  116   IGTFRVVVGPEWGEGKSALLHNGWIGIGKNKQDAGKPGPELHLRVKLDPDPRYVFQFQDE  175

Query  1060  PECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKER  881
                SP + Q+QG+I+QP+FSCKFS +R         ++      W+ +   D+D   +ER
Sbjct  176   TALSPQIVQLQGTIKQPIFSCKFSRDRRASQLDTVGNY------WLSSNREDQDADRRER  229

Query  880   KGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRL  701
             KGW I+I+DLSGS+VAAA M TPFVPS G DRV+RSNPGAWLILRP+    S W PWGRL
Sbjct  230   KGWKIMIHDLSGSAVAAAFMATPFVPSMGCDRVARSNPGAWLILRPDAAGSSGWYPWGRL  289

Query  700   EAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP--  527
             EAWRE GS D +  +  L+ D G  +G+ ++E  ++ +KGG F ID  R+    +  P  
Sbjct  290   EAWRETGSRDFVCLRLHLLPD-GQEAGVLVSEVLISSEKGGEFYIDMDRQTPVGTPVPSS  348

Query  526   ----------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAI  401
                               GFVM   V  EGK    SVQ+A+ HV C+ DAA+F+AL+AA 
Sbjct  349   QGGTGDYFTTSLAGSLAGGFVMNCRVQGEGKISKPSVQLAMRHVTCVEDAAIFMALAAAA  408

Query  400   DLSMDACQLFSTKLRKEFCH  341
             DLS+ AC+ F    RK F H
Sbjct  409   DLSIKACRPFRRNARKGFRH  428



>ref|XP_010420061.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Camelina 
sativa]
Length=473

 Score =   274 bits (701),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 159/373 (43%), Positives = 227/373 (61%), Gaps = 44/373 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATK----------PAGPGVHPSTTPCYAKLKFSSFPSQTA  1418
             MDPC FVR+I+ ++AV+ PS++           P+  G++PS   CY K++F +FP +  
Sbjct  1     MDPCSFVRIIVGNLAVRFPSSSSSSSSSSSSSGPSVSGINPSFPNCYCKIRFKNFPREIV  60

Query  1417  LLP-LCSALPKDDSSSPTDSFASAEGFHLDPSALRRLSEKPVALKLSVFA--------GR  1265
              +P +      D  +  + S   A  F L  S +    +KP    LSV A        G 
Sbjct  61    SIPVMFRTESSDSETRSSSSSTVAACFSLSKSQIEASLKKPKWSVLSVEAFSRGYTDDGV  120

Query  1264  MGQTCGITSG--KLLGVVQVAVDLSGAQSRPVVFQSGW----KKLGGGGADK------PM  1121
              G +CG+ +   KLLG  +V++DL  A+++  +  +GW     K GG  ++K      P 
Sbjct  121   TGASCGLATAGEKLLGRFEVSLDLKSAETKTCLAHNGWVPLGSKKGGSKSNKSKTGSDPE  180

Query  1120  LHVVVRSEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNN-------RTRS  962
             LHV VR EPDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF +  +N        + S
Sbjct  181   LHVTVRVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLLHSSS  240

Query  961   LPSDFSLNSRGWMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRV  782
             + S+  +++R  + +   ++++P KERKGW + ++DLSGS VA ASM+TPFVPSPGS+RV
Sbjct  241   MMSEL-ISTRSLISSMKSEKEQPSKERKGWSVTVHDLSGSPVAMASMVTPFVPSPGSNRV  299

Query  781   SRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEG  602
             +RS+PGAWLILRP+G    +WKPWGRLEAWRE G  D LGY+F+L  D G  + +  A  
Sbjct  300   TRSSPGAWLILRPDG---CTWKPWGRLEAWREAGYSDTLGYRFDLFQD-GIATAVS-ASS  354

Query  601   AMNVKKGGRFCID  563
             ++++K GG F ID
Sbjct  355   SISLKNGGSFVID  367



>ref|XP_002268337.1| PREDICTED: uncharacterized protein LOC100245378 [Vitis vinifera]
Length=430

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 170/439 (39%), Positives = 256/439 (58%), Gaps = 41/439 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPS-ATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDP  F+RL I S+ +++P  A   A  G+H   +PC  +++   FP QT+ +PL S+  
Sbjct  1     MDPQAFIRLSIGSLGLRIPGPALNAAKSGIHAVPSPCSCEIRLRGFPVQTSSVPLVSS--  58

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRL------SEKPVALKLSVFAGRMGQTCGI-TSGK  1232
                  +  DS + A  F+L+ S L+ L            L++ VF GR G  CG+    +
Sbjct  59    ---PEATPDSHSIASSFYLEESDLKALLAPGCFYAPHACLEIVVFTGRKGSHCGVGIKRQ  115

Query  1231  LLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGAD--KP--MLHVVVRSEPDPRFVFQFGG  1064
              +G  ++ V     + +PV+   GW  +G    +  KP   LH+ V+ +PDPR+VFQF  
Sbjct  116   QIGTFKLEVGPEWGEKKPVILFHGWIGIGKNKQESGKPGAELHLRVKLDPDPRYVFQFED  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
                 SP + Q+QG+I+QP+FSCKFS +R ++   L + +S ++       S +++   +E
Sbjct  176   VATSSPQIVQLQGTIKQPIFSCKFSRDRVSQVDPLSTYWSGSAD------SSEQETERRE  229

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW + I+DLSGS+VAAA + TPFVPS G D V+RSNPGAWLI+RP+     SW+PWG+
Sbjct  230   RKGWKVKIHDLSGSAVAAAFITTPFVPSTGCDWVARSNPGAWLIVRPDACRPESWQPWGK  289

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP-  527
             LEAWRERG  D +  +F L+++      + ++E  +N +KGG F ID  R+  A++ +P 
Sbjct  290   LEAWRERGIRDSICCRFHLLSEGQDGGELLMSEIFINAEKGGEFFIDTDRQVRAAATTPI  349

Query  526   ---------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAID  398
                            V GFVM   V  EGK+    VQ+A+ H+ C+ DAA+F+AL+AA+D
Sbjct  350   PSPQSSGDFAALAPAVGGFVMSCRVQGEGKSSKPLVQLAIRHITCVEDAAIFMALAAAVD  409

