BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20241_g1_i1 len=305 path=[711:0-138 286:139-167 315:168-304]

Length=305
                                                                      Score     E

ref|WP_029467737.1|  hypothetical protein [                           67.0    2e-15   
gb|KDQ49122.1|  hypothetical protein JAAARDRAFT_143838                68.9    7e-13   
gb|KDE75754.1|  hypothetical protein AO1008_01399                     69.7    2e-11   
gb|EGN91453.1|  hypothetical protein SERLA73DRAFT_67379               65.1    2e-11   
ref|XP_007371709.1|  hypothetical protein DICSQDRAFT_73523            59.3    2e-09   
gb|EUB53836.1|  hypothetical protein EGR_11314                        56.6    6e-08   
ref|WP_010118018.1|  hypothetical protein                             55.8    9e-08   
ref|XP_005765668.1|  hypothetical protein EMIHUDRAFT_79785            42.4    1e-07   
gb|EHK48568.1|  hypothetical protein TRIATDRAFT_255346                53.9    2e-07   
ref|XP_003614391.1|  Tar1p                                            56.6    5e-07   
ref|XP_007335615.1|  hypothetical protein AGABI1DRAFT_28160           52.4    8e-07   
gb|KDQ32289.1|  hypothetical protein PLEOSDRAFT_23300                 52.0    1e-06   
ref|XP_007335665.1|  hypothetical protein AGABI1DRAFT_49393           52.0    1e-06   
gb|ACU14517.1|  unknown                                               51.2    2e-06   Glycine max [soybeans]
ref|XP_007718977.1|  hypothetical protein COCCADRAFT_42279            51.2    2e-06   
ref|XP_007132740.1|  hypothetical protein PHAVU_011G121000g           50.4    4e-06   
ref|XP_002118239.1|  predicted protein                                49.7    3e-05   Trichoplax adhaerens
ref|XP_003614380.1|  Cytochrome P450 likeTBP                          50.4    7e-05   
gb|EFX61784.1|  hypothetical protein DAPPUDRAFT_68692                 47.4    8e-05   
ref|XP_003614394.1|  hypothetical protein MTR_5g051130                50.4    1e-04   
ref|XP_003614383.1|  hypothetical protein MTR_5g051000                50.1    1e-04   
ref|XP_007419024.1|  hypothetical protein MELLADRAFT_84532            47.4    1e-04   
gb|KEH16991.1|  senescence-associated protein                         49.7    2e-04   
emb|CDP91802.1|  Protein Bm8707, isoform b                            45.4    2e-04   
gb|EHA21134.1|  hypothetical protein ASPNIDRAFT_138414                45.1    3e-04   
gb|KCX71215.1|  hypothetical protein J567_4386                        44.3    4e-04   
gb|KDQ05630.1|  hypothetical protein BOTBODRAFT_122479                45.1    4e-04   
ref|WP_034429724.1|  hypothetical protein                             44.3    6e-04   
ref|XP_005717732.1|  18 S rRNA                                        44.3    6e-04   
ref|XP_002886322.1|  hypothetical protein ARALYDRAFT_900485           43.9    7e-04   
ref|XP_002590019.1|  hypothetical protein BRAFLDRAFT_122937           46.2    0.001   Branchiostoma floridae
emb|CDW75723.1|  UNKNOWN                                              47.4    0.001   



>ref|WP_029467737.1| hypothetical protein [[Clostridium] hathewayi]
Length=130

 Score = 67.0 bits (162),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  268  PPTIPINHYGGPRNQQNRTTRPILLFHANVFEQ  170
            PPT+PINHY GPRNQQNRT RPILLFHAN+FEQ
Sbjct  2    PPTVPINHYDGPRNQQNRTKRPILLFHANIFEQ  34


 Score = 41.6 bits (96),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 25/44 (57%), Gaps = 1/44 (2%)
 Frame = -1

Query  167  ACFEHSNFFTVKVLVPPTASEGHEVPQKERSSRTSTRGEADRPA  36
            ACFEHSNFF VKVLV     +G    QKER  R +   E   PA
Sbjct  36   ACFEHSNFFKVKVLV-HQGPQGPRASQKERPGRKNQYAEKSGPA  78



>gb|KDQ49122.1| hypothetical protein JAAARDRAFT_143838, partial [Jaapia argillacea 
MUCL 33604]
Length=80

