BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20205_g2_i1 len=1899 path=[1880:0-300 6914:301-337 2218:338-373
3782:374-631 7049:632-657 5308:658-825 2709:826-853 6248:854-973
6368:974-1180 3064:1181-1209 4344:1210-1470 7170:1471-1522
3406:1523-1898]

Length=1899
                                                                      Score     E

ref|NP_001233838.1|  carotenoid cleavage dioxygenase 1-2                927   0.0      
ref|XP_006345441.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    925   0.0      
gb|AIY62758.1|  carotenoid cleavage dioxygenase                         925   0.0      
ref|XP_009589879.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    922   0.0      
gb|AHH25650.1|  carotenoid cleavage dioxygenase 1-2                     922   0.0      
ref|XP_010695196.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    919   0.0      
ref|XP_009589878.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    916   0.0      
gb|AHH25649.1|  carotenoid cleavage dioxygenase 1-1                     915   0.0      
gb|AIX87533.1|  carotenoid cleavage dioxygenase 1A                      915   0.0      
ref|XP_010324092.1|  PREDICTED: carotenoid cleavage dioxygenase 1...    914   0.0      
gb|AAT68189.1|  carotenoid cleavage dioxygenase 1                       914   0.0      Petunia x hybrida [garden petunia]
ref|XP_009784260.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    914   0.0      
ref|XP_009760607.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    914   0.0      
gb|AIX87509.1|  carotenoid cleavage dioxygenase 1A                      912   0.0      
ref|NP_001234542.1|  carotenoid cleavage dioxygenase 1-1                911   0.0      
ref|XP_006345442.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    911   0.0      
ref|XP_006345443.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    910   0.0      
gb|AHA43413.1|  carotenoid cleavage dioxygenase                         909   0.0      
gb|AIL30506.1|  carotenoid cleavage dioxygenase 1-1                     908   0.0      
ref|XP_009589876.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    908   0.0      
emb|CAD33264.1|  carotenoid cleavage oxygenase                          902   0.0      Solanum lycopersicum
ref|XP_008461300.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    902   0.0      
gb|ABB82946.1|  carotenoid cleavage dioxygenase                         901   0.0      Cucumis melo [Oriental melon]
dbj|BAJ05401.1|  carotenoid cleavage dioxygenase 1                      899   0.0      
emb|CAC79644.1|  dioxygenase                                            897   0.0      Capsicum annuum
ref|XP_010241258.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    896   0.0      
ref|XP_004135934.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    895   0.0      
gb|AAY21819.1|  carotenoid cleavage dioxygenase                         894   0.0      Suaeda salsa
gb|AGN03859.1|  carotenoid cleavage dioxygenase 1                       893   0.0      
ref|XP_007052518.1|  Carotenoid cleavage dioxygenase 1 isoform 1        893   0.0      
gb|ABA43900.1|  carotenoid cleavage dioxygenase 1                       891   0.0      Coffea canephora [robusta coffee]
ref|NP_001267844.1|  9,10[9',10']carotenoid cleavage dioxygenase        888   0.0      
gb|ABA43904.1|  carotenoid cleavage dioxygenase 1                       888   0.0      Coffea arabica [arabica coffee]
gb|AFU91489.1|  carotenoid cleavage dioxygenase 1                       886   0.0      
gb|AAX48772.1|  9,10[9',10']carotenoid cleavage dioxygenase             885   0.0      Vitis vinifera
ref|XP_006345500.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    885   0.0      
ref|XP_006379094.1|  carotenoid cleavage dioxygenase 1 family pro...    885   0.0      
gb|AFJ94680.1|  carotenoid cleavage dioxygenase 1                       885   0.0      
ref|XP_011025444.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    884   0.0      
ref|XP_006482870.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    884   0.0      
ref|XP_006439108.1|  hypothetical protein CICLE_v10031039mg             884   0.0      
gb|AFJ94677.1|  carotenoid cleavage dioxygenase 1                       883   0.0      
gb|ADN65332.1|  carotenoid cleavage dioxygenase 1                       881   0.0      
gb|AGT63320.1|  carotenoid cleavage dioxygenase 1                       880   0.0      
ref|XP_011087733.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    879   0.0      
gb|ABB52081.1|  putative carotenoid cleavage dioxygenase                879   0.0      Daucus carota subsp. sativus
gb|AFC88468.1|  9-cis-epoxycarotenoid deoxygenase                       879   0.0      
ref|XP_010552741.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    878   0.0      
gb|AFJ94678.1|  carotenoid cleavage dioxygenase 1                       878   0.0      
ref|XP_007052519.1|  Carotenoid cleavage dioxygenase 1 isoform 2        877   0.0      
sp|Q84KG5.1|CCD_CROSA  RecName: Full=Carotenoid 9,10(9',10')-clea...    876   0.0      Crocus sativus [saffron crocus]
gb|ABY47994.1|  carotenoid cleavage dioxygenase 1                       875   0.0      Rosa x damascena [damask rose]
ref|XP_011087743.1|  PREDICTED: LOW QUALITY PROTEIN: carotenoid 9...    875   0.0      
dbj|BAE72095.1|  Lactuca sativa carotenoid cleavage dioxygenase 2       874   0.0      Lactuca sativa [cultivated lettuce]
ref|XP_002278628.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    873   0.0      Vitis vinifera
ref|XP_009394395.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    872   0.0      
ref|XP_008375177.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    872   0.0      
gb|ABO69703.1|  9-cis-epoxycarotenoid dioxygenase                       872   0.0      Castanea mollissima
gb|KDP43480.1|  hypothetical protein JCGZ_16767                         872   0.0      
ref|XP_004306539.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    871   0.0      
ref|XP_010512783.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    870   0.0      
gb|AFV15390.1|  carotenoid cleavage dioxygenase 1                       869   0.0      
ref|XP_008231253.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    869   0.0      
ref|XP_002298429.2|  hypothetical protein POPTR_0001s27260g             869   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010067867.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    868   0.0      
emb|CAR57918.1|  carotenoid cleavage dioxygenase 1                      867   0.0      Medicago truncatula
ref|XP_010413131.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    867   0.0      
ref|XP_008801952.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    867   0.0      
ref|NP_191911.1|  carotenoid 9,10(9',10')-cleavage dioxygenase 1        867   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAA06712.1|  carotenoid cleavage dioxygenase 1                      867   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAE92957.1|  carotenoid cleavage dioxygenase1                       866   0.0      Citrus unshiu [satsuma mandarin]
ref|XP_007220659.1|  hypothetical protein PRUPE_ppa003814mg             866   0.0      
ref|XP_002298430.2|  carotenoid 9 family protein                        865   0.0      Populus trichocarpa [western balsam poplar]
sp|Q8LP17.1|CCD1_PEA  RecName: Full=Carotenoid 9,10(9',10')-cleav...    864   0.0      Pisum sativum [garden pea]
dbj|BAE92958.1|  carotenoid cleavage dioxygenase1                       863   0.0      Citrus sinensis [apfelsine]
ref|XP_011047392.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    862   0.0      
ref|XP_010552739.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    861   0.0      
gb|ACA13522.1|  dioxygenase                                             861   0.0      Fragaria x ananassa
ref|XP_006402264.1|  hypothetical protein EUTSA_v10005877mg             860   0.0      
ref|XP_003542847.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    860   0.0      
sp|Q94IR2.1|CCD1_PHAVU  RecName: Full=Carotenoid 9,10(9',10')-cle...    860   0.0      Phaseolus vulgaris [French bean]
gb|KCW66101.1|  hypothetical protein EUGRSUZ_G03374                     858   0.0      
ref|XP_007133813.1|  hypothetical protein PHAVU_011G211200g             857   0.0      
gb|KHN19457.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase 1          854   0.0      
ref|XP_010931015.1|  PREDICTED: LOW QUALITY PROTEIN: carotenoid 9...    852   0.0      
ref|XP_004963348.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    852   0.0      
gb|ABS19630.2|  carotenoid cleavage dioxygenase                         852   0.0      Bixa orellana [achiote]
gb|KFK35504.1|  hypothetical protein AALP_AA5G293200                    851   0.0      
gb|AFG30025.1|  carotenoid cleavage dioxygenase 1                       849   0.0      
gb|KHN37625.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase 1          848   0.0      
ref|XP_002876727.1|  hypothetical protein ARALYDRAFT_486866             848   0.0      
ref|XP_002465882.1|  hypothetical protein SORBIDRAFT_01g047540          847   0.0      Sorghum bicolor [broomcorn]
gb|AAN17413.1|  neoxanthin cleavage enzyme nc1                          844   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KCW66082.1|  hypothetical protein EUGRSUZ_G03362                     843   0.0      
ref|XP_004510991.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    842   0.0      
gb|ACO87672.1|  carotenoid cleavage dioxygenase                         842   0.0      Brachypodium sylvaticum
emb|CDX93902.1|  BnaC04g20610D                                          842   0.0      
gb|ABF85668.1|  carotenoid cleavage dioxyganase 1                       841   0.0      Zea mays [maize]
gb|ACF79397.1|  unknown                                                 841   0.0      Zea mays [maize]
ref|XP_003577313.1|  PREDICTED: LOW QUALITY PROTEIN: carotenoid 9...    840   0.0      
ref|XP_010067847.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    843   0.0      
ref|NP_001105286.1|  carotenoid cleavage dioxygenase                    840   0.0      Zea mays [maize]
gb|ACF75911.1|  carotenoid cleavage dioxygenases                        839   0.0      Malus hupehensis var. mengshanensis
ref|NP_001105815.1|  white cap1                                         839   0.0      Zea mays [maize]
ref|XP_011047393.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    839   0.0      
ref|XP_006850220.1|  hypothetical protein AMTR_s00022p00253450          838   0.0      
ref|XP_009138676.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    838   0.0      
gb|ABA99624.2|  9,10-9',10' carotenoid cleavage dioxygenase 1, pu...    833   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006293242.1|  hypothetical protein CARUB_v10019573mg             831   0.0      
gb|KCW66083.1|  hypothetical protein EUGRSUZ_G03362                     832   0.0      
ref|XP_008363317.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    830   0.0      
ref|XP_003577349.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    830   0.0      
ref|XP_006664795.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    830   0.0      
ref|XP_010088226.1|  hypothetical protein L484_012508                   831   0.0      
gb|EEC69751.1|  hypothetical protein OsI_39285                          828   0.0      Oryza sativa Indica Group [Indian rice]
gb|ACO87673.1|  carotenoid cleavage dioxygenase                         828   0.0      Brachypodium sylvaticum
ref|XP_004510990.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    829   0.0      
gb|KDO83428.1|  hypothetical protein CISIN_1g007605mg                   830   0.0      
ref|NP_001067395.2|  Os12g0640600                                       827   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006439106.1|  hypothetical protein CICLE_v10031014mg             825   0.0      
gb|ABA99623.2|  9,10-9',10' carotenoid cleavage dioxygenase 1, pu...    823   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010088227.1|  hypothetical protein L484_012509                   823   0.0      
ref|XP_006482868.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    825   0.0      
gb|AGT17077.1|  carotenoid cleavage dioxygenase                         821   0.0      
sp|C3VEQ4.1|CCD1_ONCHC  RecName: Full=Carotenoid 9,10(9',10')-cle...    821   0.0      
gb|KEH19092.1|  carotenoid 9,10(9',10')-cleavage dioxygenase            818   0.0      
emb|CAD71148.1|  carotenoid cleavage dioxygenase                        816   0.0      Bixa orellana [achiote]
ref|XP_002300210.2|  hypothetical protein POPTR_0001s27290g             814   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009365069.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    813   0.0      
emb|CDY53711.1|  BnaAnng12520D                                          812   0.0      
ref|XP_002517824.1|  9-cis-epoxycarotenoid dioxygenase, putative        811   0.0      Ricinus communis
gb|ACJ85687.1|  unknown                                                 810   0.0      Medicago truncatula
gb|EYU27047.1|  hypothetical protein MIMGU_mgv1a004951mg                807   0.0      
ref|XP_009117091.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    811   0.0      
emb|CBI24897.3|  unnamed protein product                                804   0.0      
ref|XP_010088225.1|  hypothetical protein L484_012507                   806   0.0      
gb|KEH19090.1|  carotenoid 9,10(9',10')-cleavage dioxygenase            806   0.0      
ref|XP_010241260.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    802   0.0      
gb|KEH19087.1|  carotenoid 9,10(9',10')-cleavage dioxygenase            802   0.0      
emb|CDX76782.1|  BnaC08g33680D                                          802   0.0      
gb|ABR17001.1|  unknown                                                 799   0.0      Picea sitchensis
ref|XP_009365068.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    796   0.0      
gb|ABK24523.1|  unknown                                                 798   0.0      Picea sitchensis
gb|AFC90006.1|  carotenoid cleavage dioxygenase 1                       794   0.0      
ref|XP_009589880.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    781   0.0      
gb|EMT19111.1|  hypothetical protein F775_00763                         783   0.0      
gb|KCW66099.1|  hypothetical protein EUGRSUZ_G03374                     781   0.0      
ref|XP_006402263.1|  hypothetical protein EUTSA_v10005877mg             780   0.0      
ref|XP_006302006.1|  hypothetical protein CARUB_v10019983mg             779   0.0      
emb|CDX76783.1|  BnaC08g33690D                                          778   0.0      
ref|XP_009784266.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    769   0.0      
ref|XP_006301637.1|  hypothetical protein CARUB_v10022080mg             768   0.0      
ref|XP_009589877.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    763   0.0      
gb|ABG22113.1|  9,10-9',10' carotenoid cleavage dioxygenase 1, pu...    759   0.0      
gb|EMT18015.1|  hypothetical protein F775_06220                         758   0.0      
gb|AEN94904.1|  carotenoid cleavage dioxygenase                         753   0.0      
gb|AIG94929.1|  carotenoid cleavage dioxygenase 2                       743   0.0      
ref|XP_010552740.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    735   0.0      
ref|XP_010413132.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    731   0.0      
ref|XP_006402261.1|  hypothetical protein EUTSA_v10005877mg             726   0.0      
emb|CDY34748.1|  BnaA09g41150D                                          725   0.0      
gb|EMS57571.1|  hypothetical protein TRIUR3_09265                       726   0.0      
gb|EMS66522.1|  hypothetical protein TRIUR3_03973                       722   0.0      
gb|AHE41421.1|  carotenoid cleavage dioxygenase 1                       706   0.0      
gb|AFW89636.1|  white cap1                                              708   0.0      
gb|ACD62475.1|  carotenoid cleavage dioxygenase 2                       711   0.0      Crocus sativus [saffron crocus]
ref|XP_010241261.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    705   0.0      
gb|EMT19110.1|  hypothetical protein F775_23086                         703   0.0      
gb|AAK00622.1|  carotenoid cleavage dioxygenase 1                       701   0.0      Persea americana
ref|XP_006850221.1|  hypothetical protein AMTR_s00022p00253640          697   0.0      
gb|EMS46219.1|  hypothetical protein TRIUR3_11060                       696   0.0      
gb|KDO83429.1|  hypothetical protein CISIN_1g007605mg                   689   0.0      
ref|XP_006482869.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    683   0.0      
gb|KDO83426.1|  hypothetical protein CISIN_1g015522mg                   672   0.0      
ref|XP_002962877.1|  hypothetical protein SELMODRAFT_165469             660   0.0      
ref|XP_002989455.1|  hypothetical protein SELMODRAFT_272067             659   0.0      
gb|KCW66102.1|  hypothetical protein EUGRSUZ_G03374                     654   0.0      
ref|XP_006402262.1|  hypothetical protein EUTSA_v10005877mg             654   0.0      
ref|XP_004158236.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    631   0.0      
ref|XP_002989454.1|  hypothetical protein SELMODRAFT_447678             637   0.0      
gb|KDO83430.1|  hypothetical protein CISIN_1g007605mg                   627   0.0      
ref|XP_001754114.1|  predicted protein                                  631   0.0      
ref|XP_001771028.1|  predicted protein                                  617   0.0      
dbj|BAI47582.1|  carotenoid cleavage dioxygenase 1                      602   0.0      Ipomoea sp. Kenyan
gb|ABB29859.1|  carotene cleavage dioxygenase                           578   0.0      Nicotiana langsdorffii x Nicotiana sanderae
emb|CAN79030.1|  hypothetical protein VITISV_032896                     579   0.0      Vitis vinifera
ref|XP_006439107.1|  hypothetical protein CICLE_v10031039mg             558   0.0      
gb|KDO83427.1|  hypothetical protein CISIN_1g015522mg                   552   0.0      
gb|KDO83431.1|  hypothetical protein CISIN_1g007605mg                   528   0.0      
ref|XP_001782366.1|  predicted protein                                  528   2e-178   
gb|AFK39230.1|  unknown                                                 503   4e-171   
ref|XP_008349836.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    484   6e-164   
gb|AFK46945.1|  unknown                                                 471   2e-159   
dbj|BAJ94401.1|  predicted protein                                      464   5e-156   
dbj|BAJ33786.1|  unnamed protein product                                454   2e-152   
gb|ABK21471.1|  unknown                                                 453   8e-152   Picea sitchensis
gb|AGS79172.1|  carotenoid cleavage dioxygenase 1                       449   1e-150   
ref|XP_005644307.1|  carotenoid oxygenase                               444   3e-145   
ref|WP_015140676.1|  lignostilbene-alpha,beta-dioxygenase-like pr...    419   3e-136   
ref|WP_015202538.1|  9-cis-epoxycarotenoid dioxygenase                  411   5e-133   
gb|AFW89635.1|  white cap1                                              401   2e-132   
ref|WP_015111403.1|  9-cis-epoxycarotenoid dioxygenase                  408   5e-132   
ref|WP_015127264.1|  9-cis-epoxycarotenoid dioxygenase                  406   2e-131   
dbj|BAF31903.1|  putative 9-cis-epoxycarotenoid dioxygenase             410   6e-131   Cryptomeria japonica
dbj|BAF31898.1|  putative 9-cis-epoxycarotenoid dioxygenase             409   1e-130   Cryptomeria japonica
dbj|BAF31922.1|  putative 9-cis-epoxycarotenoid dioxygenase             409   2e-130   Cryptomeria japonica
dbj|BAF31929.1|  putative 9-cis-epoxycarotenoid dioxygenase             409   3e-130   Cryptomeria japonica
dbj|BAF31900.1|  putative 9-cis-epoxycarotenoid dioxygenase             409   3e-130   Cryptomeria japonica
dbj|BAF31905.1|  putative 9-cis-epoxycarotenoid dioxygenase             409   3e-130   Cryptomeria japonica
dbj|BAF31899.1|  putative 9-cis-epoxycarotenoid dioxygenase             409   3e-130   Cryptomeria japonica
dbj|BAF31906.1|  putative 9-cis-epoxycarotenoid dioxygenase             409   3e-130   Cryptomeria japonica
ref|WP_012409393.1|  carotenoid oxygenase                               401   2e-129   
ref|WP_015118911.1|  lignostilbene-alpha,beta-dioxygenase-like pr...    400   3e-129   
ref|WP_015153132.1|  Carotenoid oxygenase                               399   7e-129   
ref|WP_029637704.1|  9-cis-epoxycarotenoid dioxygenase [                399   9e-129   
dbj|BAF32138.1|  putative 9-cis-epoxycarotenoid dioxygenase             405   1e-128   Taxodium distichum [bald cypress]
ref|WP_017319350.1|  Retinal pigment epithelial membrane protein        399   1e-128   
ref|WP_017745616.1|  Retinal pigment epithelial membrane protein        399   1e-128   
ref|WP_006099204.1|  Retinal pigment epithelial membrane protein        399   2e-128   
ref|WP_015183663.1|  lignostilbene-alpha,beta-dioxygenase-like pr...    398   4e-128   
ref|WP_010995279.1|  hypothetical protein                               397   9e-128   
ref|WP_038074680.1|  9-cis-epoxycarotenoid dioxygenase                  397   1e-127   
ref|WP_009783644.1|  Retinal pigment epithelial membrane protein        395   2e-127   
ref|WP_039743349.1|  9-cis-epoxycarotenoid dioxygenase                  395   2e-127   
ref|WP_011320410.1|  retinal pigment epithelial membrane protein        394   1e-126   
ref|WP_026098555.1|  9-cis-epoxycarotenoid dioxygenase                  394   1e-126   
ref|WP_016874878.1|  Retinal pigment epithelial membrane protein        393   3e-126   
ref|WP_015213082.1|  9-cis-epoxycarotenoid dioxygenase                  392   3e-126   
ref|WP_019489052.1|  Retinal pigment epithelial membrane protein        389   5e-125   
ref|WP_028084014.1|  9-cis-epoxycarotenoid dioxygenase                  389   6e-125   
ref|WP_028090825.1|  9-cis-epoxycarotenoid dioxygenase                  389   7e-125   
ref|WP_016952678.1|  Retinal pigment epithelial membrane protein        389   1e-124   
ref|WP_015198082.1|  9-cis-epoxycarotenoid dioxygenase                  388   2e-124   
ref|XP_002981140.1|  hypothetical protein SELMODRAFT_113788             394   3e-124   
ref|WP_006197241.1|  Retinal pigment epithelial membrane protein        387   7e-124   
ref|WP_015079490.1|  carotenoid oxygenase                               386   9e-124   
ref|XP_002982621.1|  hypothetical protein SELMODRAFT_116420             392   1e-123   
ref|WP_039716095.1|  9-cis-epoxycarotenoid dioxygenase                  386   1e-123   
ref|WP_008274084.1|  Retinal pigment epithelial membrane protein        385   2e-123   
ref|WP_036478419.1|  9-cis-epoxycarotenoid dioxygenase                  385   6e-123   
ref|WP_015227792.1|  9-cis-epoxycarotenoid dioxygenase                  383   2e-122   
ref|WP_007312440.1|  Retinal pigment epithelial membrane protein        382   3e-122   
ref|XP_001784596.1|  predicted protein                                  384   9e-122   
ref|WP_007303189.1|  Retinal pigment epithelial membrane protein        381   9e-122   
ref|WP_009546963.1|  MULTISPECIES: 9-cis-epoxycarotenoid dioxygenase    381   1e-121   
ref|WP_023064357.1|  carotenoid 9,10(9',10')-cleavage dioxygenase       380   2e-121   
ref|WP_016870978.1|  hypothetical protein                               381   2e-121   
ref|XP_002459356.1|  hypothetical protein SORBIDRAFT_02g003230          384   2e-121   Sorghum bicolor [broomcorn]
ref|XP_001769871.1|  predicted protein                                  387   4e-121   
ref|WP_015210868.1|  lignostilbene-alpha,beta-dioxygenase-like en...    379   1e-120   
ref|XP_010060796.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    381   7e-120   
ref|WP_016860197.1|  hypothetical protein                               376   1e-119   
ref|WP_035116230.1|  hypothetical protein                               375   2e-119   
ref|NP_001050765.1|  Os03g0645900                                       379   3e-119   Oryza sativa Japonica Group [Japonica rice]
gb|AEH41591.1|  9-cis-epoxycarotenoid dioxygenase 1                     378   1e-118   
ref|NP_001147781.1|  viviparous-14                                      375   5e-118   Zea mays [maize]
ref|XP_008225495.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    375   2e-117   
ref|XP_009406704.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    375   2e-117   
ref|XP_001765996.1|  predicted protein                                  371   2e-117   
gb|EAY91193.1|  hypothetical protein OsI_12802                          374   3e-117   Oryza sativa Indica Group [Indian rice]
gb|AEW91475.1|  9-cis-epoxycarotenoid dioxygenase                       373   7e-117   
ref|XP_005844864.1|  hypothetical protein CHLNCDRAFT_138368             370   7e-117   
dbj|BAD31592.1|  putative viviparous-14 protein                         372   7e-117   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001234455.1|  nine-cis-epoxycarotenoid dioxygenase               373   8e-117   
ref|XP_004963201.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    373   8e-117   
ref|XP_005645886.1|  carotenoid cleavage dioxygenase 1B                 371   8e-117   
ref|XP_008670979.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    372   8e-117   
gb|AGN03861.1|  9-cis epoxycarotenoid dioxygenase                       373   9e-117   
ref|XP_004955480.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    372   1e-116   
ref|XP_007213614.1|  hypothetical protein PRUPE_ppa002314mg             375   1e-116   
ref|NP_001275103.1|  9-cis-epoxy-carotenoid dioxygenase 1               372   1e-116   
gb|ABK24456.1|  unknown                                                 373   1e-116   Picea sitchensis
ref|NP_001058913.1|  Os07g0154100                                       373   2e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009804376.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    371   4e-116   
ref|XP_002519665.1|  9-cis-epoxycarotenoid dioxygenase, putative        371   5e-116   Ricinus communis
gb|AEG78287.1|  9-cis-epoxycarotenoid dioxygenase                       370   9e-116   
ref|XP_011029543.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    370   1e-115   
ref|XP_002316871.1|  hypothetical protein POPTR_0011s11370g             370   1e-115   Populus trichocarpa [western balsam poplar]
ref|NP_001274963.1|  9-cis-epoxy-carotenoid dioxygenase 2               369   1e-115   
gb|ACD44928.1|  plastid 9-cis-epoxycarotenoid dioxygenase               370   2e-115   
ref|XP_004504912.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    369   2e-115   
ref|XP_006650343.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    369   3e-115   
ref|XP_007022180.1|  Nine-cis-epoxycarotenoid dioxygenase 3             369   3e-115   
emb|CAB76920.1|  putative 9-cis-epoxycarotenoid dioxygenase             369   4e-115   
dbj|BAC10551.1|  nine-cis-epoxycarotenoid dioxygenase3                  368   6e-115   
ref|XP_004293530.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    368   6e-115   
gb|ADQ74052.1|  9-cis-epoxycarotenoid dioxygenase                       367   1e-114   
gb|AFO85470.1|  9-cis-epoxy-carotenoid dioxygenase                      368   1e-114   
gb|ADQ74069.1|  9-cis-epoxycarotenoid dioxygenase                       367   1e-114   
gb|ADQ74054.1|  9-cis-epoxycarotenoid dioxygenase                       367   1e-114   
gb|AIY62759.1|  9-cis epoxycarotenoid dioxygenase                       367   1e-114   
gb|ADQ74065.1|  9-cis-epoxycarotenoid dioxygenase                       367   1e-114   
gb|ADQ74059.1|  9-cis-epoxycarotenoid dioxygenase                       367   1e-114   
gb|ADQ74027.1|  9-cis-epoxycarotenoid dioxygenase                       367   2e-114   
gb|AIX87507.1|  9-cis-epoxycarotenoid dioxygenase 1                     367   2e-114   
ref|XP_009797946.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    367   2e-114   
gb|ADQ74019.1|  9-cis-epoxycarotenoid dioxygenase                       366   3e-114   
gb|AIU94747.1|  9-cis-epoxycarotenoid dioxygenase                       366   3e-114   
gb|AIX87531.1|  9-cis-epoxycarotenoid dioxygenase 1                     366   3e-114   
gb|ADQ74056.1|  9-cis-epoxycarotenoid dioxygenase                       366   4e-114   
gb|ADQ74047.1|  9-cis-epoxycarotenoid dioxygenase                       366   4e-114   
gb|ADQ74048.1|  9-cis-epoxycarotenoid dioxygenase                       366   4e-114   
gb|ADQ74055.1|  9-cis-epoxycarotenoid dioxygenase                       366   4e-114   
gb|ADQ74018.1|  9-cis-epoxycarotenoid dioxygenase                       366   4e-114   
gb|ADQ74029.1|  9-cis-epoxycarotenoid dioxygenase                       366   4e-114   
ref|XP_009408528.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    366   4e-114   
gb|ADQ74050.1|  9-cis-epoxycarotenoid dioxygenase                       365   5e-114   
gb|ADQ74036.1|  9-cis-epoxycarotenoid dioxygenase                       365   5e-114   
gb|ADQ74061.1|  9-cis-epoxycarotenoid dioxygenase                       365   5e-114   
gb|ADQ74025.1|  9-cis-epoxycarotenoid dioxygenase                       365   5e-114   
gb|ADQ74020.1|  9-cis-epoxycarotenoid dioxygenase                       365   5e-114   
gb|ADQ74013.1|  9-cis-epoxycarotenoid dioxygenase                       365   6e-114   
gb|ADQ74022.1|  9-cis-epoxycarotenoid dioxygenase                       365   6e-114   
gb|ADQ74032.1|  9-cis-epoxycarotenoid dioxygenase                       365   6e-114   
ref|XP_002466753.1|  hypothetical protein SORBIDRAFT_01g013520          366   6e-114   
gb|AFP57677.1|  9-cis-epoxycarotenoid dioxygenase 3 protein famil...    366   6e-114   
gb|ADQ74038.1|  9-cis-epoxycarotenoid dioxygenase                       365   6e-114   
gb|AHA94921.1|  viviparous 14                                           366   7e-114   
gb|ADQ74072.1|  9-cis-epoxycarotenoid dioxygenase                       365   7e-114   
ref|XP_009615476.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    366   7e-114   
gb|ADQ74044.1|  9-cis-epoxycarotenoid dioxygenase                       365   7e-114   
gb|ADQ74028.1|  9-cis-epoxycarotenoid dioxygenase                       365   7e-114   
gb|ADQ74030.1|  9-cis-epoxycarotenoid dioxygenase                       365   7e-114   
gb|ADQ74012.1|  9-cis-epoxycarotenoid dioxygenase                       365   8e-114   
ref|XP_010694572.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    365   8e-114   
gb|ADQ74053.1|  9-cis-epoxycarotenoid dioxygenase                       365   8e-114   
gb|ADQ74021.1|  9-cis-epoxycarotenoid dioxygenase                       365   8e-114   
gb|ADQ74042.1|  9-cis-epoxycarotenoid dioxygenase                       365   8e-114   
ref|XP_009603531.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    365   8e-114   
emb|CBN79001.1|  conserved unknown protein                              363   9e-114   
gb|AFP57678.1|  9-cis-epoxycarotenoid dioxygenase 3 protein famil...    365   1e-113   
ref|XP_007214657.1|  hypothetical protein PRUPE_ppa002804mg             365   1e-113   
gb|ADQ74016.1|  9-cis-epoxycarotenoid dioxygenase                       364   1e-113   
ref|XP_004244807.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    364   1e-113   
gb|AGA84060.1|  9-cis-epoxycarotenoid dioxygenase                       364   2e-113   
gb|AAV35466.1|  9-cis-epoxycarotenoid dioxygenase                       363   2e-113   
ref|XP_008226239.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    365   2e-113   
gb|ADQ74046.1|  9-cis-epoxycarotenoid dioxygenase                       363   3e-113   
gb|ADQ74024.1|  9-cis-epoxycarotenoid dioxygenase                       363   3e-113   
pdb|3NPE|A  Chain A, Structure Of Vp14 In Complex With Oxygen           361   5e-113   
ref|NP_001147527.1|  viviparous-14                                      364   6e-113   
ref|XP_010478382.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    363   6e-113   
ref|XP_010092722.1|  hypothetical protein L484_024617                   363   7e-113   
gb|ADQ74040.1|  9-cis-epoxycarotenoid dioxygenase                       362   9e-113   
gb|ADU85829.1|  9-cis-epoxycarotenoid dioxygenase                       363   1e-112   
dbj|BAN15737.1|  9-cis-epoxy-carotenoid dioxygenase                     362   1e-112   
gb|AGA84061.1|  9-cis-epoxycarotenoid dioxygenase                       362   1e-112   
gb|AGK38338.1|  lignostilbene-alpha,beta-dioxygenase-like protein       358   1e-112   
dbj|BAF36657.2|  putative 9-cis-epoxycarotenoid dioxygenase             362   1e-112   
gb|ADQ74039.1|  9-cis-epoxycarotenoid dioxygenase                       362   1e-112   
gb|ADQ74017.1|  9-cis-epoxycarotenoid dioxygenase                       362   2e-112   
ref|XP_006449708.1|  hypothetical protein CICLE_v10014639mg             362   2e-112   
ref|WP_013324698.1|  9-cis-epoxycarotenoid dioxygenase                  357   2e-112   
ref|XP_010062726.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    362   2e-112   
gb|EYU33373.1|  hypothetical protein MIMGU_mgv1a003582mg                361   2e-112   
dbj|BAJ84863.1|  predicted protein                                      361   2e-112   
ref|XP_004300667.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    362   2e-112   
ref|XP_002960273.1|  hypothetical protein SELMODRAFT_75383              362   2e-112   
ref|XP_009783401.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    361   2e-112   
ref|XP_003561898.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    361   2e-112   
ref|NP_001268199.1|  9-cis-epoxycarotenoid dioxygenase 1                361   3e-112   
tpg|DAA50307.1|  TPA: viviparous14                                      361   3e-112   
dbj|BAF02838.1|  putative 9-cis-epoxycarotenoid dioxygenase             361   3e-112   
gb|AGT28471.1|  9-cis-epoxycarotenoid dioxygenase                       361   3e-112   
gb|AGQ03804.1|  9-cis-epoxycarotenoid dioxygenase                       361   3e-112   
gb|AGI98130.1|  9-cis-epoxycarotenoid dioxygenase                       361   4e-112   
gb|KDO78199.1|  hypothetical protein CISIN_1g007291mg                   361   5e-112   
gb|AFN11666.1|  putative 9-cis-epoxycarotenoid dioxygenase              360   6e-112   
dbj|BAN15738.1|  9-cis-epoxy-carotenoid dioxygenase                     359   8e-112   
ref|XP_009360900.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    360   9e-112   
ref|XP_002967439.1|  hypothetical protein SELMODRAFT_31991              357   1e-111   
ref|XP_009376527.1|  PREDICTED: probable carotenoid cleavage diox...    357   1e-111   
gb|ABA43901.1|  9-cis-epoxycarotenoid dioxygenase 3                     360   1e-111   
gb|AHJ80848.1|  9-cis-epoxycarotenoid dioxygenase 2                     359   1e-111   
emb|CDP06103.1|  unnamed protein product                                360   1e-111   
gb|ABB71583.1|  9-cis-epoxycarotenoid dioxygenase 1                     357   2e-111   
ref|NP_001177063.1|  Os12g0617400                                       359   2e-111   
ref|NP_001105902.2|  9-cis-epoxycarotenoid dioxygenase 1, chlorop...    358   3e-111   
ref|XP_006370181.1|  nine-cis-epoxycarotenoid dioxygenase3 family...    358   3e-111   
gb|EYU26242.1|  hypothetical protein MIMGU_mgv1a025212mg                358   3e-111   
ref|XP_004986352.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    359   3e-111   
ref|XP_006836449.1|  hypothetical protein AMTR_s00092p00172590          358   4e-111   
ref|XP_010108103.1|  hypothetical protein L484_023189                   358   4e-111   
ref|XP_011098124.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    358   4e-111   
ref|XP_008809583.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    358   6e-111   
ref|XP_001695565.1|  carotenoid cleavage dioxygenase                    358   6e-111   
gb|ABB52078.1|  putative 9-cis epoxycarotenoid dioxygenase              357   6e-111   
emb|CAN74478.1|  hypothetical protein VITISV_002243                     358   6e-111   
ref|XP_010247741.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    358   8e-111   
gb|EAY83911.1|  hypothetical protein OsI_39134                          358   8e-111   
ref|XP_006307061.1|  hypothetical protein CARUB_v10008647mg             357   1e-110   
gb|ABB52079.1|  putative 9-cis epoxycarotenoid dioxygenase              357   1e-110   
emb|CAN81383.1|  hypothetical protein VITISV_018449                     357   1e-110   
gb|ABB71584.1|  9-cis-epoxycarotenoid dioxygenase 2                     356   2e-110   
ref|XP_009399013.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    357   2e-110   
gb|AAR11193.1|  9-cis-epoxycarotenoid dioxygenase 1                     357   2e-110   
ref|NP_001275868.1|  9-cis-epoxycarotenoid dioxygenase 2                356   3e-110   
ref|XP_008787808.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    356   4e-110   
gb|AFU91490.1|  carotenoid cleavage dioxygenase 4                       355   5e-110   
gb|AAS47838.1|  9-cis-epoxycarotenoid dioxygenase                       355   5e-110   
gb|KDP37985.1|  hypothetical protein JCGZ_04628                         355   5e-110   
gb|AGL08676.1|  carotenoid cleavage dioxygenase 4                       355   5e-110   
ref|XP_011096581.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    355   6e-110   
gb|AAY98512.2|  9-cis-epoxycarotenoid dioxygenase                       355   6e-110   
gb|AGI97131.1|  9-cis-epoxy carotenoid dioxygenase                      355   7e-110   
ref|XP_010472055.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    355   7e-110   
ref|XP_010941288.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    355   8e-110   
ref|XP_010428966.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    355   8e-110   
ref|XP_008221785.1|  PREDICTED: probable carotenoid cleavage diox...    355   8e-110   
ref|XP_004161563.1|  PREDICTED: probable carotenoid cleavage diox...    354   8e-110   
gb|AGO64765.1|  9-cis-epoxycarotenoid dioxygenase                       355   1e-109   
emb|CBN77365.1|  conserved unknown protein                              352   1e-109   
gb|AFA36207.1|  9-cis-epoxycarotenoid dioxygenase 4                     353   1e-109   
gb|ACX33872.1|  NCED3                                                   354   1e-109   
ref|XP_010275132.1|  PREDICTED: probable carotenoid cleavage diox...    355   1e-109   
gb|ACX46382.1|  plastid NCED3                                           354   1e-109   
ref|XP_010923828.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    355   1e-109   
ref|XP_009398335.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    354   2e-109   
gb|AIG92851.1|  9-cis-epoxycarotenoid dioxygenase                       354   2e-109   
ref|XP_010552176.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    353   2e-109   
gb|AHJ80847.1|  9-cis-epoxycarotenoid dioxygenase 1                     354   2e-109   
gb|ABB52080.1|  putative 9-cis epoxycarotenoid dioxygenase              353   2e-109   
gb|AFA36209.1|  9-cis-epoxycarotenoid dioxygenase 4                     353   2e-109   
ref|XP_010460787.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    353   3e-109   
ref|XP_011012661.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    353   3e-109   
dbj|BAE92961.1|  9-cis-epoxycarotenoid dioxygenase                      353   3e-109   
ref|XP_008378396.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    353   3e-109   
gb|AGA83648.1|  9-cis-epoxycarotenoid dioxygenase                       353   3e-109   
ref|XP_004147771.1|  PREDICTED: probable carotenoid cleavage diox...    353   4e-109   
dbj|BAE72094.1|  Lactuca sativa carotenoid cleavage dioxygenase 1       353   4e-109   
ref|XP_007034452.1|  Nine-cis-epoxycarotenoid dioxygenase 6             353   4e-109   
dbj|BAF02837.1|  putative 9-cis-epoxycarotenoid dioxygenase             353   4e-109   
ref|XP_006302015.1|  hypothetical protein CARUB_v10019990mg             353   4e-109   
dbj|BAE92960.1|  9-cis-epoxycarotenoid-dioxygenase                      352   4e-109   
ref|XP_011082846.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    353   4e-109   
ref|XP_008340019.1|  PREDICTED: probable carotenoid cleavage diox...    353   4e-109   
ref|XP_009367762.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    353   5e-109   
dbj|BAJ93203.1|  predicted protein                                      353   5e-109   
dbj|BAE92962.1|  9-cis-epoxycarotenoid dioxygenase                      352   5e-109   
ref|XP_008382970.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    353   5e-109   
ref|XP_010416821.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    353   6e-109   
ref|XP_007025058.1|  Nine-cis-epoxycarotenoid dioxygenase 5             353   7e-109   
gb|AFA36208.1|  9-cis-epoxycarotenoid dioxygenase 4                     352   7e-109   
ref|XP_010499525.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    352   8e-109   
gb|KDO50508.1|  hypothetical protein CISIN_1g007379mg                   352   9e-109   
gb|ACX33873.1|  NCED3                                                   352   9e-109   
ref|NP_001275864.1|  putative 9-cis-epoxycarotenoid dioxygenase 3       352   1e-108   
ref|XP_009363530.1|  PREDICTED: probable carotenoid cleavage diox...    352   1e-108   
ref|XP_008465499.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    352   1e-108   
ref|XP_007158058.1|  hypothetical protein PHAVU_002G120600g             351   1e-108   
gb|ABY60886.1|  carotenoid cleavage dioxygenase 4                       351   1e-108   
ref|XP_010666721.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    352   1e-108   
gb|ADG03462.1|  9-cis-epoxycarotenoid dioxygenase                       352   1e-108   
ref|NP_174302.1|  9-cis-epoxycarotenoid dioxygenase                     351   1e-108   
ref|XP_006442236.1|  hypothetical protein CICLE_v10019364mg             352   2e-108   
ref|XP_006415513.1|  hypothetical protein EUTSA_v10007160mg             351   2e-108   
gb|AGT63321.1|  carotenoid cleavage dioxygenase 4a                      351   2e-108   
ref|XP_010247635.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    352   2e-108   
ref|XP_010439748.1|  PREDICTED: probable carotenoid cleavage diox...    351   2e-108   
dbj|BAE72093.1|  Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 4     350   2e-108   
ref|XP_002268404.1|  PREDICTED: probable carotenoid cleavage diox...    351   2e-108   
gb|EYU38203.1|  hypothetical protein MIMGU_mgv1a003133mg                351   2e-108   
ref|XP_010264135.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    349   3e-108   
gb|ACH85193.1|  9-cis-epoxycarotenoid dioxygenase                       351   3e-108   
gb|AFA36205.1|  9-cis-epoxycarotenoid dioxygenase 4                     350   3e-108   
gb|AFJ94675.1|  carotenoid cleavage dioxygenase 4a                      350   3e-108   
ref|XP_008439625.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    350   3e-108   
ref|XP_010439749.1|  PREDICTED: probable carotenoid cleavage diox...    350   4e-108   
ref|XP_006389988.1|  hypothetical protein EUTSA_v10019707mg             350   5e-108   
ref|XP_008371764.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    350   7e-108   
ref|XP_004134911.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    349   9e-108   
dbj|BAF36655.1|  putative 9-cis-epoxycarotenoid dioxygenase             349   9e-108   
ref|XP_009354854.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    350   1e-107   
gb|AIG92852.1|  9-cis-epoxycarotenoid dioxygenase                       350   1e-107   
gb|AHJ80777.1|  9-cis-epoxicarotenoid dioxygenase 1 protein             349   1e-107   
ref|XP_004488719.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    349   1e-107   
ref|XP_004289731.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    348   1e-107   
ref|XP_010434441.1|  PREDICTED: probable carotenoid cleavage diox...    349   2e-107   
emb|CAE00459.2|  9-cis-epoxycarotenoid dioxygenase                      349   2e-107   
ref|XP_010110953.1|  hypothetical protein L484_021647                   349   2e-107   
dbj|BAE72090.1|  Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 1     348   2e-107   
dbj|BAM72560.1|  9-cis-epoxycarotenoid dioxygenase                      349   2e-107   
emb|CBN79002.1|  conserved unknown protein                              347   2e-107   
gb|KFK38809.1|  hypothetical protein AALP_AA3G162900                    348   2e-107   
emb|CDX88443.1|  BnaC06g38870D                                          348   2e-107   
dbj|BAF42336.1|  9-cis-epoxycarotenoid dioxygenase                      348   2e-107   
ref|NP_177960.1|  9-cis-epoxycarotenoid dioxygenase                     350   2e-107   
ref|XP_006854405.1|  hypothetical protein AMTR_s00039p00194530          348   2e-107   
gb|AGM34083.1|  nine-cis-epoxycarotenoid dioxygenase 4                  349   3e-107   
ref|XP_002862994.1|  nine-cis-epoxycarotenoid dioxygenase 9             348   3e-107   
gb|ABY47995.1|  carotenoid cleavage dioxygenase 4                       347   4e-107   
ref|XP_008644645.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    348   4e-107   
gb|AFU91491.1|  9-cis-epoxycarotenoid dioxygenase                       347   4e-107   
dbj|BAN15739.1|  9-cis-epoxy-carotenoid dioxygenase                     347   4e-107   
ref|XP_008371610.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    348   5e-107   
ref|XP_007040858.1|  Nine-cis-epoxycarotenoid dioxygenase 4             347   6e-107   
gb|KDP27683.1|  hypothetical protein JCGZ_19722                         347   6e-107   
dbj|BAF36656.2|  putative carotenoid cleavage dioxygenase               347   6e-107   
ref|XP_007223976.1|  hypothetical protein PRUPE_ppa014647mg             345   7e-107   
ref|WP_011318839.1|  retinal pigment epithelial membrane protein        352   7e-107   