Query  397   LSMDACQLFSTKLRKEFCH  341
             LS++AC+ F  K R+  CH
Sbjct  410   LSIEACRPFRRKFRRGNCH  428



>ref|XP_010478443.1| PREDICTED: uncharacterized protein LOC104757404 [Camelina sativa]
Length=466

 Score =   272 bits (696),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 193/472 (41%), Positives = 247/472 (52%), Gaps = 84/472 (18%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTP--------CYAKLKFSSFPSQTALL  1412
             MDPC FVR+I+ ++AV+ P +   +      S           CY K+KF SFP +   +
Sbjct  1     MDPCSFVRIIVGNLAVRFPRSPSSSSSSSSSSGPSVSDVSSGNCYCKIKFKSFPRKIVTV  60

Query  1411  PLCSALPKDDSSSPTDSFAS-----AEGFHLDPSALRRLSEKPVALKLSVFAGRMG-QTC  1250
             P+      +  S     F+      +  F L  S +    +KP    LSV     G  +C
Sbjct  61    PVLLRTESESESESRCCFSGNVSNVSACFSLSKSQIEASLKKPKWSVLSVEVYSRGVASC  120

Query  1249  GITSG----KLLGVVQVAVDLSGAQSRPVVFQSGWKKLG-----GGGADKPMLHVVVRSE  1097
                +     KL+G   V++DL  A+++  +  +GW  LG           P LHV VR E
Sbjct  121   RFVAAASGDKLIGRFDVSIDLKAAETKTCLAHNGWVDLGTKSKKKKSGSNPELHVSVRVE  180

Query  1096  PDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKF----SAERNNRTRSLPSDFSLNSRG  929
             PDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF    SA+R+  T       S     
Sbjct  181   PDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGFRNSADRSLTTSLSSLSLSSGKEQ  240

Query  928   WMRTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLIL  749
             +M           KERKGW I I+DLSGS VA ASM+TPFVPSPGS+RVSRS+PGAWLIL
Sbjct  241   FM-----------KERKGWSITIHDLSGSPVAMASMVTPFVPSPGSNRVSRSSPGAWLIL  289

Query  748   RPNGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPI-AEGAMNVKKGGRF  572
             RP+G    +WKPWGRL+AWRE  + D LGY+FEL  D      IP+ A  ++N K GG F
Sbjct  290   RPDG---YTWKPWGRLQAWREPETSDVLGYRFELFQDG---VAIPVSASSSINTKLGGSF  343

Query  571   CIDNARKHSASSLS-------------------------------------PVRGFVMCS  503
              ID +   + +SL+                                        GFVM +
Sbjct  344   IIDGSTTCTTASLTGSGESYDLTSRSSMESSRTGSGSSAGSDFGFSLPQAQQKLGFVMST  403

Query  502   SVEG--KNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRK  353
             +VEG  K     V+V V HV C  DAA  VAL AA+DLSMDAC+LFS KLRK
Sbjct  404   TVEGVEKQSRPKVEVGVKHVTCTEDAAAHVALGAAVDLSMDACRLFSHKLRK  455



>ref|XP_010500559.1| PREDICTED: uncharacterized protein LOC104777930 [Camelina sativa]
Length=465

 Score =   272 bits (696),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 195/469 (42%), Positives = 252/469 (54%), Gaps = 79/469 (17%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTP--------CYAKLKFSSFPSQTALL  1412
             MDPC FVR+ + ++AV+ P +   +      S           CY K+KF  FP +   +
Sbjct  1     MDPCSFVRITVGNLAVRFPRSPSSSSSSSSSSGPSVSDVSSGNCYCKIKFKRFPRKIVTV  60

Query  1411  PLCSALPKDDSSSPTDSFAS-----AEGFHLDPSALRRLSEKPVALKLSVFAGRMG-QTC  1250
             P+      +  S     F+      A  F L  S +    +KP    LSV     G  +C
Sbjct  61    PVLLRTESESESETRCCFSGNVSTVAACFSLSKSQIEASLKKPKWSVLSVEVYSRGVASC  120

Query  1249  GITSG----KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGAD------KPMLHVVVRS  1100
                +     KL+G  +V++DL  A+++  +  +GW  LG   +        P LHV VR 
Sbjct  121   RFVAAASGDKLIGRFEVSLDLKAAETKTCLAHNGWVDLGTTKSKKKKSGSDPELHVSVRV  180

Query  1099  EPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMR  920
             EPDPRFVFQF GEPECSP VFQ+QG+ +Q VF+CKF   RN+  RSL +  S  S G   
Sbjct  181   EPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGF-RNSADRSLSTSLSSLSSG---  236

Query  919   TFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPN  740
                  +++  KERKGW I I+DLSGS VA ASM+TPFVPSPGS+RVSRS+PGAWLILRP+
Sbjct  237   -----KEQFMKERKGWSITIHDLSGSPVAMASMVTPFVPSPGSNRVSRSSPGAWLILRPD  291

Query  739   GPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPI-AEGAMNVKKGGRFCID  563
             G    +WKPWGRL+AWRE G  D LGY+FEL  D      IP+ A  ++N K GG F ID
Sbjct  292   G---YTWKPWGRLQAWREPGISDVLGYRFELFQDG---VAIPVSASSSINTKLGGSFIID  345

Query  562   NARKHSASSLS-------------------------------------PVRGFVMCSSVE  494
              +   + +SL+                                        GFVM ++VE
Sbjct  346   GSVTCTTASLTGSSGESFDLTSRSSMGSSRTGSGSSGSDFGFSLPQAQQKLGFVMSTTVE  405

Query  493   G--KNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRK  353
             G  K     V+V V HV C  DAA  VAL+AA+DLSMDAC+LFS KLRK
Sbjct  406   GVEKQSRPKVEVGVKHVTCTEDAAAHVALAAAVDLSMDACRLFSHKLRK  454



>gb|EPS68322.1| hypothetical protein M569_06448, partial [Genlisea aurea]
Length=436

 Score =   271 bits (693),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 196/459 (43%), Positives = 252/459 (55%), Gaps = 75/459 (16%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDPCPFVR+++ ++A+K P A+         S+   Y K K     SQ +          
Sbjct  1     MDPCPFVRIVVGNLALKFPEASS------RLSSASYYCKFKLRGVASQIS----------  44