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRTTRPILLFHAN  182
            SKNFTS + IL PPT+PINHYG  RNQQNRT RPILLFHAN
Sbjct  6    SKNFTSSNRILMPPTVPINHYGDSRNQQNRTARPILLFHAN  46



>gb|KDE75754.1| hypothetical protein AO1008_01399 [Aspergillus oryzae 100-8]
Length=646

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  167  ACFEHSNFFTVKVLVPPTASEGHEVPQKERSSRTSTRGEADRPAR  33
            ACFEHSNFFTVKVLVPPTASEGHEVPQKERSSR         P R
Sbjct  57   ACFEHSNFFTVKVLVPPTASEGHEVPQKERSSRKVHADSDHLPVR  101



>gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379 [Serpula lacrymans var. 
lacrymans S7.3]
Length=80

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRTTRPILLFHAN  182
            SKNFTS + IL  PT+PINHYG  RNQQNRT  PILLFHAN
Sbjct  6    SKNFTSSNRILMSPTVPINHYGNSRNQQNRTAHPILLFHAN  46



>ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens 
LYAD-421 SS1]
 gb|EJF55554.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens 
LYAD-421 SS1]
Length=66

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  277  ILTPPTIPINHYGGPRNQQNRTTRPILLFHANV  179
            IL PPTIPINHYG  RNQQNRT RPILLFHAN 
Sbjct  1    ILMPPTIPINHYGDSRNQQNRTARPILLFHANF  33



>gb|EUB53836.1| hypothetical protein EGR_11314 [Echinococcus granulosus]
Length=124

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 39/73 (53%), Gaps = 11/73 (15%)
 Frame = -1

Query  206  SYSIIP-C*CIRAKACFEHSNFFTVKVLVPPTASEGHEVPQKERSSRTSTRGEA------  48
            SYSIIP C    A+ACFEHSNFF V    P     GH     E + R   RG A      
Sbjct  56   SYSIIPSCGIQAARACFEHSNFFKVNASGP----AGHSAKSIEGAPRGKGRGRAVARLAA  111

Query  47   DRPARPKVQLRAF  9
            DRP  PK+QLRAF
Sbjct  112  DRPPAPKIQLRAF  124



>ref|WP_010118018.1| hypothetical protein, partial [Acinetobacter sp. P8-3-8]
Length=121

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 39/73 (53%), Gaps = 11/73 (15%)
 Frame = -1

Query  206  SYSIIP-C*CIRAKACFEHSNFFTVKVLVPPTASEGHEVPQKERSSRTSTRGEA------  48
            SYSIIP C    A+ACFEHSNFF V    P     GH     E + R   RG A      
Sbjct  53   SYSIIPSCGIQAARACFEHSNFFKVNASGP----AGHSAKSIEGAPRGKGRGRAVARLAA  108

Query  47   DRPARPKVQLRAF  9
            DRP  PK+QLRAF
Sbjct  109  DRPPAPKIQLRAF  121



>ref|XP_005765668.1| hypothetical protein EMIHUDRAFT_79785 [Emiliania huxleyi CCMP1516]
 ref|XP_005776389.1| hypothetical protein EMIHUDRAFT_79134 [Emiliania huxleyi CCMP1516]
 ref|XP_005783427.1| hypothetical protein EMIHUDRAFT_413798 [Emiliania huxleyi CCMP1516]
 ref|XP_005790932.1| hypothetical protein EMIHUDRAFT_79409 [Emiliania huxleyi CCMP1516]
 gb|EOD13239.1| hypothetical protein EMIHUDRAFT_79785 [Emiliania huxleyi CCMP1516]
 gb|EOD23960.1| hypothetical protein EMIHUDRAFT_79134 [Emiliania huxleyi CCMP1516]
 gb|EOD30998.1| hypothetical protein EMIHUDRAFT_413798 [Emiliania huxleyi CCMP1516]
 gb|EOD38503.1| hypothetical protein EMIHUDRAFT_79409 [Emiliania huxleyi CCMP1516]
Length=109

 Score = 42.4 bits (98),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 26/39 (67%), Gaps = 3/39 (8%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRTTRPILLFH  188
            S+NFTS   I  P T+P+NHY G RNQQN T    +LFH
Sbjct  11   SENFTSLGGIRVPLTVPVNHYSGVRNQQNSTR---VLFH  46


 Score = 39.7 bits (91),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (54%), Gaps = 0/56 (0%)
 Frame = -1