>ref|NP_001233838.1| carotenoid cleavage dioxygenase 1-2 [Solanum lycopersicum]
 gb|AAT68188.2| carotenoid cleavage dioxygenase 1B [Solanum lycopersicum]
Length=545

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/527 (83%), Positives = 481/527 (91%), Gaps = 3/527 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ+G+AAKAIDW+EWAI+K+M+DS+KPL +L GNFAP  +ETPP K+LPV GHLPECL
Sbjct  20    PKPQNGVAAKAIDWVEWAIIKLMNDSTKPLPFLQGNFAPT-DETPPLKNLPVIGHLPECL  78

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL+IKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  79    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLQIKDGKATYVSRFVRTSRLKQEEFFGGAK  138

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL +VY+ MLR KLKVLD SYGNGTANTA+IYH GKLLALHEGDKPY +
Sbjct  139   FMKIGDLKGLFGLFSVYIYMLREKLKVLDTSYGNGTANTAMIYHHGKLLALHEGDKPYVV  198

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             K+LEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+Q  PF TYRVISKDG+M
Sbjct  199   KILEDGDLQTLGMLDYDKRLQHSFTAHPKVDPVTGEMFTFGYSQTPPFATYRVISKDGVM  258

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIPASVMMHDFAITENYAI MDLPLYF+PKEMV  KQLAY FD TKKARFGVLP
Sbjct  259   QDPVPITIPASVMMHDFAITENYAIMMDLPLYFRPKEMVKNKQLAYSFDPTKKARFGVLP  318

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DFV  746
             RYAKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+ R+QNPDLD   GT K+     F 
Sbjct  319   RYAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITSRLQNPDLDAIKGTEKEEQRDGFT  378

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMK G+ASQKKLSE+AVDFPR+NENYTGRKQRYVY T+L+++A++ G+VKFD
Sbjct  379   NELYEMRFNMKNGVASQKKLSEAAVDFPRINENYTGRKQRYVYGTILNNVAQITGVVKFD  438

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAEPETGKTKLEVGGNV GIFDLGPGRFGSEAIFVPR+  T CEEDDGYLILFVHDENT
Sbjct  439   LHAEPETGKTKLEVGGNVPGIFDLGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDENT  498

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKS+VNVIDAKTMSAEPVAVVELP RVP+GFHAFFVTEEQ+Q QA++
Sbjct  499   GKSSVNVIDAKTMSAEPVAVVELPKRVPFGFHAFFVTEEQIQEQAKM  545



>ref|XP_006345441.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Solanum tuberosum]
Length=546

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/527 (83%), Positives = 481/527 (91%), Gaps = 3/527 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ+G+AAKAIDW+EWAI+K+M+DS+KPL +L GNFAP  +ETPP K LPV GHLPECL
Sbjct  21    PKPQNGVAAKAIDWVEWAIIKLMNDSTKPLPFLQGNFAPT-DETPPFKHLPVIGHLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL+IKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  80    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLQIKDGKATYVSRFVRTSRLKQEEFFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL +VY+ MLR KLKVLD SYG+GTANTA+IYH GKLLALHEGDKPY +
Sbjct  140   FMKIGDLKGLFGLFSVYIYMLREKLKVLDTSYGHGTANTAMIYHHGKLLALHEGDKPYVV  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             K+LEDGDLQTLGMLDYDKRL H FTAHPKVDPVTGEMFTFGY+Q  PF TYRVISKDG+M
Sbjct  200   KILEDGDLQTLGMLDYDKRLQHPFTAHPKVDPVTGEMFTFGYSQTPPFATYRVISKDGVM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIPASVMMHDFAITENYAI MDLPLYF+PKEMV KKQLAY FD TKKARFGVLP
Sbjct  260   QDPVPITIPASVMMHDFAITENYAIMMDLPLYFRPKEMVKKKQLAYSFDPTKKARFGVLP  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DFV  746
             RYAKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+ R+QNPDLD   GT K+     F 
Sbjct  320   RYAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITSRLQNPDLDAIKGTEKEEQRDGFT  379

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMK+GLASQKKLSE+AVDFPR+NENYTGRKQRYVY T+L+++A++ G+VKFD
Sbjct  380   NELYEMRFNMKSGLASQKKLSEAAVDFPRINENYTGRKQRYVYGTILNNVAQITGVVKFD  439

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAEPETGKTKLEVGGNV GIFDLGPGRFGSEAIFVPR+  T CEEDDGYLILFVHDENT
Sbjct  440   LHAEPETGKTKLEVGGNVPGIFDLGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDENT  499

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKS+VNVIDAKTMSAEPVAVVELP RVP+GFHAFFVTEEQ+Q QA++
Sbjct  500   GKSSVNVIDAKTMSAEPVAVVELPKRVPFGFHAFFVTEEQIQEQAKM  546



>gb|AIY62758.1| carotenoid cleavage dioxygenase [Lycium chinense]
Length=546

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/527 (83%), Positives = 476/527 (90%), Gaps = 3/527 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+ AKAID LEW ++K+M+DS+KPLHYL GNFAP   ETPP KDLPV GHLPECL
Sbjct  21    PKPKKGVVAKAIDLLEWGMIKLMNDSTKPLHYLQGNFAPT-HETPPFKDLPVKGHLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAP AGYHWFDGDGMIHGL IKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  80    NGEFVRVGPNPKFAPAAGYHWFDGDGMIHGLHIKDGKATYVSRFVRTSRLKQEEFFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL +VY+ MLR KLKVLD SYGNGTANTA+IYH GKLLALHEGDKPY +
Sbjct  140   FMKIGDLKGLFGLFSVYIYMLRQKLKVLDTSYGNGTANTAMIYHHGKLLALHEGDKPYVV  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGYAQ  P+ TYRVISKDG+M
Sbjct  200   KVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPVTGEMFTFGYAQTPPYATYRVISKDGIM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIPA+VMMHDFAITENYAI MDLPLYF+PKEMV  KQLAY FD TKKARFGVLP
Sbjct  260   EDPVPITIPAAVMMHDFAITENYAIMMDLPLYFKPKEMVKNKQLAYSFDPTKKARFGVLP  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DFV  746
             RYAKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+CR+QNPDLD  +GT  +     F 
Sbjct  320   RYAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITCRLQNPDLDAINGTENEQQRDGFT  379

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMK GLAS+KKLSESAVDFPRVNENYTGRKQRYVY T+L+++AK+ G+VKFD
Sbjct  380   NELYEMRFNMKNGLASEKKLSESAVDFPRVNENYTGRKQRYVYGTILNNVAKITGVVKFD  439

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAEPETGKTKLEVGGN+ GIFDLGPGRFGSEAIFVPR+  T CEEDDGYLILFVHDE T
Sbjct  440   LHAEPETGKTKLEVGGNIPGIFDLGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDEIT  499

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             G+S+VNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQ+Q QA++
Sbjct  500   GQSSVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQIQEQAKL  546



>ref|XP_009589879.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Nicotiana tomentosiformis]
 gb|AHH25652.1| carotenoid cleavage dioxygenase 1 [Nicotiana tomentosiformis]
Length=548

 Score =   922 bits (2384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/527 (83%), Positives = 477/527 (91%), Gaps = 2/527 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ+G+ AKAID LE  + K+MHDSSKPL +L GN+AP  +ETPP K+LPV GHLPECL
Sbjct  22    PKPQNGLTAKAIDLLERVMAKLMHDSSKPLPFLQGNYAPTDDETPPFKNLPVKGHLPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL IKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  82    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLHIKDGKATYVSRFVRTSRLKQEEFFGGAK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL +VY+ MLR KLKVLD SYGNGTANTA+IYH GKLLALHEGDKPY +
Sbjct  142   FMKIGDLKGLFGLFSVYIYMLREKLKVLDTSYGNGTANTAMIYHHGKLLALHEGDKPYVV  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+Q  P+ TYRVISKDG+M
Sbjct  202   KVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPVTGEMFTFGYSQTPPYATYRVISKDGVM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIPASVMMHDFAITENY+I MDLPLYF+PKEMV  K+LAY FD TKKARFG+LP
Sbjct  262   QDPVPITIPASVMMHDFAITENYSIMMDLPLYFKPKEMVKNKKLAYSFDPTKKARFGILP  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DFV  746
             RYAKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+CR+QNPDLD+ +GT K+     F 
Sbjct  322   RYAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITCRLQNPDLDVINGTEKEQQRDGFT  381

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFN+KTGLASQKKLSESAVDFPRVNENYTGRKQRYVY T+L+ +AK+ GIVKFD
Sbjct  382   NELYEMRFNIKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYGTILNHMAKITGIVKFD  441

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAEPETGKTKLEVGGNV GIFDLGPGRFGSEAIFVPR+  T CEEDDGYLILFVHDENT
Sbjct  442   LHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDENT  501

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKS+VNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+  QA++
Sbjct  502   GKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQILEQAKL  548



>gb|AHH25650.1| carotenoid cleavage dioxygenase 1-2 [Nicotiana tabacum]
Length=548

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/527 (83%), Positives = 476/527 (90%), Gaps = 2/527 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ+G+ AKAID LE  + K+MHDSSKPL +L GN+AP  +ETPP K+LPV GHLPECL
Sbjct  22    PKPQNGLTAKAIDLLERVMAKLMHDSSKPLPFLQGNYAPTDDETPPFKNLPVKGHLPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL IKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  82    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLHIKDGKATYVSRFVRTSRLKQEEFFGGAK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL +VY+ MLR KLKVLD SYGNGTANTA+IYH GKLLALHEGDKPY +
Sbjct  142   FMKIGDLKGLFGLFSVYIYMLREKLKVLDTSYGNGTANTAMIYHHGKLLALHEGDKPYVV  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+Q  P+ TYRVISKDG+M
Sbjct  202   KVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPVTGEMFTFGYSQTPPYATYRVISKDGVM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIPASVMMHDFAITENY+I MDLPLYF+PKEMV  K+LAY FD TKKARFG+LP
Sbjct  262   QDPVPITIPASVMMHDFAITENYSIMMDLPLYFKPKEMVKNKKLAYSFDPTKKARFGILP  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DFV  746
             RYAKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+CR+QNPDLD  +GT K+     F 
Sbjct  322   RYAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITCRLQNPDLDAINGTEKEQQRDGFT  381

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFN+KTGLASQKKLSESAVDFPRVNENYTGRKQRYVY T+L+ +AK+ GIVKFD
Sbjct  382   NELYEMRFNIKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYGTILNHMAKITGIVKFD  441

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAEPETGKTKLEVGGNV GIFDLGPGRFGSEAIFVPR+  T CEEDDGYLILFVHDENT
Sbjct  442   LHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDENT  501

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKS+VNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+  QA++
Sbjct  502   GKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQILEQAKL  548



>ref|XP_010695196.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Beta 
vulgaris subsp. vulgaris]
Length=581

 Score =   919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/526 (82%), Positives = 473/526 (90%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  +KAIDWLE   VK+MHDSS+PLHYL+GNFAP  +ETPPCKDLPV GHLPECL
Sbjct  56    PKPNNGFTSKAIDWLEKLFVKLMHDSSQPLHYLTGNFAPVTDETPPCKDLPVHGHLPECL  115

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPK  P+AGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEEFFG  K
Sbjct  116   NGEFVRVGPNPKLPPLAGYHWFDGDGMIHGMRIKDGKATYVSRYVKTSRLKQEEFFGAPK  175

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLLTV LQMLR KLKVLD SYGNGTANTALIYH GKLLAL EGDKPY +
Sbjct  176   FMKIGDLKGLFGLLTVNLQMLRAKLKVLDMSYGNGTANTALIYHHGKLLALSEGDKPYVL  235

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             +VLEDGDLQT+G+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG+M
Sbjct  236   RVLEDGDLQTIGLLDYDKRLTHSFTAHPKVDPFTGEMFTFGYSHAPPYITYRVISKDGVM  295

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITIPA +MMHDFAITENYAI MDLPLYF+PKEMV +K+L + FD+TKK+RFGVLP
Sbjct  296   HDPVPITIPAPIMMHDFAITENYAIIMDLPLYFRPKEMVKEKKLIFTFDSTKKSRFGVLP  355

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAKNE LIKWFELPNCFIFH ANAWEEGDEVV+I+CRI NPDLDM SG   D +D F N
Sbjct  356   RYAKNESLIKWFELPNCFIFHNANAWEEGDEVVLITCRIDNPDLDMVSGAATDMVDNFSN  415

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             +LYEMRFNMKTGLASQK+LS SAVDFPRVNENYTGRKQRYVY T+L  +AKV+GIVKFDL
Sbjct  416   QLYEMRFNMKTGLASQKQLSASAVDFPRVNENYTGRKQRYVYGTILGSIAKVQGIVKFDL  475

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP++ KTKLEVGG V+GIFDLGPGRFGSEAIFVPRE  T  EEDDGYLI FVHDE TG
Sbjct  476   HAEPDSSKTKLEVGGTVQGIFDLGPGRFGSEAIFVPREQGTTSEEDDGYLIFFVHDEKTG  535

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMSA+PVAVV+LPNRVPYGFHAFFVTEEQL+ QAEI
Sbjct  536   KSSVNVIDAKTMSADPVAVVDLPNRVPYGFHAFFVTEEQLKEQAEI  581



>ref|XP_009589878.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Nicotiana tomentosiformis]
Length=549

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/529 (83%), Positives = 477/529 (90%), Gaps = 5/529 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHD--SSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPE  1646
             P P +   AKAIDWLE  IVK+M++  SSK  H+LSG+FAP  EETPPCKDLPV G+LPE
Sbjct  22    PKPNNKFGAKAIDWLEKVIVKLMYNTASSKACHFLSGDFAPV-EETPPCKDLPVKGYLPE  80

Query  1645  CLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGR  1466
             CLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL IKDGKATYVSRFV+TSRLKQEEFFG 
Sbjct  81    CLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLHIKDGKATYVSRFVRTSRLKQEEFFGG  140

Query  1465  AKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPY  1286
             AKFMKIGDLKG+FGL +VY+ MLR KLKVLD SYGNGTANTA+IYH GKLLALHEGDKPY
Sbjct  141   AKFMKIGDLKGLFGLFSVYIYMLREKLKVLDTSYGNGTANTAMIYHHGKLLALHEGDKPY  200

Query  1285  AIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDG  1106
              +KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+Q  P+ TYRVISKDG
Sbjct  201   VVKVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPVTGEMFTFGYSQTPPYATYRVISKDG  260

Query  1105  LMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGV  926
             +M DPVPITIPASVMMHDFAITENY+I MDLPLYF+PKEMV  K+LAY FD TKKARFG+
Sbjct  261   VMQDPVPITIPASVMMHDFAITENYSIMMDLPLYFKPKEMVKNKKLAYSFDPTKKARFGI  320

Query  925   LPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--D  752
             LPRYAKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+CR+QNPDLD+ +GT K+     
Sbjct  321   LPRYAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITCRLQNPDLDVINGTEKEQQRDG  380

Query  751   FVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVK  572
             F NELYEMRFN+KTGLASQKKLSESAVDFPRVNENYTGRKQRYVY T+L+ +AK+ GIVK
Sbjct  381   FTNELYEMRFNIKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYGTILNHMAKITGIVK  440

Query  571   FDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDE  392
             FDLHAEPETGKTKLEVGGNV GIFDLGPGRFGSEAIFVPR+  T CEEDDGYLILFVHDE
Sbjct  441   FDLHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDE  500

Query  391   NTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             NTGKS+VNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+  QA++
Sbjct  501   NTGKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQILEQAKL  549



>gb|AHH25649.1| carotenoid cleavage dioxygenase 1-1 [Nicotiana tabacum]
Length=544

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/527 (83%), Positives = 475/527 (90%), Gaps = 3/527 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ+G+ AKAID LE  +VK+MHDSSKPL +L GN+AP  +ETPP  +LPV GHLPECL
Sbjct  19    PKPQTGLTAKAIDLLERVMVKLMHDSSKPLPFLQGNYAPT-DETPPLTNLPVKGHLPECL  77

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL+IKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  78    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLQIKDGKATYVSRFVRTSRLKQEEFFGGAK  137

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL +VY+ MLR KLKVLD SYGNG ANTA+IYH GKLLALHEGDKPY +
Sbjct  138   FMKIGDLKGLFGLFSVYIYMLREKLKVLDTSYGNGAANTAMIYHHGKLLALHEGDKPYVV  197

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+Q  P+ TYRVISKDG+M
Sbjct  198   KVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPVTGEMFTFGYSQTPPYATYRVISKDGVM  257

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIPASVMMHDFAITENY+I MDLPLYF+PKEMV  K+L Y FD TKKARFG+LP
Sbjct  258   QDPVPITIPASVMMHDFAITENYSIMMDLPLYFKPKEMVKNKKLVYSFDPTKKARFGILP  317

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DFV  746
             RYAKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+CR+QNPDLD  +GT K+     F 
Sbjct  318   RYAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITCRLQNPDLDAINGTEKEQQRDGFT  377

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVY T+L+ +AK+ G+VKFD
Sbjct  378   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYGTILNHMAKITGVVKFD  437

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAEPETGKTKLEVGGNV GIFDLGPGRFGSEAIFVP +  T CEEDDGYLILFVHDENT
Sbjct  438   LHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPCQPGTECEEDDGYLILFVHDENT  497

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKS+VNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+Q QA++
Sbjct  498   GKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQIQEQAKL  544



>gb|AIX87533.1| carotenoid cleavage dioxygenase 1A [Lycium ruthenicum]
Length=540

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/526 (82%), Positives = 474/526 (90%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ AKA+D LEW IVK+MHD+SKPLHYL GNFAP  +ETPP  DL V GHLPECL
Sbjct  16    PKPGKGLIAKAVDLLEWGIVKLMHDASKPLHYLQGNFAPT-DETPPLNDLIVQGHLPECL  74

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEEFFG AK
Sbjct  75    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEFFGGAK  134

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL TVY+Q+LR KLKVLD SYGNGTANTAL+YH GKLLAL E DKPYA+
Sbjct  135   FMKIGDLKGLFGLFTVYMQLLRTKLKVLDISYGNGTANTALVYHHGKLLALSEADKPYAL  194

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+   P++TYRVISKDG+M
Sbjct  195   KVLEDGDLQTLGMLDYDKRLAHSFTAHPKVDPVTGEMFTFGYSHTPPYITYRVISKDGIM  254

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP ++MMHDFAITENYAI MDLPL F+PKEMV   +LA+ FD TKKARFGVL 
Sbjct  255   QDPVPITIPEAIMMHDFAITENYAIMMDLPLCFRPKEMVKNNKLAFTFDGTKKARFGVLA  314

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYA NE LIKWFELPNCFIFH ANAWEEGDEVV+I+CR+QNPDLDM +G +K++L +F N
Sbjct  315   RYANNEALIKWFELPNCFIFHNANAWEEGDEVVLITCRVQNPDLDMVNGGVKENLENFCN  374

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G ASQKKLSESAVDFPR+NE+YTGRKQRYVY T L+ +AKV GI+KFDL
Sbjct  375   ELYEMRFNMKSGAASQKKLSESAVDFPRINESYTGRKQRYVYGTTLNSIAKVTGIIKFDL  434

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGK++LEVGGNV+GIFDLGPGRFGSEA+FVPR+  T CEEDDGYLI FVHDENTG
Sbjct  435   HAEPETGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPRQPGTECEEDDGYLIFFVHDENTG  494

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+Q QA++
Sbjct  495   KSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQIQEQAKL  540



>ref|XP_010324092.1| PREDICTED: carotenoid cleavage dioxygenase 1-2 isoform X1 [Solanum 
lycopersicum]
Length=550

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/528 (82%), Positives = 473/528 (90%), Gaps = 3/528 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKP-LHYLSGNFAPAPEETPPCKDLPVSGHLPEC  1643
             P P      KAIDWLE  I+K+M+ S+ P  H+LSGNFAP  EETPPCKDLPV G+LPEC
Sbjct  23    PNPNKKFGGKAIDWLEKVIIKLMYKSNVPNSHFLSGNFAPIDEETPPCKDLPVKGYLPEC  82

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL+IKDGKATYVSRFV+TSRLKQEEFFG A
Sbjct  83    LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLQIKDGKATYVSRFVRTSRLKQEEFFGGA  142

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KFMKIGDLKG+FGL +VY+ MLR KLKVLD SYGNGTANTA+IYH GKLLALHEGDKPY 
Sbjct  143   KFMKIGDLKGLFGLFSVYIYMLREKLKVLDTSYGNGTANTAMIYHHGKLLALHEGDKPYV  202

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             +K+LEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+Q  PF TYRVISKDG+
Sbjct  203   VKILEDGDLQTLGMLDYDKRLQHSFTAHPKVDPVTGEMFTFGYSQTPPFATYRVISKDGV  262

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             M DPVPITIPASVMMHDFAITENYAI MDLPLYF+PKEMV  KQLAY FD TKKARFGVL
Sbjct  263   MQDPVPITIPASVMMHDFAITENYAIMMDLPLYFRPKEMVKNKQLAYSFDPTKKARFGVL  322

Query  922   PRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DF  749
             PRYAKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+ R+QNPDLD   GT K+     F
Sbjct  323   PRYAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITSRLQNPDLDAIKGTEKEEQRDGF  382

Query  748   VNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKF  569
              NELYEMRFNMK G+ASQKKLSE+AVDFPR+NENYTGRKQRYVY T+L+++A++ G+VKF
Sbjct  383   TNELYEMRFNMKNGVASQKKLSEAAVDFPRINENYTGRKQRYVYGTILNNVAQITGVVKF  442

Query  568   DLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDEN  389
             DLHAEPETGKTKLEVGGNV GIFDLGPGRFGSEAIFVPR+  T CEEDDGYLILFVHDEN
Sbjct  443   DLHAEPETGKTKLEVGGNVPGIFDLGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDEN  502

Query  388   TGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             TGKS+VNVIDAKTMSAEPVAVVELP RVP+GFHAFFVTEEQ+Q QA++
Sbjct  503   TGKSSVNVIDAKTMSAEPVAVVELPKRVPFGFHAFFVTEEQIQEQAKM  550



>gb|AAT68189.1| carotenoid cleavage dioxygenase 1 [Petunia x hybrida]
Length=546

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/526 (82%), Positives = 475/526 (90%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ GI AKAID LE  I+K+MHDSSKPLHYLSGNFAP  +ETPP  DLP+ GHLPECL
Sbjct  22    PKPKKGITAKAIDLLEKVIIKLMHDSSKPLHYLSGNFAPT-DETPPLNDLPIKGHLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEEFF  AK
Sbjct  81    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEFFEGAK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL TVY+QMLR KLK+LD SYGNGTANTAL+YH GKLLAL E DKPYA+
Sbjct  141   FMKIGDLKGLFGLFTVYMQMLRAKLKILDTSYGNGTANTALVYHHGKLLALSEADKPYAL  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGYA + P++TYRVISKDG+M
Sbjct  201   KVLEDGDLQTLGMLDYDKRLLHSFTAHPKVDPVTGEMFTFGYAHEPPYITYRVISKDGIM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP ++MMHDFAITENYAI MDLPL F+PKEMV   QLA+ FD TKKARFGVLP
Sbjct  261   QDPVPITIPEAIMMHDFAITENYAIMMDLPLCFRPKEMVKNNQLAFTFDTTKKARFGVLP  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+E LI+WFELPNCFIFH ANAWEEGDEVV+I+CR+ +PDLDM +G +K++L +F N
Sbjct  321   RYAKSEALIRWFELPNCFIFHNANAWEEGDEVVLITCRLPHPDLDMVNGEVKENLENFSN  380

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G ASQKKLSES+VDFPR+NENYTGRKQRYVY T L+ +AKV GI+KFDL
Sbjct  381   ELYEMRFNMKSGAASQKKLSESSVDFPRINENYTGRKQRYVYGTTLNSIAKVTGIIKFDL  440

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGK +LEVGGNV+GIFDLGPGRFGSEA+FVP +  T CEEDDGYLI FVHDENTG
Sbjct  441   HAEPETGKKQLEVGGNVQGIFDLGPGRFGSEAVFVPSQPGTECEEDDGYLIFFVHDENTG  500

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+Q QA++
Sbjct  501   KSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQIQEQAKL  546



>ref|XP_009784260.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Nicotiana sylvestris]
Length=546

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/526 (82%), Positives = 474/526 (90%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+  KAID LE  I+K+MHDS+KPLHYLSGNFAP  +ETPP KDL V+GHLPECL
Sbjct  22    PKPKKGVIGKAIDLLEKVIIKLMHDSTKPLHYLSGNFAPT-DETPPLKDLSVTGHLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEEFFG AK
Sbjct  81    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEFFGGAK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL TVY+Q+LR KLKVLD +YGNGTANTAL+YH GKLLAL E DKPYA+
Sbjct  141   FMKIGDLKGLFGLFTVYMQVLRAKLKVLDITYGNGTANTALVYHHGKLLALSEADKPYAL  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+Q  P++TYRVISK G+M
Sbjct  201   KVMEDGDLQTLGMLDYDKRLAHSFTAHPKVDPVTGEMFTFGYSQNPPYITYRVISKGGIM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP  +MMHDFAITENYAI MDLPL F+PKEMV   QLA+ FDATK ARFGVLP
Sbjct  261   QDPVPITIPEPIMMHDFAITENYAIMMDLPLCFRPKEMVKNNQLAFFFDATKNARFGVLP  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+E LIKWFELPNCFIFH ANAWEEGDEVV+I+CR+QNP+LDM +G +K+ L +F N
Sbjct  321   RYAKSEALIKWFELPNCFIFHNANAWEEGDEVVLITCRVQNPNLDMVNGVVKEKLENFSN  380

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G ASQKKLSESAVDFPR+NENYTGRKQRYVY T L  +AKV GI+KFDL
Sbjct  381   ELYEMRFNMKSGAASQKKLSESAVDFPRINENYTGRKQRYVYGTTLDSIAKVTGIIKFDL  440

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGK +LEVGGNV+GIFDLGPGRFGSEA+FVPR+  T CEEDDGYLI FVHDENTG
Sbjct  441   HAEPETGKAQLEVGGNVQGIFDLGPGRFGSEAVFVPRQPGTECEEDDGYLIFFVHDENTG  500

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+Q QA++
Sbjct  501   KSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQIQEQAKL  546



>ref|XP_009760607.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Nicotiana sylvestris]
 gb|AHH25651.1| carotenoid cleavage dioxygenase 1 [Nicotiana sylvestris]
Length=544

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/527 (83%), Positives = 474/527 (90%), Gaps = 3/527 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ+G+ AKAID LE  +VK+MHDSSKPL +L GN+AP  +ETPP  +LPV GHLPECL
Sbjct  19    PKPQTGLTAKAIDLLERVMVKLMHDSSKPLPFLQGNYAPT-DETPPLTNLPVKGHLPECL  77

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL+IKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  78    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLQIKDGKATYVSRFVRTSRLKQEEFFGGAK  137

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL +VY+ MLR KLKVLD SYGNG ANTA+IYH GK LALHEGDKPY +
Sbjct  138   FMKIGDLKGLFGLFSVYIYMLREKLKVLDTSYGNGAANTAMIYHHGKFLALHEGDKPYVV  197

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+Q  P+ TYRVISKDG+M
Sbjct  198   KVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPVTGEMFTFGYSQTPPYATYRVISKDGVM  257

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIPASVMMHDFAITENY+I MDLPLYF+PKEMV  K+L Y FD TKKARFG+LP
Sbjct  258   QDPVPITIPASVMMHDFAITENYSIMMDLPLYFKPKEMVKNKKLVYSFDPTKKARFGILP  317

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DFV  746
             RYAKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+CR+QNPDLD  +GT K+     F 
Sbjct  318   RYAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITCRLQNPDLDAINGTEKEQQRDGFT  377

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVY T+L+ +AK+ G+VKFD
Sbjct  378   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYGTILNHMAKITGVVKFD  437

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAEPETGKTKLEVGGNV GIFDLGPGRFGSEAIFVP +  T CEEDDGYLILFVHDENT
Sbjct  438   LHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPCQPGTECEEDDGYLILFVHDENT  497

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKS+VNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+Q QA++
Sbjct  498   GKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQIQEQAKL  544



>gb|AIX87509.1| carotenoid cleavage dioxygenase 1A [Lycium barbarum]
Length=540

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/526 (81%), Positives = 472/526 (90%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ AKA+D LEW IVK+MHD+SKPLHYL GNFAP  +ETPP  DL V GHLPECL
Sbjct  16    PKPGKGLIAKAVDVLEWGIVKLMHDASKPLHYLQGNFAPT-DETPPLNDLIVQGHLPECL  74

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLR+KDGKATYVSR+V+TSRLKQEEFFG AK
Sbjct  75    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRVKDGKATYVSRYVRTSRLKQEEFFGGAK  134

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL TVY+QMLR KLKVLD SYGNGTANTAL+YH GKLLAL E DKPYA+
Sbjct  135   FMKIGDLKGLFGLFTVYMQMLRTKLKVLDTSYGNGTANTALVYHHGKLLALSEADKPYAL  194

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+   P++TYRVISKDG+M
Sbjct  195   KVLEDGDLQTLGMLDYDKRLAHSFTAHPKVDPVTGEMFTFGYSHTPPYITYRVISKDGIM  254

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP ++MMHDFAITENYAI MDLPL F+PKEMV   +LA+ FD TKKARFGVL 
Sbjct  255   QDPVPITIPEAIMMHDFAITENYAIMMDLPLCFRPKEMVKNNKLAFTFDGTKKARFGVLA  314

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYA NE LIKWFELPNCFIFH ANAWEEGDEVV+I+CR+QNPDLDM +G +K++L +F N
Sbjct  315   RYANNEALIKWFELPNCFIFHNANAWEEGDEVVLITCRVQNPDLDMVNGGVKENLENFCN  374

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G ASQKKLSESAVDFPR+NE+YTGRKQRYVY T L+ +AKV GI+KFDL
Sbjct  375   ELYEMRFNMKSGAASQKKLSESAVDFPRINESYTGRKQRYVYGTTLNSIAKVTGIIKFDL  434

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP TGK++LEVGGNV+GIFDLGPGRFGSEA+FVPR+  T CEEDDGYLI FVHDENTG
Sbjct  435   HAEPGTGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPRQPGTECEEDDGYLIFFVHDENTG  494

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKTMS EPVAVVELP RVPYGFHAFFVTEEQ+Q QA++
Sbjct  495   KSAVNVIDAKTMSTEPVAVVELPKRVPYGFHAFFVTEEQIQEQAKL  540



>ref|NP_001234542.1| carotenoid cleavage dioxygenase 1-1 [Solanum lycopersicum]
 gb|AAT68187.1| carotenoid cleavage dioxygenase 1A [Solanum lycopersicum]
Length=545