Query  1387  DDSSSPTDSFASAEGFH----LDPSALRRLSEKPV---ALKLSVFAGRMGQTCG---ITS  1238
             D S    +  A     H    L    + +L+ K      LK+ +      ++ G   + S
Sbjct  45    DVSHLAAEGDAVESRIHVCLALSKPEIEKLAAKSSDFSTLKIEIRRRGGRESGGCGSLRS  104

Query  1237  GKLLGVVQVAVDL-----SGAQSRPVVFQSGWKKLGGGGADKPMLHVVVRSEPDPRFVFQ  1073
             GKL+G V V +DL     +   +R  V Q+GW  +G  G     LH+ VR+EPDPRFVF 
Sbjct  105   GKLVGCVLVQLDLKNILENSGTNRTSVIQNGWVSIGDSGLK---LHMNVRAEPDPRFVFG  161

Query  1072  FGGEPECSPVVFQIQGSIRQPVFSCKF----SAERNNRTRSLPSDFSLNSRGWMRTFSGD  905
             F GEPECSP VFQ+ GS++QPVFSCKF    S ER  R+RS  +D S +     R+   +
Sbjct  162   FDGEPECSPQVFQVNGSLKQPVFSCKFGFRTSGERALRSRSSATDTSTSLANCFRSAGAE  221

Query  904   RD--RPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPS  731
              D  RP KERKGW I I+DLSGS VAAASM+TPFVPS  SD VS+SNPGAWLILRP    
Sbjct  222   EDEERPLKERKGWSITIHDLSGSPVAAASMLTPFVPSENSDCVSKSNPGAWLILRPG---  278

Query  730   VSSWKPWGRLEAWRERG---SVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCID-  563
               +WKPWGRLEAWRER      D LGY+F+L+ D G  + + +A   +N K GG+F +D 
Sbjct  279   YGTWKPWGRLEAWRERNRGIGGDRLGYRFDLIPDGGIDT-VSLASSTINAKSGGKFSVDI  337

Query  562   ----NARKHSASSLSP---------------------VRGFVMCSSV--EGKNGFLSVQV  464
                      ++SS                         RGFVM S+V  +GK+G   V V
Sbjct  338   TTGFTPMSSTSSSFDLGSASGSGSSSDLGSASWVHLLYRGFVMSSTVRGDGKSGKPEVVV  397

Query  463   AVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
                HV C  DAA FVAL+AA+DLS+DAC+ FS KLRKE 
Sbjct  398   GAQHVTCSEDAAAFVALAAALDLSVDACRPFSRKLRKEL  436



>ref|XP_010461856.1| PREDICTED: uncharacterized protein LOC104742540 [Camelina sativa]
Length=467

 Score =   269 bits (687),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 193/471 (41%), Positives = 253/471 (54%), Gaps = 77/471 (16%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTP-------CYAKLKFSSFPSQTALLP  1409
             MDPCPFVR+ + ++AV+ P ++  +        +        CY K+KF  FP +   +P
Sbjct  1     MDPCPFVRITVGNLAVRFPRSSSSSSSSSSSGPSVSDVSSGNCYCKIKFKRFPRKIFTVP  60

Query  1408  LCSALPKDDSSSPTDSFAS-----AEGFHLDPSALRRLSEKPVALKLSVFAGRMG-QTCG  1247
             +      +  S     F+      A  F L  S +    +KP    LSV     G  +C 
Sbjct  61    VLLRTESESESESRCCFSGNVSTVAACFSLSKSQIEASLKKPKWSVLSVEVYSRGVASCR  120

Query  1246  ITSG----KLLGVVQVAVDLSGAQSRPVVFQSGWKKLG--------GGGADKPMLHVVVR  1103
               +     KL+G  +V +DL  A+++  +  +GW  LG          G+D P LHV VR
Sbjct  121   FVAAASGDKLIGRFEVPLDLKAAETKTCLAHNGWVDLGTKSKKKKKKSGSD-PELHVSVR  179

Query  1102  SEPDPRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWM  923
              EPD RFVFQF GEPECSP VFQ+QG+ +Q VF+CKF   RN   R   S    +     
Sbjct  180   VEPDRRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGF-RNPADRRSLSTSLSSL----  234

Query  922   RTFSGDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRP  743
              + S  ++R  KERKGW I I+DLSGS VA ASM+TPFVPSPGS+RVS S+PGAWLILRP
Sbjct  235   -SLSSGKERLMKERKGWSITIHDLSGSPVAMASMVTPFVPSPGSNRVSPSSPGAWLILRP  293

Query  742   NGPSVSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPI-AEGAMNVKKGGRFCI  566
             +G    +WKPWGRL+AWRE+G+ D LGY+FEL  D      IP+ A  ++N + GG F I
Sbjct  294   DG---YTWKPWGRLQAWREQGTSDVLGYRFELFQDG---VAIPVSASSSINTRLGGSFII  347

Query  565   DNARKHSASSLS------------------------------------PVRGFVMCSSVE  494
             D +   + +SL+                                       GFVM ++VE
Sbjct  348   DGSTTCTTASLTGSGESFDLTSRSSMESSRTGSGSSGSDFGFSLPQGQQKLGFVMSTTVE  407

Query  493   G--KNGFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
             G  K     V+V V HV C  DAA  VAL+AA+DLSMDAC+LFS KLRKE 
Sbjct  408   GAEKQSRPKVEVGVKHVTCTEDAAAHVALAAAVDLSMDACRLFSRKLRKEL  458



>ref|NP_175426.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF76441.1|AC015445_8 ESTs gb|AI994059, gb|T43740 come from this gene [Arabidopsis 
thaliana]
 gb|AAL67079.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14183.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32511.1| uncharacterized protein AT1G50040 [Arabidopsis thaliana]
Length=460

 Score =   268 bits (685),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 192/466 (41%), Positives = 245/466 (53%), Gaps = 74/466 (16%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTP--------CYAKLKFSSFPSQTALL  1412
             MDPC FVR+I+ ++AV+ P +   +      S           CY K+KF SFP Q   +
Sbjct  1     MDPCSFVRIIVGNLAVRFPRSPSSSSSSSSSSGPSVSDVSSGNCYCKIKFKSFPRQIVSV  60

Query  1411  PLCSALPKDDSSSPTDSFAS--AEGFHLDPSALRRLSEKPVALKLSV-FAGRMGQTCGIT  1241
             P+      +  S       S  A  F L  S +    +K     LSV    R   +CG  
Sbjct  61    PVLLRTESESESRCCSGNVSTVAACFSLSKSQIETSLKKAKWSVLSVEVYSRRSASCGFV  120