Query  176  RAKACFEHSNFFTVKVLVPPTASEGHEVPQKERSSRTSTRGEADRPARPKVQLRAF  9
            RA AC +HS+FF VK   P  A          + +  S    ADR ARP+++LRAF
Sbjct  54   RATACLKHSDFFKVKDPSPAPAQLRVGAVSGWKDAPASAYPSADRSARPEIRLRAF  109



>gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride 
IMI 206040]
Length=59

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  100 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFN  5
           M F R KGPAGPV AVRRTGQP PRFNYELFN
Sbjct  1   MGFRRGKGPAGPVHAVRRTGQPGPRFNYELFN  32



>ref|XP_003614391.1| Tar1p [Medicago truncatula]
Length=553

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 52/105 (50%), Gaps = 26/105 (25%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRT----TRPILLFHANVFEQRPALNTLIFSQ  137
            SKNFTS+  I  PPT+P+NHY  P  Q NR       P+L++     E+R AL+    + 
Sbjct  445  SKNFTSNYEIRMPPTVPVNHYSDPEGQHNRIRILWCYPMLMYP----ERRLALSQERIAG  500

Query  136  *KSWFPPQPVKAMRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNC  2
                            RR  P G     RRT +P+PR NYELFNC
Sbjct  501  ----------------RRDEPTGA--HHRRTDRPNPRSNYELFNC  527



>ref|XP_007335615.1| hypothetical protein AGABI1DRAFT_28160, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM73748.1| hypothetical protein AGABI1DRAFT_28160, partial [Agaricus bisporus 
var. burnettii JB137-S8]
Length=64

 Score = 52.4 bits (124),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRTTRPIL---LFHANVFEQR  167
            SKNFTS   I  PPTIPINHYG  RNQQNRT R      LF+ N F  R
Sbjct  5    SKNFTSSDSIPMPPTIPINHYGDSRNQQNRTARLKFNYGLFNCNNFNIR  53



>gb|KDQ32289.1| hypothetical protein PLEOSDRAFT_23300, partial [Pleurotus ostreatus 
PC15]
Length=74

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRTTRPIL---LFHANVFEQR  167
            SKNFTS   I  PPTIPINHYG  RNQQNRT R      LF+ N F  R
Sbjct  6    SKNFTSSDSIPMPPTIPINHYGDSRNQQNRTARLKFNYELFNCNNFNIR  54



>ref|XP_007335665.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM73697.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus 
var. burnettii JB137-S8]
Length=73

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRTTRPIL---LFHANVFEQR  167
            SKNFTS   I  PPTIPINHYG  RNQQNRT R      LF+ N F  R
Sbjct  5    SKNFTSSDSIPMPPTIPINHYGDSRNQQNRTARLKFNYGLFNCNNFNIR  53



>gb|ACU14517.1| unknown [Glycine max]
Length=66

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 8/60 (13%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNR----TTRPILLFHANVFEQRPALNTLIFSQ  137
            SKNFTSD  I  PPT+P+NHY  P  Q NR       P+L++     E+R AL+TLI S+
Sbjct  11   SKNFTSDYEIRMPPTVPVNHYSDPEGQHNRFRILWCYPMLMYT----ERRLALSTLISSK  66



>ref|XP_007718977.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13]
 gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 
48331]
 gb|EUC26718.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13]
Length=68

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 35/89 (39%), Gaps = 48/89 (54%)
 Frame = -2

Query  268  PPTIPINHYGGPRNQQNRTTRPILLFHANVFEQRPALNTLIFSQ*KSWFPPQPVKAMRFP  89
            PPT+P+NH G  RNQQNR  RPILLFHAN                               
Sbjct  2    PPTVPVNHCGVSRNQQNRNARPILLFHAN-------------------------------  30

Query  88   RRKGPAGPVLAVRRTGQPDPRFNYELFNC  2
                             PDP FNYELFNC
Sbjct  31   -----------------PDPSFNYELFNC  42



>ref|XP_007132740.1| hypothetical protein PHAVU_011G121000g [Phaseolus vulgaris]
 gb|ESW04734.1| hypothetical protein PHAVU_011G121000g [Phaseolus vulgaris]
Length=66

 Score = 50.4 bits (119),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 8/60 (13%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRT----TRPILLFHANVFEQRPALNTLIFSQ  137
            SKNFTSD  I  PPT+P+NHY  P  Q NR       P+L++     E+R AL+TLI S+
Sbjct  11   SKNFTSDYEIRMPPTVPVNHYSDPEGQHNRIRILWCYPMLMYP----ERRLALSTLISSK  66