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/526 (82%), Positives = 470/526 (89%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ GI AKAID LEW IVK+MHDSSKPLHYL GNFAP  +ETPP  DL V GHLPECL
Sbjct  21    PKPRRGITAKAIDLLEWGIVKLMHDSSKPLHYLQGNFAPT-DETPPLNDLVVQGHLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEEFFG AK
Sbjct  80    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEFFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG+FGL TVY+QMLR KLKVLD SYGN TANTAL+YH GKLLAL E DKPYA+
Sbjct  140   FMKVGDLKGLFGLFTVYMQMLRTKLKVLDISYGNSTANTALVYHHGKLLALSEADKPYAL  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVD VTGEMFTFGYA   P++TYRVISKDG+M
Sbjct  200   KVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDAVTGEMFTFGYAHTPPYITYRVISKDGIM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP  +MMHDFAITENYAI MDLPL F+PKEMV K +LA+ FDATKKARFGVLP
Sbjct  260   QDPVPITIPEPIMMHDFAITENYAIMMDLPLCFRPKEMVKKNKLAFTFDATKKARFGVLP  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYA NE LI+WFELPNCFIFH ANAWEEGDEVV+I+CR+ NPDLDM +G +K+ L +F N
Sbjct  320   RYANNEALIRWFELPNCFIFHNANAWEEGDEVVLITCRLVNPDLDMVNGAVKEKLENFCN  379

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G ASQKKLSESAVDFPR+NENYTGRKQRYVY T L+ +AKV G++KFDL
Sbjct  380   ELYEMRFNMKSGAASQKKLSESAVDFPRINENYTGRKQRYVYGTTLNSIAKVTGVIKFDL  439

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGK++LEVGGNV+GIFDLGPGRFGSEA+FVP    T  EEDDGYLI FVHDENTG
Sbjct  440   HAEPETGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPSRPGTEREEDDGYLIFFVHDENTG  499

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+Q QA++
Sbjct  500   KSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQIQEQAKL  545



>ref|XP_006345442.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Solanum tuberosum]
Length=550

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/528 (82%), Positives = 473/528 (90%), Gaps = 3/528 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKP-LHYLSGNFAPAPEETPPCKDLPVSGHLPEC  1643
             P P      KAIDWLE  IVK+M+ S+ P   +LSGNFAP  EETPPCKDLPV G+LPEC
Sbjct  23    PKPNKKFGGKAIDWLEKVIVKLMYKSNAPNCPFLSGNFAPIDEETPPCKDLPVKGYLPEC  82

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL+IKDGKATYVSRFV+TSRLKQEEFFG A
Sbjct  83    LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLQIKDGKATYVSRFVRTSRLKQEEFFGGA  142

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KFMKIGDLKG+FGL +VY+ MLR KLKVLD SYG+GTANTA+IYH GKLLALHEGDKPY 
Sbjct  143   KFMKIGDLKGLFGLFSVYIYMLREKLKVLDTSYGHGTANTAMIYHHGKLLALHEGDKPYV  202

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             +K+LEDGDLQTLGMLDYDKRL H FTAHPKVDPVTGEMFTFGY+Q  PF TYRVISKDG+
Sbjct  203   VKILEDGDLQTLGMLDYDKRLQHPFTAHPKVDPVTGEMFTFGYSQTPPFATYRVISKDGV  262

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             M DPVPITIPASVMMHDFAITENYAI MDLPLYF+PKEMV KKQLAY FD TKKARFGVL
Sbjct  263   MQDPVPITIPASVMMHDFAITENYAIMMDLPLYFRPKEMVKKKQLAYSFDPTKKARFGVL  322

Query  922   PRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DF  749
             PRYAKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+ R+QNPDLD   GT K+     F
Sbjct  323   PRYAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITSRLQNPDLDAIKGTEKEEQRDGF  382

Query  748   VNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKF  569
              NELYEMRFNMK+GLASQKKLSE+AVDFPR+NENYTGRKQRYVY T+L+++A++ G+VKF
Sbjct  383   TNELYEMRFNMKSGLASQKKLSEAAVDFPRINENYTGRKQRYVYGTILNNVAQITGVVKF  442

Query  568   DLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDEN  389
             DLHAEPETGKTKLEVGGNV GIFDLGPGRFGSEAIFVPR+  T CEEDDGYLILFVHDEN
Sbjct  443   DLHAEPETGKTKLEVGGNVPGIFDLGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDEN  502

Query  388   TGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             TGKS+VNVIDAKTMSAEPVAVVELP RVP+GFHAFFVTEEQ+Q QA++
Sbjct  503   TGKSSVNVIDAKTMSAEPVAVVELPKRVPFGFHAFFVTEEQIQEQAKM  550



>ref|XP_006345443.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum tuberosum]
Length=545

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/526 (81%), Positives = 470/526 (89%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+ AKAID LEW IVK+MHDSSKPLHYL GNFAP  +ETPP  DL V GHLPECL
Sbjct  21    PKPRKGLTAKAIDLLEWGIVKLMHDSSKPLHYLQGNFAPT-DETPPLNDLVVQGHLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEEFFG AK
Sbjct  80    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEFFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG+FGL TVY+QMLR KLKVLD SYGN TANTAL+YH GKLLAL E DKPYA+
Sbjct  140   FMKVGDLKGLFGLFTVYMQMLRTKLKVLDISYGNSTANTALVYHHGKLLALSEADKPYAL  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             +VLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGYA   P++TYRVISKDG+M
Sbjct  200   QVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDPVTGEMFTFGYAHTPPYITYRVISKDGIM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP  +MMHDFAITENYAI MDLPL F+P EMV   +LA+ FDATKKARFGVLP
Sbjct  260   QDPVPITIPEPIMMHDFAITENYAIIMDLPLCFRPMEMVKNNKLAFTFDATKKARFGVLP  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYA NE LI+WFELPNCFIFH ANAWEEGDEVV+I+CR+ NPDLDM +G +K+ L +F N
Sbjct  320   RYANNEALIRWFELPNCFIFHNANAWEEGDEVVLITCRLMNPDLDMVNGAVKEKLENFCN  379

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G ASQKKLSESAVDFPR+NENYTGRKQRYVY T L+ +AKV G++KFDL
Sbjct  380   ELYEMRFNMKSGAASQKKLSESAVDFPRINENYTGRKQRYVYGTTLNSIAKVTGVIKFDL  439

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGK++LEVGGNV+GIFDLGPGRFGSEA+FVP +  T CEEDDGYLI FVHDENTG
Sbjct  440   HAEPETGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPSQPGTECEEDDGYLIFFVHDENTG  499

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKTMS EPVAVVELP RVPYGFHAFFVTEEQ++ QA++
Sbjct  500   KSAVNVIDAKTMSMEPVAVVELPKRVPYGFHAFFVTEEQIREQAKL  545



>gb|AHA43413.1| carotenoid cleavage dioxygenase [Solanum nigrum]
Length=545

 Score =   909 bits (2348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/526 (81%), Positives = 470/526 (89%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+ +KAID  EW IVK++HDSSKPLHYL GNFAP  +ETPP  DL V GHLPECL
Sbjct  21    PKPRKGLISKAIDLFEWGIVKLVHDSSKPLHYLQGNFAPT-DETPPLNDLVVQGHLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEEFFG AK
Sbjct  80    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEFFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG+FGL TVY+QMLR KLKVLD SYGN TANTAL+YH GKLLAL E DKPYA+
Sbjct  140   FMKVGDLKGLFGLFTVYMQMLRTKLKVLDISYGNSTANTALVYHHGKLLALSEADKPYAL  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             +VLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGYA   P++TYRVISKDG+M
Sbjct  200   RVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDPVTGEMFTFGYAHTPPYITYRVISKDGIM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP  +MMHDFAITENYAI MDLPL F+PKEMV   +LA+ FDATKKARFGVL 
Sbjct  260   QDPVPITIPEPIMMHDFAITENYAIIMDLPLCFRPKEMVKNNKLAFTFDATKKARFGVLA  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYA NE LI+WFELPNCFIFH ANAWEEGDEVV+I+CR+ NPDLDM +G +KD L +F N
Sbjct  320   RYANNEALIRWFELPNCFIFHNANAWEEGDEVVLITCRLVNPDLDMVNGAVKDKLENFCN  379

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G ASQKKLSESAVDFPR+NENYTGRKQRYVY T L+ +AKV GI+KFDL
Sbjct  380   ELYEMRFNMKSGAASQKKLSESAVDFPRINENYTGRKQRYVYGTTLNSIAKVTGIIKFDL  439

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGK++LEVGGNV+GIFDLGPGRFGSEA+FVP +  T CEEDDGYLI FVHDENTG
Sbjct  440   HAEPETGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPSQPGTECEEDDGYLIFFVHDENTG  499

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ++ QA++
Sbjct  500   KSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQIREQAKV  545



>gb|AIL30506.1| carotenoid cleavage dioxygenase 1-1 [Nicotiana tabacum]
Length=547

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/527 (82%), Positives = 474/527 (90%), Gaps = 3/527 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+  KAID LE  I+++MHDS+KPLHYLSGNFAP  +ETPP KDL V+GHLPECL
Sbjct  22    PKPKKGVIGKAIDLLEKVIIELMHDSTKPLHYLSGNFAPT-DETPPLKDLSVTGHLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEEFFG AK
Sbjct  81    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEFFGGAK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL TVY+Q+LR KLKVLD +YGNGTANTAL+YH GKLLAL E DKPYA+
Sbjct  141   FMKIGDLKGLFGLFTVYMQVLRAKLKVLDITYGNGTANTALVYHHGKLLALSEADKPYAL  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+Q  P++TYRVISK G+M
Sbjct  201   KVMEDGDLQTLGMLDYDKRLAHSFTAHPKVDPVTGEMFTFGYSQNPPYITYRVISKGGIM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP  +MMHDFAITENY+I MDLPLYF+PKEMV  K+LAY FD TKKARFG+LP
Sbjct  261   QDPVPITIPEPIMMHDFAITENYSIMMDLPLYFKPKEMVKNKKLAYSFDPTKKARFGILP  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DFV  746
             R AKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+CR+QNPDLD  +GT K+     F 
Sbjct  321   RCAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITCRLQNPDLDAINGTEKEQQRDGFT  380

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFN+KTGLASQKKLSESAVDFPRVNENYTGRKQRYVY T+L+ +AK+ GIVKFD
Sbjct  381   NELYEMRFNIKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYGTILNHMAKITGIVKFD  440

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAEPETGKTKL VGGNV GIFDLGPGRFGSEAIFVPR+  T CEEDDGYLILFVHDENT
Sbjct  441   LHAEPETGKTKLGVGGNVLGIFDLGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDENT  500

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKS+VNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+  QA++
Sbjct  501   GKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQILEQAKL  547



>ref|XP_009589876.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Nicotiana tomentosiformis]
Length=546

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/526 (81%), Positives = 469/526 (89%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+  KAID LE  I+K+MHDS+KPLHYL GNFAP  +ETPP KDL VSGHLPECL
Sbjct  22    PKPKKGVIGKAIDLLEKGIIKLMHDSTKPLHYLQGNFAPT-DETPPLKDLSVSGHLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEEFFG AK
Sbjct  81    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEFFGGAK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL TVY+QMLR KLKVLD +YGNGTANTAL+YH GKLLAL E DKPYA+
Sbjct  141   FMKIGDLKGLFGLFTVYMQMLRAKLKVLDITYGNGTANTALVYHHGKLLALSEADKPYAL  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+   P++TYRVISKDG+M
Sbjct  201   KVLEDGDLQTLGMLDYDKRLAHSFTAHPKVDPVTGEMFTFGYSHNPPYITYRVISKDGIM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPV ITIP  VMMHDFAITENYA+ MDLPL F+PKEMV   QLA+ FD TKKARFGVLP
Sbjct  261   QDPVSITIPEPVMMHDFAITENYAVMMDLPLCFRPKEMVKNNQLAFSFDVTKKARFGVLP  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+E LIKWFELPNCFIFH ANAWEEGDEVV+I+CR+QNP+LDM +G +K+ L +F N
Sbjct  321   RYAKSEALIKWFELPNCFIFHNANAWEEGDEVVLITCRLQNPNLDMVNGVVKEKLENFTN  380

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G ASQKKLSESAVDFPR+NENYTGRKQRYVY T L  +AKV G++KFDL
Sbjct  381   ELYEMRFNMKSGAASQKKLSESAVDFPRINENYTGRKQRYVYGTTLDSIAKVTGVIKFDL  440

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGK +LEVGGNV+GIFDLG GRFGSEA+FVPR+  T  EEDDGYLI FVHDENTG
Sbjct  441   HAEPETGKAQLEVGGNVQGIFDLGSGRFGSEAVFVPRQPGTESEEDDGYLIFFVHDENTG  500

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKTMS EPVAVVELP RVPYGFHAFFVTEEQ+Q QA++
Sbjct  501   KSAVNVIDAKTMSTEPVAVVELPKRVPYGFHAFFVTEEQIQEQAKL  546



>emb|CAD33264.1| carotenoid cleavage oxygenase [Solanum lycopersicum]
Length=546

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/527 (81%), Positives = 469/527 (89%), Gaps = 3/527 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ GI AKAID LEW IVK+MHDSSKPLHYL GNFAP  +ETPP  DL V GHLPECL
Sbjct  21    PKPRRGITAKAIDLLEWGIVKLMHDSSKPLHYLQGNFAPT-DETPPLNDLVVQGHLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEEFFG AK
Sbjct  80    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEFFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG+FGL TVY+QMLR KLKVLD SYGN TANTAL+YH GKLLAL E DKPYA+
Sbjct  140   FMKVGDLKGLFGLFTVYMQMLRTKLKVLDISYGNSTANTALVYHHGKLLALSEADKPYAL  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVD VTGEMFTFGYA   P++TYRVISKDG+M
Sbjct  200   KVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDAVTGEMFTFGYAHTPPYITYRVISKDGIM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP  +MMHDFAITENYAI MDLPL F+PKEMV K +LA+ FDATKKARFGVLP
Sbjct  260   QDPVPITIPEPIMMHDFAITENYAIMMDLPLCFRPKEMVKKNKLAFTFDATKKARFGVLP  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DFV  746
             RYAKNE LIKWFELPNCFIFH ANAWEEGD+VV+I+ R+QNPDLD   GT K+     F 
Sbjct  320   RYAKNESLIKWFELPNCFIFHNANAWEEGDDVVLITSRLQNPDLDAIKGTEKEEQRDGFT  379

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMK G++S KKLSE+AVDFPR+NENYTGRKQRYVY T+L+++A++  +VKFD
Sbjct  380   NELYEMRFNMKNGVSSHKKLSEAAVDFPRINENYTGRKQRYVYGTILNNVAQITRVVKFD  439

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAEPET KTKLEVGGNV GIFDLGPGRFGSEAIFVPR+  T CEEDDGYLILFVHDENT
Sbjct  440   LHAEPETVKTKLEVGGNVPGIFDLGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDENT  499

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKS+VNVIDAKTMSAEPVAVVELP RVP+GFHAFFVTEEQ+Q QA++
Sbjct  500   GKSSVNVIDAKTMSAEPVAVVELPKRVPFGFHAFFVTEEQIQEQAKM  546



>ref|XP_008461300.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Cucumis 
melo]
Length=547

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/526 (81%), Positives = 471/526 (90%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ +KA D LE   VK+M+DSSKP HYLSGNFAP  +ETPP  DLPV G+LPECL
Sbjct  22    PKPSKGLVSKATDLLEKLFVKLMYDSSKPQHYLSGNFAPVHDETPPITDLPVKGYLPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKA+YVSR+V+TSRLKQEE+FG AK
Sbjct  82    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKASYVSRYVRTSRLKQEEYFGAAK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL+ V +QMLR KLKVLD SYG GT NTALIYH GKLLAL EGDKPY I
Sbjct  142   FMKIGDLKGFFGLIMVNMQMLRAKLKVLDVSYGTGTGNTALIYHHGKLLALSEGDKPYVI  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H FTAHPKVDPVTGEMFTFGY+   P+VTYRVISKDGLM
Sbjct  202   KVLEDGDLQTLGLLDYDKRLTHTFTAHPKVDPVTGEMFTFGYSHSPPYVTYRVISKDGLM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITIPA VMMHDFAITENYAIFMDLPLYF+PKEMV + +L + FDATKKARFGVLP
Sbjct  262   HDPVPITIPAPVMMHDFAITENYAIFMDLPLYFKPKEMVKENKLIFTFDATKKARFGVLP  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++LLI+WFELPNCFIFH ANAWEEGDE+V+I+CR++NPDLDM SG++K+ L +F N
Sbjct  322   RYAKDDLLIQWFELPNCFIFHNANAWEEGDELVLITCRLENPDLDMVSGSVKEKLENFSN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+K+GLASQ+KLSESAVDFPRVNE+YTGRKQ+YVY T L  +AKV GI KFDL
Sbjct  382   ELYEMRFNLKSGLASQRKLSESAVDFPRVNESYTGRKQQYVYGTTLDSIAKVTGIAKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGKTK+EVGGNV+G++DLGPGRFGSEAIFVPR   T  EEDDGYLILFVHDENTG
Sbjct  442   HAEPETGKTKIEVGGNVQGLYDLGPGRFGSEAIFVPRVPGTTSEEDDGYLILFVHDENTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNV+DAKTMS+EPVAVVELP+RVPYGFHAFFVTEEQLQ Q  +
Sbjct  502   KSAVNVVDAKTMSSEPVAVVELPHRVPYGFHAFFVTEEQLQEQGRL  547



>gb|ABB82946.1| carotenoid cleavage dioxygenase [Cucumis melo]
Length=543

 Score =   901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/526 (81%), Positives = 471/526 (90%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ +KA D LE   VK+M+DSSKP HYLSGNFAP  +ETPP  DLPV G+LPECL
Sbjct  18    PKPSKGLVSKATDLLEKLFVKLMYDSSKPQHYLSGNFAPVHDETPPITDLPVKGYLPECL  77

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKA+YVSR+V+TSRLKQEE+FG AK
Sbjct  78    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKASYVSRYVRTSRLKQEEYFGAAK  137

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL+ V +QMLR KLKVLD SYG GT NTALIYH GKLLAL EGDKPY I
Sbjct  138   FMKIGDLKGFFGLIMVNMQMLRAKLKVLDVSYGTGTGNTALIYHHGKLLALSEGDKPYVI  197

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H FTAHPKVDPVTGEMFTFGY+   P+VTYRVISKDGLM
Sbjct  198   KVLEDGDLQTLGLLDYDKRLTHTFTAHPKVDPVTGEMFTFGYSHSPPYVTYRVISKDGLM  257

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITIPA VMMHDFAITENYAIFMDLPLYF+PKEMV + +L + FDATKKARFGVLP
Sbjct  258   HDPVPITIPAPVMMHDFAITENYAIFMDLPLYFKPKEMVKENKLIFTFDATKKARFGVLP  317

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++LLI+WFELPNCFIFH ANAWEEGDE+V+I+CR++NPDLDM SG++K+ L +F N
Sbjct  318   RYAKDDLLIQWFELPNCFIFHNANAWEEGDELVLITCRLENPDLDMVSGSVKEKLENFSN  377

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+K+GLASQ+KLSESAVDFPRVNE+YTGRKQ+YVY T L  +AKV GI KFDL
Sbjct  378   ELYEMRFNLKSGLASQRKLSESAVDFPRVNESYTGRKQQYVYGTTLDSIAKVTGIAKFDL  437

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGKTK+EVGGNV+G++DLGPGRFGSEAIFVPR   T  EEDDGYLILFVHDENTG
Sbjct  438   HAEPETGKTKIEVGGNVQGLYDLGPGRFGSEAIFVPRVPGTTSEEDDGYLILFVHDENTG  497

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNV+DAKTMS+EPVAVVELP+RVPYGFHAFFVTEEQLQ Q  +
Sbjct  498   KSAVNVVDAKTMSSEPVAVVELPHRVPYGFHAFFVTEEQLQEQGRL  543



>dbj|BAJ05401.1| carotenoid cleavage dioxygenase 1 [Osmanthus fragrans]
Length=543

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/526 (80%), Positives = 467/526 (89%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ +KAIDWLEW  VK+MHDS +PLHYLSGNFAP  +ETPP KDLPV+GHLPECL
Sbjct  19    PKPSQGLTSKAIDWLEWLFVKMMHDSKQPLHYLSGNFAPV-DETPPLKDLPVTGHLPECL  77

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFA +AGYHWFDGDGMIHG+RIKDGKATYVSR+V+TSRLKQEEFFGRA 
Sbjct  78    NGEFVRVGPNPKFASIAGYHWFDGDGMIHGMRIKDGKATYVSRYVQTSRLKQEEFFGRAM  137

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKGMFGLL V +QMLR KLKVLD SYG GTANTAL+YH GKLLAL E DKPYAI
Sbjct  138   FMKIGDLKGMFGLLMVNMQMLRAKLKVLDISYGIGTANTALVYHHGKLLALSEADKPYAI  197

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P+VTYRVISKDG M
Sbjct  198   KVLEDGDLQTIGLLDYDKRLAHSFTAHPKVDPFTGEMFTFGYSHTPPYVTYRVISKDGAM  257

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             +DPVPIT+   +MMHDFAITENYAIFMDLPLYF+PKEMV  K+  + FDAT+KARFG+LP
Sbjct  258   NDPVPITVSGPIMMHDFAITENYAIFMDLPLYFKPKEMVKDKKFIFSFDATQKARFGILP  317

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAKNELLIKWFELPNCFIFH ANAWEEGDEVV+I+CR++NPDLDM + T+K+ LD F N
Sbjct  318   RYAKNELLIKWFELPNCFIFHNANAWEEGDEVVLITCRLENPDLDMVNSTVKERLDNFKN  377

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN++ GLASQKKLS SAVDFPRVNE+YT RKQRYVY T L  +AKV GI+KFDL
Sbjct  378   ELYEMRFNLQNGLASQKKLSVSAVDFPRVNESYTTRKQRYVYGTTLDKIAKVTGIIKFDL  437

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGK KLE+GGNV+GIFDLGPGRFGSEA+FVPR      EEDDGYLI FVHDENTG
Sbjct  438   HAEPETGKEKLELGGNVKGIFDLGPGRFGSEAVFVPRHPGITSEEDDGYLIFFVHDENTG  497

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKTMS +PVAVVELP RVPYGFHAFFVTE+QLQ QA++
Sbjct  498   KSAVNVIDAKTMSPDPVAVVELPKRVPYGFHAFFVTEDQLQEQAKV  543



>emb|CAC79644.1| dioxygenase [Capsicum annuum]
Length=547

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/526 (81%), Positives = 469/526 (89%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G +AKA+D LE  IVK++HDSSKPLHYL GNFAP  +ETPP  DL V GHLPECL
Sbjct  23    PKPRKGFSAKALDLLEKGIVKLVHDSSKPLHYLQGNFAPT-DETPPLNDLLVHGHLPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEEFFG AK
Sbjct  82    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEFFGGAK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG+FGL TVY+QMLR KL+VLD SYGNGTANTAL YH GKLLAL E DKPYA+
Sbjct  142   FMKVGDLKGLFGLFTVYMQMLRAKLEVLDISYGNGTANTALAYHHGKLLALSEADKPYAL  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+   P++TYRVISKDG+M
Sbjct  202   KVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHDPPYITYRVISKDGIM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP  +MMHDFAITENYAI MDLPL F+PKEMV   +LA+ FDATKKARFGVL 
Sbjct  262   QDPVPITIPEPIMMHDFAITENYAIMMDLPLCFRPKEMVKNNKLAFTFDATKKARFGVLA  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYA NE LIKWFELPNCFIFH ANAWEEGDEVV+I+CR+ NPDLD+ +G +K+ L +F N
Sbjct  322   RYANNEALIKWFELPNCFIFHNANAWEEGDEVVLITCRLMNPDLDLVNGAVKEKLENFCN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G ASQKKLSESAVDFPR+NENYTGRKQRYVY T L+ +AKV GI+KFDL
Sbjct  382   ELYEMRFNMKSGAASQKKLSESAVDFPRINENYTGRKQRYVYGTTLNSIAKVTGIIKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+TGK++LEVGGNV+GIFDLGPGRFGSEA+FVP +  T CEEDDG+LI FVHDENTG
Sbjct  442   HAEPKTGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPSQPDTECEEDDGFLIFFVHDENTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+  QA++
Sbjct  502   KSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQILEQAKL  547



>ref|XP_010241258.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Nelumbo 
nucifera]
Length=543

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/525 (81%), Positives = 472/525 (90%), Gaps = 2/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ GIA++ +D +E  IVK+M+D+SKP HYLSGNF+P  +ETPPCK+LPV G+LPECL
Sbjct  19    PKPRKGIASRFVDLVEKLIVKLMYDASKPYHYLSGNFSPV-DETPPCKNLPVKGYLPECL  77

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHG+RIKDGKATYVSR+V+TSRLKQEEFFG AK
Sbjct  78    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGMRIKDGKATYVSRYVRTSRLKQEEFFGGAK  137

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +Q+LR KLKVLD SYGNGTANTALIYH GKLLAL E DKPYAI
Sbjct  138   FMKIGDLKGLFGLLMVNIQLLRNKLKVLDVSYGNGTANTALIYHHGKLLALSEADKPYAI  197

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEM+TFGY+   P+VTYRVISKDG M
Sbjct  198   KVLEDGDLQTLGMLDYDKRLAHSFTAHPKVDPFTGEMYTFGYSHDPPYVTYRVISKDGFM  257

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   VMMHDFAITENYAIFMDLPLYF+PKEMV   +L + FD TKKARFG+LP
Sbjct  258   HDPVPITISDPVMMHDFAITENYAIFMDLPLYFRPKEMVKGNKLIFSFDDTKKARFGILP  317

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+ELLIKWFELPNCFIFH ANAWEE DE+V+I+CR++NPDLDM SGT+K+ L +F N
Sbjct  318   RYAKDELLIKWFELPNCFIFHNANAWEEEDEIVLITCRLENPDLDMVSGTVKEKLENFNN  377

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQ+KLS SAVDFPR+NENYTGRKQR+VY T+L  +AKV GIVKFDL
Sbjct  378   ELYEMRFNMKTGLASQRKLSASAVDFPRINENYTGRKQRFVYGTILDSIAKVTGIVKFDL  437

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HA+PE  +TKLEVGGNV+GIFDLGPGRFGSEAIFVPRE     EEDDGYLI FVHDENTG
Sbjct  438   HAQPEKDRTKLEVGGNVQGIFDLGPGRFGSEAIFVPREPGISSEEDDGYLIFFVHDENTG  497

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KSAVNVIDAKTMSA+PVAVVELP+RVPYGFHAFFVTEEQ+Q QA+
Sbjct  498   KSAVNVIDAKTMSADPVAVVELPHRVPYGFHAFFVTEEQIQEQAK  542



>ref|XP_004135934.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Cucumis sativus]
 gb|KGN45124.1| hypothetical protein Csa_7G428120 [Cucumis sativus]
Length=547

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/526 (80%), Positives = 470/526 (89%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G+ +KA D LE   VK+M DSSKP HYLSGNFAP  +ETPP  DLPV G+LPECL
Sbjct  22    PNPSNGLLSKATDLLEKLFVKLMFDSSKPQHYLSGNFAPVHDETPPITDLPVKGYLPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKA+YVSR+V+TSRLKQEE+FG +K
Sbjct  82    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKASYVSRYVQTSRLKQEEYFGASK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL+ V +Q+LR KLKVLD SYG GT NTALIYH GKLLAL EGDKPY I
Sbjct  142   FMKIGDLKGFFGLIMVNMQLLRAKLKVLDVSYGTGTGNTALIYHHGKLLALSEGDKPYVI  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H FTAHPKVDPVTGEMFTFGY+   P+VTYRVISKDGLM
Sbjct  202   KVLEDGDLQTLGLLDYDKRLKHTFTAHPKVDPVTGEMFTFGYSHSPPYVTYRVISKDGLM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITIPA VMMHDFAITENYAIFMDLPLYF+PKEMV + +L + FDATKKARFGVLP
Sbjct  262   HDPVPITIPAPVMMHDFAITENYAIFMDLPLYFKPKEMVKENKLIFTFDATKKARFGVLP  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++LLI+WFELPNCFIFH ANAWEE DE+V+I+CR++NPDLDM SG++K+ L +F N
Sbjct  322   RYAKDDLLIRWFELPNCFIFHNANAWEEEDELVLITCRLENPDLDMVSGSVKEKLENFSN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+K+GLASQ+KLSESAVDFPRVNE+YTGRKQ+YVY T L  +AKV GI KFDL
Sbjct  382   ELYEMRFNLKSGLASQRKLSESAVDFPRVNESYTGRKQQYVYGTTLDSIAKVTGIAKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGKTK+EVGGNV+G++DLGPGRFGSEAIFVPR   T  EEDDGYLILFVHDENTG
Sbjct  442   HAEPETGKTKIEVGGNVQGLYDLGPGRFGSEAIFVPRVPGTTSEEDDGYLILFVHDENTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNV+DAKTMS+EPVAVVELP+RVPYGFHAFFVTEEQLQ Q  +
Sbjct  502   KSAVNVVDAKTMSSEPVAVVELPHRVPYGFHAFFVTEEQLQEQGRL  547



>gb|AAY21819.1| carotenoid cleavage dioxygenase [Suaeda salsa]
Length=556

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/524 (81%), Positives = 463/524 (88%), Gaps = 1/524 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G  +KAIDWLE  IVK+M+DSS+P HYLSGNFAP  +ETPP KDL V GHLPECL
Sbjct  31    PKPNQGFTSKAIDWLEKIIVKLMYDSSQPQHYLSGNFAPVVDETPPAKDLIVHGHLPECL  90

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWF+GDGMIHG+ IKDGKATYVSR+V+TSR+KQEEFFG AK
Sbjct  91    NGEFVRVGPNPKFAPVAGYHWFEGDGMIHGMHIKDGKATYVSRYVRTSRMKQEEFFGGAK  150

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKGMFGLLTV LQMLR KLKVLD SYG+GTANTALIYH GKLLAL EGDKPY +
Sbjct  151   FMKIGDLKGMFGLLTVSLQMLRAKLKVLDMSYGHGTANTALIYHHGKLLALSEGDKPYVV  210

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             +VLEDGDLQTLG+LDYDKRL H FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  211   RVLEDGDLQTLGLLDYDKRLAHNFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  270

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+PA +MMHDFAITENYAI MDLPLYF+PK+MV +K++   FD TKKARFG+LP
Sbjct  271   HDPVPITVPAPIMMHDFAITENYAIIMDLPLYFRPKDMVKEKKIIVTFDPTKKARFGLLP  330

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAKNE LIKWFELPNCFIFH ANAWEEGDEVV+I+CRI+NPDLDM  G  +D +D F N
Sbjct  331   RYAKNESLIKWFELPNCFIFHNANAWEEGDEVVLITCRIENPDLDMVGGAAEDMVDSFTN  390

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQ+KLS SAVDFPRVNENYTGRKQRYVY T L  +AKVKGIVKFDL
Sbjct  391   ELYEMRFNMKTGLASQRKLSASAVDFPRVNENYTGRKQRYVYGTSLGSIAKVKGIVKFDL  450

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+  + KLEVGG+V+GIFDLGP RFGSEAIFVPRE  T  EEDDGYLI FVHDENTG
Sbjct  451   HAEPDPSQKKLEVGGSVQGIFDLGPERFGSEAIFVPREQGTSSEEDDGYLIFFVHDENTG  510

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             KS VNVIDAKTMSA+PVAVVELP+RVPYGFHAFFVTEEQL+ Q 
Sbjct  511   KSFVNVIDAKTMSADPVAVVELPSRVPYGFHAFFVTEEQLKDQV  554



>gb|AGN03859.1| carotenoid cleavage dioxygenase 1 [Scutellaria baicalensis]
Length=544

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/526 (79%), Positives = 466/526 (89%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+ +KAIDWLEW  VK+MHD  +PLHYL+GNFAP  +ET P  DLPV GHLPECL
Sbjct  20    PKPQKGLTSKAIDWLEWVFVKMMHDPKQPLHYLAGNFAPV-DETQPLTDLPVQGHLPECL  78

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNP+FAPVAGYHWFDGDGMIHG+RIK+GKATYVSRFVKTSRLKQEE FG +K
Sbjct  79    NGEFVRVGPNPRFAPVAGYHWFDGDGMIHGMRIKNGKATYVSRFVKTSRLKQEEHFGGSK  138

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL+ V + +LR K KVLD SYG GTANTAL+YH+GKLLAL E DKPYAI
Sbjct  139   FMKIGDLKGFFGLVMVNMHLLRTKFKVLDLSYGQGTANTALVYHNGKLLALSEADKPYAI  198

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+GMLDYDKRL H+FTAHPKVDP TGEMFTFGY+Q  P+VTYRVISK+G+M
Sbjct  199   KVLEDGDLQTIGMLDYDKRLSHSFTAHPKVDPFTGEMFTFGYSQTPPYVTYRVISKEGVM  258

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPIT+P  +MMHDFAITENY IFMDLPLYF+PKEMV +K+  + FD TKKARFG+LP
Sbjct  259   QDPVPITVPEPIMMHDFAITENYVIFMDLPLYFKPKEMVKEKKFIFSFDPTKKARFGILP  318

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYA+NELLI+WFELPNCFIFH ANAWEEGDEVV+I+CR+QNPDLDM +G +K+ L +F N
Sbjct  319   RYAQNELLIRWFELPNCFIFHNANAWEEGDEVVLITCRLQNPDLDMVNGAVKEKLENFTN  378

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+K GLASQKKLSES+VDFPRVNE+YTGRKQRYVY T L  +AKV GIVKFDL
Sbjct  379   ELYEMRFNLKNGLASQKKLSESSVDFPRVNESYTGRKQRYVYGTRLDSIAKVTGIVKFDL  438

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             H EPE+GK KLEVGGNV G+FDLGPGRFGSEA+FVPRE  T  EEDDGYLI FVHDENTG
Sbjct  439   HMEPESGKDKLEVGGNVSGLFDLGPGRFGSEAVFVPREPGTTSEEDDGYLIFFVHDENTG  498

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNV+DAKTMS++PVAVVELP RVPYGFHAFFV+EEQLQ QA++
Sbjct  499   KSAVNVLDAKTMSSDPVAVVELPRRVPYGFHAFFVSEEQLQEQAKL  544



>ref|XP_007052518.1| Carotenoid cleavage dioxygenase 1 isoform 1 [Theobroma cacao]
 gb|EOX96675.1| Carotenoid cleavage dioxygenase 1 isoform 1 [Theobroma cacao]
Length=549

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/525 (80%), Positives = 467/525 (89%), Gaps = 1/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+++K IDWLE  IVK+M+DSS+P HYLSGNFAP+P ETPP KDLPV GHLPECL
Sbjct  25    PKPQKGLSSKLIDWLEKLIVKLMYDSSQPQHYLSGNFAPSPNETPPTKDLPVKGHLPECL  84

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVA YHWFDGDGMIHG+RIKDGKATYVSRFVKTSR+KQEE+FG +K
Sbjct  85    NGEFVRVGPNPKFAPVAAYHWFDGDGMIHGMRIKDGKATYVSRFVKTSRIKQEEYFGGSK  144

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG FGLL V +Q LR K KVLD SYG GTANTALIYH GKLLAL E DKPY +
Sbjct  145   FMKVGDLKGFFGLLMVNIQKLREKAKVLDLSYGYGTANTALIYHHGKLLALQEADKPYVL  204

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+ + P++TYRVISKDG M
Sbjct  205   KVFEDGDLQTLGMLDYDKRLAHSFTAHPKVDPVTGEMFTFGYSHEPPYITYRVISKDGFM  264

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIF+DLPLYF+PKEMV +K++ + FDA+KKARFGVLP
Sbjct  265   HDPVPITISEPIMMHDFAITENYAIFLDLPLYFRPKEMVKEKKMIFSFDASKKARFGVLP  324

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++LLI+WFELPNCFIFH ANAWEE DE+V+I+CR++NPDLD+ SG +K+ LD F N
Sbjct  325   RYAKDDLLIRWFELPNCFIFHNANAWEEEDEIVLITCRLENPDLDLVSGEVKEKLDNFNN  384

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQK+LS SAVDFPRVNE YTGRKQRYVY T L  +A V GIVKFDL
Sbjct  385   ELYEMRFNMKTGLASQKQLSVSAVDFPRVNEYYTGRKQRYVYGTTLDSIANVTGIVKFDL  444

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK K+EVGGNV+G+FDLGPGRFGSEAIFVPRE  T  EEDDGYLI FVHDENTG
Sbjct  445   HAEPEAGKPKIEVGGNVQGLFDLGPGRFGSEAIFVPREPGTTSEEDDGYLIFFVHDENTG  504

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS+VNVIDAKTMSA+PVAVVELP+RVPYGFHAFFVTEEQL  QA+
Sbjct  505   KSSVNVIDAKTMSADPVAVVELPHRVPYGFHAFFVTEEQLHEQAK  549



>gb|ABA43900.1| carotenoid cleavage dioxygenase 1 [Coffea canephora]
 emb|CDP07788.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/526 (79%), Positives = 470/526 (89%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  AK IDW+E A+VK+M+DS +PLHYLSGNFAP  +ETPPCKDL V GHLPECL
Sbjct  24    PKPNNGFTAKLIDWVEKAVVKLMYDSKQPLHYLSGNFAPV-DETPPCKDLLVKGHLPECL  82

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEE+FG +K
Sbjct  83    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGIRIKDGKATYVSRYVKTSRLKQEEYFGGSK  142