Query  1240  SG---KLLGVVQVAVDLSGAQSRPVVFQSGWKKLG-------GGGADKPMLHVVVRSEPD  1091
             +    KL+G  QV +DL  A+S+  +  +GW  LG         G+D P LHV VR EPD
Sbjct  121   AASGEKLIGRFQVTLDLKAAESKTCLAHNGWVDLGTKSKNNKKSGSD-PELHVSVRVEPD  179

Query  1090  PRFVFQFGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFS  911
              RFVFQF GEPECSP VFQ+QG+ +Q VF+CKF   RN+  R        N    + + +
Sbjct  180   TRFVFQFDGEPECSPQVFQVQGNAKQAVFTCKFGF-RNSGDR--------NLSLSLSSVT  230

Query  910   GDRDRPGKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPS  731
               +++  KERKGW I I+DLSGS VA ASM+TPFVPSPGS+RVSRS+PGAWLILRP+G  
Sbjct  231   SGKEQFSKERKGWSITIHDLSGSPVAMASMVTPFVPSPGSNRVSRSSPGAWLILRPDG--  288

Query  730   VSSWKPWGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNAR-  554
               +WKPW RL+AWRE G  D LGY+FEL  D    +    A  +++ K GG F ID +  
Sbjct  289   -YTWKPWVRLQAWREPGVSDVLGYRFELYKDG--IAVAVSASSSISTKLGGSFIIDGSTS  345

Query  553   -----------------------------------KHSASSLSPVRGFVMCSSVEG--KN  485
                                                + S S      GFVM + V+G  K 
Sbjct  346   TTTTASWSSSEGSFDLSSWSSIRSSRTDSGSGSDFRFSLSQAQQNLGFVMSTRVQGVEKQ  405

Query  484   GFLSVQVAVNHVNCMadaalfvalsaAIDLSMDACQLFSTKLRKEF  347
                 V+V V HV C  DAA  VAL+AA+DLSMDAC+LFS KLR E 
Sbjct  406   SKPKVEVGVKHVTCTEDAAAHVALAAAVDLSMDACRLFSQKLRNEL  451



>ref|XP_008460086.1| PREDICTED: uncharacterized protein LOC103499002 [Cucumis melo]
 ref|XP_008460087.1| PREDICTED: uncharacterized protein LOC103499002 [Cucumis melo]
Length=428

 Score =   266 bits (681),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 172/438 (39%), Positives = 257/438 (59%), Gaps = 48/438 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP-SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLC---S  1400
             MDP  F+RL I S+ +++P ++     PGV+  ++PC  +++   FP QT+ +PL     
Sbjct  1     MDPQAFIRLSIGSLGLRIPGTSLNSTKPGVNAFSSPCSCEIRLRGFPMQTSSIPLVPSPE  60

Query  1399  ALPKDDSSSPTDSFASAEGFHLDPSALRRL------SEKPVALKLSVFAGRMGQTCGI-T  1241
             A+P        DS   A  F+L+ S L+ L            L++SVF+GR G  CG+  
Sbjct  61    AIP--------DSHVIASSFYLEESDLKALLAPGCFYNTHACLEISVFSGRKGSHCGVGI  112

Query  1240  SGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGG----GGADKPMLHVVVRSEPDPRFVFQ  1073
               +L+G  ++ V       +PV+  +GW  +G      G     LH+ V+ +PDPR+VFQ
Sbjct  113   KRQLIGTFKLDVSPEWGDGKPVILFNGWIGIGKSKNENGRHGAELHLRVKLDPDPRYVFQ  172

Query  1072  FGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             F      SP + Q+QGSI+QP+FSCKFS +R ++  SL + +S    G       D +  
Sbjct  173   FQDVTRSSPQIVQLQGSIKQPIFSCKFSRDRVSQADSLSNYWSGLGDG------SDLEVE  226

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              +ERKGW + I+DLSGS+VAAA + TPFVPS G D V+RSNPG+WLI+RP+     SW+P
Sbjct  227   RRERKGWKVKIHDLSGSAVAAAFITTPFVPSTGCDWVARSNPGSWLIVRPDVCIPESWQP  286

Query  712   WGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSL  533
             WG+LEAWRERG  D +  +F L+++A     + ++E  +N +KGG F ID  ++  A++ 
Sbjct  287   WGKLEAWRERGIRDTVCCRFHLLSEAQEGGELLMSEIHINAEKGGEFFIDTDKQLRAAT-  345

Query  532   SP----------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsa  407
             SP                V GFVM   V  EG++   +VQ+A+ HV C+ DAA+F+AL+A
Sbjct  346   SPIPSPQSSGDFAALGQVVGGFVMSCRVQGEGRSSKPTVQLAMRHVTCIEDAAIFMALAA  405

Query  406   AIDLSMDACQLFSTKLRK  353
             A+DLS++AC+ F  K+R+
Sbjct  406   AVDLSIEACRPFRRKIRR  423



>emb|CAN65847.1| hypothetical protein VITISV_014976 [Vitis vinifera]
Length=430

 Score =   265 bits (677),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 167/437 (38%), Positives = 254/437 (58%), Gaps = 41/437 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPS-ATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDP  F+RL I S+ +++P  A   A  G+H   +PC  +++   FP QT+ +PL S+  
Sbjct  1     MDPQAFIRLSIGSLGLRIPGPALNAAKSGIHAVPSPCSCEIRLRGFPVQTSSVPLVSS--  58

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRL------SEKPVALKLSVFAGRMGQTCGI-TSGK  1232
                  +  DS + A  F+L+ S L+ L            L++ VF GR G  CG+    +
Sbjct  59    ---PEATPDSHSIASSFYLEESDLKALLAPGCFYAPHACLEIVVFTGRKGSHCGVGIKRQ  115

Query  1231  LLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGAD--KP--MLHVVVRSEPDPRFVFQFGG  1064
              +G  ++ V     + +PV+   GW  +G    +  KP   LH+ V+ +PDPR+VFQF  
Sbjct  116   QIGTFKLEVGPEWGEKKPVILFHGWIGIGKNKQESGKPGAELHLRVKLDPDPRYVFQFED  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
                 SP + Q+QG+I+QP+FSCKFS +R ++   L + +S ++       S +++   +E
Sbjct  176   VATSSPQIVQLQGTIKQPIFSCKFSRDRVSQVDPLSTYWSGSAD------SSEQETERRE  229