>ref|XP_002118239.1| predicted protein [Trichoplax adhaerens]
 gb|EDV19242.1| predicted protein [Trichoplax adhaerens]
Length=206

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRTTRPILLFHANVFEQ  170
            SKNFTSD+ +  PPT+PINHY G  NQQNRT    +LF+ ++  +
Sbjct  65   SKNFTSDNEVRMPPTVPINHYFGSENQQNRTK---VLFYYSMLSK  106



>ref|XP_003614380.1| Cytochrome P450 likeTBP [Medicago truncatula]
 gb|KEH16986.1| hypothetical protein MTR_0055s0030 [Medicago truncatula]
Length=593

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 49/102 (48%), Gaps = 26/102 (25%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRT----TRPILLFHANVFEQRPALNTLIFSQ  137
            SKNFTSD  I  PPT+P+NHY  P  Q NR       P+L++     E+R AL+    + 
Sbjct  455  SKNFTSDYEIQMPPTVPVNHYSDPEGQHNRIRILWCYPMLMYP----ERRLALSQERIAG  510

Query  136  *KSWFPPQPVKAMRFPRRKGPAGPVLAVRRTGQPDPRFNYEL  11
                            RR  P G     RRT +P+PR NYEL
Sbjct  511  ----------------RRDEPTG--AHHRRTDRPNPRSNYEL  534



>gb|EFX61784.1| hypothetical protein DAPPUDRAFT_68692 [Daphnia pulex]
Length=96

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  132  FYCEKIRVFKAGLCSNTLAWNNRIG  206
            FYCEKIRVF+AG   NTLAWNN IG
Sbjct  2    FYCEKIRVFQAGFSPNTLAWNNGIG  26



>ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago truncatula]
Length=1337

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 49/102 (48%), Gaps = 26/102 (25%)
 Frame = -2

Query  304   SKNFTSDS*ILTPPTIPINHYGGPRNQQNRT----TRPILLFHANVFEQRPALNTLIFSQ  137
             SKNFTSD  I  PPT+P+NHY  P  Q NR       P+L++     E+R AL+    + 
Sbjct  1014  SKNFTSDYEIRMPPTVPVNHYSDPEGQHNRIRILWCYPMLMYP----ERRLALSQERIAG  1069

Query  136   *KSWFPPQPVKAMRFPRRKGPAGPVLAVRRTGQPDPRFNYEL  11
                             RR  P G     RRT +P+PR NYEL
Sbjct  1070  ----------------RRDEPTG--AHHRRTDRPNPRSNYEL  1093



>ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago truncatula]
Length=1735

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 49/102 (48%), Gaps = 26/102 (25%)
 Frame = -2

Query  304   SKNFTSDS*ILTPPTIPINHYGGPRNQQNRT----TRPILLFHANVFEQRPALNTLIFSQ  137
             SKNFTSD  I  PPT+P+NHY  P  Q NR       P+L++     E+R AL+    + 
Sbjct  1593  SKNFTSDYEIRMPPTVPVNHYSDPEGQHNRIRILWCYPMLMYP----ERRLALSQERIAG  1648

Query  136   *KSWFPPQPVKAMRFPRRKGPAGPVLAVRRTGQPDPRFNYEL  11
                             RR  P G     RRT +P+PR NYEL
Sbjct  1649  ----------------RRDEPTG--AHHRRTDRPNPRSNYEL  1672



>ref|XP_007419024.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 
98AG31]
 gb|EGF97701.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 
98AG31]
Length=146

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQN  218
            SKNFTSD  I  PPT PINHYG PRNQQN
Sbjct  33   SKNFTSDDVIQMPPTDPINHYGDPRNQQN  61



>gb|KEH16991.1| senescence-associated protein [Medicago truncatula]
Length=1771

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRT----TRPILLFHANVFEQRPALNTLIFSQ  137
            SKNFTSD  I  PPT+P+NHY  P  Q NR       P+L++     E+R AL+TLI S+
Sbjct  800  SKNFTSDYEIRMPPTVPVNHYSDPEGQHNRIRILWCYPMLMYP----ERRLALSTLISSK  855

Query  136  *KS  128
             +S
Sbjct  856  GRS  858



>emb|CDP91802.1| Protein Bm8707, isoform b [Brugia malayi]
Length=58

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 3/44 (7%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNRTTRPILLFHANVFE  173
            SKNFTS + I  PP++P+NHY    NQQNRT    +LFH ++ E
Sbjct  11   SKNFTSHAAIRMPPSVPLNHYLRSENQQNRTE---ILFHYSMHE  51