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG+FGL  V +Q+LR KLKVLD +YG GTANTALIYH GKLLAL E DKPY +
Sbjct  143   FMKVGDLKGLFGLFMVNMQILRAKLKVLDMTYGIGTANTALIYHHGKLLALQEADKPYVL  202

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             +VLEDGDLQTLG+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISK+G+M
Sbjct  203   RVLEDGDLQTLGLLDYDKRLTHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKEGVM  262

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV  K+L + FD TKKARFGVLP
Sbjct  263   DDPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKDKKLIFTFDPTKKARFGVLP  322

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RY+KN+ LIKWFELPNCFIFH ANAWEEGDEV++I+CR+QNPDLDM SG +K  L +F N
Sbjct  323   RYSKNDALIKWFELPNCFIFHNANAWEEGDEVILITCRLQNPDLDMVSGIVKKKLENFSN  382

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLASQKKLSESAVDFPRVNE+YTGRKQ+YVY T+L  +AKV GI KFDL
Sbjct  383   ELYEMRFNLKTGLASQKKLSESAVDFPRVNESYTGRKQQYVYGTILDSIAKVTGIAKFDL  442

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGKTK+EVGGNV+G+FDLGPGRFGSEAIFVPR+     EEDDGYLI FVHDE+TG
Sbjct  443   HAEPETGKTKIEVGGNVQGVFDLGPGRFGSEAIFVPRQPGITSEEDDGYLIFFVHDESTG  502

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKTMSA+PVAVVELPNRVPYGFHAFFVTEEQL+ QA++
Sbjct  503   KSAVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTEEQLEEQAKL  548



>ref|NP_001267844.1| 9,10[9',10']carotenoid cleavage dioxygenase [Vitis vinifera]
 emb|CBI24894.3| unnamed protein product [Vitis vinifera]
 gb|AFJ94679.1| carotenoid cleavage dioxygenase 1 [Vitis vinifera]
 gb|AFJ94681.1| carotenoid cleavage dioxygenase 1 [Vitis vinifera]
Length=546

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/526 (79%), Positives = 468/526 (89%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             PTP  G  +KA+DWLE  IVK+MHDSS+PLHYLSGNFAP  +ETPPCK+LPV G+LPECL
Sbjct  21    PTPSKGFTSKAVDWLEKLIVKLMHDSSQPLHYLSGNFAPVRDETPPCKNLPVIGYLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGL IKDGKATYVSR+V+TSRLKQEE+FG AK
Sbjct  81    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLHIKDGKATYVSRYVRTSRLKQEEYFGGAK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FM+IGDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +
Sbjct  141   FMRIGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVYHHGKLLALSEADKPYVL  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMF+FGY+   P++TYRVISKDG M
Sbjct  201   KVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDPFTGEMFSFGYSHTPPYITYRVISKDGFM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             H+PVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV +K+L + FDATKKARFGVLP
Sbjct  261   HEPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKLIFTFDATKKARFGVLP  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNEL IKWFELPNCFIFH ANAWEE DEVV+I+CR++NPDLD+  G +K+ L +F N
Sbjct  321   RYAKNELHIKWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDLVGGDVKEKLENFGN  380

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+ASQ+KLS S+VDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  381   ELYEMRFNMKTGIASQRKLSASSVDFPRVNESYTGRKQRYVYGTILDSIAKVTGIIKFDL  440

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+TGK+KLEVGGNV+GIFDLG GRFGSEA+FVPRE     EEDDGYLI F+HDE TG
Sbjct  441   HAEPDTGKSKLEVGGNVQGIFDLGVGRFGSEAVFVPREPGITSEEDDGYLIFFIHDEKTG  500

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS VNVIDAKTMS +P+A+VELPNRVPYGFHAFFVTEEQL+ QA++
Sbjct  501   KSYVNVIDAKTMSPDPIAIVELPNRVPYGFHAFFVTEEQLKEQAKL  546



>gb|ABA43904.1| carotenoid cleavage dioxygenase 1 [Coffea arabica]
Length=548

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/526 (79%), Positives = 470/526 (89%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  AK IDW+E A+VK+M+DS +PLHYLSGNFAP  +ETPPCKDL V GHLPECL
Sbjct  24    PKPNNGFTAKLIDWVEKAVVKLMYDSKQPLHYLSGNFAPV-DETPPCKDLLVKGHLPECL  82

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEE+FG +K
Sbjct  83    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGIRIKDGKATYVSRYVKTSRLKQEEYFGGSK  142

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG++GL  V +Q+LR KLKVLD +YG GTANTALIYH GKLLAL E DKPY +
Sbjct  143   FMKVGDLKGLYGLFMVNMQILRAKLKVLDITYGIGTANTALIYHHGKLLALQEADKPYVL  202

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             +VLEDGDLQTLG+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISK+G+M
Sbjct  203   RVLEDGDLQTLGLLDYDKRLTHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKEGVM  262

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV  K+L + FD TKKARFGVLP
Sbjct  263   DDPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKDKKLIFTFDPTKKARFGVLP  322

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RY+KN+ LIKWFELPNCFIFH ANAWEEGDEV++I+CR+QNPDLDM SG +K  L +F N
Sbjct  323   RYSKNDALIKWFELPNCFIFHNANAWEEGDEVILITCRLQNPDLDMVSGIVKKKLENFSN  382

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLASQKKLSESAVDFPRVNE+YTGRKQ+YVY T+L  +AKV GI KFDL
Sbjct  383   ELYEMRFNLKTGLASQKKLSESAVDFPRVNESYTGRKQQYVYGTILDSIAKVTGIAKFDL  442

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGKTK+EVGGNV+G+FDLGPGRFGSEAIFVPR+     EEDDGYLI FVHDE+TG
Sbjct  443   HAEPETGKTKIEVGGNVQGVFDLGPGRFGSEAIFVPRQPGITSEEDDGYLIFFVHDESTG  502

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAKT+SA+PVAVVELPNRVPYGFHAFFVTEEQL+ QA++
Sbjct  503   KSAVNVIDAKTLSADPVAVVELPNRVPYGFHAFFVTEEQLEEQAKL  548



>gb|AFU91489.1| carotenoid cleavage dioxygenase 1 [Momordica charantia]
Length=547

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/526 (79%), Positives = 467/526 (89%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+A+KA D LE   VK+M+D+S P HYLSGNFAP  +ETPP  DLPV G+LPECL
Sbjct  22    PKPSKGLASKATDLLEKLFVKLMYDASNPQHYLSGNFAPVRDETPPITDLPVKGYLPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  82    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVKTSRLKQEEYFGGAK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL+ V +QMLR KLKVLD SYG GT NTALIYH GKLLAL E DKPY I
Sbjct  142   FMKIGDLKGFFGLIMVNMQMLRAKLKVLDVSYGTGTGNTALIYHHGKLLALSEADKPYVI  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDPVTGEMFTFGY+   P+VTYRVISKDGLM
Sbjct  202   KVLEDGDLQTLGLLDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHSPPYVTYRVISKDGLM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDP+PITIP  VMMHDFAITENYAIFMDLPLYF+PKE+V + +L + FDATK+ARFGVLP
Sbjct  262   HDPIPITIPNPVMMHDFAITENYAIFMDLPLYFKPKELVKENKLIFTFDATKRARFGVLP  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYA+++LLI+WFELPNCFIFH ANAWEEGDEVV+I+CR++NPDLDM SG++K+ L +F N
Sbjct  322   RYARDDLLIRWFELPNCFIFHNANAWEEGDEVVLITCRLENPDLDMVSGSVKEKLENFSN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+K+G ASQKKLSESAVDFPRVNE+YTGRKQ+YVY T+L  +AKV GI KFDL
Sbjct  382   ELYEMRFNLKSGRASQKKLSESAVDFPRVNESYTGRKQQYVYGTILDSIAKVTGIAKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             +A+PETGKTK+EVGGNV+G++D GPGRFGSEAIFVPR   T  EEDDGYLI FVHDENTG
Sbjct  442   NAKPETGKTKIEVGGNVQGLYDPGPGRFGSEAIFVPRIPGTTSEEDDGYLIFFVHDENTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMS EPVAVVELP+RVPYGFHAFFVTEEQLQ Q  +
Sbjct  502   KSSVNVIDAKTMSTEPVAVVELPHRVPYGFHAFFVTEEQLQEQERL  547



>gb|AAX48772.1| 9,10[9',10']carotenoid cleavage dioxygenase [Vitis vinifera]
Length=542

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/526 (79%), Positives = 467/526 (89%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G  +KA+DWLE  IVK+MHDSS+PLHYLSGNFAP  +ETPPCK+LPV G+LPECL
Sbjct  17    PKPSKGFTSKAVDWLEKLIVKLMHDSSQPLHYLSGNFAPVRDETPPCKNLPVIGYLPECL  76

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGL IKDGKATYVSR+V+TSRLKQEE+FG AK
Sbjct  77    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLHIKDGKATYVSRYVRTSRLKQEEYFGGAK  136

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FM+IGDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL++H GKLLAL E DKPY +
Sbjct  137   FMRIGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVFHHGKLLALSEADKPYVL  196

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMF+FGY+   P++TYRVISKDG M
Sbjct  197   KVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDPFTGEMFSFGYSHTPPYITYRVISKDGFM  256

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             H+PVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV +K+L + FDATKKARFGVLP
Sbjct  257   HEPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKLIFTFDATKKARFGVLP  316

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNEL IKWFELPNCFIFH ANAWEE DEVV+I+CR++NPDLD+  G +K+ L +F N
Sbjct  317   RYAKNELHIKWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDLVGGDVKEKLENFGN  376

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+ASQ+KLS S+VDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  377   ELYEMRFNMKTGIASQRKLSASSVDFPRVNESYTGRKQRYVYGTILDSIAKVTGIIKFDL  436

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+TGK+KLEVGGNV+GIFDLG GRFGSEA+FVPRE     EEDDGYLI FVHDE TG
Sbjct  437   HAEPDTGKSKLEVGGNVQGIFDLGVGRFGSEAVFVPREPGITSEEDDGYLIFFVHDEKTG  496

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS VNVIDAKTMS +P+A+VELPNRVPYGFHAFFVTEEQL+ QA++
Sbjct  497   KSYVNVIDAKTMSPDPIAIVELPNRVPYGFHAFFVTEEQLKEQAKL  542



>ref|XP_006345500.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum tuberosum]
Length=576

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/526 (80%), Positives = 464/526 (88%), Gaps = 3/526 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ+G+AAKAIDW+EWAI+K+M++S+KPL  L GNF P  +ETPP K LPV GHLPECL
Sbjct  21    PKPQNGVAAKAIDWVEWAIIKLMNNSTKPLPLLQGNFVPT-DETPPLKHLPVKGHLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEF RVGPNPKFAPVAG HWFDGDGMIHGL+IKDGKATYVS FV+TSRLKQEEFFG AK
Sbjct  80    NGEFFRVGPNPKFAPVAGSHWFDGDGMIHGLQIKDGKATYVSHFVRTSRLKQEEFFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL +V + MLR KLKVLD SYG+GTANTA+IYH GKLLALHEGDKPY +
Sbjct  140   FMKIGDLKGLFGLFSVCIYMLRQKLKVLDISYGSGTANTAMIYHHGKLLALHEGDKPYVV  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGM+DYDKRL H+FT HPKVDPVTGEMFTFGY+   PF TYRVISK G+M
Sbjct  200   KVLEDGDLQTLGMMDYDKRLQHSFTTHPKVDPVTGEMFTFGYSPTPPFATYRVISKHGVM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIPASVMMHDFAITENYAI MDLP+YF+PKEMV  KQL Y FD TKKARFGV P
Sbjct  260   QDPVPITIPASVMMHDFAITENYAIMMDLPMYFRPKEMVINKQLVYSFDPTKKARFGVFP  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL--DFV  746
             RYAKNE LIKWFELPNC IFH ANAWEEGD+VV+I+  +QNPDLD  +GT K+     F 
Sbjct  320   RYAKNEALIKWFELPNCLIFHNANAWEEGDDVVLITSHLQNPDLDAINGTEKEEQRDGFT  379

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMK G+ASQKKLSE+AVDFPR+NENYTGRKQRYVY T+L+++ K+ GIVKFD
Sbjct  380   NELYEMRFNMKNGVASQKKLSEAAVDFPRINENYTGRKQRYVYGTILNNIYKITGIVKFD  439

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAE ETGKTK+EVGGN+ GI DLGPGRFGSEA+FVPR+  T CEEDDGYLILFVHDENT
Sbjct  440   LHAEAETGKTKIEVGGNIPGICDLGPGRFGSEAVFVPRQPGTECEEDDGYLILFVHDENT  499

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             GKS+VNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+Q QA+
Sbjct  500   GKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQIQEQAK  545



>ref|XP_006379094.1| carotenoid cleavage dioxygenase 1 family protein [Populus trichocarpa]
 gb|ERP56891.1| carotenoid cleavage dioxygenase 1 family protein [Populus trichocarpa]
Length=551

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/526 (78%), Positives = 468/526 (89%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+ +K ID+LE  IVK+M+D+S+  HYLSGNFAP P+ETPP KDLPV G+LP+CL
Sbjct  26    PKPQKGLTSKLIDYLEKLIVKLMYDTSQSHHYLSGNFAPVPDETPPVKDLPVKGYLPDCL  85

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPK  PVAGYHWFDGDGMIHG+RIKDGKA YV RFV+TSRLKQEEFFG AK
Sbjct  86    NGEFVRVGPNPKLVPVAGYHWFDGDGMIHGMRIKDGKAAYVRRFVRTSRLKQEEFFGGAK  145

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG+FGLL V +QMLR K KVLD SYGNGT NT LIYH GKLLAL E DKPY +
Sbjct  146   FMKVGDLKGLFGLLMVNMQMLRAKTKVLDMSYGNGTGNTNLIYHHGKLLALQEADKPYVV  205

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDLQT+G+LDY+KRL H+FTAHPKVDP TGEMFTFGY+ + P+VTYRVISKDG+M
Sbjct  206   KVMEDGDLQTIGLLDYEKRLKHSFTAHPKVDPFTGEMFTFGYSHEPPYVTYRVISKDGVM  265

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV +K+L + FDATKKARFGVLP
Sbjct  266   HDPVPITISEPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKLIFTFDATKKARFGVLP  325

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++LLIKWFELPNCFIFH ANAWEE DE+V+I+CR+QNPDLDM SG +K+ L+ F N
Sbjct  326   RYAKDDLLIKWFELPNCFIFHNANAWEEEDEIVLITCRVQNPDLDMVSGDVKEKLENFSN  385

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G+ASQKKLSESAVDFPRVNE+YTGRKQRYVY T+L  +AKV G+VKFDL
Sbjct  386   ELYEMRFNMKSGVASQKKLSESAVDFPRVNESYTGRKQRYVYGTILDSIAKVTGVVKFDL  445

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK K+EVGGNV+GIFDLGPGRFGSEA+FVP +  T  EEDDGYLI F HDE+TG
Sbjct  446   HAEPEPGKGKIEVGGNVKGIFDLGPGRFGSEAVFVPSKPGTTSEEDDGYLIFFAHDESTG  505

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMSA+PVAVVELP+RVPYGFHAFFV+EEQLQ QA++
Sbjct  506   KSSVNVIDAKTMSADPVAVVELPHRVPYGFHAFFVSEEQLQEQAKL  551



>gb|AFJ94680.1| carotenoid cleavage dioxygenase 1 [Vitis vinifera]
Length=546

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/526 (79%), Positives = 467/526 (89%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             PTP  G  +KA+DWLE  IVK+MHDSS+PLHYLSGNFAP  +ETPPCK+LPV G+LPECL
Sbjct  21    PTPSKGFTSKAVDWLEKLIVKLMHDSSQPLHYLSGNFAPVRDETPPCKNLPVIGYLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGL IKDGKATYVSR+V+TSRLKQEE+FG AK
Sbjct  81    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLHIKDGKATYVSRYVRTSRLKQEEYFGGAK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FM+IGDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +
Sbjct  141   FMRIGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVYHHGKLLALSEADKPYVL  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMF+FGY+   P++TYRVISKDG M
Sbjct  201   KVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDPFTGEMFSFGYSHTPPYITYRVISKDGFM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             H+PVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV +K+L + FDATKKARFGVLP
Sbjct  261   HEPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKLIFTFDATKKARFGVLP  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNEL IKWFELPNCFIFH ANAWEE DEVV+I+CR++NPDLD+  G +K+ L +F N
Sbjct  321   RYAKNELHIKWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDLVGGDVKEKLENFGN  380

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKT +ASQ+KLS S+VDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  381   ELYEMRFNMKTCIASQRKLSASSVDFPRVNESYTGRKQRYVYGTILDSIAKVTGIIKFDL  440

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+TGK+KLEVGGNV+GIFDLG GRFGSEA+FVPRE     EEDDGYLI F+HDE TG
Sbjct  441   HAEPDTGKSKLEVGGNVQGIFDLGVGRFGSEAVFVPREPGITSEEDDGYLIFFIHDEKTG  500

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS VNVIDAKTMS +P+A+VELPNRVPYGFHAFFVTEEQL+ QA++
Sbjct  501   KSYVNVIDAKTMSPDPIAIVELPNRVPYGFHAFFVTEEQLKEQAKL  546



>ref|XP_011025444.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Populus euphratica]
Length=551

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/526 (78%), Positives = 468/526 (89%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+ +K ID+LE  IVK+M+D+S+  HYLSGNFAP P+ETPP KDLPV G+LP+CL
Sbjct  26    PKPQKGLTSKLIDYLEKLIVKLMYDTSQSHHYLSGNFAPVPDETPPVKDLPVKGYLPDCL  85

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPK  PVAGYHWFDGDGMIHG+RIKDGKA YV RFV+TSRLKQEEFFG AK
Sbjct  86    NGEFVRVGPNPKLVPVAGYHWFDGDGMIHGMRIKDGKAAYVRRFVRTSRLKQEEFFGGAK  145

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG+FGLL VY+QMLR K KVLD SYGNGT NT LIYH GKLLAL E DKPY +
Sbjct  146   FMKVGDLKGLFGLLMVYMQMLRAKTKVLDMSYGNGTGNTNLIYHHGKLLALQEADKPYVV  205

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDLQT+G+LDY+KRL H+FTAHPKVDP TGEMFTFGY+ + P+VTYRVISKDG+M
Sbjct  206   KVMEDGDLQTIGLLDYEKRLKHSFTAHPKVDPFTGEMFTFGYSHEPPYVTYRVISKDGVM  265

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV +K+L + FDATKKARFGVLP
Sbjct  266   HDPVPITISEPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKLIFTFDATKKARFGVLP  325

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++LLIKWFELPNCFIFH ANAWEE DE+V+I+CR+QNPDLDM SG +K+ L+ F N
Sbjct  326   RYAKDDLLIKWFELPNCFIFHNANAWEEEDEIVLITCRVQNPDLDMVSGDVKEKLENFTN  385

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G+ASQKKLSE+AVDF RVNE+YTGRKQRYVY T+L  +AKV G+VKFDL
Sbjct  386   ELYEMRFNMKSGVASQKKLSEAAVDFTRVNESYTGRKQRYVYGTILDSIAKVTGVVKFDL  445

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK K+EVGGNV+GIFDLGPGRFGSEA+FVP +  T  EEDDGYLI F HDE+TG
Sbjct  446   HAEPEPGKGKIEVGGNVKGIFDLGPGRFGSEAVFVPSKPGTTSEEDDGYLIFFAHDESTG  505

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMSA+PVAVVELP+RVPYGFHAFFV+EEQLQ QA++
Sbjct  506   KSSVNVIDAKTMSADPVAVVELPHRVPYGFHAFFVSEEQLQEQAKL  551



>ref|XP_006482870.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Citrus sinensis]
Length=547

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/526 (79%), Positives = 464/526 (88%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P++G+ +K ID++E  IVK M+DSS+PLHYLSGNFAP P+ETPP KDL V GHLP+CL
Sbjct  22    PKPKNGVTSKVIDFVEKLIVKWMYDSSQPLHYLSGNFAPVPDETPPTKDLHVIGHLPDCL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  82    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KLKVLD SYGNGTANTAL+YH GKLLAL E DKPYA+
Sbjct  142   FMKIGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAV  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGYA   P++TYRVISKDG M
Sbjct  202   KVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGYAHTPPYITYRVISKDGFM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+   +MMHDFAITENYAIFMDLPLYF+PKEMV + +L + FD TKKARFG+LP
Sbjct  262   HDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVKENKLIFTFDDTKKARFGILP  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNE  +KWFELPNCFIFH ANAWEE DEVV+I+CR+  PDLDM +G +K+ L +F N
Sbjct  322   RYAKNEAQMKWFELPNCFIFHNANAWEEEDEVVLITCRLDKPDLDMVNGAVKEKLENFSN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLASQK+LS SAVDFPRVNE YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  382   ELYEMRFNLKTGLASQKRLSASAVDFPRVNECYTGRKQRYVYGTILDSIAKVTGIIKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+  KTKLEVGGNV GIFDLGPGRFGSEA+FVPRE  T  EED GYLI F HDE TG
Sbjct  442   HAEPDEEKTKLEVGGNVRGIFDLGPGRFGSEAVFVPREPGTSSEEDVGYLIFFSHDEKTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMSA+PVAVVELP RVPYGFHAFFV+EEQL+ QA++
Sbjct  502   KSSVNVIDAKTMSADPVAVVELPQRVPYGFHAFFVSEEQLEEQAKL  547



>ref|XP_006439108.1| hypothetical protein CICLE_v10031039mg [Citrus clementina]
 gb|ESR52348.1| hypothetical protein CICLE_v10031039mg [Citrus clementina]
Length=589

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/526 (79%), Positives = 464/526 (88%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P++G+ +K ID++E  IVK M+DSS+PLHYLSGNFAP P+ETPP KDL V GHLP+CL
Sbjct  64    PKPKNGVTSKVIDFVEKLIVKWMYDSSQPLHYLSGNFAPVPDETPPTKDLHVIGHLPDCL  123

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  124   NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAK  183

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KLKVLD SYGNGTANTAL+YH GKLLAL E DKPYA+
Sbjct  184   FMKIGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAV  243

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGYA   P++TYRVISKDG M
Sbjct  244   KVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGYAHTPPYITYRVISKDGFM  303

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+   +MMHDFAITENYAIFMDLPLYF+PKEMV + +L + FD TKKARFG+LP
Sbjct  304   HDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVKENKLIFTFDDTKKARFGILP  363

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNE  +KWFELPNCFIFH ANAWEE DEVV+I+CR+  PDLDM +G +K+ L +F N
Sbjct  364   RYAKNEAQMKWFELPNCFIFHNANAWEEEDEVVLITCRLDKPDLDMVNGAVKEKLENFSN  423

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLASQK+LS SAVDFPRVNE YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  424   ELYEMRFNLKTGLASQKRLSASAVDFPRVNECYTGRKQRYVYGTILDSIAKVTGIIKFDL  483

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+  KTKLEVGGNV GIFDLGPGRFGSEA+FVPRE  T  EED GYLI F HDE TG
Sbjct  484   HAEPDEEKTKLEVGGNVRGIFDLGPGRFGSEAVFVPREPGTSSEEDVGYLIFFSHDEKTG  543

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMSA+PVAVVELP RVPYGFHAFFV+EEQL+ QA++
Sbjct  544   KSSVNVIDAKTMSADPVAVVELPQRVPYGFHAFFVSEEQLEEQAKL  589



>gb|AFJ94677.1| carotenoid cleavage dioxygenase 1 [Vitis vinifera]
Length=546

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/526 (78%), Positives = 467/526 (89%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G  +KA+DWLE  IVK+M+DSS+PLHYLSGNFAP  +ETPPCK+LPV G+LPECL
Sbjct  21    PKPSKGFTSKAVDWLEKLIVKLMYDSSQPLHYLSGNFAPVRDETPPCKNLPVIGYLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGL IKDGKATYVSR+V+TSRLKQEE+FG AK
Sbjct  81    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLHIKDGKATYVSRYVRTSRLKQEEYFGGAK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FM+IGDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL++H GKLLAL E DKPY +
Sbjct  141   FMRIGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVFHHGKLLALSEADKPYVL  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMF+FGY+   P++TYRVISKDG M
Sbjct  201   KVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDPFTGEMFSFGYSHTPPYITYRVISKDGFM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             H+PVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV +K+L + FDATKKARFGVLP
Sbjct  261   HEPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKLIFTFDATKKARFGVLP  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNEL IKWFELPNCFIFH ANAWEE DEVV+I+CR++NPDLD+  G +K+ L +F N
Sbjct  321   RYAKNELHIKWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDLVGGDVKEKLENFGN  380

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+ASQ+KLS S+VDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  381   ELYEMRFNMKTGIASQRKLSASSVDFPRVNESYTGRKQRYVYGTILDSIAKVTGIIKFDL  440

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+TGK+KLEVGGNV+GIFDLG GRFGSEA+FVPRE     EEDDGYLI FVHDE TG
Sbjct  441   HAEPDTGKSKLEVGGNVQGIFDLGVGRFGSEAVFVPREPGITSEEDDGYLIFFVHDEKTG  500

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS VNVIDAKTMS +P+A+VELPNRVPYGFHAFFVTEEQL+ QA++
Sbjct  501   KSYVNVIDAKTMSPDPIAIVELPNRVPYGFHAFFVTEEQLKEQAKL  546



>gb|ADN65332.1| carotenoid cleavage dioxygenase 1 [Manihot esculenta]
Length=552

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/526 (78%), Positives = 467/526 (89%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+K +D LE  IVK+M D+SKPLHYLSGNFAP  +ETPP +DL V GHLP+CL
Sbjct  27    PKPRKGLASKFVDLLEKLIVKLMFDASKPLHYLSGNFAPVTDETPPVRDLSVKGHLPDCL  86

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHG+RIK+GKATYV R+V+TSR++QEEFFG +K
Sbjct  87    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGMRIKNGKATYVRRYVRTSRIQQEEFFGGSK  146

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
              MK+GDLKG+FGL  V +Q+LR KLKVLD SYGNGTANTALIYH GKLLAL E DKPY +
Sbjct  147   IMKVGDLKGLFGLFMVNMQILRAKLKVLDMSYGNGTANTALIYHHGKLLALQEADKPYVV  206

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+GMLDYDKRL H+FTAHPKVDP TGEMFTFGYA + P++TYRVISKDG+M
Sbjct  207   KVLEDGDLQTVGMLDYDKRLKHSFTAHPKVDPNTGEMFTFGYAHEPPYITYRVISKDGVM  266

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIF+DLPLYF+PKEMV  K+L + FDATKKARFGVLP
Sbjct  267   HDPVPITISDPIMMHDFAITENYAIFLDLPLYFRPKEMVKDKKLIFTFDATKKARFGVLP  326

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++  I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SG +K+ L +F N
Sbjct  327   RYAKDDHQIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGNVKEKLENFAN  386

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+ASQK+LS  AVDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  387   ELYEMRFNMKTGVASQKRLSAPAVDFPRVNESYTGRKQRYVYGTILDSIAKVTGIIKFDL  446

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+ GKTKLEVGGN++GIFDLGPGRFGSEA+FVPRE  T  EEDDGYLI F HDENTG
Sbjct  447   HAEPQQGKTKLEVGGNIKGIFDLGPGRFGSEAVFVPREPGTSSEEDDGYLIFFTHDENTG  506

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMS++PVAVVELP+RVPYGFHAFFVTEEQLQ QA +
Sbjct  507   KSSVNVIDAKTMSSDPVAVVELPHRVPYGFHAFFVTEEQLQAQATL  552



>gb|AGT63320.1| carotenoid cleavage dioxygenase 1 [Vitis vinifera]
Length=542

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/526 (78%), Positives = 467/526 (89%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G  +KA+DWLE  IVK+M+DSS+PLHYLSGNFAP  +ETPPCK+LPV G+LPECL
Sbjct  17    PKPSKGFTSKAVDWLEKLIVKLMYDSSQPLHYLSGNFAPVRDETPPCKNLPVIGYLPECL  76

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGL IKDGKATYVSR+V+TSRLKQEE+FG AK
Sbjct  77    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLHIKDGKATYVSRYVRTSRLKQEEYFGGAK  136

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FM+IGDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL++H GKLLAL E DKPY +
Sbjct  137   FMRIGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVFHRGKLLALSEADKPYVL  196

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMF+FGY+   P++TYRVISKDG M
Sbjct  197   KVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDPFTGEMFSFGYSHTPPYITYRVISKDGFM  256

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             H+PVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV +K+L + FDATKKARFGVLP
Sbjct  257   HEPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKLIFTFDATKKARFGVLP  316

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNEL IKWFELPNCFIFH ANAWEE DEVV+I+CR+++PDLD+  G +K+ L +F N
Sbjct  317   RYAKNELHIKWFELPNCFIFHNANAWEEEDEVVLITCRLEHPDLDLVGGDVKEKLENFGN  376

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+ASQ+KLS S+VDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  377   ELYEMRFNMKTGIASQRKLSASSVDFPRVNESYTGRKQRYVYGTILDSIAKVTGIIKFDL  436

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+TGK+KLEVGGNV+GIFDLG GRFGSEA+FVPRE     EEDDGYLI FVHDE TG
Sbjct  437   HAEPDTGKSKLEVGGNVQGIFDLGVGRFGSEAVFVPREPGITSEEDDGYLIFFVHDEKTG  496

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS VNVIDAKTMS +P+A+VELPNRVPYGFHAFFVTEEQL+ QA++
Sbjct  497   KSYVNVIDAKTMSPDPIAIVELPNRVPYGFHAFFVTEEQLKEQAKL  542



>ref|XP_011087733.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Sesamum indicum]
Length=540

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/519 (80%), Positives = 457/519 (88%), Gaps = 4/519 (1%)
 Frame = -3

Query  1801  IAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVR  1622
             +A+K IDWLEW  VK+MHD  +P HYLSGNFAP  +ETPP  DLPV GHLPECLNGEFVR
Sbjct  26    LASKVIDWLEWTFVKLMHDPKQPNHYLSGNFAPV-DETPPLTDLPVKGHLPECLNGEFVR  84

Query  1621  VGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGD  1442
             VG NPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEE +G  KFMK GD
Sbjct  85    VGSNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEELYGGPKFMKFGD  144

Query  1441  LKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDG  1262
             +KG+FGL+ V + MLR KLKVLD SYG GTANTA++YH GKL+ALHEGDKPYAIKVLEDG
Sbjct  145   MKGIFGLIMVNMHMLRTKLKVLDASYGFGTANTAIVYHHGKLMALHEGDKPYAIKVLEDG  204

Query  1261  DLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPI  1082
             DLQT+GMLDYDKRL H FTAHPKVDP TGEMFTFGY+Q  P+VTYRVISK+G+M DPVPI
Sbjct  205   DLQTIGMLDYDKRLAHTFTAHPKVDPFTGEMFTFGYSQTPPYVTYRVISKEGVMEDPVPI  264

Query  1081  TIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNE  902
             TI   VMMHDFA+TENYAIFMDLPLYF+PKEMV +K+L + FD TKKARFGVLPRYAKNE
Sbjct  265   TIADPVMMHDFAVTENYAIFMDLPLYFRPKEMVKEKKLMFTFDPTKKARFGVLPRYAKNE  324

Query  901   LLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRF  722
             LLI+WFELPNCFIFH ANAWEEGDEVV+I+CR+QNPDLDM S ++K   +F NELYEMRF
Sbjct  325   LLIRWFELPNCFIFHNANAWEEGDEVVLITCRLQNPDLDMFSSSVK---EFTNELYEMRF  381

Query  721   NMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETG  542
             N+K GLASQK+LS SAVDFPRVNENYTGR Q YVY T+L   AKV GI+KFDLHAEPETG
Sbjct  382   NLKNGLASQKRLSVSAVDFPRVNENYTGRNQHYVYGTILGSTAKVTGIIKFDLHAEPETG  441

Query  541   KTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVI  362
             K KLEVGGN+ GIFDLGPG+FGSEA+FVPR+  T  +EDDGYLI FVHDENTGKSAVNVI
Sbjct  442   KEKLEVGGNITGIFDLGPGKFGSEAVFVPRQPGTASDEDDGYLIFFVHDENTGKSAVNVI  501

Query  361   DAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             DAKTMSA+PVAVVELP RVPYGFHA FVTEEQLQ QA++
Sbjct  502   DAKTMSADPVAVVELPKRVPYGFHALFVTEEQLQEQAKL  540



>gb|ABB52081.1| putative carotenoid cleavage dioxygenase [Daucus carota subsp. 
sativus]
Length=547

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/526 (79%), Positives = 469/526 (89%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ +KAIDW+E  IVK+M+D+S P H+L+GNFAP  +ETPP +DLPV G +PECL
Sbjct  23    PKPSKGLTSKAIDWIESLIVKLMYDASVPHHWLAGNFAPV-DETPPARDLPVIGSIPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEE FG AK
Sbjct  82    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEETFGGAK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KL VLD SYGNGTANTA+IYH G+LLAL E DKPYAI
Sbjct  142   FMKIGDLKGLFGLLMVNMQMLRGKLNVLDMSYGNGTANTAMIYHHGRLLALSEADKPYAI  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG+M
Sbjct  202   KVLEDGDLQTLGLLDYDKRLTHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGVM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             +DPVPIT+   +MMHDFAITENYAI MDLPLYF+PKEMV +K+L + FDATKKARFGVLP
Sbjct  262   NDPVPITLADPIMMHDFAITENYAIIMDLPLYFKPKEMVKEKKLIFTFDATKKARFGVLP  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNELLIKWFELPNCFIFH ANAWEEGDEVV+I+CR++NPDLDM +G++K+ L +F N
Sbjct  322   RYAKNELLIKWFELPNCFIFHNANAWEEGDEVVLITCRLENPDLDMVNGSMKEKLENFNN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+GLASQKKLS SAVDFPR+NE+YTGRKQRYVYAT L  +AKV GIVKFDL
Sbjct  382   ELYEMRFNMKSGLASQKKLSASAVDFPRINESYTGRKQRYVYATSLDSIAKVTGIVKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             H EPE GK KLEVGGN++GIFDLG GRFGSEAIFVPR+  T  EEDDGYLI F+HDE+TG
Sbjct  442   HMEPEIGKKKLEVGGNIQGIFDLGVGRFGSEAIFVPRQPGTTSEEDDGYLIHFLHDESTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSA N+IDAKTMS +PVAVVELP+RVPYGFHAFFVTEEQLQ QA++
Sbjct  502   KSAANIIDAKTMSPDPVAVVELPHRVPYGFHAFFVTEEQLQEQAKL  547



>gb|AFC88468.1| 9-cis-epoxycarotenoid deoxygenase [Acanthus ebracteatus]
Length=545

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/526 (78%), Positives = 462/526 (88%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+++KAIDWLEWA VK+MHD  +PLHYL+GNFAP  +ET P  DLPV G+LPECL
Sbjct  20    PKPQKGLSSKAIDWLEWAFVKLMHDPKQPLHYLTGNFAPV-DETAPLTDLPVQGNLPECL  78

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+ IKDGKATYVSRFVKTSRLKQEE++G +K
Sbjct  79    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMHIKDGKATYVSRFVKTSRLKQEEYYGGSK  138

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL+ V + MLR K K LD SYG+GTANT LIYH GKLLAL E DKPYAI
Sbjct  139   FMKIGDLKGFFGLIMVNMMMLRTKSKALDISYGHGTANTNLIYHHGKLLALSEADKPYAI  198

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPK+DP TGE+FTFGY+   P++TYRVISKDG+M
Sbjct  199   KVLEDGDLQTIGLLDYDKRLAHSFTAHPKLDPFTGELFTFGYSHTPPYITYRVISKDGVM  258

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPIT+   +MMHDFAITENYAIFMDLPLYF+PKEMV +K+  + FD TKKARFG+LP
Sbjct  259   EDPVPITVAEPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKFIFSFDPTKKARFGILP  318

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAKNELLI+WFELPNCFIFH ANAWEEGDEVV+I+CR+QNPDLDM + + K+ LD F N
Sbjct  319   RYAKNELLIRWFELPNCFIFHNANAWEEGDEVVLITCRLQNPDLDMVNSSAKERLDNFTN  378

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+K GLASQKKLS SAVDFPRVNENYTGRKQRYVY T+L  +AKV G++KFDL
Sbjct  379   ELYEMRFNLKNGLASQKKLSVSAVDFPRVNENYTGRKQRYVYGTILDSIAKVTGVIKFDL  438

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK KLEVGGNV GI+DLGPGRFGSEA+FVPRE  T  EEDDGYLI FVHDENTG
Sbjct  439   HAEPEIGKDKLEVGGNVTGIYDLGPGRFGSEAVFVPREPGTTSEEDDGYLIFFVHDENTG  498

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAV+VIDAKTMS +PVAVV+LP RVPYGFHAF VTEEQLQ QA++
Sbjct  499   KSAVHVIDAKTMSPDPVAVVDLPKRVPYGFHAFXVTEEQLQEQAQL  544



>ref|XP_010552741.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 isoform 
X3 [Tarenaya hassleriana]
Length=542

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/524 (78%), Positives = 465/524 (89%), Gaps = 1/524 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G +++ ID LE   VK MHD+S+PLHYLSGNFAP  EETPP KDLPV+GHLPECL
Sbjct  13    PKPSKGFSSRLIDLLETLFVKFMHDASQPLHYLSGNFAPVREETPPVKDLPVTGHLPECL  72

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQE+FFG AK
Sbjct  73    NGEFVRVGPNPKFDPVAGYHWFDGDGMIHGVRIKDGKATYVSRYVKTSRLKQEQFFGGAK  132