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW + I+DLSGS+VAAA + TPFVPS G D V+RSNPGAWLI+RP+     SW+PWG+
Sbjct  230   RKGWKVKIHDLSGSAVAAAFITTPFVPSTGCDWVARSNPGAWLIVRPDACRPESWQPWGK  289

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP-  527
             LEAWRERG  D +  +F L+++      + ++E  +N +KGG F ID  R+  A++ +P 
Sbjct  290   LEAWRERGIRDSICCRFHLLSEGQDGGELLMSEIFINAEKGGEFFIDTDRQVRAAATTPI  349

Query  526   ---------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAID  398
                            V GFVM   V  EGK+    VQ+A+ H+ C+ DAA+F+AL+AA+D
Sbjct  350   PSPQSSGDFAALAPAVGGFVMSCRVQGEGKSSKPLVQLAIRHITCVEDAAIFMALAAAVD  409

Query  397   LSMDACQLFSTKLRKEF  347
             LS++AC+ F  K   ++
Sbjct  410   LSIEACRPFRRKYSLKY  426



>ref|XP_004145014.1| PREDICTED: uncharacterized protein LOC101209874 [Cucumis sativus]
 ref|XP_004153015.1| PREDICTED: uncharacterized protein LOC101204096 [Cucumis sativus]
 ref|XP_004160679.1| PREDICTED: uncharacterized protein LOC101224857 [Cucumis sativus]
 gb|KGN46265.1| hypothetical protein Csa_6G078600 [Cucumis sativus]
Length=428

 Score =   265 bits (677),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 172/438 (39%), Positives = 257/438 (59%), Gaps = 48/438 (11%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP-SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLC---S  1400
             MDP  F+RL I S+ +++P ++     PGV+  ++PC  +++   FP QT+ +PL     
Sbjct  1     MDPQAFIRLSIGSLGLRIPGTSLNSTKPGVNAFSSPCSCEIRLRGFPMQTSSIPLVPSPE  60

Query  1399  ALPKDDSSSPTDSFASAEGFHLDPSALRRL------SEKPVALKLSVFAGRMGQTCGI-T  1241
             A+P        DS   A  F+L+ S L+ L            L++SVF+GR G  CG+  
Sbjct  61    AIP--------DSHGIASSFYLEESDLKALLAPGCFYNTHACLEISVFSGRKGSHCGVGI  112

Query  1240  SGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGG----GGADKPMLHVVVRSEPDPRFVFQ  1073
               +L+G  ++ V       +PV+  +GW  +G      G     LH+ V+ +PDPR+VFQ
Sbjct  113   KRQLIGTFKLDVSPEWGDGKPVILFNGWIGIGKSKNENGRHGAELHLRVKLDPDPRYVFQ  172

Query  1072  FGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             F      SP V Q++GSI+QP+FSCKFS +R ++  SL + +S    G       D +  
Sbjct  173   FQDVTRSSPQVVQLRGSIKQPIFSCKFSRDRVSQADSLSNYWSGLGDG------SDLEVE  226

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              +ERKGW + I+DLSGS+VAAA + TPFVPS G D V+RSNPG+WLI+RP+     SW+P
Sbjct  227   RRERKGWKVKIHDLSGSAVAAAFITTPFVPSTGCDWVARSNPGSWLIVRPDVCIPESWQP  286

Query  712   WGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSL  533
             WG+LEAWRERG  D +  +F L+++A     + ++E  +N +KGG F ID  ++  A++ 
Sbjct  287   WGKLEAWRERGIRDTVCCRFHLLSEAQEGGELLMSEIHINAEKGGEFFIDTDKQLRAAT-  345

Query  532   SP----------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsa  407
             SP                V GFVM   V  EG++   +VQ+A+ HV C+ DAA+F+AL+A
Sbjct  346   SPIPSPQSSGDFAALGQVVGGFVMSCRVQGEGRSSKPTVQLAMRHVTCIEDAAIFMALAA  405

Query  406   AIDLSMDACQLFSTKLRK  353
             A+DLS++AC+ F  K+R+
Sbjct  406   AVDLSIEACRPFRRKIRR  423



>ref|XP_002319218.1| hypothetical protein POPTR_0013s06840g [Populus trichocarpa]
 gb|EEE95141.1| hypothetical protein POPTR_0013s06840g [Populus trichocarpa]
Length=428

 Score =   265 bits (676),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 169/433 (39%), Positives = 248/433 (57%), Gaps = 39/433 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSAT-KPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDP  F+RL I S+ +++   T   A  G+   ++PC  +++   FP QT  +PL S+  
Sbjct  1     MDPQAFIRLSIGSLGLRISGTTLNSAQSGLQAFSSPCSCEIRLRGFPVQTIAVPLLSS--  58

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRL------SEKPVALKLSVFAGRMGQTCGI-TSGK  1232
               + +    S AS   F+L+ S L+ L            L+++VF GR G  CG+    +
Sbjct  59    -PEVAPEIHSIASI--FYLEESDLKALLTPGCFYANQACLEIAVFTGRKGSHCGVGIKRQ  115

Query  1231  LLGVVQVAVDLSGAQSRPVVFQSGWKKLGGG----GADKPMLHVVVRSEPDPRFVFQFGG  1064
              +G  ++ V     + +PV+  SGW  +G      G  +  LH+ V+ +PDPR+VFQF  
Sbjct  116   QIGTFKLEVGPEWGEGKPVILFSGWIGIGKNKKESGKPRAELHLRVKLDPDPRYVFQFED  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
                 SP + Q+QGSI+QP+FSCKFS +R  +   L + +S +  G       D +   KE
Sbjct  176   VTTSSPQIVQLQGSIKQPIFSCKFSRDRVTQVDPLSTYWSTSDDG------ADVETERKE  229

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW + I+DLSGS+VAA  + TPFVP+ G D V+RSNPGAWLI+RP+     SW+PWG+
Sbjct  230   RKGWKVKIHDLSGSAVAATFITTPFVPATGCDWVARSNPGAWLIVRPDACRPDSWQPWGK  289

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA------  542
             LEAWRERG  D +  +F L+++      + ++E  ++ +KGG F ID  R+         
Sbjct  290   LEAWRERGIRDSICCRFHLLSEGQEGGEVLMSEILISAEKGGEFFIDTDRQLRTAAAPIP  349