>gb|EHA21134.1| hypothetical protein ASPNIDRAFT_138414 [Aspergillus niger ATCC 
1015]
Length=65

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/18 (100%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +3

Query  99   MAFTGCGGNQDFYCEKIR  152
            MAFTGCGGNQDFYCEKIR
Sbjct  1    MAFTGCGGNQDFYCEKIR  18



>gb|KCX71215.1| hypothetical protein J567_4386, partial [Acinetobacter baumannii 
754286]
Length=30

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  129  DFYCEKIRVFKAGLCSNTLAWNNRI  203
            D YCEKIRVFKAG+C N LAWNN +
Sbjct  6    DIYCEKIRVFKAGICLNILAWNNHV  30



>gb|KDQ05630.1| hypothetical protein BOTBODRAFT_122479, partial [Botryobasidium 
botryosum FD-172 SS1]
 gb|KDQ16185.1| hypothetical protein BOTBODRAFT_107195, partial [Botryobasidium 
botryosum FD-172 SS1]
Length=76

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 38/92 (41%), Gaps = 42/92 (46%)
 Frame = -2

Query  277  ILTPPTIPINHYGGPRNQQNRTTRPILLFHANVFEQRPALNTLIFSQ*KSWFPPQPVKAM  98
            IL PPT+PINHYG  RNQQNRT R           +RP              P  PVK M
Sbjct  1    ILMPPTVPINHYGDSRNQQNRTAR-----------KRPGS------------PTHPVKGM  37

Query  97   RFPRRKGPAGPVLAVRRTGQPDPRFNYELFNC  2
                   PA               FNYELFNC
Sbjct  38   -------PA------------HQEFNYELFNC  50



>ref|WP_034429724.1| hypothetical protein [Candidatus Entotheonella sp. TSY1]
 gb|ETX03503.1| hypothetical protein ETSY1_47025 [Candidatus Entotheonella sp. 
TSY1]
Length=68

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +2

Query  200  NRTCGSILLVSRTAVMINRDSRGRQYSAVRGEILG  304
                G ILLVSR  VMI RDS G  Y  VRGEILG
Sbjct  2    EEDLGPILLVSRAEVMIERDSWGHSYLIVRGEILG  36



>ref|XP_005717732.1| 18 S rRNA [Chondrus crispus]
 emb|CDF37861.1| 18 S rRNA [Chondrus crispus]
Length=45

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 4/46 (9%)
 Frame = -2

Query  268  PPTIPINHYGGPRNQQNRTTRPILLFHANVF--EQRPALNTLIFSQ  137
            PPT+P+NHY    NQQNR  + +L +++ +    Q PALNTLIFSQ
Sbjct  2    PPTVPLNHYPILTNQQNR--KQVLFYYSMLMYSWQTPALNTLIFSQ  45



>ref|XP_002886322.1| hypothetical protein ARALYDRAFT_900485 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62581.1| hypothetical protein ARALYDRAFT_900485 [Arabidopsis lyrata subsp. 
lyrata]
Length=50

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = -2

Query  304  SKNFTSDS*ILTPPTIPINHYGGPRNQQNR  215
            SKNFTSD  I  PPT+P+NHY  P  Q NR
Sbjct  17   SKNFTSDYEIRMPPTVPVNHYSDPEGQHNR  46



>ref|XP_002590019.1| hypothetical protein BRAFLDRAFT_122937 [Branchiostoma floridae]
 gb|EEN46030.1| hypothetical protein BRAFLDRAFT_122937 [Branchiostoma floridae]
Length=291

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 1/57 (2%)
 Frame = -1

Query  176  RAKACFEHSNFFTVKVLVPPTAS-EGHEVPQKERSSRTSTRGEADRPARPKVQLRAF  9
            R +ACFEHSNFF V    P  A   G    ++E   R  TR  ADR   PK+QLRAF
Sbjct  235  RQQACFEHSNFFKVNAPAPRGAQLRGPGRIRREGPGRAVTRLAADRKPGPKIQLRAF  291



>emb|CDW75723.1| UNKNOWN [Stylonychia lemnae]
Length=1881

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  304   SKNFTSDS*ILTPPTIPINHYGGPRNQQNR  215
             S+NFTSD+ IL PPTIPINHY  P NQQ R
Sbjct  1293  SENFTSDNQILMPPTIPINHYFSPSNQQRR  1322



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517403453504