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGD+KG+FGLL V +Q LR KLK+LD+SYG GTANTALIYH GKLLAL E DKPY +
Sbjct  133   FMKIGDVKGLFGLLMVNMQQLRTKLKILDDSYGIGTANTALIYHHGKLLALQEADKPYVV  192

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+GM+DYDKRL H+FTAHPKVDPVTGEMFTFGY+ KAP++TYRVISKDG+M
Sbjct  193   KVLEDGDLQTVGMMDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHKAPYITYRVISKDGVM  252

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             H+PVPITIP  +MMHDFAITENYAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVLP
Sbjct  253   HNPVPITIPEPIMMHDFAITENYAIFMDLPMHFRPKEMVKEKKMIYSFDLTKKARFGVLP  312

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+EL+I+WFELPNCFIFH ANAWE+ DEVV+I+CR++NPDLDM SG +K+ L +F N
Sbjct  313   RYAKDELMIRWFELPNCFIFHNANAWEDEDEVVLITCRLENPDLDMVSGNVKEKLENFGN  372

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNM TG ASQ+KLS SAVDFPR+NE YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  373   ELYEMRFNMATGAASQRKLSASAVDFPRINEWYTGRKQRYVYGTILDSIAKVTGIIKFDL  432

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GKT+LEVGGN+ GI+DLGPGR+GSEAI+VP+E     EED GYLI FVHDE TG
Sbjct  433   HAEPEPGKTELEVGGNIIGIYDLGPGRYGSEAIYVPQETGCTAEEDGGYLIFFVHDERTG  492

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             KS VNVIDAKTMSA+PVAVVELP+RVPYGFHAFFVTEEQLQ QA
Sbjct  493   KSYVNVIDAKTMSADPVAVVELPHRVPYGFHAFFVTEEQLQEQA  536



>gb|AFJ94678.1| carotenoid cleavage dioxygenase 1 [Vitis vinifera]
Length=546

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/526 (78%), Positives = 465/526 (88%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G  +KA+DWLE  IVK+M+DS +PLHYLSGNFAP  +ETPPCK+LPV G+LPECL
Sbjct  21    PKPSKGFTSKAVDWLEKLIVKLMYDSPQPLHYLSGNFAPVRDETPPCKNLPVIGYLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGL IKDGKA YVSR+V+TSRLKQEE+FG AK
Sbjct  81    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLHIKDGKAIYVSRYVRTSRLKQEEYFGGAK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FM+IGDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL++H GKLLAL E DKPY +
Sbjct  141   FMRIGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVFHHGKLLALSEADKPYVL  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMF+FGY+   P++TYRVISKDG M
Sbjct  201   KVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDPFTGEMFSFGYSHTPPYITYRVISKDGFM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             H+PVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV +K+L + FDATKKARFGVLP
Sbjct  261   HEPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKLIFTFDATKKARFGVLP  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNEL IKWFELPNCFIFH ANAWEE DEVV+I+CR++NPDLD+  G +K+ L +F N
Sbjct  321   RYAKNELHIKWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDLVGGDVKEKLENFGN  380

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+ASQ+KLS S+VDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  381   ELYEMRFNMKTGIASQRKLSASSVDFPRVNESYTGRKQRYVYGTILDSIAKVTGIIKFDL  440

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+TGK+KLEVGGNV+GIFDLG GRFGSEA+FVPRE     EEDDGYLI FVHDE TG
Sbjct  441   HAEPDTGKSKLEVGGNVQGIFDLGVGRFGSEAVFVPREPGITSEEDDGYLIFFVHDEKTG  500

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS VNVIDAKTMS +P+A+VELPNRVPYGFHAFFVTEEQL+ QA++
Sbjct  501   KSYVNVIDAKTMSPDPIAIVELPNRVPYGFHAFFVTEEQLKEQAKL  546



>ref|XP_007052519.1| Carotenoid cleavage dioxygenase 1 isoform 2 [Theobroma cacao]
 gb|EOX96676.1| Carotenoid cleavage dioxygenase 1 isoform 2 [Theobroma cacao]
Length=541

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/525 (79%), Positives = 460/525 (88%), Gaps = 9/525 (2%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+++K IDWLE  IVK+M+DSS+P HYLSGNFAP+P ETPP KDLPV GHLPECL
Sbjct  25    PKPQKGLSSKLIDWLEKLIVKLMYDSSQPQHYLSGNFAPSPNETPPTKDLPVKGHLPECL  84

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVA YHWFDGDGMIHG+RIKDGKATYVSRFVKTSR+KQEE+FG +K
Sbjct  85    NGEFVRVGPNPKFAPVAAYHWFDGDGMIHGMRIKDGKATYVSRFVKTSRIKQEEYFGGSK  144

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG FGLL V +Q LR K KVLD SYG GTANTALIYH GKLLAL E DKPY +
Sbjct  145   FMKVGDLKGFFGLLMVNIQKLREKAKVLDLSYGYGTANTALIYHHGKLLALQEADKPYVL  204

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+ + P++TYRVISKDG M
Sbjct  205   KVFEDGDLQTLGMLDYDKRLAHSFTAHPKVDPVTGEMFTFGYSHEPPYITYRVISKDGFM  264

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIF+DLPLYF+PK         + FDA+KKARFGVLP
Sbjct  265   HDPVPITISEPIMMHDFAITENYAIFLDLPLYFRPK--------VFSFDASKKARFGVLP  316

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++LLI+WFELPNCFIFH ANAWEE DE+V+I+CR++NPDLD+ SG +K+ LD F N
Sbjct  317   RYAKDDLLIRWFELPNCFIFHNANAWEEEDEIVLITCRLENPDLDLVSGEVKEKLDNFNN  376

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQK+LS SAVDFPRVNE YTGRKQRYVY T L  +A V GIVKFDL
Sbjct  377   ELYEMRFNMKTGLASQKQLSVSAVDFPRVNEYYTGRKQRYVYGTTLDSIANVTGIVKFDL  436

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK K+EVGGNV+G+FDLGPGRFGSEAIFVPRE  T  EEDDGYLI FVHDENTG
Sbjct  437   HAEPEAGKPKIEVGGNVQGLFDLGPGRFGSEAIFVPREPGTTSEEDDGYLIFFVHDENTG  496

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS+VNVIDAKTMSA+PVAVVELP+RVPYGFHAFFVTEEQL  QA+
Sbjct  497   KSSVNVIDAKTMSADPVAVVELPHRVPYGFHAFFVTEEQLHEQAK  541



>sp|Q84KG5.1|CCD_CROSA RecName: Full=Carotenoid 9,10(9',10')-cleavage dioxygenase; AltName: 
Full=CsCCD [Crocus sativus]
 emb|CAC79592.1| crocetin dialdehyde [Crocus sativus]
Length=546

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/523 (79%), Positives = 455/523 (87%), Gaps = 1/523 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ + A+D +E A+V + HD SKP HYLSGNFAP  +ETPPC DLPV GHLPECL
Sbjct  20    PQPSKGLVSSAVDLIEKAVVYLFHDKSKPCHYLSGNFAPVVDETPPCPDLPVRGHLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIHG+RIKDGKATY SR+VKTSRLKQEE+F   K
Sbjct  80    NGEFVRVGPNPKFMPVAGYHWFDGDGMIHGMRIKDGKATYASRYVKTSRLKQEEYFEGPK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q+LR KLKV+D SYG GT NTALIYH GKLLAL E DKPY +
Sbjct  140   FMKIGDLKGFFGLFMVQMQLLRAKLKVIDVSYGVGTGNTALIYHHGKLLALSEADKPYVV  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMFTFGYA   P+VTYRVISKDG+M
Sbjct  200   KVLEDGDLQTLGLLDYDKRLSHSFTAHPKVDPFTDEMFTFGYAHTPPYVTYRVISKDGVM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIPASVMMHDFAITENY+IFMDLPLYFQPKEMV   +L + FDATKKARFGVLP
Sbjct  260   RDPVPITIPASVMMHDFAITENYSIFMDLPLYFQPKEMVKGGKLIFSFDATKKARFGVLP  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++ LI+WFELPNCFIFH ANAWEEGDEVV+I+CR++NPDLDM +G +K+ L+ F N
Sbjct  320   RYAKDDSLIRWFELPNCFIFHNANAWEEGDEVVLITCRLENPDLDMVNGAVKEKLENFKN  379

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPR+NE+YT RKQRYVY T+L ++ KVKGI+KFDL
Sbjct  380   ELYEMRFNMKTGAASQKQLSVSAVDFPRINESYTTRKQRYVYGTILDNITKVKGIIKFDL  439

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK KLEVGGNV+GIFDLGPGR+GSEA+FVPRE     EEDDGYLI FVHDENTG
Sbjct  440   HAEPEAGKKKLEVGGNVQGIFDLGPGRYGSEAVFVPRERGIKSEEDDGYLIFFVHDENTG  499

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             KS VNVIDAKTMSAEPVAVVELPNRVPYGFHAFFV EEQLQ Q
Sbjct  500   KSEVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVNEEQLQWQ  542



>gb|ABY47994.1| carotenoid cleavage dioxygenase 1 [Rosa x damascena]
Length=552

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/525 (78%), Positives = 464/525 (88%), Gaps = 1/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ +  +D +E  IVK+M+DSS+P HYL+GNFAP  EETPP KDL V GHLP+CL
Sbjct  27    PKPSKGVTSTLVDTVEKLIVKLMYDSSQPHHYLAGNFAPVIEETPPTKDLHVIGHLPDCL  86

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  87    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  146

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG+FGLL VY+Q LR KLKVLD SYG+GT NTA +YH GKLLAL EGDKPY +
Sbjct  147   FMKVGDLKGLFGLLMVYMQQLRAKLKVLDLSYGHGTGNTAFVYHHGKLLALSEGDKPYVL  206

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P+VTYRVISKDG M
Sbjct  207   KVLEDGDLQTVGLLDYDKRLKHSFTAHPKVDPFTGEMFTFGYSHDPPYVTYRVISKDGFM  266

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDP+PIT+PA VMMHDFAITENYAIFMDLPLYF+PKEMV + +L + FD TKKARFGVLP
Sbjct  267   HDPIPITVPAPVMMHDFAITENYAIFMDLPLYFRPKEMVKEGKLIFSFDETKKARFGVLP  326

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++LLI+WFELPNCFIFH ANAWEE DEVV+++CR++NPDLDM +G +K  LD F N
Sbjct  327   RYAKDDLLIRWFELPNCFIFHNANAWEEEDEVVLMTCRLENPDLDMVNGPIKKKLDNFKN  386

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLA+QKKLSESAVDFPRVNE+YTGRKQRYVY T L  +AKV GIVKFDL
Sbjct  387   ELYEMRFNLKTGLATQKKLSESAVDFPRVNESYTGRKQRYVYGTTLDSIAKVTGIVKFDL  446

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HA PE GKTK+EVGGNV+G++DLGPGRFGSEAIFVPR      EEDDGYLI FVHDENTG
Sbjct  447   HAAPEIGKTKIEVGGNVQGLYDLGPGRFGSEAIFVPRVPGITSEEDDGYLIFFVHDENTG  506

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KSA++V+DAKTMS +PVA+VELP+RVPYGFHAFFVTEEQLQ QA+
Sbjct  507   KSAIHVLDAKTMSGDPVAIVELPHRVPYGFHAFFVTEEQLQEQAK  551



>ref|XP_011087743.1| PREDICTED: LOW QUALITY PROTEIN: carotenoid 9,10(9',10')-cleavage 
dioxygenase 1-like [Sesamum indicum]
Length=547

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/523 (79%), Positives = 463/523 (89%), Gaps = 5/523 (1%)
 Frame = -3

Query  1801  IAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPEC---LNGE  1631
             +A+KAIDWLEWA VK+MHD ++PLHYLSGNF P  +ETPP  DLPV GHLP        E
Sbjct  26    LASKAIDWLEWAFVKLMHDPNRPLHYLSGNFGPV-DETPPLTDLPVKGHLPXXKFXXXXE  84

Query  1630  FVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMK  1451
             FVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQE+F+G +KFMK
Sbjct  85    FVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEDFYGGSKFMK  144

Query  1450  IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVL  1271
             +GDLKGMFGL+ V +QMLR KLKVLD SYG GTANTALIYH GKLLAL E DKPYAIKVL
Sbjct  145   VGDLKGMFGLIMVNMQMLRAKLKVLDVSYGVGTANTALIYHHGKLLALSEADKPYAIKVL  204

Query  1270  EDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDP  1091
             EDGDLQT+GMLDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISK+G+M DP
Sbjct  205   EDGDLQTIGMLDYDKRLAHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKEGVMQDP  264

Query  1090  VPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYA  911
             VPIT+   +MMHDFAITENYA+FMDLPLYF+PKEMV   +  + FD TKKARFG+LPRYA
Sbjct  265   VPITVADPIMMHDFAITENYAVFMDLPLYFRPKEMVKDNKFIFSFDPTKKARFGILPRYA  324

Query  910   KNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVNELY  734
             KNELLI+WFELPNC+IFH ANAWEEGDEVV+I+CR+QNPDLDM +G++K+ L +F NELY
Sbjct  325   KNELLIRWFELPNCYIFHNANAWEEGDEVVLITCRLQNPDLDMVNGSVKEKLENFTNELY  384

Query  733   EMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAE  554
             EMRFN+K+GLASQK+LS SAVDFPRVNE++TGRKQRYVY T+L  +AKV GI+KFDLHAE
Sbjct  385   EMRFNLKSGLASQKRLSVSAVDFPRVNESFTGRKQRYVYGTILDSIAKVTGIIKFDLHAE  444

Query  553   PETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSA  374
             PETGK KLEVGGNV GIFDLGPGRFGSEAIFVPR+  T  EEDDGYLI FVHDENTGKSA
Sbjct  445   PETGKEKLEVGGNVIGIFDLGPGRFGSEAIFVPRQPGTTSEEDDGYLIFFVHDENTGKSA  504

Query  373   VNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             VNVIDAKTMSA+PVAVVELP RVPYGFHAFFVTEEQLQ QA++
Sbjct  505   VNVIDAKTMSADPVAVVELPKRVPYGFHAFFVTEEQLQEQAKL  547



>dbj|BAE72095.1| Lactuca sativa carotenoid cleavage dioxygenase 2
Length=541

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/526 (79%), Positives = 463/526 (88%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G ++KA+DWLE  IVK+M+DSS+P H+L GNFAP  +ETPPCKDLPV GHLPECL
Sbjct  17    PKPKKGFSSKAVDWLEKLIVKLMYDSSQPHHWLFGNFAPV-DETPPCKDLPVIGHLPECL  75

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATY+SR+VKTSRL+QEE+FG AK
Sbjct  76    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYLSRYVKTSRLEQEEYFGGAK  135

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KLKVLD S+G GT NTALIYH  KLLAL EGDKPYAI
Sbjct  136   FMKIGDLKGLFGLLMVNMQMLRTKLKVLDLSFGQGTGNTALIYHHKKLLALSEGDKPYAI  195

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDL+TLG++DYDKRL H FTAHPK+DPVTGEMFTFGY Q  P+VTYRVISKDG+M
Sbjct  196   KVMEDGDLETLGLMDYDKRLSHTFTAHPKIDPVTGEMFTFGYTQSPPYVTYRVISKDGVM  255

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             +DPVPITI   VMMHDFAITENYAIFMDLPLYF+PKEMV   +L + FD+TKKARFG+LP
Sbjct  256   NDPVPITIAEPVMMHDFAITENYAIFMDLPLYFRPKEMVKGNKLIFTFDSTKKARFGILP  315

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAKNE+ IKWFELPNCFIFH ANAWEEGDEVV+I+CR+QNP+LDM  G +K+ LD F N
Sbjct  316   RYAKNEVQIKWFELPNCFIFHNANAWEEGDEVVLITCRLQNPNLDMVGGGVKEKLDNFAN  375

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNM+TG+ASQKKLSESAVDFPRVNE YTGRKQRYVY T L  +AKV GIVKFDL
Sbjct  376   ELYEMRFNMETGVASQKKLSESAVDFPRVNECYTGRKQRYVYGTRLDSIAKVTGIVKFDL  435

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGKTKLE+GGN+ GI+DLGPGR+GSEAIFVP++     EEDDGYLI F HDE TG
Sbjct  436   HAEPETGKTKLEIGGNIPGIYDLGPGRYGSEAIFVPKKPGFDSEEDDGYLIFFTHDETTG  495

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V VIDAKTMS +PVAVV L +RVPYGFHAFFVTEEQ+Q QA +
Sbjct  496   KSTVTVIDAKTMSPDPVAVVPLSHRVPYGFHAFFVTEEQIQEQANL  541



>ref|XP_002278628.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Vitis vinifera]
Length=552

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/532 (77%), Positives = 465/532 (87%), Gaps = 7/532 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G  +KA+DWLE  IVK+M+DSS+PLHYLSGNFAP  +ETPPCK+LPV G+LPECL
Sbjct  21    PKPSKGFTSKAVDWLEKLIVKLMYDSSQPLHYLSGNFAPVRDETPPCKNLPVIGYLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEE+FG AK
Sbjct  81    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEYFGGAK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F + GDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +
Sbjct  141   FTRFGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVYHHGKLLALSEVDKPYVL  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  201   KVLEDGDLQTLGLLDYDKRLTHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             H+PVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV +K+L + FDATKKARFGVLP
Sbjct  261   HEPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKLIFTFDATKKARFGVLP  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNEL IKWFELPNCFIFH ANAWEE DEVV+I+CR++NPDLD+    +K+ L +F N
Sbjct  321   RYAKNELHIKWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDLVGRNVKEKLENFAN  380

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYAT------MLSDLAKVKG  581
             ELYEMRFNMKTG+ASQ+KLS S+VDFPRVNE+YTGRKQRYVY T      +L  +AKV G
Sbjct  381   ELYEMRFNMKTGIASQRKLSASSVDFPRVNESYTGRKQRYVYGTILDSIAILDSIAKVAG  440

Query  580   IVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFV  401
             I+KFDLHAEP+TGK+KLEVGGNV+GIFDLG GRFGSEA+FVPRE     EEDDGYLI FV
Sbjct  441   IIKFDLHAEPDTGKSKLEVGGNVQGIFDLGVGRFGSEAVFVPREPGITSEEDDGYLIFFV  500

Query  400   HDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             HDE TGKS VNVI+AKTMS +PVA+VELPNRVPYGFHAFFVTEEQL+ QA++
Sbjct  501   HDEKTGKSYVNVINAKTMSPDPVAIVELPNRVPYGFHAFFVTEEQLKEQAKL  552



>ref|XP_009394395.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase [Musa 
acuminata subsp. malaccensis]
Length=547

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/525 (78%), Positives = 458/525 (87%), Gaps = 2/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+ +  +D +E  IV +MHD   PLHYL+GNFAP  +ETPPC DLPV G LPECL
Sbjct  23    PKPKKGLVSATVDLIERVIVYLMHDRKTPLHYLAGNFAPVRDETPPCTDLPVRGTLPECL  82

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  83    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHGMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  142

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL  V +Q+LR KLK+LD SYG GTANTAL+YH GKLLAL E DKPY +
Sbjct  143   FMKIGDLKGLFGLFMVQMQLLRAKLKILDVSYGTGTANTALVYHHGKLLALSEADKPYIV  202

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             +VLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVT EMFTFGY+   P+VTYRVI+KDG+M
Sbjct  203   RVLEDGDLQTLGMLDYDKRLAHSFTAHPKVDPVTDEMFTFGYSHVPPYVTYRVITKDGVM  262

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP  VMMHDFAITENYAIFMDLPLYFQPKEMV K +L + FDATKK+RFGVLP
Sbjct  263   LDPVPITIPDPVMMHDFAITENYAIFMDLPLYFQPKEMV-KGKLIFNFDATKKSRFGVLP  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+EL I+WFELPNC+IFH ANAWEEGDEVV+I+CR+QNPDLD  +G +KD L +F N
Sbjct  322   RYAKDELHIRWFELPNCYIFHNANAWEEGDEVVLITCRLQNPDLDQVNGAVKDHLENFTN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK+G ASQK+LS SAVDFPR+NE+YTGRKQRYVY T+L  +AKVKGI+KFDL
Sbjct  382   ELYEMRFNMKSGAASQKQLSVSAVDFPRINESYTGRKQRYVYCTILDSIAKVKGIIKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK KLEVGGNV+GIFDLGPGR+GSEA+FVP +     EEDDGYLI FVHDENTG
Sbjct  442   HAEPELGKKKLEVGGNVKGIFDLGPGRYGSEAVFVPHKPGFSSEEDDGYLIFFVHDENTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS VNVIDAKTMSA+PVAVVELP RVPYGFHAFFVTEEQLQ Q E
Sbjct  502   KSEVNVIDAKTMSADPVAVVELPTRVPYGFHAFFVTEEQLQRQVE  546



>ref|XP_008375177.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Malus domestica]
Length=582

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/526 (78%), Positives = 461/526 (88%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G A+K +D +E  IVK M+DSS+P HYL+GNFAP  +ETPP  +LPV GHLPECL
Sbjct  57    PKPNKGYASKVVDLMEKLIVKWMYDSSQPHHYLAGNFAPVVDETPPTTNLPVIGHLPECL  116

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIKDGKATYVSR+V+TSRLKQEE+FG AK
Sbjct  117   NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKDGKATYVSRYVRTSRLKQEEYFGGAK  176

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V LQMLR KLK+ D SYGNGT NTAL+YH GKLLAL E DKPY +
Sbjct  177   FMKIGDLKGFFGLFMVNLQMLRAKLKIFDMSYGNGTGNTALVYHHGKLLALSEADKPYVL  236

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDPVTGEMFTFGY+   P+VTYRVISKDG M
Sbjct  237   KVLEDGDLQTVGLLDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHAPPYVTYRVISKDGFM  296

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDP+PITI   VMMHDFAITENYAIFMDLPL F+PKEMV +K+  + FD TK ARFG+LP
Sbjct  297   HDPIPITIADPVMMHDFAITENYAIFMDLPLIFKPKEMVKEKKFIFTFDQTKIARFGLLP  356

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNE LI+WFELPNCFIFH ANAWEEGDEVV+I+CR+ N DLDM +G++K+ L +F N
Sbjct  357   RYAKNESLIRWFELPNCFIFHNANAWEEGDEVVLITCRLDNLDLDMVNGSVKEKLENFKN  416

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLASQKKLSESAVDFPRVNE+YTGRKQRYVY T+L  +AKV G+ KFDL
Sbjct  417   ELYEMRFNLKTGLASQKKLSESAVDFPRVNESYTGRKQRYVYGTLLDSIAKVTGVAKFDL  476

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GKTK+EVGGNV+G++DLGPGRFGSEAIFVPR      EEDDGYLILFVHDENTG
Sbjct  477   HAEPEVGKTKIEVGGNVQGLYDLGPGRFGSEAIFVPRIPGVTSEEDDGYLILFVHDENTG  536

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAV+V+DAKTMS EPVAVVELP+RVPYGFHAFFVTEEQLQ QA++
Sbjct  537   KSAVHVVDAKTMSXEPVAVVELPHRVPYGFHAFFVTEEQLQEQAKL  582



>gb|ABO69703.1| 9-cis-epoxycarotenoid dioxygenase [Castanea mollissima]
Length=548

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/526 (78%), Positives = 461/526 (88%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G+ +K ID++E  IVK+M+DSS P HYLSGNFAP  EETPP  DL V GHLP+CL
Sbjct  23    PKPNNGLTSKVIDFVEKLIVKLMYDSSLPHHYLSGNFAPVREETPPTTDLLVKGHLPDCL  82

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIK+GKATYVSR+V+TSR+KQEE+FG AK
Sbjct  83    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKNGKATYVSRYVRTSRIKQEEYFGGAK  142

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +Q+LR KLKVLD++YG GTANTA++YH GKLLAL E DKPYA+
Sbjct  143   FMKIGDLKGLFGLLMVNMQILRTKLKVLDDTYGYGTANTAMVYHHGKLLALSEADKPYAV  202

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  203   KVLEDGDLQTLGMLDYDKRLSHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  262

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV   +L + FDATK ARFGVLP
Sbjct  263   HDPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKGNKLIFTFDATKNARFGVLP  322

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+EL I+WFELPNCFIFH ANAWEE DEVV I+CR+QNPDLDM +G +K+ L +F N
Sbjct  323   RYAKDELQIRWFELPNCFIFHNANAWEEEDEVVPITCRLQNPDLDMVNGVVKEKLENFTN  382

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQKKLS SAVDFPRVNE+YTGR+QRYVY T+L  +AKV GI+KFDL
Sbjct  383   ELYEMRFNMKTGLASQKKLSASAVDFPRVNESYTGRRQRYVYGTILDSIAKVTGIIKFDL  442

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+TGKTKLE GGNV GI+DLGPGRFGSEA+FVPR      EEDDGYLI F HDENTG
Sbjct  443   HAEPDTGKTKLEAGGNVLGIYDLGPGRFGSEAVFVPRVPGITSEEDDGYLIFFAHDENTG  502

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMS +PVAVVE+P RVP+GFHAFFVTEEQLQ Q ++
Sbjct  503   KSSVNVIDAKTMSPDPVAVVEMPRRVPFGFHAFFVTEEQLQEQGKL  548



>gb|KDP43480.1| hypothetical protein JCGZ_16767 [Jatropha curcas]
Length=561

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/541 (77%), Positives = 463/541 (86%), Gaps = 19/541 (4%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ +K +D+LE  IVK+M D S+PLHYL+GNFAP PE  PP KDLPV GHLPECL
Sbjct  20    PKPNKGLTSKLVDYLEKLIVKLMFDKSQPLHYLNGNFAPVPE-APPVKDLPVIGHLPECL  78

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYV R+V+TSRLKQEEFFG AK
Sbjct  79    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVRRYVETSRLKQEEFFGGAK  138

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGLLTVY+QMLR KLKVLD SYG GTANTALIYH  KLLAL E DKPY +
Sbjct  139   FMKIGDLKGFFGLLTVYMQMLRAKLKVLDMSYGYGTANTALIYHHRKLLALSEADKPYVV  198

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDLQT+G+LDYDKRL H+FTAHPKVDP TGEMFTFGYA + P+VTYRVISKDG+M
Sbjct  199   KVMEDGDLQTVGLLDYDKRLKHSFTAHPKVDPFTGEMFTFGYAHEPPYVTYRVISKDGVM  258

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPL+F+PKEMV +K+L + FDATKK+RFGVLP
Sbjct  259   HDPVPITISDPIMMHDFAITENYAIFMDLPLFFRPKEMVKEKKLIFTFDATKKSRFGVLP  318

Query  919   RYAKNELLIKWFELPNCFIFHT-----------------ANAWEEGDEVVMISCRIQNPD  791
             RYAK++  I+WFELPNC IFH                  ANAWEEGDEVV+I+CR+QNPD
Sbjct  319   RYAKDDRQIRWFELPNCMIFHNAHPSRCIGSDLFTNFLLANAWEEGDEVVLITCRLQNPD  378

Query  790   LDMASGTLKDSLD-FVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYA  614
             LDM SG +K+ L+ F NELYEMRFNMKTG ASQKKLS SAVDFPRVNE+YTGRKQRYVY 
Sbjct  379   LDMVSGNVKEKLENFTNELYEMRFNMKTGAASQKKLSTSAVDFPRVNESYTGRKQRYVYG  438

Query  613   TMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGC  434
             T+L  +AKV GI+KFDLHAEP+  K KLEVGGNV+GIFDLGPGRFGSEAIFVPRE  T  
Sbjct  439   TILDSIAKVTGIIKFDLHAEPQPEKQKLEVGGNVKGIFDLGPGRFGSEAIFVPREPGTSS  498

Query  433   EEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             EEDDGYLI FVHDE TGKS+ NVIDAKTMS++PVAVVELP+RVPYGFHAFFVTEEQLQ Q
Sbjct  499   EEDDGYLIFFVHDEKTGKSSANVIDAKTMSSDPVAVVELPHRVPYGFHAFFVTEEQLQEQ  558

Query  253   A  251
             A
Sbjct  559   A  559



>ref|XP_004306539.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Fragaria vesca subsp. vesca]
Length=557

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/526 (78%), Positives = 464/526 (88%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ +K +D +E  IVK+M+DSS+P HYL+GNFAP  EETPP KDL V GHLP+CL
Sbjct  32    PKPSKGLTSKLVDLVEKLIVKLMYDSSQPHHYLAGNFAPVIEETPPTKDLNVIGHLPDCL  91

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  92    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  151

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +Q LR KLKV+D SYG+GT+NTALIYH G+LLAL EGDKPY +
Sbjct  152   FMKIGDLKGLFGLLMVNMQQLRAKLKVVDLSYGHGTSNTALIYHHGRLLALSEGDKPYVL  211

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRV+SKDG M
Sbjct  212   KVLEDGDLQTVGLLDYDKRLKHSFTAHPKVDPFTGEMFTFGYSHDPPYITYRVVSKDGFM  271

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+PA +MMHDFAITENYAIFMDLPLYF+PKEMV + +L + FD TKKARFGVLP
Sbjct  272   HDPVPITVPAPIMMHDFAITENYAIFMDLPLYFRPKEMVKEGKLIFSFDETKKARFGVLP  331

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++LLI+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM +G +K  LD F N
Sbjct  332   RYAKDDLLIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVNGPIKKKLDTFKN  391

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLA+QKKLSESAVDFPRVNE+YTGRKQR+VY T L  +AKV GIVKFDL
Sbjct  392   ELYEMRFNLKTGLATQKKLSESAVDFPRVNESYTGRKQRFVYGTTLDSIAKVTGIVKFDL  451

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HA PE GKT + VGGNV+G++DLGPGRFGSEAIFVPR      EEDDGYLI FVHDENTG
Sbjct  452   HAAPEVGKTNIVVGGNVQGLYDLGPGRFGSEAIFVPRVPGITSEEDDGYLIFFVHDENTG  511

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSA++V+DAKTMS +PVAVVELP+RVPYGFHAFFVTEEQLQ QA +
Sbjct  512   KSAIHVLDAKTMSNDPVAVVELPHRVPYGFHAFFVTEEQLQEQANL  557



>ref|XP_010512783.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Camelina 
sativa]
Length=538

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/526 (78%), Positives = 462/526 (88%), Gaps = 4/526 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G ++K +D +E  +VK+MHD++ PLHYLSGNFAP  +ETPP KDLPV G LPEC+
Sbjct  16    PKPSKGFSSKLVDLIEGLVVKLMHDAAIPLHYLSGNFAPVRDETPPVKDLPVHGFLPECM  75

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRL+QEE+FG +K
Sbjct  76    NGEFVRVGPNPKFDPVAGYHWFDGDGMIHGVRIKDGKATYVSRYVKTSRLQQEEYFGASK  135

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGLL V +Q LR KL +LDNSYG GTANTAL+YHDGKLLAL E DKPY +
Sbjct  136   FMKIGDLKGFFGLLMVNMQQLRTKLNILDNSYGIGTANTALVYHDGKLLALQEADKPYVV  195

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGM+DYDKRL H+FTAHPKVDPVTGEMFTFGY+   P++TYRVISKDG+M
Sbjct  196   KVLEDGDLQTLGMIDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHTPPYLTYRVISKDGIM  255

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITE YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVLP
Sbjct  256   HDPVPITISEPIMMHDFAITEAYAIFMDLPMHFRPKEMVKEKKMIYSFDPTKKARFGVLP  315

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SGT+K+ L +F N
Sbjct  316   RYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGTVKEKLENFSN  375

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS SAVDFPR+NE YTG+KQRYVY T+L  +AKV GI+KFDL
Sbjct  376   ELYEMRFNMKTGSASQKKLSASAVDFPRINECYTGKKQRYVYGTILDSIAKVTGIIKFDL  435

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAE ETGK  LEVGGN++GI+DLG GR+GSEAI+VPREA+   EEDDGYLI FVHDENTG
Sbjct  436   HAEAETGKRMLEVGGNIKGIYDLGQGRYGSEAIYVPREAA---EEDDGYLIFFVHDENTG  492

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS VNVIDAKTMSAEPVAVVELP+RVPYGFHA FVTEEQLQ Q  I
Sbjct  493   KSCVNVIDAKTMSAEPVAVVELPHRVPYGFHALFVTEEQLQEQTLI  538



>gb|AFV15390.1| carotenoid cleavage dioxygenase 1 [Tanacetum cinerariifolium]
Length=539

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/525 (78%), Positives = 462/525 (88%), Gaps = 2/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G  +KA+DW+E  +VK+M+DSS+P H+L GNFAP  +ETPPC DL V GHLP+CL
Sbjct  15    PKPNKGFTSKAVDWVEKVLVKLMYDSSQPHHWLFGNFAPV-DETPPCTDLDVIGHLPDCL  73

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIK GKATY+SR+VKTSRL+QEE+FG AK
Sbjct  74    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKYGKATYLSRYVKTSRLEQEEYFGGAK  133

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL+ V++QMLR KLKVLD +YG GT NTALIYH GKLLAL EGDKPYAI
Sbjct  134   FMKIGDLKGFFGLVMVHMQMLRTKLKVLDLTYGQGTGNTALIYHHGKLLALSEGDKPYAI  193

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG++DYDKRL H FTAHPK+DPVTGEMF FGYAQ  P+VTYRVISKDG+M
Sbjct  194   KVLEDGDLQTLGLMDYDKRLSHTFTAHPKIDPVTGEMFAFGYAQAPPYVTYRVISKDGVM  253

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENYAIFMDLPLYF+PK+MV +K+L + FDATKKARFG+LP
Sbjct  254   SDPVPITIPESVMMHDFAITENYAIFMDLPLYFRPKDMVKEKKLIFTFDATKKARFGILP  313

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNEL IKWFELPNCFIFH ANAWEEGDEVV+I+CR+QNP+LD   G +++   +F N
Sbjct  314   RYAKNELQIKWFELPNCFIFHNANAWEEGDEVVLITCRLQNPNLDKVGGGVEEKRENFSN  373

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNM+TGLA+QKKLSESAVDFPRVNE YTGRKQR+VYAT L  +AKV GIVKFDL
Sbjct  374   ELYEMRFNMETGLATQKKLSESAVDFPRVNEYYTGRKQRFVYATRLDSIAKVTGIVKFDL  433

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK K+EVGGNV+GI+DLGPGR+GSEAIFVP++     EEDDGYLI F HDENTG
Sbjct  434   HAEPEAGKEKIEVGGNVQGIYDLGPGRYGSEAIFVPKQPGVDSEEDDGYLIFFTHDENTG  493

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS V VIDAKTMS +PVAVV LP+RVPYGFHAFFVTEEQ+Q QA+
Sbjct  494   KSTVTVIDAKTMSPDPVAVVPLPHRVPYGFHAFFVTEEQIQEQAK  538



>ref|XP_008231253.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Prunus 
mume]
Length=547

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/526 (77%), Positives = 465/526 (88%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G A+K +D +E  IVK+M+D S+P HYL+GNFAP  +ETPP  +LPV G LPECL
Sbjct  22    PKPNKGFASKVVDLIENLIVKLMYDPSQPHHYLAGNFAPVLDETPPTNNLPVIGSLPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIKDGKA YVSR+V+TSRLKQEE+FG AK
Sbjct  82    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKDGKAMYVSRYVRTSRLKQEEYFGGAK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG+FGLL V +Q+LR KLKVLD SYGNGT NTALIYH GKLLAL E DKPY +
Sbjct  142   FMKVGDLKGLFGLLMVNMQILRAKLKVLDMSYGNGTGNTALIYHHGKLLALSEADKPYVL  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  202   KVLEDGDLQTVGLLDYDKRLTHSFTAHPKVDPFTGEMFTFGYSHSPPYITYRVISKDGFM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDP+PIT+ A +MMHDFAITENYAIFMDLPLYF+PKEMV +K+L + FD TKK+RFGVLP
Sbjct  262   HDPIPITVAAPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKLIFTFDPTKKSRFGVLP  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++LLI+WFELPNCFIFH ANAWEE DE+V+I+CR++NPDLDM +G +K+ L +F N
Sbjct  322   RYAKDDLLIRWFELPNCFIFHNANAWEEEDEIVLITCRLENPDLDMVNGPVKEKLENFKN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLASQKKLSESAVDFPRVNE+YTGRKQRYVY T+L  +AKV G+VKFDL
Sbjct  382   ELYEMRFNLKTGLASQKKLSESAVDFPRVNESYTGRKQRYVYGTLLDSIAKVTGVVKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HA PE GKTK+EVGGNV+G++DLGPGRFGSEAIFVPR      EEDDGYLI FVHDE TG
Sbjct  442   HAAPELGKTKIEVGGNVQGLYDLGPGRFGSEAIFVPRVPGVTSEEDDGYLIFFVHDEKTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+++VIDAKTMS++PVAVVELP+RVPYGFHAFFVTEEQLQ QA++
Sbjct  502   KSSIHVIDAKTMSSDPVAVVELPHRVPYGFHAFFVTEEQLQEQAKL  547



>ref|XP_002298429.2| hypothetical protein POPTR_0001s27260g [Populus trichocarpa]
 gb|EEE83234.2| hypothetical protein POPTR_0001s27260g [Populus trichocarpa]
Length=545