Query  541   --------SSLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLS  392
                     S LSP+ GF+M   V  EGK+    VQ+A+ HV C+ DAA+F+AL+AA+DLS
Sbjct  350   SPQSSGDFSGLSPIVGFIMSCRVQGEGKHNKPLVQLAMRHVTCVEDAAIFMALAAAVDLS  409

Query  391   MDACQLFSTKLRK  353
             + AC+ F  KLRK
Sbjct  410   IVACRPFRRKLRK  422



>ref|XP_011086622.1| PREDICTED: uncharacterized protein LOC105168293 [Sesamum indicum]
Length=429

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 169/433 (39%), Positives = 250/433 (58%), Gaps = 40/433 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP-SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDP  F+RL I S+ +++P +A   A  G+   ++PC  +++   FP QT  +P  S+  
Sbjct  1     MDPQAFIRLSIGSLGIRIPGTAPTAAKSGITAFSSPCVCEIRLRGFPVQTTPIPFISS--  58

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRL------SEKPVALKLSVFAGRMGQTCGI-TSGK  1232
                  +  +S + A  F+L+ S L+ L            L++ VF GR G  CG+ T  +
Sbjct  59    ---PEATPNSHSVASSFYLEESDLKALLAPGCFYASHACLEIVVFTGRKGSHCGVGTKRQ  115

Query  1231  LLGVVQVAVDLSGAQSRPVVFQSGWKKLGGG----GADKPMLHVVVRSEPDPRFVFQFGG  1064
              +G  ++ V     + +PV+  SGW  +G      G     LH+ V+ +PDPR+VFQF  
Sbjct  116   QIGAFKLNVGPEWGEGKPVILFSGWIGIGKNRQESGKPGAELHLRVKLDPDPRYVFQFED  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
             E + SP V Q+QG+++QP+FSCKFS +R ++   L S +S +  G        +D   +E
Sbjct  176   ETKLSPQVVQLQGTVKQPIFSCKFSRDRVSQVDPLSSFWSSSGDG------SYQDIERRE  229

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW + I+DLSGS+VAAA + TPFVPS G D V++SNPGAWLI+RP+     SW+PWG+
Sbjct  230   RKGWKVKIHDLSGSAVAAAFITTPFVPSSGCDWVAKSNPGAWLIVRPDACRPESWQPWGK  289

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA------  542
             LE WRERG  D + ++F + +D        ++E  +N +KGG F ID  R+         
Sbjct  290   LEVWRERGIRDSICFRFHVFSDGQEGGEFLMSELLINAEKGGEFFIDTDRQIRGAATPVP  349

Query  541   --------SSLSPVR-GFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDL  395
                     ++LSPV  GFVM   V  EGK     VQ+A+ HV C+ DAA+F+AL+AA+DL
Sbjct  350   SPQSSGDFAALSPVTGGFVMSCRVQGEGKCSKPLVQLAMRHVTCVEDAAIFMALAAAVDL  409

Query  394   SMDACQLFSTKLR  356
             S++AC+ F  K+R
Sbjct  410   SIEACRPFRRKMR  422



>ref|XP_010097676.1| hypothetical protein L484_023816 [Morus notabilis]
 gb|EXB70631.1| hypothetical protein L484_023816 [Morus notabilis]
Length=431

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 168/440 (38%), Positives = 254/440 (58%), Gaps = 42/440 (10%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP-SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDP  F+RL I S+ +++P +A       +H  ++PC  +++   FP QT  +PL S+  
Sbjct  1     MDPQAFIRLSIGSLGLRIPGTALNSTKSEIHAFSSPCSCEIRLRGFPVQTTSVPLLSS--  58

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRL------SEKPVALKLSVFAGRMGQT-CGI-TSG  1235
                  +  DS + A  F+L+ S L+ L            L+++V+ G+   + CG+    
Sbjct  59    ---PEATPDSHSIASSFYLEDSDLKALLAPGCFYSTHACLEIAVYTGKKESSHCGVGIKR  115

Query  1234  KLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGG----GADKPMLHVVVRSEPDPRFVFQFG  1067
             + +G  ++ V     + +PV+  +GW  +G      G     LH+ V+ +PDPR+VFQF 
Sbjct  116   QQIGTFKLEVSPEWGEGKPVILFNGWIGIGKNKQETGKQGVELHLRVKVDPDPRYVFQFE  175

Query  1066  GEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGK  887
                  SP +FQ+QGSI+Q +FSCKFS +R  +   L + +S +      T + D +   +
Sbjct  176   DVTRLSPQIFQLQGSIKQRIFSCKFSRDRVPQVDPLCNYWSGS------TDNADLEAERR  229

Query  886   ERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWG  707
             ERKGW + I+DLSGS+VAAA M TPFVPS G D V++SNPGAWLI+RP+     SW+PWG
Sbjct  230   ERKGWKVKIHDLSGSAVAAAFMTTPFVPSTGCDWVAKSNPGAWLIVRPDVCRAESWQPWG  289

Query  706   RLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSASSLSP  527
             +LEAWRERG  D +  +F L+++      + ++E  +N +KGG F ID  R+  A++ SP
Sbjct  290   KLEAWRERGIRDSVCCRFRLMSEGQEVGELLMSEIYINTEKGGEFFIDTDRQMPAAAASP  349

Query  526   ----------------VRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAI  401
                             V GFVM   V  EGK+    VQ+A+ HV C+ DAA+F+AL+AA+
Sbjct  350   IPSPQSSGDFAALGTVVGGFVMSCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAV  409

Query  400   DLSMDACQLFSTKLRKEFCH  341
             DLS++AC+ F  K++K  CH
Sbjct  410   DLSIEACRPFRRKMKKGSCH  429



>gb|KDP39605.1| hypothetical protein JCGZ_02625 [Jatropha curcas]
Length=428

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 168/424 (40%), Positives = 245/424 (58%), Gaps = 39/424 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLP-SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDP  F+RL I S+ +++P +A   A  G+H  ++PC  +++   FP QT  +PL S+  
Sbjct  1     MDPQAFIRLSIGSLGLRIPGTALNSAKSGIHTFSSPCLCEIRLRGFPVQTTSVPLLSS--  58

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRLSE------KPVALKLSVFAGRMGQTCGI-TSGK  1232
                S    D  + A  F+L+ S L+ L E          L++ VF GR G  CG+    +
Sbjct  59    ---SEVTPDIHSIASSFYLEESDLKALLEPGCFYTHHACLEIVVFTGRKGSHCGVGIKRQ  115

Query  1231  LLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGAD--KP--MLHVVVRSEPDPRFVFQFGG  1064
              +G  ++ V     + +P +  +GW ++G    +  KP   LH+ V+ +PDPR+VFQF  
Sbjct  116   QIGTFKLEVGPEWGEGKPAILFNGWIRIGKKKQESRKPGAELHLRVKLDPDPRYVFQFED  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
                 SP + Q+QGSIRQP+FSCKFS +R ++   L + +S    G       D +   +E
Sbjct  176   VTTSSPQIVQLQGSIRQPIFSCKFSRDRVSQVDPLSNYWSTAVEGM------DLETERRE  229

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW + I+DLSGS+VAAA + TPFVPS G D V++SNPGAWLI+RP+     SW+PWG+
Sbjct  230   RKGWKVKIHDLSGSAVAAAFITTPFVPSTGCDWVAKSNPGAWLIVRPDVCRPESWQPWGK  289

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA------  542
             LEAWRERG  D +  +F L++++     + ++E  M+ +KGG F ID  R+         
Sbjct  290   LEAWRERGIRDSICCRFHLLSESQEGGEVLMSEIFMSAEKGGEFFIDTDRQMRTAATPIP  349

Query  541   --------SSLSPVRGFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaAIDLS  392
                     S L P  GFVM   V  EGK+    VQ+A+ HV C+ DAA+F+AL+AA+DLS
Sbjct  350   SPQSSGDFSGLGPTGGFVMSCRVQGEGKHSKPLVQLAMRHVTCVEDAAIFMALAAAVDLS  409

Query  391   MDAC  380
             + AC
Sbjct  410   IVAC  413



>gb|KHG03019.1| Wilms tumor [Gossypium arboreum]
Length=432

 Score =   261 bits (666),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 169/434 (39%), Positives = 253/434 (58%), Gaps = 40/434 (9%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPS-ATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALP  1391
             MDP  F+RL I S+ +++P  A K +  G+H  + PC  +++   FP QT  +PL S+  
Sbjct  1     MDPQAFIRLSIGSLGLRIPGPALKSSKAGIHAFSAPCSCEIRLRGFPVQTTTIPLVSS--  58

Query  1390  KDDSSSPTDSFASAEGFHLDPSALRRL------SEKPVALKLSVFAGRMGQTCGI-TSGK  1232
                S    D  + A  F+L+ S L+ L            L+++VF GR G   G+    +
Sbjct  59    ---SEVTPDVHSIASSFYLEESDLKALLTPGCFYNHRAYLEITVFMGRKGTHFGVGVKRQ  115

Query  1231  LLGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGAD--KPM--LHVVVRSEPDPRFVFQFGG  1064
              +G  ++AV     + +PV+  +GW  +G    +  KP+  LH+ V+ +PDPR+VFQF  
Sbjct  116   QIGTFKLAVGPEWGEGKPVILFNGWIGIGKNKHENGKPVAELHLRVQLDPDPRYVFQFED  175

Query  1063  EPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKE  884
                 SP + Q+QGS++QP+FSCKFS +R ++   L + +  ++         D +   +E
Sbjct  176   VTMLSPQIVQLQGSVKQPIFSCKFSRDRASQVDLLNAYWPGSADNL------DIETSRRE  229

Query  883   RKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGR  704
             RKGW + I+DLSGS+VAAA + TPFVPS G D V++SNPGAWLILRP+     SW PWG+
Sbjct  230   RKGWKVKIHDLSGSAVAAAFITTPFVPSTGCDWVAKSNPGAWLILRPDVVRPESWLPWGK  289

Query  703   LEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA------  542
             LEAWRERG  D +  +F L+++A   + + ++E  ++ +KGG F ID  R          
Sbjct  290   LEAWRERGIRDAVCCRFHLLSEAQDGAEVLMSEIRISAEKGGEFFIDTDRLMRQAPTPIP  349

Query  541   --------SSLSPVR-GFVMCSSVEG--KNGFLSVQVAVNHVNCMadaalfvalsaAIDL  395
                     S+LSP+  GFVM   V+G  KN    VQ+A+ HV C+ DAA+F+AL+AA+DL
Sbjct  350   SPQSSGDFSALSPISGGFVMSCRVQGESKNSKPLVQLAMRHVTCIEDAAIFMALAAAVDL  409

Query  394   SMDACQLFSTKLRK  353
             S++AC+ F  K R+
Sbjct  410   SIEACKPFRRKFRR  423



>emb|CDP16208.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 169/437 (39%), Positives = 257/437 (59%), Gaps = 40/437 (9%)
 Frame = -2

Query  1576  LKKMDPCPFVRLIIESMAVKLP-SATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCS  1400
             + KMDP  F+RL + S+ ++LP +    +  G++  ++PC  +++   FP QT+ +P  S
Sbjct  27    VTKMDPQAFIRLSVGSLGLRLPGTELNSSKSGINALSSPCVCEIRLRGFPVQTSSIPFLS  86

Query  1399  ALPKDDSSSPTDSFASAEGFHLDPSALRRL------SEKPVALKLSVFAGRMGQTCGI-T  1241
             +          D+ + A  F+L+ S L+ L            L++ VF GR G  CG+  
Sbjct  87    S-----PEVTPDAQSVASSFYLEESDLKALLAPGCFYASHACLEIVVFRGRKGTHCGVGI  141

Query  1240  SGKLLGVVQVAVDLSGAQSRPVVFQSGWKKLGGG--GADKP--MLHVVVRSEPDPRFVFQ  1073
               + +G  ++ V     + +P++  +GW  +G    G+ KP   LH+ V+ +PDPR+VFQ
Sbjct  142   KRQQIGTFKLEVGPEWGEGKPIILFNGWIGIGKSKQGSAKPGAELHLRVKLDPDPRYVFQ  201

Query  1072  FGGEPECSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRP  893
             F  E   SP + Q+QG+ +Q +FSCKF+ +R  +   L S+F  +S       S D+D  
Sbjct  202   FEDETRSSPQIVQLQGTFKQRIFSCKFNQDRVTQLDPL-SNFWSHS-----VDSSDQDVE  255