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/526 (78%), Positives = 461/526 (88%), Gaps = 7/526 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+ +K ID+LE  IV +MHD+S+  HYLSGNFAP  +ET P KDLP      EC+
Sbjct  26    PEPQKGLTSKLIDYLEKLIVNLMHDTSQSHHYLSGNFAPVLDETAPVKDLP------ECM  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHG+RIKDGKA YV RFV+TSRLKQEEFFG AK
Sbjct  80    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGMRIKDGKAAYVRRFVRTSRLKQEEFFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +Q+LR+K KVLDNSYG GT NT LIYH+GKLLAL E DKPY +
Sbjct  140   FMKIGDLKGLFGLLMVNMQILRLKSKVLDNSYGIGTGNTNLIYHNGKLLALQEADKPYVV  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDLQTLG+LDYDKRL H+FTAHPKVDP TGEMFTFGY+ + P+VTYRVISKDG+M
Sbjct  200   KVMEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTGEMFTFGYSHEPPYVTYRVISKDGVM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYA+F+DLPLYF+PKEMV  K+  + FDATKKARFGVLP
Sbjct  260   HDPVPITISDPIMMHDFAITENYAVFLDLPLYFRPKEMVKDKKFIFTFDATKKARFGVLP  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++LLIKWFELPNCFIFH ANAWEE DE+V+I+CR+QNPDLDM +G +K+ L +F N
Sbjct  320   RYAKDDLLIKWFELPNCFIFHNANAWEEEDEIVLITCRLQNPDLDMVNGAVKEKLENFTN  379

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+ASQKKLSESAVDFPRVNE+YTGRKQRYVY T+L  +AKV GIVKFDL
Sbjct  380   ELYEMRFNMKTGVASQKKLSESAVDFPRVNESYTGRKQRYVYGTLLDSIAKVTGIVKFDL  439

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             H+EPE GK K+EVGGNV+GIFDLGPGRFGSEAIF+PRE  T  EEDDGYLI F HDENTG
Sbjct  440   HSEPEPGKGKIEVGGNVKGIFDLGPGRFGSEAIFIPREPGTTSEEDDGYLIFFAHDENTG  499

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMSA PVAVVELP+RVPYGFHAFFV+EEQLQ Q ++
Sbjct  500   KSSVNVIDAKTMSANPVAVVELPHRVPYGFHAFFVSEEQLQEQEKL  545



>ref|XP_010067867.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Eucalyptus grandis]
 gb|KCW66100.1| hypothetical protein EUGRSUZ_G03374 [Eucalyptus grandis]
Length=553

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/526 (77%), Positives = 460/526 (87%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             PTP+ G+ +K +D++E  IVK M+DSS+P  YL+GNFAP  +ETPP  DLPV GHLP+CL
Sbjct  28    PTPKKGVTSKVVDYIEKLIVKFMYDSSRPHQYLAGNFAPVADETPPVTDLPVVGHLPDCL  87

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIK+GKATYVSR+V+TS+LKQEE++G AK
Sbjct  88    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKNGKATYVSRYVRTSKLKQEEYYGGAK  147

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +
Sbjct  148   FMKIGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVYHHGKLLALSEADKPYVL  207

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  208   KVLEDGDLQTLGMLDYDKRLSHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  267

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV   +L + FD TKK+RFGVLP
Sbjct  268   HDPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKDNKLIFTFDKTKKSRFGVLP  327

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNEL I+WFELPNCFIFH ANAWEE DEVV+++CR++N DLDM SGT+K+ L +F N
Sbjct  328   RYAKNELQIRWFELPNCFIFHNANAWEEEDEVVLVTCRLENLDLDMVSGTVKEHLENFGN  387

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQKKLS  +VDFPR+NE YTGRKQRYVY T+L  +AKV GIVKFDL
Sbjct  388   ELYEMRFNMKTGLASQKKLSAPSVDFPRINECYTGRKQRYVYGTILDSIAKVTGIVKFDL  447

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK K+EVGGNV G+FDLGPGRFGSEA+FVPRE     EEDDGYLI FVHDE+TG
Sbjct  448   HAEPEEGKKKIEVGGNVAGVFDLGPGRFGSEAVFVPREPGITSEEDDGYLIFFVHDESTG  507

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAK MS++PVAVVELP+RVPYGFHAFFVTEEQLQ  A++
Sbjct  508   KSAVNVIDAKNMSSDPVAVVELPHRVPYGFHAFFVTEEQLQELAKL  553



>emb|CAR57918.1| carotenoid cleavage dioxygenase 1 [Medicago truncatula]
 gb|KEH19093.1| carotenoid cleavage dioxygenase [Medicago truncatula]
Length=540

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/526 (78%), Positives = 460/526 (87%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  +KA+D LE  IVK+ +DSS P H+L+GNFAP  +ETPP KDLP+ GHLP+CL
Sbjct  15    PKPSNGFTSKAVDLLEKIIVKLFYDSSLPHHWLAGNFAPVKDETPPIKDLPIKGHLPDCL  74

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPN KFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEE+FG +K
Sbjct  75    NGEFVRVGPNSKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEYFGGSK  134

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGD+KG+FGLL V +QMLR KLKV+D SYG+GTANTAL+YH  KLLAL EGDKPYAI
Sbjct  135   FMKIGDMKGLFGLLMVNMQMLRAKLKVVDVSYGHGTANTALVYHHQKLLALSEGDKPYAI  194

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLGMLDYDKRLGH FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  195   KVFEDGDLQTLGMLDYDKRLGHNFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  254

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENY+IFMDLPLYF+PKEMV  K L + FD+TKKARFGVLP
Sbjct  255   HDPVPITISEPIMMHDFAITENYSIFMDLPLYFRPKEMVKNKTLIFSFDSTKKARFGVLP  314

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK+E  I+WFELPNCFIFH ANAWEE DE+V+I+CR++NP+LDM  G +K+ LD F N
Sbjct  315   RYAKDEKHIRWFELPNCFIFHNANAWEEEDEIVLITCRLENPNLDMVGGAVKEKLDNFAN  374

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS SAVDFPRVNE+YTGRKQRYVY T L  +AKV GIVKFDL
Sbjct  375   ELYEMRFNMKTGEASQKKLSASAVDFPRVNESYTGRKQRYVYGTELDSIAKVTGIVKFDL  434

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HA+P++GKTKLEVGGNV G +DLGPGRFGSEA++VPR   T  EEDDGYLI FVHDENTG
Sbjct  435   HAKPDSGKTKLEVGGNVVGHYDLGPGRFGSEAVYVPRVPGTDSEEDDGYLIFFVHDENTG  494

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V+V+DAKTMSA+PVAVVELP RVPYGFHAFFVTEEQLQ QA++
Sbjct  495   KSFVHVLDAKTMSADPVAVVELPQRVPYGFHAFFVTEEQLQEQAKL  540



>ref|XP_010413131.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Camelina sativa]
Length=538

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/526 (77%), Positives = 461/526 (88%), Gaps = 4/526 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G ++K +D +E  +VK+MHD++ PLHYLSGNFAP  +ETPP KDLPV G LPEC+
Sbjct  16    PKPSKGFSSKLVDLIEGLVVKLMHDAAIPLHYLSGNFAPVRDETPPVKDLPVHGFLPECM  75

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRL+QEE+FG +K
Sbjct  76    NGEFVRVGPNPKFDPVAGYHWFDGDGMIHGVRIKDGKATYVSRYVKTSRLQQEEYFGASK  135

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGLL V +Q LR KL +LDNSYG GTANTAL+YHDGKLLAL E DKPY +
Sbjct  136   FMKIGDLKGFFGLLMVNMQQLRTKLNILDNSYGIGTANTALVYHDGKLLALQEADKPYVV  195

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGM+DYDKRL H+FTAHPKVDPVTGEMFTFGY+   P++TYRVISKDG+M
Sbjct  196   KVLEDGDLQTLGMIDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHTPPYLTYRVISKDGIM  255

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPV ITI   +MMHDFAITE YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVLP
Sbjct  256   HDPVAITISEPIMMHDFAITEAYAIFMDLPMHFRPKEMVKEKKMIYSFDPTKKARFGVLP  315

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SGT+K+ L +F N
Sbjct  316   RYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGTVKEKLENFSN  375

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS SAVDFPR+NE YTG+KQRYVY T+L  +AKV GI+KFDL
Sbjct  376   ELYEMRFNMKTGSASQKKLSASAVDFPRINECYTGKKQRYVYGTILDSIAKVTGIIKFDL  435

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAE ETGK  LEVGGN++GI+DLG G+FGSEAI+VPREA+   EEDDGYLI FVHDENTG
Sbjct  436   HAEAETGKRMLEVGGNIKGIYDLGQGKFGSEAIYVPREAA---EEDDGYLIFFVHDENTG  492

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS VNVIDAKTMSAEPVAVVELP+RVPYGFHA FVTEEQLQ Q  I
Sbjct  493   KSCVNVIDAKTMSAEPVAVVELPHRVPYGFHALFVTEEQLQEQTLI  538



>ref|XP_008801952.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase [Phoenix 
dactylifera]
Length=547

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/524 (79%), Positives = 455/524 (87%), Gaps = 2/524 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+ +KA+D +E AIV +MHDSSKPLHYLSGNFAP  +ETPPC DLPV G LPECL
Sbjct  23    PKPRKGLVSKAVDLIERAIVYLMHDSSKPLHYLSGNFAPVRDETPPCSDLPVRGSLPECL  82

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIHG+ IKDGKATYVSR+VKTSRLKQEEFFG AK
Sbjct  83    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHGMHIKDGKATYVSRYVKTSRLKQEEFFGGAK  142

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL  V +Q+LR KLKVLD SYG GT NTALIYH GKLLAL E DKPY +
Sbjct  143   FMKIGDLKGLFGLFMVQMQLLRAKLKVLDVSYGTGTGNTALIYHHGKLLALSEADKPYVV  202

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H FTAHPKVDP T EMFTFGY+   P+ TYRVISK G+M
Sbjct  203   KVLEDGDLQTLGMLDYDKRLAHPFTAHPKVDPFTDEMFTFGYSHTPPYCTYRVISKGGVM  262

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITI   VMMHDFAITENYAIFMDLPL+F+PKEMV K QL + FD TKKARFGVLP
Sbjct  263   LDPVPITISDPVMMHDFAITENYAIFMDLPLFFRPKEMV-KGQLIFTFDTTKKARFGVLP  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++  I+WFELPNCFIFH ANAWEEGDEVV+I+CR++NPDLDM +G +KD L +F N
Sbjct  322   RYAKDDHHIRWFELPNCFIFHNANAWEEGDEVVLITCRLENPDLDMINGIMKDQLENFKN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK G ASQK+LS SAVDFPR+NE+YTGRKQRYVY T+L ++ KVKGI+KFDL
Sbjct  382   ELYEMRFNMKNGAASQKQLSVSAVDFPRINESYTGRKQRYVYGTILDNITKVKGIIKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK KLEVGGNV+GIF+LGP R+GSEAIFVPR+     EEDDGYLI FVHDENTG
Sbjct  442   HAEPEPGKKKLEVGGNVKGIFELGPARYGSEAIFVPRQPGITSEEDDGYLIFFVHDENTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             KS VNVIDAKTMSA+PVAVVELPNRVPYGFHAFFVTEE+LQ Q 
Sbjct  502   KSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTEERLQRQV  545



>ref|NP_191911.1| carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Arabidopsis thaliana]
 sp|O65572.2|CCD1_ARATH RecName: Full=Carotenoid 9,10(9',10')-cleavage dioxygenase 1; 
AltName: Full=AtCCD1; AltName: Full=Neoxanthin cleavage enzyme 
NC1; Short=AtNCED1 [Arabidopsis thaliana]
 emb|CAB87805.1| neoxanthin cleavage enzyme nc1 [Arabidopsis thaliana]
 gb|AEE80498.1| carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Arabidopsis thaliana]
Length=538

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/526 (78%), Positives = 459/526 (87%), Gaps = 4/526 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G ++K +D LE  +VK+MHD+S PLHYLSGNFAP  +ETPP KDLPV G LPECL
Sbjct  16    PRPSKGFSSKLLDLLERLVVKLMHDASLPLHYLSGNFAPIRDETPPVKDLPVHGFLPECL  75

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF  VAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEEFFG AK
Sbjct  76    NGEFVRVGPNPKFDAVAGYHWFDGDGMIHGVRIKDGKATYVSRYVKTSRLKQEEFFGAAK  135

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGLL V +Q LR KLK+LDN+YGNGTANTAL+YH GKLLAL E DKPY I
Sbjct  136   FMKIGDLKGFFGLLMVNVQQLRTKLKILDNTYGNGTANTALVYHHGKLLALQEADKPYVI  195

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG++DYDKRL H+FTAHPKVDPVTGEMFTFGY+   P++TYRVISKDG+M
Sbjct  196   KVLEDGDLQTLGIIDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHTPPYLTYRVISKDGIM  255

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITE YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVLP
Sbjct  256   HDPVPITISEPIMMHDFAITETYAIFMDLPMHFRPKEMVKEKKMIYSFDPTKKARFGVLP  315

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SG +K+ L +F N
Sbjct  316   RYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGKVKEKLENFGN  375

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS SAVDFPR+NE YTG+KQRYVY T+L  +AKV GI+KFDL
Sbjct  376   ELYEMRFNMKTGSASQKKLSASAVDFPRINECYTGKKQRYVYGTILDSIAKVTGIIKFDL  435

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAE ETGK  LEVGGN++GI+DLG GR+GSEAI+VPRE +   EEDDGYLI FVHDENTG
Sbjct  436   HAEAETGKRMLEVGGNIKGIYDLGEGRYGSEAIYVPRETA---EEDDGYLIFFVHDENTG  492

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V VIDAKTMSAEPVAVVELP+RVPYGFHA FVTEEQLQ Q  I
Sbjct  493   KSCVTVIDAKTMSAEPVAVVELPHRVPYGFHALFVTEEQLQEQTLI  538



>emb|CAA06712.1| carotenoid cleavage dioxygenase 1 [Arabidopsis thaliana]
Length=538

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/526 (78%), Positives = 459/526 (87%), Gaps = 4/526 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G ++K +D LE  +VK+MHD+S PLHYLSGNFAP  +ETPP KDLPV G LPECL
Sbjct  16    PRPSKGFSSKLLDLLERLVVKLMHDASLPLHYLSGNFAPIRDETPPVKDLPVHGFLPECL  75

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF  VAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEEFFG AK
Sbjct  76    NGEFVRVGPNPKFDAVAGYHWFDGDGMIHGVRIKDGKATYVSRYVKTSRLKQEEFFGAAK  135

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGLL V +Q LR KLK+LDN+YGNGTANTAL+YH GKLLAL E DKPY I
Sbjct  136   FMKIGDLKGFFGLLMVNIQQLRTKLKILDNTYGNGTANTALVYHHGKLLALQEADKPYVI  195

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG++DYDKRL H+FTAHPKVDPVTGEMFTFGY+   P++TYRVISKDG+M
Sbjct  196   KVLEDGDLQTLGIIDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHTPPYLTYRVISKDGIM  255

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITE YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVLP
Sbjct  256   HDPVPITISEPIMMHDFAITETYAIFMDLPMHFRPKEMVKEKKMIYSFDPTKKARFGVLP  315

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SG +K+ L +F N
Sbjct  316   RYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGKVKEKLENFGN  375

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS SAVDFPR+NE YTG+KQRYVY T+L  +AKV GI+KFDL
Sbjct  376   ELYEMRFNMKTGSASQKKLSASAVDFPRINECYTGKKQRYVYGTILDSIAKVTGIIKFDL  435

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAE ETGK  LEVGGN++GI+DLG GR+GSEAI+VPRE +   EEDDGYLI FVHDENTG
Sbjct  436   HAEAETGKRMLEVGGNIKGIYDLGEGRYGSEAIYVPRETA---EEDDGYLIFFVHDENTG  492

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V VIDAKTMSAEPVAVVELP+RVPYGFHA FVTEEQLQ Q  I
Sbjct  493   KSCVTVIDAKTMSAEPVAVVELPHRVPYGFHALFVTEEQLQEQTLI  538



>dbj|BAE92957.1| carotenoid cleavage dioxygenase1 [Citrus unshiu]
 dbj|BAE92959.1| carotenoid cleavage dioxygenase1 [Citrus limon]
Length=523

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/513 (80%), Positives = 453/513 (88%), Gaps = 1/513 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P++G+ +K ID++E  IVK M+DSS+PLHYLSGNFAP P+ETPP KDL V GHLP+CL
Sbjct  11    PKPKNGVTSKVIDFVEKLIVKWMYDSSQPLHYLSGNFAPVPDETPPTKDLHVIGHLPDCL  70

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  71    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAK  130

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KLKVLD SYGNGTANTAL+YH GKLLAL E DKPYA+
Sbjct  131   FMKIGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAV  190

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGYA   P++TYRVISKDG M
Sbjct  191   KVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGYAHTPPYITYRVISKDGFM  250

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+   +MMHDFAITENYAIFMDLPLYF+PKEMV + +L + FD TKKARFG+LP
Sbjct  251   HDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVKENKLIFTFDDTKKARFGILP  310

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAKNE  +KWFELPNCFIFH ANAWEE DEVV+I+CR+  PDLDM +G +K+ L+ F N
Sbjct  311   RYAKNEAQMKWFELPNCFIFHNANAWEEEDEVVLITCRLDKPDLDMVNGAVKEKLENFSN  370

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLASQK+LS SAVDFPRVNE YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  371   ELYEMRFNLKTGLASQKRLSASAVDFPRVNECYTGRKQRYVYGTILDSIAKVTGIIKFDL  430

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+  KTKLEVGGNV GIFDLGPGRFGSEA+FVPRE  T  EEDDGYLI F HDE TG
Sbjct  431   HAEPDEEKTKLEVGGNVRGIFDLGPGRFGSEAVFVPREPGTSSEEDDGYLIFFSHDEKTG  490

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAF  284
             KS+VNVIDAKTMSA+PVAVVELP RVPYGFHAF
Sbjct  491   KSSVNVIDAKTMSADPVAVVELPQRVPYGFHAF  523



>ref|XP_007220659.1| hypothetical protein PRUPE_ppa003814mg [Prunus persica]
 gb|EMJ21858.1| hypothetical protein PRUPE_ppa003814mg [Prunus persica]
Length=547

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/526 (77%), Positives = 464/526 (88%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G A+K +D +E  IVK+M+D S+P HYL+GNFAP  +ETPP  +LPV G LPECL
Sbjct  22    PKPNKGFASKVVDLIENLIVKLMYDPSQPHHYLAGNFAPVLDETPPTNNLPVIGSLPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIKDGKATYVSR+V+TSRLKQEE+FG AK
Sbjct  82    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKDGKATYVSRYVRTSRLKQEEYFGGAK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FM+IGDLKG+FGLL V +Q+LR KLKVLD SYGNGT NTALIYH GKLLAL E DKPY +
Sbjct  142   FMRIGDLKGLFGLLMVNMQILRAKLKVLDMSYGNGTGNTALIYHHGKLLALSEADKPYVL  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  202   KVLEDGDLQTVGLLDYDKRLTHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDP+PIT+   +MMHDFAITENYAIFMDLPLYF+PKEMV +K+L + FD TKKARFGVLP
Sbjct  262   HDPIPITVADPIMMHDFAITENYAIFMDLPLYFRPKEMVKEKKLIFTFDPTKKARFGVLP  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+ELLI+WFELPNC+IFH ANAWEE DE+V+I+CR++N DLDM +G +K+ L +F N
Sbjct  322   RYAKDELLIRWFELPNCYIFHNANAWEEEDEIVLITCRLENLDLDMVNGPVKEKLENFKN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLASQKKLSESAVDFPRVNE+YTGRKQRYVY T+L  +AKV G+VKFDL
Sbjct  382   ELYEMRFNLKTGLASQKKLSESAVDFPRVNESYTGRKQRYVYGTLLDSIAKVTGVVKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HA PE GKTK+EVGGNV+G++DLGPGRFGSEAIFVPR      EEDDGYLI FVHDE TG
Sbjct  442   HAAPELGKTKIEVGGNVQGLYDLGPGRFGSEAIFVPRVPGVTSEEDDGYLIFFVHDEKTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+++VIDAKTMS++PVAVVELP+RVPYGFHAFFVTEEQLQ QA++
Sbjct  502   KSSIHVIDAKTMSSDPVAVVELPHRVPYGFHAFFVTEEQLQEQAKL  547



>ref|XP_002298430.2| carotenoid 9 family protein [Populus trichocarpa]
 gb|ABK95260.1| unknown [Populus trichocarpa]
 gb|EEE83235.2| carotenoid 9 family protein [Populus trichocarpa]
Length=545

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/526 (77%), Positives = 463/526 (88%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+ +K +D+LE  I+K+MHD+S+   YLSGNFAP  EET P KDLPV GHLPEC+
Sbjct  21    PKPQKGLTSKLVDYLEKLIMKLMHDTSQSHPYLSGNFAPV-EETAPVKDLPVEGHLPECM  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHG+RIKDGKA YVSRFV+TSRLKQEEFFG AK
Sbjct  80    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGMRIKDGKAAYVSRFVRTSRLKQEEFFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +Q+LR+K KVLDNSYG GT NT LIYH+GKLLAL E DKPY +
Sbjct  140   FMKIGDLKGLFGLLMVNIQILRLKTKVLDNSYGIGTGNTNLIYHNGKLLALQEADKPYVV  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDLQTLG+LDYDKRL H FTAHPKVDP TGEMFTFGY+ + P+VTYRVISKDG M
Sbjct  200   KVMEDGDLQTLGLLDYDKRLKHPFTAHPKVDPFTGEMFTFGYSHEPPYVTYRVISKDGAM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYA+F+DLPLYF+PKEMV  K+  + FDATKKARFGVLP
Sbjct  260   HDPVPITISDPIMMHDFAITENYAVFLDLPLYFRPKEMVKDKKFVFTFDATKKARFGVLP  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++LLIKWFELPNCFIFH ANAWEE DE+V+I+CR+Q+P  D+A+  +K+   +FV+
Sbjct  320   RYAKDDLLIKWFELPNCFIFHNANAWEEEDEIVLITCRLQDPGFDVANWAVKEKQENFVD  379

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+ASQKKLSESAVDFPRVNE+YTGRKQRYVY T+L  +AKV GIVKFDL
Sbjct  380   ELYEMRFNMKTGVASQKKLSESAVDFPRVNESYTGRKQRYVYGTLLDSIAKVTGIVKFDL  439

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             H+EPE GK K+EVGGNV+GIFDLGPGRFGSEA+F+PRE  T  EEDDGYL+ F HDENTG
Sbjct  440   HSEPEPGKGKIEVGGNVKGIFDLGPGRFGSEAVFIPRELGTTSEEDDGYLMFFAHDENTG  499

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMSA PVAVVELP+RVPYGFHAFFV+EEQLQ Q ++
Sbjct  500   KSSVNVIDAKTMSANPVAVVELPHRVPYGFHAFFVSEEQLQEQEKL  545



>sp|Q8LP17.1|CCD1_PEA RecName: Full=Carotenoid 9,10(9',10')-cleavage dioxygenase 1; 
AltName: Full=PsCCD1; AltName: Full=PsNCED1 [Pisum sativum]
 dbj|BAC10549.1| nine-cis-epoxycarotenoid dioxygenase1 [Pisum sativum]
Length=541

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/526 (78%), Positives = 457/526 (87%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  +KA+D LE  IVK+ +DSS P H+LSGNFAP  +ETPP KDL V GHLP+CL
Sbjct  16    PKPSNGFTSKAVDLLEKIIVKLFYDSSLPHHWLSGNFAPVKDETPPVKDLTVQGHLPDCL  75

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKA+YVSRFVKTSR KQEE+F  +K
Sbjct  76    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKASYVSRFVKTSRFKQEEYFNGSK  135

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KLK+LD SYG+GTANTAL+YH  KLLAL EGDKPYAI
Sbjct  136   FMKIGDLKGLFGLLMVNMQMLRAKLKILDVSYGHGTANTALVYHHQKLLALSEGDKPYAI  195

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLGMLDYDKRLGH FTAHPKVDP TGEMFTFGY+  AP+VTYRVISKDG M
Sbjct  196   KVFEDGDLQTLGMLDYDKRLGHNFTAHPKVDPFTGEMFTFGYSHTAPYVTYRVISKDGFM  255

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITI   VMMHDFAITENY+IFMDLPLYF+PKEMV  K L + FD+TKKARFGVLP
Sbjct  256   QDPVPITISDPVMMHDFAITENYSIFMDLPLYFRPKEMVKNKTLIFSFDSTKKARFGVLP  315

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++  I+WFELPNCFIFH ANAWEE DE+V+I+CR++NP+LD+  G +K+ LD F N
Sbjct  316   RYAKDDKHIRWFELPNCFIFHNANAWEEEDEIVLITCRLENPNLDVVGGAVKEKLDNFSN  375

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS S VDFPRVNE+YTGRKQRYVY T L  +AKV GI+KFDL
Sbjct  376   ELYEMRFNMKTGEASQKKLSASTVDFPRVNESYTGRKQRYVYGTTLDSIAKVTGIIKFDL  435

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP++GKTKLEVGGNV+G++DLGPGRFGSEA++VPR   T  EEDDGYLI FVHDENTG
Sbjct  436   HAEPDSGKTKLEVGGNVQGLYDLGPGRFGSEAVYVPRVPGTDSEEDDGYLIFFVHDENTG  495

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V+VIDAK MSAEPVAVVELP RVPYGFHAFFVTE+QLQ QA+ 
Sbjct  496   KSFVHVIDAKRMSAEPVAVVELPQRVPYGFHAFFVTEDQLQEQAKF  541



>dbj|BAE92958.1| carotenoid cleavage dioxygenase1 [Citrus sinensis]
Length=523

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/513 (80%), Positives = 452/513 (88%), Gaps = 1/513 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P++G+ +K ID++E  IVK M+DSS+PLHYLSGNFAP P+ETPP KDL V GHLP+CL
Sbjct  11    PKPKNGVTSKVIDFVEKLIVKWMYDSSQPLHYLSGNFAPVPDETPPTKDLHVIGHLPDCL  70

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  71    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAK  130

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KLKVLD SYGNGTANTAL+YH GKLLAL E DKPYA+
Sbjct  131   FMKIGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAV  190

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGYA   P++TYRVISKDG M
Sbjct  191   KVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGYAHTPPYITYRVISKDGFM  250

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+   +MMHDFAITENYAIFMDLPLYF+PKEMV + +L + FD TKKARFG+LP
Sbjct  251   HDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVKENKLIFTFDDTKKARFGILP  310

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAKNE  +KWFELPNCFIFH ANAWEE DEVV+I+CR+  PDLDM +G +K+ L+ F N
Sbjct  311   RYAKNEAQMKWFELPNCFIFHNANAWEEEDEVVLITCRLDKPDLDMVNGAVKEKLENFSN  370

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLASQK+LS SAVDFPRVNE YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  371   ELYEMRFNLKTGLASQKRLSASAVDFPRVNECYTGRKQRYVYGTILDSIAKVTGIIKFDL  430

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+  KTKLEVGGNV GIFDLGPGRFGSEA+FVPRE  T  EED GYLI F HDE TG
Sbjct  431   HAEPDEEKTKLEVGGNVRGIFDLGPGRFGSEAVFVPREPGTSSEEDVGYLIFFSHDEKTG  490

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAF  284
             KS+VNVIDAKTMSA+PVAVVELP RVPYGFHAF
Sbjct  491   KSSVNVIDAKTMSADPVAVVELPQRVPYGFHAF  523



>ref|XP_011047392.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Populus euphratica]
Length=546

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/526 (77%), Positives = 465/526 (88%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+ +K +D+LE  ++K+M D+S+P  YLSGNFAP  EET P KDLPV GHLPEC+
Sbjct  21    PKPQKGLTSKLVDYLEKLVMKLMRDTSEPHPYLSGNFAPVLEETAPVKDLPVEGHLPECM  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGY+WFDGDGMIHGLRIKDGKA YVSR+VKTSRLKQEEFFG AK
Sbjct  81    NGEFVRVGPNPKFAPVAGYNWFDGDGMIHGLRIKDGKAAYVSRYVKTSRLKQEEFFGGAK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK GDLKG+FGLL V +Q+LR+K KVLDNSYG GT NT LIYH+GKLLAL E DKPY +
Sbjct  141   FMKFGDLKGLFGLLMVNIQILRLKTKVLDNSYGIGTGNTNLIYHNGKLLALQEADKPYVV  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDLQTLG+LDYDKRL H FTAHPKVDP TGEMFTFGY+ + P+VTYRVISKDG+M
Sbjct  201   KVMEDGDLQTLGLLDYDKRLKHPFTAHPKVDPFTGEMFTFGYSHEPPYVTYRVISKDGVM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITEN+A+F+DLPLYF+PKEMV  ++  + FDATKKARFGVLP
Sbjct  261   HDPVPITISDPIMMHDFAITENHAVFLDLPLYFRPKEMVKDQKFIFTFDATKKARFGVLP  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++LLIKWFELPNCFIFH ANAWEE DE+V+I+CR+Q+P LD+A+GT+K+   +FV+
Sbjct  321   RYAKDDLLIKWFELPNCFIFHNANAWEEEDEIVLITCRLQDPGLDVANGTVKEKHENFVD  380

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+ASQKKLSESAVDFPRVNE+YTGRKQRYVY T+L+ +AKV GIVKFDL
Sbjct  381   ELYEMRFNMKTGVASQKKLSESAVDFPRVNESYTGRKQRYVYGTLLNSIAKVTGIVKFDL  440

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
              AEPE GK K+EVGGNV+GIFDLGPGRFGSEA+FVP +  T  EEDDGYLI F HDE+TG
Sbjct  441   QAEPEPGKEKIEVGGNVKGIFDLGPGRFGSEAVFVPHKPGTTSEEDDGYLIFFAHDESTG  500

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNV+DAKTMS  PVAVVELP+RVPYGFHAFFV+EEQLQ QAE+
Sbjct  501   KSSVNVVDAKTMSPNPVAVVELPHRVPYGFHAFFVSEEQLQEQAEL  546



>ref|XP_010552739.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 isoform 
X1 [Tarenaya hassleriana]
Length=508

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/502 (80%), Positives = 453/502 (90%), Gaps = 1/502 (0%)
 Frame = -3

Query  1753  MHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWF  1574
             MHD+S+PLHYLSGNFAP  EETPP KDLPV+GHLPECLNGEFVRVGPNPKF PVAGYHWF
Sbjct  1     MHDASQPLHYLSGNFAPVREETPPVKDLPVTGHLPECLNGEFVRVGPNPKFDPVAGYHWF  60

Query  1573  DGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLR  1394
             DGDGMIHG+RIKDGKATYVSR+VKTSRLKQE+FFG AKFMKIGD+KG+FGLL V +Q LR
Sbjct  61    DGDGMIHGVRIKDGKATYVSRYVKTSRLKQEQFFGGAKFMKIGDVKGLFGLLMVNMQQLR  120

Query  1393  IKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGH  1214
              KLK+LD+SYG GTANTALIYH GKLLAL E DKPY +KVLEDGDLQT+GM+DYDKRL H
Sbjct  121   TKLKILDDSYGIGTANTALIYHHGKLLALQEADKPYVVKVLEDGDLQTVGMMDYDKRLTH  180

Query  1213  AFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITEN  1034
             +FTAHPKVDPVTGEMFTFGY+ KAP++TYRVISKDG+MH+PVPITIP  +MMHDFAITEN
Sbjct  181   SFTAHPKVDPVTGEMFTFGYSHKAPYITYRVISKDGVMHNPVPITIPEPIMMHDFAITEN  240

Query  1033  YAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHT  854
             YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVLPRYAK+EL+I+WFELPNCFIFH 
Sbjct  241   YAIFMDLPMHFRPKEMVKEKKMIYSFDLTKKARFGVLPRYAKDELMIRWFELPNCFIFHN  300

Query  853   ANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVNELYEMRFNMKTGLASQKKLSES  677
             ANAWE+ DEVV+I+CR++NPDLDM SG +K+ L+ F NELYEMRFNM TG ASQ+KLS S
Sbjct  301   ANAWEDEDEVVLITCRLENPDLDMVSGNVKEKLENFGNELYEMRFNMATGAASQRKLSAS  360

Query  676   AVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFD  497
             AVDFPR+NE YTGRKQRYVY T+L  +AKV GI+KFDLHAEPE GKT+LEVGGN+ GI+D
Sbjct  361   AVDFPRINEWYTGRKQRYVYGTILDSIAKVTGIIKFDLHAEPEPGKTELEVGGNIIGIYD  420

Query  496   LGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVEL  317
             LGPGR+GSEAI+VP+E     EED GYLI FVHDE TGKS VNVIDAKTMSA+PVAVVEL
Sbjct  421   LGPGRYGSEAIYVPQETGCTAEEDGGYLIFFVHDERTGKSYVNVIDAKTMSADPVAVVEL  480

Query  316   PNRVPYGFHAFFVTEEQLQTQA  251
             P+RVPYGFHAFFVTEEQLQ QA
Sbjct  481   PHRVPYGFHAFFVTEEQLQEQA  502



>gb|ACA13522.1| dioxygenase [Fragaria x ananassa]
Length=553

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/543 (75%), Positives = 464/543 (85%), Gaps = 18/543 (3%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ +K +D +E  IVK+M+DSS+P HYL+GNF P  EETPP KDL V GHLP+CL
Sbjct  11    PKPSKGLTSKLVDLVEKLIVKLMYDSSQPHHYLAGNFTPVIEETPPTKDLNVIGHLPDCL  70

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  71    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  130

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +Q LR KLKV+D SYG+GT+NTALIYH GKLLAL EGDKPY +
Sbjct  131   FMKIGDLKGLFGLLMVNMQQLRAKLKVVDLSYGHGTSNTALIYHHGKLLALSEGDKPYVL  190

Query  1279  KVLEDGDLQTLGMLDYDKRLG-----------------HAFTAHPKVDPVTGEMFTFGYA  1151
             KVLEDGDLQT+G+LDYDKRL                  H+FTAHPKVDP TGEMFTFGY+
Sbjct  191   KVLEDGDLQTVGLLDYDKRLKVEKPHVTDDHDDVKQKLHSFTAHPKVDPFTGEMFTFGYS  250

Query  1150  QKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQ  971
                P+V YRV+SKDG MHDPVPIT+PA +MMHDFAITENYAIFMDLPLYF+PKEMV + +
Sbjct  251   HDPPYVMYRVVSKDGFMHDPVPITVPAPIMMHDFAITENYAIFMDLPLYFKPKEMVKEGK  310

Query  970   LAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPD  791
             L + FD TKKARFGVLPRYAK++LLI+WFELPNCFIFH ANAWEE DEVV+I+CR++NPD
Sbjct  311   LIFSFDETKKARFGVLPRYAKDDLLIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPD  370

Query  790   LDMASGTLKDSLD-FVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYA  614
             LDM +G +K  LD F NELYEMRFN+KTGLA+QKKLSESAVDFPRVNE+YTGRKQR+VY 
Sbjct  371   LDMVNGPIKKKLDTFKNELYEMRFNLKTGLATQKKLSESAVDFPRVNESYTGRKQRFVYG  430

Query  613   TMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGC  434
             T L  +AKV GIVKFDLHA PE GKTK+EVGGN++G++DLGPGRFGSEAIFVPR      
Sbjct  431   TTLDSIAKVTGIVKFDLHAAPEVGKTKIEVGGNIQGLYDLGPGRFGSEAIFVPRVPGITS  490

Query  433   EEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             EEDDGYLI FVHDENTGKSA++V+DAKTMS +PVAVVELP+RVPYGFHAFFVTEEQLQ Q
Sbjct  491   EEDDGYLIFFVHDENTGKSAIHVLDAKTMSNDPVAVVELPHRVPYGFHAFFVTEEQLQEQ  550

Query  253   AEI  245
             A +
Sbjct  551   ANL  553



>ref|XP_006402264.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
 gb|ESQ43717.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
Length=537

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/527 (77%), Positives = 460/527 (87%), Gaps = 5/527 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPV-SGHLPEC  1643
             P P  G ++K +D LE  +VK+MHD+S PLHYLSGNFAP  +ETPP KDLPV  G LPEC
Sbjct  14    PKPSKGFSSKLLDLLERVVVKLMHDASLPLHYLSGNFAPLKDETPPVKDLPVVHGFLPEC  73

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             LNGEFVRVGPNPKF PVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEEFFG A
Sbjct  74    LNGEFVRVGPNPKFDPVAGYHWFDGDGMIHGVRIKDGKATYVSRYVKTSRLKQEEFFGAA  133

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KFMKIGDLKG FGLL V +Q LR KLKVLD+SYG GTANTAL+YH GKLLAL E DKPY 
Sbjct  134   KFMKIGDLKGFFGLLMVNMQQLRTKLKVLDDSYGYGTANTALVYHHGKLLALQEADKPYV  193

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             +KVLEDGDLQTLGM+DYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVIS+DG+
Sbjct  194   VKVLEDGDLQTLGMIDYDKRLTHSFTAHPKVDPATGEMFTFGYSHTPPYLTYRVISEDGI  253

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             M DPVPITI   +MMHDFAITE+YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVL
Sbjct  254   MLDPVPITISEPIMMHDFAITESYAIFMDLPMHFRPKEMVKEKKMIYSFDPTKKARFGVL  313

Query  922   PRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FV  746
             PRYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SG +K+ L+ F 
Sbjct  314   PRYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGNVKEKLENFS  373

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMKTG ASQ+KLS SAVDFPR+NE YTG+KQRYVY T+L  +AKV GI+KFD
Sbjct  374   NELYEMRFNMKTGSASQRKLSASAVDFPRINERYTGKKQRYVYGTILDSIAKVTGIIKFD  433

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAE ETGK  LEVGGN++GI++LG GR+GSEAI+VPREA+   EEDDGYLI FVHDENT
Sbjct  434   LHAEAETGKKMLEVGGNIKGIYELGQGRYGSEAIYVPREAA---EEDDGYLIFFVHDENT  490

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKS VNVIDAKTMSAEPVAVVELP+RVPYGFHA FVTEEQLQ Q  I
Sbjct  491   GKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHALFVTEEQLQEQTRI  537



>ref|XP_003542847.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Glycine 
max]
Length=543

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/526 (78%), Positives = 458/526 (87%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  +K +D LE  +VK ++DSS P HYL+GNFAP   ETPP KDLPV G+LP+CL
Sbjct  19    PKPSNGFTSKVVDLLEKLVVKFLYDSSLPHHYLTGNFAPV-SETPPTKDLPVKGYLPDCL  77

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEE+FG +K
Sbjct  78    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEYFGGSK  137

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V + MLR K KVLD SYG GTANTAL+YH GKLLAL E DKPYAI
Sbjct  138   FMKIGDLKGLFGLLMVNIHMLRTKWKVLDASYGTGTANTALVYHHGKLLALSEADKPYAI  197

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLGMLDYDKRLGH+FTAHPKVDP TGEMFTFGYA   P++TYRVISKDG M
Sbjct  198   KVFEDGDLQTLGMLDYDKRLGHSFTAHPKVDPFTGEMFTFGYAHTPPYITYRVISKDGYM  257

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+   +MMHDFAITENYAIF+DLPL F+PKEMV  K L + FD+TKKARFGVLP
Sbjct  258   HDPVPITVSDPIMMHDFAITENYAIFLDLPLIFRPKEMVKNKTLIFSFDSTKKARFGVLP  317

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+E LI+WFELPNCFIFH ANAWEE DEVV+I+CR+QNP+LD+  GT K+ L +F N
Sbjct  318   RYAKDEKLIRWFELPNCFIFHNANAWEEEDEVVLITCRLQNPNLDLVGGTAKEKLENFSN  377

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS SAVDFPRVNE+YTGRKQRYVY T L  +AKV GI+KFDL
Sbjct  378   ELYEMRFNMKTGEASQKKLSASAVDFPRVNESYTGRKQRYVYGTTLDSIAKVTGIIKFDL  437

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+ GKTKLEVGGNV+G++DLGPG++GSEA++VPR   T  EEDDGYLI FVHDENTG
Sbjct  438   HAEPDNGKTKLEVGGNVQGLYDLGPGKYGSEAVYVPRVPGTDSEEDDGYLICFVHDENTG  497

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V+VI+AKTMSA+PVAVVELP+RVPYGFHAFFVTEEQLQ Q ++
Sbjct  498   KSFVHVINAKTMSADPVAVVELPHRVPYGFHAFFVTEEQLQEQGKL  543



>sp|Q94IR2.1|CCD1_PHAVU RecName: Full=Carotenoid 9,10(9',10')-cleavage dioxygenase 1; 
AltName: Full=Neoxanthin cleavage enzyme NC2; AltName: Full=PvCCD1; 
AltName: Full=PvNCED2 [Phaseolus vulgaris]
 gb|AAK38744.1| carotenoid 9,10-9',10' cleavage dioxygenase [Phaseolus vulgaris]
Length=543

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/526 (78%), Positives = 455/526 (87%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G ++K ID LE  +VK ++DSS P HYL+GNF P   ETPP KDLPV GHLP+CL
Sbjct  19    PKPTNGFSSKVIDLLEKLLVKFLYDSSLPHHYLTGNFGPV-TETPPTKDLPVKGHLPDCL  77

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEE+FGR+K
Sbjct  78    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVETSRLKQEEYFGRSK  137

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V + MLR KLKVLD SYG GT NTAL+YH GKLLAL E DKPYAI
Sbjct  138   FMKIGDLKGLFGLLMVNIHMLRTKLKVLDLSYGGGTTNTALVYHHGKLLALSEADKPYAI  197

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLGMLDYDKRLGH+FTAHPKVDP TGEMF+FGYA   P++TYRVISKDG M
Sbjct  198   KVFEDGDLQTLGMLDYDKRLGHSFTAHPKVDPFTGEMFSFGYAHTPPYITYRVISKDGYM  257

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYA+FMDLPL F+PKEMV  K L + FD+TKKARFGVLP
Sbjct  258   HDPVPITISDPIMMHDFAITENYAVFMDLPLIFRPKEMVKNKTLIFSFDSTKKARFGVLP  317

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+E  I+WFELPNCFIFH ANAWEE DEVV+I+CR+QNP LD   GT+++ L +F N
Sbjct  318   RYAKDEQHIRWFELPNCFIFHNANAWEEEDEVVLITCRLQNPKLDNVGGTVQEKLENFSN  377

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS S VDFPRVNENYTGRKQRYVY T L  +AKV GI+KFDL
Sbjct  378   ELYEMRFNMKTGEASQKKLSASTVDFPRVNENYTGRKQRYVYGTTLDSIAKVTGIIKFDL  437

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+ GK KLEVGGNV+G++DLGPG+FGSEA+++PR      EEDDGYL+LFVHDEN G
Sbjct  438   HAEPDHGKEKLEVGGNVQGLYDLGPGKFGSEAVYIPRVPGIESEEDDGYLVLFVHDENAG  497

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V+VIDAKTMSA+PVAVVELPNRVPYGFHAFFVTEEQLQ QA++
Sbjct  498   KSFVHVIDAKTMSADPVAVVELPNRVPYGFHAFFVTEEQLQEQAKL  543



>gb|KCW66101.1| hypothetical protein EUGRSUZ_G03374 [Eucalyptus grandis]
Length=576

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/517 (77%), Positives = 453/517 (88%), Gaps = 1/517 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             PTP+ G+ +K +D++E  IVK M+DSS+P  YL+GNFAP  +ETPP  DLPV GHLP+CL
Sbjct  28    PTPKKGVTSKVVDYIEKLIVKFMYDSSRPHQYLAGNFAPVADETPPVTDLPVVGHLPDCL  87

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIK+GKATYVSR+V+TS+LKQEE++G AK
Sbjct  88    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKNGKATYVSRYVRTSKLKQEEYYGGAK  147

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +
Sbjct  148   FMKIGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVYHHGKLLALSEADKPYVL  207

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  208   KVLEDGDLQTLGMLDYDKRLSHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  267

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV   +L + FD TKK+RFGVLP
Sbjct  268   HDPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKDNKLIFTFDKTKKSRFGVLP  327

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAKNEL I+WFELPNCFIFH ANAWEE DEVV+++CR++N DLDM SGT+K+ L+ F N
Sbjct  328   RYAKNELQIRWFELPNCFIFHNANAWEEEDEVVLVTCRLENLDLDMVSGTVKEHLENFGN  387

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQKKLS  +VDFPR+NE YTGRKQRYVY T+L  +AKV GIVKFDL
Sbjct  388   ELYEMRFNMKTGLASQKKLSAPSVDFPRINECYTGRKQRYVYGTILDSIAKVTGIVKFDL  447

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK K+EVGGNV G+FDLGPGRFGSEA+FVPRE     EEDDGYLI FVHDE+TG
Sbjct  448   HAEPEEGKKKIEVGGNVAGVFDLGPGRFGSEAVFVPREPGITSEEDDGYLIFFVHDESTG  507

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTE  272
             KSAVNVIDAK MS++PVAVVELP+RVPYGFHAFFVTE
Sbjct  508   KSAVNVIDAKNMSSDPVAVVELPHRVPYGFHAFFVTE  544



>ref|XP_007133813.1| hypothetical protein PHAVU_011G211200g [Phaseolus vulgaris]
 gb|ESW05807.1| hypothetical protein PHAVU_011G211200g [Phaseolus vulgaris]
Length=543

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/526 (78%), Positives = 454/526 (86%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  +K ID LE  +VK ++DSS P HYL+GNF P   ETPP KDLPV GHLP+CL
Sbjct  19    PKPTNGFTSKVIDLLEKLLVKFLYDSSLPHHYLTGNFGPV-TETPPTKDLPVKGHLPDCL  77

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEE+FGR+K
Sbjct  78    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVETSRLKQEEYFGRSK  137

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V + MLR KLKVLD SYG GTANTAL+YH GKLLAL E DKPYAI
Sbjct  138   FMKIGDLKGLFGLLMVNIHMLRTKLKVLDLSYGGGTANTALVYHHGKLLALSEADKPYAI  197

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLGMLDYDKRLGH+FTAHPKVDP TGEMF+FGYA   P++TYRVISKDG M
Sbjct  198   KVFEDGDLQTLGMLDYDKRLGHSFTAHPKVDPFTGEMFSFGYAHTPPYITYRVISKDGYM  257

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYA+FMDLPL F+PKEMV  K L + FD+TKKARFGVLP
Sbjct  258   HDPVPITISDPIMMHDFAITENYAVFMDLPLIFRPKEMVKNKTLIFSFDSTKKARFGVLP  317

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+E  I+WFELPNCFIFH ANAWEE DEVV+I+CR+QNP LD   GT+++ L +F N
Sbjct  318   RYAKDEQHIRWFELPNCFIFHNANAWEEEDEVVLITCRLQNPKLDNVGGTVQEKLENFSN  377

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS S VDFPRVNENYTGRKQRYVY T L  +AKV GI+KFDL
Sbjct  378   ELYEMRFNMKTGEASQKKLSASTVDFPRVNENYTGRKQRYVYGTTLDSIAKVTGIIKFDL  437

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+  K KLEVGGNV+G++DLGPG+FGSEA+++PR      EEDDGYL+LFVHDEN G
Sbjct  438   HAEPDHEKEKLEVGGNVQGLYDLGPGKFGSEAVYIPRVPGIESEEDDGYLVLFVHDENAG  497

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V+VIDAKTMSA+PVAVVELPNRVPYGFHAFFVTEEQLQ QA++
Sbjct  498   KSFVHVIDAKTMSADPVAVVELPNRVPYGFHAFFVTEEQLQEQAKL  543



>gb|KHN19457.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Glycine soja]
Length=543

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/526 (77%), Positives = 456/526 (87%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  +K +D LE  +VK ++DSS   HYL+GNFAP PE TPP KDLPV G+LP+CL
Sbjct  19    PKPSNGFTSKVVDLLEKLVVKFLYDSSLTHHYLTGNFAPVPE-TPPTKDLPVKGYLPDCL  77

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEE+FG +K
Sbjct  78    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEYFGGSK  137

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V + MLR K KVLD SYG GTANTAL+YH GKLLAL E DKPYAI
Sbjct  138   FMKIGDLKGLFGLLMVNIHMLRTKWKVLDVSYGTGTANTALVYHHGKLLALSEADKPYAI  197

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLGMLDYDKRLGH+FTAHPKVDP TGEMFTFGYA   P++TYRVISKDG M
Sbjct  198   KVFEDGDLQTLGMLDYDKRLGHSFTAHPKVDPFTGEMFTFGYAHTPPYITYRVISKDGYM  257

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+   +MMHDFAITENYAIF+DLPL F+PKEMV  K L + FD+TKKARFGVLP
Sbjct  258   HDPVPITVSDPIMMHDFAITENYAIFLDLPLIFRPKEMVKNKTLIFSFDSTKKARFGVLP  317

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+E LI+WFELPNCFIFH ANAWEE DEVV+I+CR+QNP+LD+  GT K+ L +F N
Sbjct  318   RYAKDEKLIRWFELPNCFIFHNANAWEEEDEVVLITCRLQNPNLDLVGGTAKEKLENFSN  377

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS SAVDFPRVNE+YTGRKQRYVY T L  +AKV GI+KFDL
Sbjct  378   ELYEMRFNMKTGEASQKKLSASAVDFPRVNESYTGRKQRYVYGTTLDSIAKVTGIIKFDL  437

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+ GKTKLEVGGNV+G++DLGPG++GSEA++VPR   T  EEDDGYLI F HDENT 
Sbjct  438   HAEPDHGKTKLEVGGNVQGLYDLGPGKYGSEAVYVPRVPGTDSEEDDGYLIFFAHDENTR  497

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V+VI+AKTMSA+PVAVVELP+RVPYGFHAFFVTEEQLQ Q ++
Sbjct  498   KSFVHVINAKTMSADPVAVVELPHRVPYGFHAFFVTEEQLQEQGKL  543



>ref|XP_010931015.1| PREDICTED: LOW QUALITY PROTEIN: carotenoid 9,10(9',10')-cleavage 
dioxygenase-like [Elaeis guineensis]
Length=544

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/524 (78%), Positives = 451/524 (86%), Gaps = 2/524 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+ +KA+D +E  IV +MHDSSKPLHYLSGNFAP  +ETPPC DLPV G LPECL
Sbjct  20    PKPRKGLVSKAVDLIERVIVYLMHDSSKPLHYLSGNFAPVRDETPPCFDLPVRGSLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIHG+ IKDGKA YVSR+VKTSRLKQEEFFG AK
Sbjct  80    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHGMHIKDGKAAYVSRYVKTSRLKQEEFFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL  V +Q+LR KLKVLD SYG GT NTALIYH GKLLAL E DKPY +
Sbjct  140   FMKIGDLKGLFGLFMVQMQLLRAKLKVLDASYGIGTGNTALIYHHGKLLALSEADKPYVV  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H FTAHPKVDP T EMFTFGY+   P+ TYRVI+KDG+M
Sbjct  200   KVLEDGDLQTLGMLDYDKRLTHPFTAHPKVDPFTDEMFTFGYSHTPPYCTYRVITKDGVM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITI   VMMHDFAITENYAIFMDLPL+F+PKEMV K +L + FD TKKARFGVLP
Sbjct  260   LDPVPITISDPVMMHDFAITENYAIFMDLPLFFRPKEMV-KGKLIFTFDTTKKARFGVLP  318

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++  I+WFELPNCFIFH ANAWEEGDEV++I+CR++NPDLDM +GT K  L +F N
Sbjct  319   RYAKDDRHIRWFELPNCFIFHNANAWEEGDEVILITCRLENPDLDMVNGTTKGQLENFSN  378

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMK G ASQK+LS SAVDFPR+NE+YTGRKQRYVY T+L ++ KVKGI+KFDL
Sbjct  379   ELYEMRFNMKNGAASQKQLSVSAVDFPRINESYTGRKQRYVYGTILDNITKVKGIIKFDL  438

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGK KLEVGGNV+GIF+LGPGR+GSEAIFVP ++    EEDDGYLI FV  + TG
Sbjct  439   HAEPETGKKKLEVGGNVKGIFELGPGRYGSEAIFVPGQSGITSEEDDGYLIFFVMMKTTG  498

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             KS VNVIDAKTMSAEPVAVVELPNRVPYGFHAFFV EEQLQ Q 
Sbjct  499   KSEVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVREEQLQRQV  542



>ref|XP_004963348.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Setaria italica]
Length=545

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/524 (77%), Positives = 450/524 (86%), Gaps = 1/524 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+A+ A+D LE   V++ HD +KPLH+LSGNFAP   ETPP  DLPV GHLPECL
Sbjct  18    PRPSKGLASWALDLLESVAVRLGHDKTKPLHWLSGNFAPVVNETPPAPDLPVRGHLPECL  77

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKT+RLKQEE+FG AK
Sbjct  78    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTARLKQEEYFGGAK  137

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR K KVLD +YG GTANTALIYH GKL+AL E DKPY +
Sbjct  138   FMKIGDLKGFFGLFMVQMQQLRKKFKVLDFTYGYGTANTALIYHHGKLMALSEADKPYVV  197

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMFTFGY+ + P+ TYRVI+KDG M
Sbjct  198   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKDGAM  257

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKKARFG+LP
Sbjct  258   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKARFGILP  317

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++ LI+WFELPNCFIFH ANAWEEGDEVV+I+CR++NPDLD  +G   D L+ F N
Sbjct  318   RYAKDDKLIRWFELPNCFIFHNANAWEEGDEVVLITCRLENPDLDKVNGHQSDKLENFGN  377

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS SAVDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  378   ELYEMRFNMKTGAASQKKLSVSAVDFPRVNESYTGRKQRYVYCTILDSIAKVTGIIKFDL  437

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE+GK +LEVGGN++GI+DLGPGRFGSEAIFVP++     EEDDGYLI FVHDENTG
Sbjct  438   HAEPESGKKELEVGGNIQGIYDLGPGRFGSEAIFVPKQPGVSGEEDDGYLIFFVHDENTG  497

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             KS VNVIDAKTMSA+PVAVVELPNRVPYGFHAFFVTEEQL  QA
Sbjct  498   KSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTEEQLAQQA  541



>gb|ABS19630.2| carotenoid cleavage dioxygenase [Bixa orellana]
Length=542

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/525 (76%), Positives = 455/525 (87%), Gaps = 5/525 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+ +  IDWLE  IVK+MHD S+PL +L+GNFAP P ETPP  DLPV GHLPECL
Sbjct  23    PKPQKGLKSTLIDWLEKLIVKLMHDPSQPLPFLTGNFAPIPHETPPTTDLPVKGHLPECL  82

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIKDGKA YVSR+V TSR KQE+FF   K
Sbjct  83    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKDGKAAYVSRYVNTSRFKQEDFFEGPK  142

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V+LQ+LR K KV+D +YG GT NTAL+YH GKLLAL+EGDKPY +
Sbjct  143   FMKIGDLKGLFGLLMVHLQILRAKTKVIDTTYGVGTGNTALVYHHGKLLALNEGDKPYVL  202

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDPVTGEMFTFGY+ +AP++TYRVISKDG M
Sbjct  203   KVLEDGDLQTIGLLDYDKRLSHSFTAHPKVDPVTGEMFTFGYSHEAPYITYRVISKDGFM  262

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPL+F+PKEMV  K++ + FD TKKARFGVLP
Sbjct  263   HDPVPITISEPIMMHDFAITENYAIFMDLPLHFRPKEMVKGKKMIFSFDPTKKARFGVLP  322

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFVNE  740
             RYAK++LLI+WFELPNCFIFH ANAWEEGD+VV+I CRI++PDLD      K    F  E
Sbjct  323   RYAKDDLLIRWFELPNCFIFHNANAWEEGDDVVLIPCRIEDPDLDN-----KKLGSFQTE  377

Query  739   LYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLH  560
             LYEMRFNMKTG ASQK+LS SAV+FPRVNE+YTGRKQRYVY T+L   AKV GI KFDLH
Sbjct  378   LYEMRFNMKTGEASQKQLSASAVEFPRVNESYTGRKQRYVYGTILGGKAKVTGIAKFDLH  437

Query  559   AEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGK  380
             AEPE GKT++EVGGNV+G+FDLG GR+GSEA+FVPRE  T  +EDDGYLI F+HDENTGK
Sbjct  438   AEPEPGKTRIEVGGNVKGVFDLGAGRYGSEAVFVPREPGTTSDEDDGYLIFFLHDENTGK  497

Query  379   SAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             S VNVIDAKTMSA+PVAVVELP+RVPYGFHAFFVTEEQLQ QA++
Sbjct  498   SFVNVIDAKTMSADPVAVVELPHRVPYGFHAFFVTEEQLQEQAKL  542



>gb|KFK35504.1| hypothetical protein AALP_AA5G293200 [Arabis alpina]
Length=532

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 459/525 (87%), Gaps = 5/525 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPV-SGHLPEC  1643
             P P  G ++K +D LE  +VK+MHD+S PLHYLSGNFAP  +ETPP KDLPV  G LPEC
Sbjct  9     PRPSKGFSSKLVDLLERLVVKLMHDASLPLHYLSGNFAPVRDETPPVKDLPVVHGFLPEC  68

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             LNGEFVRVGPNPKF PVAGYHWFDGDGMIHGLRIKDGKATYVSR+VKTSRLKQEEFFG A
Sbjct  69    LNGEFVRVGPNPKFDPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVKTSRLKQEEFFGAA  128

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KFMKIGD+KG FGL+ V +Q LR KLK+LD+SYG GTANTAL+YH GKLLAL E DKPY 
Sbjct  129   KFMKIGDIKGFFGLIMVNMQQLRTKLKILDDSYGIGTANTALVYHHGKLLALQEADKPYV  188

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             ++VLEDGDLQTLG++DYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG+
Sbjct  189   VRVLEDGDLQTLGIIDYDKRLTHSFTAHPKVDPATGEMFTFGYSHTPPYLTYRVISKDGI  248

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             MHDPVPITI   +MMHDFAITE YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVL
Sbjct  249   MHDPVPITISEPIMMHDFAITEAYAIFMDLPMHFRPKEMVKEKKMIYSFDPTKKARFGVL  308

Query  922   PRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FV  746
             PRYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SG +K+ L+ F 
Sbjct  309   PRYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGNVKEKLENFG  368

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMKTG ASQKKLS SAVDFPR+NE+YTG+KQRYVY T+L  +AK+ GI+KFD
Sbjct  369   NELYEMRFNMKTGSASQKKLSASAVDFPRINESYTGKKQRYVYGTILDSIAKITGIIKFD  428

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAE ET K  LEVGGN++GI++LG GR+GSEA++VPR+A+   EEDDGYLI FVHDENT
Sbjct  429   LHAEAETDKKMLEVGGNIKGIYELGEGRYGSEAVYVPRDAA---EEDDGYLIFFVHDENT  485

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             GKS VNVI+AKTMSAEPVAVVELP+RVPYGFHA FVTEEQL+ Q 
Sbjct  486   GKSCVNVINAKTMSAEPVAVVELPHRVPYGFHALFVTEEQLREQT  530



>gb|AFG30025.1| carotenoid cleavage dioxygenase 1, partial [Eriobotrya japonica]
Length=501

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/501 (79%), Positives = 448/501 (89%), Gaps = 1/501 (0%)
 Frame = -3

Query  1744  SSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGD  1565
             SS+P HYL+GNFAP  +ETPP  DLPV GHLPECLNGEFVRVGPNPKFAPVAGYHWFDGD
Sbjct  1     SSQPHHYLAGNFAPVVDETPPTTDLPVIGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGD  60

Query  1564  GMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKL  1385
             GM+HG+RIKDGKATYVSR+V+TSRLKQEE+FG AKFMKIGDLKG  GL  V+LQMLR KL
Sbjct  61    GMVHGMRIKDGKATYVSRYVRTSRLKQEEYFGGAKFMKIGDLKGFLGLFMVHLQMLRAKL  120

Query  1384  KVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFT  1205
             K+LD SYGNGT NTAL+YH GKLLAL E DKPY +KVLEDGDLQT+G+LDYDKRL H+FT
Sbjct  121   KILDMSYGNGTGNTALVYHHGKLLALSEVDKPYVLKVLEDGDLQTVGLLDYDKRLTHSFT  180

Query  1204  AHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAI  1025
             AHPKVDPVTGEMFTFGY+Q  P+VTYRVISKDG MHDP+PITI   VMMHDFAITENYAI
Sbjct  181   AHPKVDPVTGEMFTFGYSQTPPYVTYRVISKDGFMHDPIPITIADPVMMHDFAITENYAI  240

Query  1024  FMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANA  845
             FMDLPL+F+PKEMV +K+    FD TK ARFG+LPRYAKNE LI+WFELPNCFIFH ANA
Sbjct  241   FMDLPLFFKPKEMVKEKKFIITFDQTKIARFGLLPRYAKNESLIRWFELPNCFIFHNANA  300

Query  844   WEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESAVD  668
             WEEGDEVV+I+CR+ N DLDM +G++K+ L +F NELYEMRFN+KTGLASQKKLSESAVD
Sbjct  301   WEEGDEVVLITCRLDNLDLDMVNGSVKEKLENFKNELYEMRFNLKTGLASQKKLSESAVD  360

Query  667   FPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGP  488
             FPRVNE+YTGRKQRYVY  +L  +AKV G+VKFDLHAEPE GKT++EVGGNV+G++DLGP
Sbjct  361   FPRVNESYTGRKQRYVYGALLDSIAKVTGVVKFDLHAEPEVGKTQIEVGGNVQGLYDLGP  420

Query  487   GRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNR  308
             GRFGSEAIFVP  +    EEDDGYLILFVHDENTGKSA++V+DAKTMS+EPVAVVELP+R
Sbjct  421   GRFGSEAIFVPPISGVTSEEDDGYLILFVHDENTGKSAIHVVDAKTMSSEPVAVVELPHR  480

Query  307   VPYGFHAFFVTEEQLQTQAEI  245
             VPYGFHAFFVTEEQLQ QA++
Sbjct  481   VPYGFHAFFVTEEQLQEQAKL  501



>gb|KHN37625.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Glycine soja]
Length=574

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/522 (77%), Positives = 453/522 (87%), Gaps = 2/522 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  +K +D LE  +VK ++DSS P HYL+GNFAP   ETPP KDLPV G+LP+CL
Sbjct  19    PKPSNGFTSKVVDLLEKLVVKFLYDSSLPHHYLTGNFAPV-SETPPTKDLPVKGYLPDCL  77

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEE+FG +K
Sbjct  78    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEYFGGSK  137

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V + MLR K KVLD SYG GTANTAL+YH GKLLAL E DKPYAI
Sbjct  138   FMKIGDLKGLFGLLMVNIHMLRTKWKVLDASYGTGTANTALVYHHGKLLALSEADKPYAI  197

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLGMLDYDKRLGH+FTAHPKVDP TGEMFTFGYA   P++TYRVISKDG M
Sbjct  198   KVFEDGDLQTLGMLDYDKRLGHSFTAHPKVDPFTGEMFTFGYAHTPPYITYRVISKDGYM  257

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+   +MMHDFAITENYAIF+DLPL F+PKEMV  K L + FD+TKKARFGVLP
Sbjct  258   HDPVPITVSDPIMMHDFAITENYAIFLDLPLIFRPKEMVKNKTLIFSFDSTKKARFGVLP  317

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+E LI+WFELPNCFIFH ANAWEE DEVV+I+CR+QNP+LD+  GT K+ L +F N
Sbjct  318   RYAKDEKLIRWFELPNCFIFHNANAWEEEDEVVLITCRLQNPNLDLVGGTAKEKLENFSN  377

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS SAVDFPRVNE+YTGRKQRYVY T L  +AKV GI+KFDL
Sbjct  378   ELYEMRFNMKTGEASQKKLSASAVDFPRVNESYTGRKQRYVYGTTLDSIAKVTGIIKFDL  437

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+ GKTKLEVGGNV+G++DLGPG++GSEA++VPR   T  EEDDGYLI FVHDENTG
Sbjct  438   HAEPDNGKTKLEVGGNVQGLYDLGPGKYGSEAVYVPRVPGTDSEEDDGYLICFVHDENTG  497

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQT  257
             KS V+VI+AKTMSA+PVAVVELP+RVPYGFHAFFVTE  + T
Sbjct  498   KSFVHVINAKTMSADPVAVVELPHRVPYGFHAFFVTEVCVTT  539



>ref|XP_002876727.1| hypothetical protein ARALYDRAFT_486866 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52986.1| hypothetical protein ARALYDRAFT_486866 [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/538 (76%), Positives = 456/538 (85%), Gaps = 16/538 (3%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G ++K +D LE  +VK+MHD+S PLHYLSGNFAP  EETPP KDLPV G LPECL
Sbjct  16    PKPSKGFSSKLVDLLERLVVKLMHDASLPLHYLSGNFAPIREETPPVKDLPVHGFLPECL  75

Query  1639  NGEFVRVGPNPKFAPVAGYHWFD------------GDGMIHGLRIKDGKATYVSRFVKTS  1496
             NGEFVRVGPNPKF  VAGYHW                 MIHG+RIKDGKATYVSR+VKTS
Sbjct  76    NGEFVRVGPNPKFDAVAGYHWHVLFFFFHFTIFNYSSWMIHGVRIKDGKATYVSRYVKTS  135

Query  1495  RLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKL  1316
             RLKQEEFFG AKFMKIGDLKG FGLL V +Q+LR KLK+LDN+YGNGTANTALIYH GKL
Sbjct  136   RLKQEEFFGAAKFMKIGDLKGFFGLLMVNVQLLRTKLKILDNTYGNGTANTALIYHHGKL  195

Query  1315  LALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPF  1136
             LAL E DKPY IKVLEDGDLQTLGM+DYDKRL H+FTAHPKVDPVTGEMFTFGY+   P+
Sbjct  196   LALQEADKPYVIKVLEDGDLQTLGMIDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHTPPY  255

Query  1135  VTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKF  956
             +TYRVISKDG+MHDPVPITI   +MMHDFAITE Y IFMDLP++F+PKEMV +K++ Y F
Sbjct  256   LTYRVISKDGIMHDPVPITISEPIMMHDFAITETYVIFMDLPMHFRPKEMVKEKKMIYSF  315

Query  955   DATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMAS  776
             D TKKARFGVLPRYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM S
Sbjct  316   DPTKKARFGVLPRYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVS  375

Query  775   GTLKDSLD-FVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSD  599
             G +K+ L+ F NELYEM+FNMKTG ASQKKLS SAVDFPR+NE YTG+KQRYVY T+L  
Sbjct  376   GKVKEKLENFGNELYEMKFNMKTGSASQKKLSASAVDFPRINECYTGKKQRYVYGTILDS  435

Query  598   LAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDG  419
             +AKV GI+KFDLHAE ETGK  LEVGGN++GI+DLG GR+GSEAI+VPREA+   EEDDG
Sbjct  436   IAKVTGIIKFDLHAEAETGKRMLEVGGNIKGIYDLGQGRYGSEAIYVPREAA---EEDDG  492

Query  418   YLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             YLI FVHDENTGKS V+VIDAKTMSAEPVAVVELP+RVPYGFHA FVTEEQLQ Q  I
Sbjct  493   YLIFFVHDENTGKSCVHVIDAKTMSAEPVAVVELPHRVPYGFHALFVTEEQLQEQTLI  550



>ref|XP_002465882.1| hypothetical protein SORBIDRAFT_01g047540 [Sorghum bicolor]
 gb|EER92880.1| hypothetical protein SORBIDRAFT_01g047540 [Sorghum bicolor]
Length=549

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 453/525 (86%), Gaps = 1/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE  +V++ HD +KPLH+LSGNFAP  EETPP  +L V GHLPECL
Sbjct  23    PRPRKGLASWALDLLESLVVRLGHDKTKPLHWLSGNFAPVVEETPPAPNLTVRGHLPECL  82

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKT+RLKQEE+FG AK
Sbjct  83    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTARLKQEEYFGGAK  142

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR K KVLD +YG GTANTALIYH GKL+AL E DKPY +
Sbjct  143   FMKIGDLKGFFGLFMVQMQQLRKKFKVLDFTYGFGTANTALIYHHGKLMALSEADKPYVV  202

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMFTFGY+ + P+ TYRVI+K+G M
Sbjct  203   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKEGAM  262

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKKARFG+LP
Sbjct  263   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKARFGILP  322

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK+E +I+WFELPNCFIFH ANAWEEGDEVV+I+CR++NPDLD  +G   D L+ F N
Sbjct  323   RYAKDEKVIRWFELPNCFIFHNANAWEEGDEVVLITCRLENPDLDKVNGHQSDKLENFGN  382

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPRVNE+YTGRKQR+VY T+L  +AKV GI+KFDL
Sbjct  383   ELYEMRFNMKTGAASQKQLSVSAVDFPRVNESYTGRKQRFVYCTILDSIAKVTGIIKFDL  442

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE+GK +LEVGGN++GI+DLGPGRFGSEAIFVP++     EEDDGYLI FVHDENTG
Sbjct  443   HAEPESGKKELEVGGNIQGIYDLGPGRFGSEAIFVPKQPGVSGEEDDGYLIFFVHDENTG  502

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS VNVIDAKTMSA+PVAVVELPNRVPYGFHAFFVTE+QL  QAE
Sbjct  503   KSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTEDQLAQQAE  547



>gb|AAN17413.1| neoxanthin cleavage enzyme nc1 [Arabidopsis thaliana]
 gb|AAN72113.1| neoxanthin cleavage enzyme nc1 [Arabidopsis thaliana]
Length=501

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/504 (80%), Positives = 445/504 (88%), Gaps = 4/504 (1%)
 Frame = -3

Query  1753  MHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWF  1574
             MHD+S PLHYLSGNFAP  +ETPP KDLPV G LPECLNGEFVRVGPNPKF  VAGYHWF
Sbjct  1     MHDASLPLHYLSGNFAPIRDETPPVKDLPVHGFLPECLNGEFVRVGPNPKFDAVAGYHWF  60

Query  1573  DGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLR  1394
             DGDGMIHG+RIKDGKATYVSR+VKTSRLKQEEFFG AKFMKIGDLKG FGLL V +Q LR
Sbjct  61    DGDGMIHGVRIKDGKATYVSRYVKTSRLKQEEFFGAAKFMKIGDLKGFFGLLMVNVQQLR  120

Query  1393  IKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGH  1214
              KLK+LDN+YGNGTANTAL+YH GKLLAL E DKPY IKVLEDGDLQTLG++DYDKRL H
Sbjct  121   TKLKILDNTYGNGTANTALVYHHGKLLALQEADKPYVIKVLEDGDLQTLGIIDYDKRLTH  180

Query  1213  AFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITEN  1034
             +FTAHPKVDPVTGEMFTFGY+   P++TYRVISKDG+MHDPVPITI   +MMHDFAITE 
Sbjct  181   SFTAHPKVDPVTGEMFTFGYSHTPPYLTYRVISKDGIMHDPVPITISEPIMMHDFAITET  240

Query  1033  YAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHT  854
             YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVLPRYAK+EL+I+WFELPNCFIFH 
Sbjct  241   YAIFMDLPMHFRPKEMVKEKKMIYSFDPTKKARFGVLPRYAKDELMIRWFELPNCFIFHN  300

Query  853   ANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVNELYEMRFNMKTGLASQKKLSES  677
             ANAWEE DEVV+I+CR++NPDLDM SG +K+ L+ F NELYEMRFNMKTG ASQKKLS S
Sbjct  301   ANAWEEEDEVVLITCRLENPDLDMVSGKVKEKLENFGNELYEMRFNMKTGSASQKKLSAS  360

Query  676   AVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFD  497
             AVDFPR+NE YTG+KQRYVY T+L  +AKV GI+KFDLHAE ETGK  LEVGGN++GI+D
Sbjct  361   AVDFPRINECYTGKKQRYVYGTILDSIAKVTGIIKFDLHAEAETGKRMLEVGGNIKGIYD  420

Query  496   LGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVEL  317
             LG GR+GSEAI+VPRE +   EEDDGYLI FVHDENTGKS V VIDAKTMSAEPVAVVEL
Sbjct  421   LGEGRYGSEAIYVPRETA---EEDDGYLIFFVHDENTGKSCVTVIDAKTMSAEPVAVVEL  477

Query  316   PNRVPYGFHAFFVTEEQLQTQAEI  245
             P+RVPYGFHA FVTEEQLQ Q  I
Sbjct  478   PHRVPYGFHALFVTEEQLQEQTLI  501



>gb|KCW66082.1| hypothetical protein EUGRSUZ_G03362 [Eucalyptus grandis]
Length=541

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/526 (75%), Positives = 453/526 (86%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+ +  +D++E  IV  M+DSS+P  YL+GNFAP  +ETPP  DLPV GHLP+CL
Sbjct  16    PMPKKGVTSMVVDYIEKLIVNFMYDSSQPHQYLAGNFAPVADETPPVTDLPVVGHLPDCL  75

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFV VGPNPKFAPVAGYHWFDGDGM+HG+RIK+GKATYVSR+V+TSRLKQEE++G A+
Sbjct  76    NGEFVLVGPNPKFAPVAGYHWFDGDGMVHGMRIKNGKATYVSRYVRTSRLKQEEYYGGAQ  135

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F KIGDLKG+FGLL + +QMLR KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +
Sbjct  136   FKKIGDLKGLFGLLMIKMQMLRAKLKILDVSYGTGTGNTALVYHHGKLLALSEADKPYVL  195

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  196   KVLEDGDLQTLGMLDYDKRLSHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  255

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLY +PKEMV   ++ Y FD TKK+RFGVLP
Sbjct  256   HDPVPITISDPIMMHDFAITENYAIFMDLPLYVRPKEMVKDNKIIYTFDKTKKSRFGVLP  315

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFV-N  743
             RYAKN+L I+WFELPNCFIFH ANAWEE DEVV++ CR++N DLDM SG ++++L+ + +
Sbjct  316   RYAKNDLQIRWFELPNCFIFHNANAWEEEDEVVLLPCRLENLDLDMISGIVRENLENIGD  375

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQKKLS  +V FPR+NE YTGRKQRYVY T+L  +AKV GIVKFDL
Sbjct  376   ELYEMRFNMKTGLASQKKLSAPSVGFPRINECYTGRKQRYVYGTILDSIAKVTGIVKFDL  435

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK K+EVGGNV G+FDLGPGRFGSEA+FVPRE+    EEDDGYLI FVHDE+TG
Sbjct  436   HAEPEEGKKKIEVGGNVAGVFDLGPGRFGSEAVFVPRESGITSEEDDGYLIFFVHDESTG  495

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAK MS++PVAVVELP+RVPYGFHAFFVTEEQLQ  A++
Sbjct  496   KSAVNVIDAKNMSSDPVAVVELPHRVPYGFHAFFVTEEQLQELAKL  541



>ref|XP_004510991.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Cicer arietinum]
Length=542

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/526 (78%), Positives = 459/526 (87%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  +K +D LE  +VK+ +DSS P H+L+GNFAP  +ETPP  DL V G LP+CL
Sbjct  17    PKPSNGFTSKVVDLLEKVVVKLFYDSSLPHHWLAGNFAPVQDETPPTTDLTVKGFLPDCL  76

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEE+FG +K
Sbjct  77    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEYFGGSK  136

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+ GLL V +QMLR KLKVLD SYG GTANTAL+YH  KLLAL EGDKPYAI
Sbjct  137   FMKIGDLKGLLGLLMVNVQMLRAKLKVLDVSYGTGTANTALVYHHRKLLALSEGDKPYAI  196