Query  892   GKERKGWMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKP  713
              +ERKGW + I+DLSGS+VAAA + TPFVPS G D V++SNPGAWLI+RP+     SW+P
Sbjct  256   RRERKGWKVKIHDLSGSAVAAAFITTPFVPSSGCDWVAKSNPGAWLIVRPDACRPESWQP  315

Query  712   WGRLEAWRERGSVDGLGYKFELVTDAGFTSGIPIAEGAMNVKKGGRFCIDNARKHSA---  542
             WG+LEAWRERG  D +  +F L+++      I ++E  +N +KGG F ID  R+  A   
Sbjct  316   WGKLEAWRERGIRDSICCRFHLLSEGQEGGEILMSEILINAEKGGEFFIDTDRQVKAAAT  375

Query  541   -----------SSLSPVR-GFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfvalsaA  404
                        ++LSPV  GFVM S V  EGK     VQ+A+ +V C+ DAA+F+AL+AA
Sbjct  376   PVPSPQSSGDFAALSPVHGGFVMSSRVQGEGKRCKPLVQLAMRYVTCVEDAAIFMALAAA  435

Query  403   IDLSMDACQLFSTKLRK  353
             +DLS++AC+ F  K+R+
Sbjct  436   VDLSIEACRPFRRKVRR  452



>gb|EYU27182.1| hypothetical protein MIMGU_mgv1a006729mg [Erythranthe guttata]
 gb|EYU27183.1| hypothetical protein MIMGU_mgv1a006729mg [Erythranthe guttata]
Length=433

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 174/441 (39%), Positives = 257/441 (58%), Gaps = 53/441 (12%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPAGPGVHPSTTPCYAKLKFSSFPSQTALLPLCSALPK  1388
             MDP  F+RL I S+ ++ P A+K + P +   ++PC  +++   FP QT  +P  S    
Sbjct  1     MDPQAFIRLSIGSLGIRFPEASKSSTPAL---SSPCACEIRLRGFPVQTTQIPFIS----  53

Query  1387  DDSSSPTDSFASAEGFHLDPSALRRLS------EKPVALKLSVFAGRMGQTCGI-TSGKL  1229
               S    +S A A  F+L+ S L+ LS           L++ VF GR G  CG+ T  + 
Sbjct  54    --SPINNNSHAVASTFYLEESDLKVLSSPRCFYNARAFLEVVVFTGRRGTHCGVGTKRRQ  111

Query  1228  LGVVQVAVDLSGAQSRPVVFQSGWKKLGGGGAD--KPMLHVVVRSEPDPRFVFQFGGEPE  1055
             +GV ++ V     + +PV+  +GW  +G  G +     LH+ V+ +PDPR+VFQF  E +
Sbjct  112   IGVFKLNVGPEWGEGKPVILFNGWVGIGKNGQELGGAELHLKVKLDPDPRYVFQFEDETK  171

Query  1054  CSPVVFQIQGSIRQPVFSCKFSAERNNRTRSLPSDFSLNSRGWMRTFSGDRDRPGKERKG  875
              SP + Q+QG+++QP+FSCKF  +R ++   L +  S +  G        +D   +ERKG
Sbjct  172   LSPQIVQLQGNVKQPIFSCKFIRDRVSQVDPLSTFASSSGDG------SHQDTERRERKG  225

Query  874   WMIIIYDLSGSSVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEA  695
             W + I+DLSGS+VAAA + TPFVPS G D V+RSNPGAWLI+RP+     SW+PWG+LEA
Sbjct  226   WNVKIHDLSGSAVAAAFITTPFVPSTGCDWVARSNPGAWLIVRPDPYQHDSWQPWGKLEA  285

Query  694   WRER--GSV--DGLGYKFELVTDAGFTSG--IPIAEGAMNVKKGGRFCIDNARKHSA---  542
             WRER  G +  D + ++F + +D G   G  + I+E ++  +KGG F ID  R+  A   
Sbjct  286   WRERRGGGIIRDSVNFRFHVFSD-GQEGGKNLLISEISLGAEKGGEFFIDTDRQIRATAE  344

Query  541   ----------------SSLSPVR-GFVMCSSV--EGKNGFLSVQVAVNHVNCMadaalfv  419
                             + LSPV  GFVM   V  EGK+   +VQ+A+ HV C+ DAA+F+
Sbjct  345   AAAAAAVPSPQSSGDFTELSPVAGGFVMSCRVCGEGKSSKPTVQLAMRHVTCVEDAAIFM  404

Query  418   alsaAIDLSMDACQLFSTKLR  356
             AL+AA+DLS++AC+ F  K+R
Sbjct  405   ALAAAVDLSIEACRPFRRKIR  425



>gb|EYU30690.1| hypothetical protein MIMGU_mgv1a0070431mg, partial [Erythranthe 
guttata]
Length=202

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 159/207 (77%), Gaps = 11/207 (5%)
 Frame = -2

Query  1567  MDPCPFVRLIIESMAVKLPSATKPA--GPGVHPSTTPCYAKLKFSSFPSQTALLPLCSAL  1394
             MDPCPFVRLI+ES+A+KLP+A      G G+HPSTTPCYAKLK  +FPSQTALLPLC A 
Sbjct  1     MDPCPFVRLIVESLALKLPAAAAKPAAGSGIHPSTTPCYAKLKIKNFPSQTALLPLCIA-  59

Query  1393  PKDDSSSPTDSFASAEGFHLDPSALRRLSEKP-VALKLSVFAGRMGQTCGITSGKLLGVV  1217
                    P +S  S+  FH DP ALRR+S KP   +KLSVF GRMG+TCG++SGKLLG V
Sbjct  60    ----GGDPPESSPSSATFHHDPDALRRISSKPATTIKLSVFTGRMGRTCGVSSGKLLGSV  115

Query  1216  QVAVDLSGAQSRPVVFQSGWKKLGGGGADKP---MLHVVVRSEPDPRFVFQFGGEPECSP  1046
             QV V+L   Q+R  V+Q+GW KL GG A       LH+ VRSEPDPRFVFQFGGEPECSP
Sbjct  116   QVCVNLGNLQTRGCVYQNGWVKLDGGAAGTEPAARLHLTVRSEPDPRFVFQFGGEPECSP  175

Query  1045  VVFQIQGSIRQPVFSCKFSAERNNRTR  965
             VVFQIQG+IRQPVFSCKF+A+R+NR+R
Sbjct  176   VVFQIQGNIRQPVFSCKFNADRSNRSR  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5062430735620