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLG+LDYDKRLGH+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  197   KVFEDGDLQTLGLLDYDKRLGHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGYM  256

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV  K L + FD+TKKARFGVLP
Sbjct  257   HDPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKNKTLIFSFDSTKKARFGVLP  316

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+E LI+WFELPNCFIFH ANAWEE DE+V+I+CR++NPDLDM SG +K+ L +F N
Sbjct  317   RYAKDEKLIRWFELPNCFIFHNANAWEEEDEIVLITCRLENPDLDMVSGAVKEKLENFNN  376

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+K+G ASQKKLS SAVDFPRVNE+YTGRKQRYVY T L  +AKV GI+KFDL
Sbjct  377   ELYEMRFNIKSGEASQKKLSASAVDFPRVNESYTGRKQRYVYGTTLDSIAKVTGIIKFDL  436

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HA+P++GKTKLEVGGNVEG++DLGPGRFGSEA++VPR   T  EEDDGYLI FVHDEN G
Sbjct  437   HAKPDSGKTKLEVGGNVEGLYDLGPGRFGSEAVYVPRIPGTDSEEDDGYLIFFVHDENIG  496

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V+VIDAKTMSA+PVAVVELP RVPYGFHAFFVTE+QLQ QA++
Sbjct  497   KSFVHVIDAKTMSADPVAVVELPQRVPYGFHAFFVTEDQLQEQAKL  542



>gb|ACO87672.1| carotenoid cleavage dioxygenase [Brachypodium sylvaticum]
Length=545

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/525 (76%), Positives = 449/525 (86%), Gaps = 1/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE   V++ HD +KPLH+LSGNFAP  +ETPP  DLPV GHLPECL
Sbjct  20    PRPRKGVASWAVDLLERVAVRLGHDKTKPLHWLSGNFAPVVDETPPAPDLPVRGHLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  80    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR KLKVLD +YG GTANTAL+YH GKL+AL E DKPY +
Sbjct  140   FMKIGDLKGFFGLFMVQMQELRKKLKVLDATYGIGTANTALVYHHGKLMALSEADKPYVV  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMFTFGY+ + P+ TYRVI+KDG+M
Sbjct  200   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKDGVM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKKARFG+L 
Sbjct  260   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKARFGILQ  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RY K++  I+WFELPNCFIFH ANAWEEGDEV++I+CR++NPDLD  +G   + L +F N
Sbjct  320   RYEKDDKNIRWFELPNCFIFHNANAWEEGDEVILITCRLENPDLDKVNGHQNEKLENFGN  379

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPR+NE+YTGRKQRYVY TML  +AKV GI+KFDL
Sbjct  380   ELYEMRFNMKTGAASQKQLSVSAVDFPRINESYTGRKQRYVYCTMLDSIAKVTGIIKFDL  439

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE+GK +LEVGGNV GI+DLGPGR+GSEA+FVP+E     EEDDGYLI FVHDENTG
Sbjct  440   HAEPESGKRQLEVGGNVTGIYDLGPGRYGSEAVFVPKEPGISGEEDDGYLIFFVHDENTG  499

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS VNVIDAKTMS +PVAVVELPNRVPYGFHAFFV EEQL  QAE
Sbjct  500   KSEVNVIDAKTMSPDPVAVVELPNRVPYGFHAFFVNEEQLGRQAE  544



>emb|CDX93902.1| BnaC04g20610D [Brassica napus]
Length=525

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/525 (77%), Positives = 454/525 (86%), Gaps = 14/525 (3%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPV-SGHLPEC  1643
             P P  G+++K +D +E  +VK+MHD+S PLHYLSGNFAP  +ETPP KDLPV  G+LPEC
Sbjct  11    PKPSKGLSSKLLDLVERVVVKLMHDASLPLHYLSGNFAPVRDETPPVKDLPVVHGYLPEC  70

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             LNGEFVRVGPNPKF         DGDGMIHG+RIKDGK+TYVSR+VKTSRLKQEEFFG A
Sbjct  71    LNGEFVRVGPNPKF---------DGDGMIHGVRIKDGKSTYVSRYVKTSRLKQEEFFGAA  121

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KFMKIGDLKG  GLL VYLQ LR KLKVLD SYG+GTANTAL+YH GKLLAL E DKPY 
Sbjct  122   KFMKIGDLKGFLGLLMVYLQQLRTKLKVLDVSYGHGTANTALVYHHGKLLALSEADKPYV  181

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             +KVLEDGDLQTLGM+DYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVIS+DG+
Sbjct  182   VKVLEDGDLQTLGMMDYDKRLTHSFTAHPKVDPTTGEMFTFGYSHTPPYLTYRVISEDGI  241

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             MHDPVPITIP  +MMHDFAITE YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVL
Sbjct  242   MHDPVPITIPEPIMMHDFAITETYAIFMDLPMHFRPKEMVKEKKMVYSFDPTKKARFGVL  301

Query  922   PRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FV  746
             PRYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SG +K+ L+ F 
Sbjct  302   PRYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGNVKEKLENFS  361

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMKTG ASQKKLS SAVDFPR+NE YTG+KQRYVY T+L  +AKV GI+KFD
Sbjct  362   NELYEMRFNMKTGSASQKKLSASAVDFPRINECYTGKKQRYVYGTILDSIAKVTGIIKFD  421

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAE ETGK  LEVGGN++GI++LG GR+GSEAI+VPREA    EEDDGYLI FVHDENT
Sbjct  422   LHAEAETGKKILEVGGNIKGIYELGQGRYGSEAIYVPREAG---EEDDGYLIFFVHDENT  478

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             GKS VNVIDAKTMSAEPVAVVELP+RVPYGFHAFFVTEEQLQ Q 
Sbjct  479   GKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHAFFVTEEQLQEQT  523



>gb|ABF85668.1| carotenoid cleavage dioxyganase 1 [Zea mays]
Length=541

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 450/525 (86%), Gaps = 1/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE   V++ HD +KPLH+LSGNFAP  EETPP  +L V GHLPECL
Sbjct  15    PRPRKGLASWALDLLESLAVRLGHDKTKPLHWLSGNFAPVVEETPPAPNLSVRGHLPECL  74

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIH +RIKDGKATYVSR+VKT+RLKQEE+FG AK
Sbjct  75    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTARLKQEEYFGGAK  134

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR K KVLD +YG GTANTALIYH GKL+AL E DKPY +
Sbjct  135   FMKIGDLKGFFGLFMVQMQQLRKKFKVLDFTYGFGTANTALIYHHGKLMALSEADKPYVV  194

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMFTFGY+ + P+ TYRVI+K+G M
Sbjct  195   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVINKEGAM  254

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKK RFG+LP
Sbjct  255   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKGRFGILP  314

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++ LI+WF+LPNCFIFH ANAWEEGDEVV+I+CR++NPDLD  +G   D L +F N
Sbjct  315   RYAKDDKLIRWFQLPNCFIFHNANAWEEGDEVVLITCRLENPDLDKVNGYQSDKLENFGN  374

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  375   ELYEMRFNMKTGAASQKQLSVSAVDFPRVNESYTGRKQRYVYCTILDSIAKVTGIIKFDL  434

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE+G  +LEVGGNV+GI+DLGPGRFGSEAIFVP+      EEDDGYLI FVHDENTG
Sbjct  435   HAEPESGVKELEVGGNVQGIYDLGPGRFGSEAIFVPKHPGVSGEEDDGYLIFFVHDENTG  494

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS VNVIDAKTMSA+PVAVVELPNRVPYGFHAFFVTE+QL  QAE
Sbjct  495   KSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTEDQLARQAE  539



>gb|ACF79397.1| unknown [Zea mays]
 gb|ACG46084.1| 9,10-9,10 carotenoid cleavage dioxygenase 1 [Zea mays]
 gb|AFW89638.1| white cap1 [Zea mays]
Length=550

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 450/525 (86%), Gaps = 1/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE   V++ HD +KPLH+LSGNFAP  EETPP  +L V GHLPECL
Sbjct  24    PRPRKGLASWALDLLESLAVRLGHDKTKPLHWLSGNFAPVVEETPPAPNLSVRGHLPECL  83

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIH +RIKDGKATYVSR+VKT+RLKQEE+FG AK
Sbjct  84    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTARLKQEEYFGGAK  143

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR K KVLD +YG GTANTALIYH GKL+AL E DKPY +
Sbjct  144   FMKIGDLKGFFGLFMVQMQQLRKKFKVLDFTYGFGTANTALIYHHGKLMALSEADKPYVV  203

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMFTFGY+ + P+ TYRVI+K+G M
Sbjct  204   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVINKEGAM  263

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKK RFG+LP
Sbjct  264   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKGRFGILP  323

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++ LI+WF+LPNCFIFH ANAWEEGDEVV+I+CR++NPDLD  +G   D L +F N
Sbjct  324   RYAKDDKLIRWFQLPNCFIFHNANAWEEGDEVVLITCRLENPDLDKVNGYQSDKLENFGN  383

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  384   ELYEMRFNMKTGAASQKQLSVSAVDFPRVNESYTGRKQRYVYCTILDSIAKVTGIIKFDL  443

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE+G  +LEVGGNV+GI+DLGPGRFGSEAIFVP+      EEDDGYLI FVHDENTG
Sbjct  444   HAEPESGVKELEVGGNVQGIYDLGPGRFGSEAIFVPKHPGVSGEEDDGYLIFFVHDENTG  503

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS VNVIDAKTMSA+PVAVVELPNRVPYGFHAFFVTE+QL  QAE
Sbjct  504   KSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTEDQLARQAE  548



>ref|XP_003577313.1| PREDICTED: LOW QUALITY PROTEIN: carotenoid 9,10(9',10')-cleavage 
dioxygenase-like [Brachypodium distachyon]
Length=547

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/525 (76%), Positives = 449/525 (86%), Gaps = 1/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE   V++ HD ++PLH+LSGNFAP  +ETPP  DLPV GHLPECL
Sbjct  22    PRPRKGVASWAVDLLERLAVRLGHDKTQPLHWLSGNFAPVVDETPPAPDLPVRGHLPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  82    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR KLKVLD +YG GTANTAL+YH GKL+AL E DKPY +
Sbjct  142   FMKIGDLKGFFGLFMVQMQELRKKLKVLDATYGIGTANTALVYHHGKLMALSEADKPYVV  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMFTFGY+ + P+ TYRVI+KDG+M
Sbjct  202   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKDGVM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKKARFG+L 
Sbjct  262   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKARFGILQ  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RY K+E  I+WFELPNCFIFH ANAWEEGDEV++I+CR++NPDLD  +G   + L +F N
Sbjct  322   RYEKDEKNIRWFELPNCFIFHNANAWEEGDEVILITCRLENPDLDKVNGHQNEKLENFGN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPR+NE+YTGRKQRYVY TML  +AKV GI+KFDL
Sbjct  382   ELYEMRFNMKTGAASQKQLSVSAVDFPRINESYTGRKQRYVYCTMLDSIAKVTGIIKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE+GK +LEVGGNV GI+DLGPGR+GSEA+FVP++     EEDDGYLI FVHDENTG
Sbjct  442   HAEPESGKKQLEVGGNVTGIYDLGPGRYGSEAVFVPKKPGVSGEEDDGYLIFFVHDENTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS VNVIDAKTMS +PVAVVELPNRVPYGFHAFFV EEQL  QAE
Sbjct  502   KSEVNVIDAKTMSPDPVAVVELPNRVPYGFHAFFVNEEQLGRQAE  546



>ref|XP_010067847.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Eucalyptus grandis]
Length=613

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/526 (75%), Positives = 453/526 (86%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+ +  +D++E  IV  M+DSS+P  YL+GNFAP  +ETPP  DLPV GHLP+CL
Sbjct  88    PMPKKGVTSMVVDYIEKLIVNFMYDSSQPHQYLAGNFAPVADETPPVTDLPVVGHLPDCL  147

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFV VGPNPKFAPVAGYHWFDGDGM+HG+RIK+GKATYVSR+V+TSRLKQEE++G A+
Sbjct  148   NGEFVLVGPNPKFAPVAGYHWFDGDGMVHGMRIKNGKATYVSRYVRTSRLKQEEYYGGAQ  207

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F KIGDLKG+FGLL + +QMLR KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +
Sbjct  208   FKKIGDLKGLFGLLMIKMQMLRAKLKILDVSYGTGTGNTALVYHHGKLLALSEADKPYVL  267

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  268   KVLEDGDLQTLGMLDYDKRLSHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  327

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLY +PKEMV   ++ Y FD TKK+RFGVLP
Sbjct  328   HDPVPITISDPIMMHDFAITENYAIFMDLPLYVRPKEMVKDNKIIYTFDKTKKSRFGVLP  387

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFV-N  743
             RYAKN+L I+WFELPNCFIFH ANAWEE DEVV++ CR++N DLDM SG ++++L+ + +
Sbjct  388   RYAKNDLQIRWFELPNCFIFHNANAWEEEDEVVLLPCRLENLDLDMISGIVRENLENIGD  447

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQKKLS  +V FPR+NE YTGRKQRYVY T+L  +AKV GIVKFDL
Sbjct  448   ELYEMRFNMKTGLASQKKLSAPSVGFPRINECYTGRKQRYVYGTILDSIAKVTGIVKFDL  507

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK K+EVGGNV G+FDLGPGRFGSEA+FVPRE+    EEDDGYLI FVHDE+TG
Sbjct  508   HAEPEEGKKKIEVGGNVAGVFDLGPGRFGSEAVFVPRESGITSEEDDGYLIFFVHDESTG  567

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAK MS++PVAVVELP+RVPYGFHAFFVTEEQLQ  A++
Sbjct  568   KSAVNVIDAKNMSSDPVAVVELPHRVPYGFHAFFVTEEQLQELAKL  613



>ref|NP_001105286.1| carotenoid cleavage dioxygenase [Zea mays]
 gb|AAV39613.1| carotenoid cleavage dioxygenase [Zea mays]
Length=541

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/525 (76%), Positives = 450/525 (86%), Gaps = 1/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE   V++ HD +KPLH+LSGNFAP  EETPP  +L V GHLPECL
Sbjct  15    PRPRKGLASWALDLLESLAVRLGHDKTKPLHWLSGNFAPVVEETPPAPNLTVRGHLPECL  74

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIH +RIKDGKATYVSR+VKT+RLKQEE+FG AK
Sbjct  75    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTARLKQEEYFGGAK  134

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR K +VLD +YG GTANTALIYH GKL+AL E DKPY +
Sbjct  135   FMKIGDLKGFFGLFMVQMQQLRKKFEVLDFTYGFGTANTALIYHHGKLMALSEADKPYVV  194

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMFTFGY+ + P+ TYRVI+K+G M
Sbjct  195   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVINKEGAM  254

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKK RFG+LP
Sbjct  255   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKGRFGILP  314

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++ LI+WF+LPNCFIFH ANAWEEGDEVV+I+CR++NPDLD  +G   D L +F N
Sbjct  315   RYAKDDKLIRWFQLPNCFIFHNANAWEEGDEVVLITCRLENPDLDKVNGYQSDKLENFGN  374

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  375   ELYEMRFNMKTGAASQKQLSVSAVDFPRVNESYTGRKQRYVYCTILDSIAKVTGIIKFDL  434

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE+G  +LEVGGNV+GI+DLGPGRFGSEAIFVP+      EEDDGYLI FVHDENTG
Sbjct  435   HAEPESGVKELEVGGNVQGIYDLGPGRFGSEAIFVPKHPGVSGEEDDGYLIFFVHDENTG  494

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS VNVIDAKTMSA+PVAVVELPNRVPYGFHAFFVTE+QL  QAE
Sbjct  495   KSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTEDQLARQAE  539



>gb|ACF75911.1| carotenoid cleavage dioxygenases [Malus hupehensis var. mengshanensis]
Length=544

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/525 (75%), Positives = 449/525 (86%), Gaps = 3/525 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P    G A+K +D +E  IVK M+DSS+P HYL+GNFAP  +ETPP  +LPV GHLPECL
Sbjct  23    PITNKGYASKVVDLMEKLIVKWMYDSSQPHHYLAGNFAPVVDETPPTTNLPVIGHLPECL  82

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIKDGKATYVSR+V+TSRL+QEE+FG AK
Sbjct  83    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKDGKATYVSRYVRTSRLEQEEYFGGAK  142

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG  GL  V LQMLR KLK+ D SYGNGT NTAL+YH GKLLAL E DKPY +
Sbjct  143   FMKIGDLKGFLGLFMVNLQMLRAKLKIFDMSYGNGTGNTALVYHHGKLLALSEADKPYVL  202

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDPVTGEMFTFGY+   P+VTYRVISKDG M
Sbjct  203   KVLEDGDLQTVGLLDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHTPPYVTYRVISKDGFM  262

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDP+PITI   VMMHDFAITENYAIFMDLPL F+PKEMV +K+  +     K ARFG+LP
Sbjct  263   HDPIPITIADPVMMHDFAITENYAIFMDLPLIFKPKEMVKEKKFIFTLIKQKYARFGLLP  322

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFVNE  740
             RYAKNE LI+WFELPNCFIFH ANAWEEG EVV+I+CR++N DL+M    L+   +F NE
Sbjct  323   RYAKNESLIRWFELPNCFIFHNANAWEEGGEVVLITCRLENLDLEMFKEKLE---NFTNE  379

Query  739   LYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLH  560
             LYEMRFN+KTGLASQKKLSE+AVDFPRVNE+YTGRKQRYVY T+L  +AKV G+ KFDL 
Sbjct  380   LYEMRFNLKTGLASQKKLSEAAVDFPRVNESYTGRKQRYVYGTLLDSIAKVTGVAKFDLR  439

Query  559   AEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGK  380
             AEPE GKT++EVGGNV+G++DLGPGRFGSEAIFVPR      EEDDGYLILFVHDENTGK
Sbjct  440   AEPEVGKTQIEVGGNVQGLYDLGPGRFGSEAIFVPRIPGVTSEEDDGYLILFVHDENTGK  499

Query  379   SAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             SA++V+ AKTMS EPVAVVELP+RVPYGFHAFFVTEEQLQ QA++
Sbjct  500   SAIHVVGAKTMSPEPVAVVELPHRVPYGFHAFFVTEEQLQEQAKL  544



>ref|NP_001105815.1| white cap1 [Zea mays]
 gb|AAZ22348.1| carotenoid cleavage dioxygenase 1 [Zea mays]
 gb|AAZ22349.1| 9,10-9',10' carotenoid cleavage dioxygenase 1 [Zea mays]
Length=550

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 449/525 (86%), Gaps = 1/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE   V++ HD +KPLH+LSGNFAP  EETPP  +L V GHLPECL
Sbjct  24    PRPRKGLASWALDLLESLAVRLGHDKTKPLHWLSGNFAPVVEETPPAPNLTVRGHLPECL  83

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIH +RIKDGKATYVSR+VKT+RLKQEE+FG AK
Sbjct  84    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTARLKQEEYFGGAK  143

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR K KVLD +YG GTANTALIYH GKL+AL E DKPY +
Sbjct  144   FMKIGDLKGFFGLFMVQMQQLRKKFKVLDFTYGFGTANTALIYHHGKLMALSEADKPYVV  203

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMFTFGY+ + P+ TYRVI+K+G M
Sbjct  204   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVINKEGAM  263

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKK RFG+LP
Sbjct  264   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKGRFGILP  323

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++ LI+WF+LPNCFIFH ANAWEEGDEVV+I+CR++NPDLD  +G   D L +F N
Sbjct  324   RYAKDDKLIRWFQLPNCFIFHNANAWEEGDEVVLITCRLENPDLDKVNGYQSDKLENFGN  383

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  384   ELYEMRFNMKTGAASQKQLSVSAVDFPRVNESYTGRKQRYVYCTILDSIAKVTGIIKFDL  443

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE+G   LEVGGNV+GI+DLGPGRFGSEAIFVP+      EEDDGYLI FVHDENTG
Sbjct  444   HAEPESGVKVLEVGGNVQGIYDLGPGRFGSEAIFVPKHPGVSGEEDDGYLIFFVHDENTG  503

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS VNVIDAKTMSA+PVAVVELPNRVPYGFHAFFVTE+QL  QAE
Sbjct  504   KSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTEDQLARQAE  548



>ref|XP_011047393.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Populus euphratica]
Length=542

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/526 (75%), Positives = 449/526 (85%), Gaps = 10/526 (2%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+ +K ID+LE  IV +MHD+S+  HYLSGNFAP  +ET P KDLPV GHLPEC+
Sbjct  26    PEPQKGLTSKLIDYLEKLIVNLMHDTSQSHHYLSGNFAPVLDETAPVKDLPVKGHLPECM  85

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHG+RIKDGKA YV RFV+TSRLKQEEFFG AK
Sbjct  86    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGMRIKDGKAAYVRRFVRTSRLKQEEFFGGAK  145

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +Q+LR+K KVLDNSYG GT NT LIYH+GKLLAL E DKPY +
Sbjct  146   FMKIGDLKGLFGLLMVNMQILRLKSKVLDNSYGIGTGNTNLIYHNGKLLALQEADKPYVV  205

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDLQTLG+LDYDKRL H+FTAHPKVDP TGEMFTFGY+ + P+VTYRVISKDG+M
Sbjct  206   KVMEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTGEMFTFGYSHEPPYVTYRVISKDGVM  265

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYA+F+DLPLYF+PKEMV  K+  + FDATKKARFGVLP
Sbjct  266   HDPVPITISDPIMMHDFAITENYAVFLDLPLYFRPKEMVKDKKFIFTFDATKKARFGVLP  325

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++LLIKWFELPNCFIFH ANAWEE DE+V+I+CR+QNPDLDM +G +K+ L +F N
Sbjct  326   RYAKDDLLIKWFELPNCFIFHNANAWEEDDEIVLITCRLQNPDLDMVNGAVKEKLENFTN  385

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+ASQKKLSESAVDFPRVNE+YTGRKQRYVY T+L  +AKV GIVK ++
Sbjct  386   ELYEMRFNMKTGVASQKKLSESAVDFPRVNESYTGRKQRYVYGTLLDSIAKVTGIVKMEI  445

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
                         + G+   +F   PGRFGSEA+F+PRE  T  EEDDGYLI F HDENTG
Sbjct  446   ---------AYTISGSRVLVFIFRPGRFGSEAVFIPREPGTTSEEDDGYLIFFAHDENTG  496

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMSA PVAVVELP+RVPYGFHAFFV+EEQLQ QA++
Sbjct  497   KSSVNVIDAKTMSANPVAVVELPHRVPYGFHAFFVSEEQLQEQAQL  542



>ref|XP_006850220.1| hypothetical protein AMTR_s00022p00253450 [Amborella trichopoda]
 gb|ERN11801.1| hypothetical protein AMTR_s00022p00253450 [Amborella trichopoda]
Length=538

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/524 (76%), Positives = 456/524 (87%), Gaps = 2/524 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+ +K +D +E  IV  M+DSSKP +YLSGN+AP   ETPPC+DL V G+LP+CL
Sbjct  16    PKPKKGLISKVLDGVEKLIVWAMYDSSKPNYYLSGNYAPVSVETPPCQDLIVKGYLPDCL  75

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIKDGKA YVSRFVKTSRLKQEEFFGRAK
Sbjct  76    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKDGKAAYVSRFVKTSRLKQEEFFGRAK  135

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F+KIGD+KG+FGL +VY+Q+L  KLKVLD SYG GT NTALI+H G+LLAL E DKPY I
Sbjct  136   FLKIGDIKGVFGLFSVYMQVLCSKLKVLDISYGTGTGNTALIFHQGRLLALSEADKPYVI  195

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P+VTYRVI+K G+M
Sbjct  196   KVLEDGDLQTIGLLDYDKRLQHSFTAHPKVDPFTGEMFTFGYSHTPPYVTYRVITKKGVM  255

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITI   VMMHDFAITENYAIFMDLPLYF+PK+MV K +L + FD TKKARFGVLP
Sbjct  256   LDPVPITISDPVMMHDFAITENYAIFMDLPLYFRPKDMV-KGKLVFTFDNTKKARFGVLP  314

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+EL I+WFELPNCFIFH ANAWE+G+EVV+I+CR+++ D+++ + + KD + +F N
Sbjct  315   RYAKDELQIRWFELPNCFIFHNANAWEDGNEVVLITCRLEDFDMELETNSSKDKVANFKN  374

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRF+MKTG ASQ+KLSESAVDFPR+NENYTGRKQR+VY T    + KVK IVKFDL
Sbjct  375   ELYEMRFHMKTGEASQRKLSESAVDFPRINENYTGRKQRFVYGTTFEGITKVKAIVKFDL  434

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGKT+LEVGGNV+GIF+LGP R+GSEAIFVPRE  T  EEDDGYLI FVHDENTG
Sbjct  435   HAEPETGKTRLEVGGNVQGIFELGPRRYGSEAIFVPREPGTTSEEDDGYLIFFVHDENTG  494

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             KS +NVIDAKTMS EPVAVVELP RVPYGFHAFFV+EEQL+ QA
Sbjct  495   KSEINVIDAKTMSQEPVAVVELPKRVPYGFHAFFVSEEQLRQQA  538



>ref|XP_009138676.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Brassica 
rapa]
 gb|AEN94300.1| carotenoid cleavage dioxygenase [Brassica napus]
 gb|AEN94301.1| carotenoid cleavage dioxygenase [Brassica napus]
Length=534

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/525 (78%), Positives = 457/525 (87%), Gaps = 5/525 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPV-SGHLPEC  1643
             P P  G+++K +D +E  +VK+MHD+S PLHYLSGNFAP  +ETPP KDLPV  G LPEC
Sbjct  11    PKPSKGLSSKLLDLVERVVVKLMHDASLPLHYLSGNFAPVRDETPPVKDLPVVHGFLPEC  70

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             LNGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKTSRLKQEEFFG  
Sbjct  71    LNGEFVRVGPNPKFDPVAGYHWFDGDGMIHAVRIKDGKATYVSRYVKTSRLKQEEFFGAP  130

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KFMKIGDLKG+ GLL VYLQ LR KLKVLD SYG+GTANTAL+YH GKLLAL E DKPY 
Sbjct  131   KFMKIGDLKGLLGLLMVYLQQLRTKLKVLDVSYGHGTANTALVYHHGKLLALSEADKPYV  190

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             +KVLEDGDLQTLGM+DYDKRL H+FTAHPKVDP TGEMFTFGY+Q  P++TYRVIS+DG 
Sbjct  191   VKVLEDGDLQTLGMMDYDKRLTHSFTAHPKVDPTTGEMFTFGYSQTPPYLTYRVISEDGF  250

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             MHDPVPITI   +MMHDFAITE YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVL
Sbjct  251   MHDPVPITISEPIMMHDFAITETYAIFMDLPMHFRPKEMVKEKKMVYSFDPTKKARFGVL  310

Query  922   PRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FV  746
             PRYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM  G  K+ L+ F 
Sbjct  311   PRYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVGGDAKEKLENFS  370

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMKTG ASQKKLS SAVDFPR+NE YTG+KQRYVY T+L  +AKV GI+KFD
Sbjct  371   NELYEMRFNMKTGSASQKKLSPSAVDFPRINECYTGKKQRYVYGTILDSIAKVTGIIKFD  430

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAE ETGK  LEVGGN++GI++LG GR+GSEAI+VPREA    EEDDGYLI FVHDENT
Sbjct  431   LHAEAETGKEILEVGGNIKGIYELGQGRYGSEAIYVPREAG---EEDDGYLIFFVHDENT  487

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             GKS VNVIDAKTMSAEPVAVVELP+RVPYGFHAFFVTEEQLQ Q 
Sbjct  488   GKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHAFFVTEEQLQEQT  532



>gb|ABA99624.2| 9,10-9',10' carotenoid cleavage dioxygenase 1, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEE53683.1| hypothetical protein OsJ_37027 [Oryza sativa Japonica Group]
Length=540

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/525 (76%), Positives = 449/525 (86%), Gaps = 2/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE A V++ HD+SKPL++LSGNFAP   ETPP   LPV GHLPECL
Sbjct  15    PRPRRGLASWALDLLERAAVRLGHDASKPLYWLSGNFAPVHHETPPAPALPVRGHLPECL  74

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  75    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  134

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG +GL  V +Q LR KLKVLD +YG+GTANTALIYH GKL+AL E DKPY +
Sbjct  135   FMKIGDLKGFYGLFMVQMQQLRKKLKVLDFTYGHGTANTALIYHHGKLMALSEADKPYVV  194

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMF FGY+ + P+ TYRVI+KDG M
Sbjct  195   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFAFGYSHEPPYCTYRVITKDGAM  254

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKKARFG+L 
Sbjct  255   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKARFGILQ  314

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RY K++  I+WFELPNCFIFH ANAWEEGDEV++I+CR++NPDLD  +G   D+L +F N
Sbjct  315   RYEKDDTNIRWFELPNCFIFHNANAWEEGDEVILITCRLENPDLDKVNGYQSDNLENFGN  374

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPR+NE+YTGRKQRYVY  +L+ +AKV GI+KFDL
Sbjct  375   ELYEMRFNMKTGAASQKQLSVSAVDFPRINESYTGRKQRYVYCAILNSIAKVAGIIKFDL  434

Query  562   HAEPE-TGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             HAEPE +GK +LEVGGNV GIFDLGPGRFGSEAIFVPRE     EEDDGYLI FVHDENT
Sbjct  435   HAEPEISGKKQLEVGGNVRGIFDLGPGRFGSEAIFVPREPGVSGEEDDGYLIFFVHDENT  494

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             GKS VNVIDAKTMSA+PVAVVELP+RVPYGFHAFF+ EEQL  Q+
Sbjct  495   GKSEVNVIDAKTMSADPVAVVELPSRVPYGFHAFFINEEQLAKQS  539



>ref|XP_006293242.1| hypothetical protein CARUB_v10019573mg [Capsella rubella]
 gb|EOA26140.1| hypothetical protein CARUB_v10019573mg [Capsella rubella]
Length=533

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/526 (75%), Positives = 447/526 (85%), Gaps = 9/526 (2%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G ++K +D LE  +VK+MHD+S PLHYLSGNFAP  +ETPP KDLPV G LPECL
Sbjct  16    PQPSKGFSSKLVDLLERLVVKLMHDASLPLHYLSGNFAPVRDETPPVKDLPVHGFLPECL  75

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHW      +      +GKATYVSR+VKTSRL+QEE+FG AK
Sbjct  76    NGEFVRVGPNPKFDPVAGYHWH-----VLYFHFYNGKATYVSRYVKTSRLQQEEYFGAAK  130

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGLL V +Q LR KL +LD+SYG GTANTAL+YH GKLLAL E DKPY +
Sbjct  131   FMKIGDLKGFFGLLMVNMQQLRTKLNILDSSYGIGTANTALVYHHGKLLALQEADKPYVV  190

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGM+DYDKRL H+FTAHPKVDPVTGEMFTFGY+   PF+TYRVISKDG+M
Sbjct  191   KVLEDGDLQTLGMIDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHTPPFLTYRVISKDGIM  250

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   VMMHDFAITE YAIFMDLP++F+PKEMV +K++ Y FD+TKKARFGVLP
Sbjct  251   HDPVPITISEPVMMHDFAITETYAIFMDLPMHFRPKEMVKEKKMIYSFDSTKKARFGVLP  310

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SG +K+ L +F N
Sbjct  311   RYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGKVKEKLENFSN  370

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS SAVDFPR+NE YTG+KQRYVY T+L  +AKV GI+KFDL
Sbjct  371   ELYEMRFNMKTGSASQKKLSASAVDFPRINECYTGKKQRYVYGTILDSIAKVTGIIKFDL  430

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAE ETGK  LEVGGN+ GI+DLG GR+GSEAI+VPRE +   EEDDGYLI FVHDENTG
Sbjct  431   HAEAETGKKMLEVGGNINGIYDLGHGRYGSEAIYVPREPA---EEDDGYLIFFVHDENTG  487

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS VNVIDAKTMSAEPVAVVELP+RVPYGFHA FVTEEQLQ Q  I
Sbjct  488   KSCVNVIDAKTMSAEPVAVVELPHRVPYGFHALFVTEEQLQEQTLI  533



>gb|KCW66083.1| hypothetical protein EUGRSUZ_G03362 [Eucalyptus grandis]
Length=564

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/517 (75%), Positives = 446/517 (86%), Gaps = 1/517 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+ +  +D++E  IV  M+DSS+P  YL+GNFAP  +ETPP  DLPV GHLP+CL
Sbjct  16    PMPKKGVTSMVVDYIEKLIVNFMYDSSQPHQYLAGNFAPVADETPPVTDLPVVGHLPDCL  75

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFV VGPNPKFAPVAGYHWFDGDGM+HG+RIK+GKATYVSR+V+TSRLKQEE++G A+
Sbjct  76    NGEFVLVGPNPKFAPVAGYHWFDGDGMVHGMRIKNGKATYVSRYVRTSRLKQEEYYGGAQ  135

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F KIGDLKG+FGLL + +QMLR KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +
Sbjct  136   FKKIGDLKGLFGLLMIKMQMLRAKLKILDVSYGTGTGNTALVYHHGKLLALSEADKPYVL  195

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  196   KVLEDGDLQTLGMLDYDKRLSHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  255

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLY +PKEMV   ++ Y FD TKK+RFGVLP
Sbjct  256   HDPVPITISDPIMMHDFAITENYAIFMDLPLYVRPKEMVKDNKIIYTFDKTKKSRFGVLP  315

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFV-N  743
             RYAKN+L I+WFELPNCFIFH ANAWEE DEVV++ CR++N DLDM SG ++++L+ + +
Sbjct  316   RYAKNDLQIRWFELPNCFIFHNANAWEEEDEVVLLPCRLENLDLDMISGIVRENLENIGD  375

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQKKLS  +V FPR+NE YTGRKQRYVY T+L  +AKV GIVKFDL
Sbjct  376   ELYEMRFNMKTGLASQKKLSAPSVGFPRINECYTGRKQRYVYGTILDSIAKVTGIVKFDL  435

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE GK K+EVGGNV G+FDLGPGRFGSEA+FVPRE+    EEDDGYLI FVHDE+TG
Sbjct  436   HAEPEEGKKKIEVGGNVAGVFDLGPGRFGSEAVFVPRESGITSEEDDGYLIFFVHDESTG  495

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTE  272
             KSAVNVIDAK MS++PVAVVELP+RVPYGFHAFFVTE
Sbjct  496   KSAVNVIDAKNMSSDPVAVVELPHRVPYGFHAFFVTE  532



>ref|XP_008363317.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Malus domestica]
Length=544

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/525 (75%), Positives = 445/525 (85%), Gaps = 3/525 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G ++K +D +E  IVK M+DSS+P H L+GNFAP  +ETPP  +LPV GHLP CL
Sbjct  23    PKPNKGFSSKVVDLIEKLIVKWMYDSSQPHHDLAGNFAPVADETPPTTNLPVIGHLPXCL  82

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+ IKDGKATYVSR+V+TS LKQEE+FG +K
Sbjct  83    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMXIKDGKATYVSRYVRTSXLKQEEYFGXSK  142

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG  GL    LQMLR KLK+LD SYG GT NTAL YH GKLLALHE DKPY +
Sbjct  143   FMKIGDLKGFLGLFMXXLQMLREKLKILDMSYGFGTGNTALTYHHGKLLALHEADKPYVL  202

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P+VTYRVISKDG M
Sbjct  203   KVLEDGDLQTVGLLDYDKRLTHSFTAHPKVDPFTGEMFTFGYSWTPPYVTYRVISKDGFM  262

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDP+PITIP  VMMHDFAITENYAIFMDLPL F+PKEMV +++L + FD  KKARFG+LP
Sbjct  263   HDPIPITIPDPVMMHDFAITENYAIFMDLPLIFKPKEMVKEQKLIFTFDQXKKARFGLLP  322

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFVNE  740
             RYAK+ELLI+WFELPNCFIFH ANAWEE DEVV+I+CR +N DL M    L+   +F NE
Sbjct  323   RYAKDELLIRWFELPNCFIFHNANAWEEXDEVVLITCRXENXDLXMFKEKLE---NFXNE  379

Query  739   LYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLH  560
             LYEMRFN+KTGLASQKKLSE+AVDFPRVNE+YTGRKQRYVY T+L  + KV G+ KFDLH
Sbjct  380   LYEMRFNLKTGLASQKKLSEAAVDFPRVNESYTGRKQRYVYGTLLDSIFKVTGVAKFDLH  439

Query  559   AEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGK  380
             AE E GKT++EVGGNV+G++DLGPGRFGSEAIFVPR      EEDDGYLILFVHDENTGK
Sbjct  440   AEXEVGKTQIEVGGNVQGLYDLGPGRFGSEAIFVPRTPGVTSEEDDGYLILFVHDENTGK  499

Query  379   SAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             SA++V+DAKTMS  PVAVVELP+RVPYG HA FVTEEQLQ QA++
Sbjct  500   SAIHVVDAKTMSPXPVAVVELPHRVPYGLHAIFVTEEQLQEQAKL  544



>ref|XP_003577349.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Brachypodium distachyon]
Length=546

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/524 (75%), Positives = 443/524 (85%), Gaps = 1/524 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE   V++ HD ++PL++LSGNFAP  +ETPP  DLPV GHLPECL
Sbjct  21    PRPRKGVASWAVDLLERVAVRLAHDKTRPLYWLSGNFAPVTDETPPAHDLPVRGHLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVG NPKF PVAGYHWFDGDGMIH +RIKDGKATY+SR+VKTSRLKQEE+FG AK
Sbjct  81    NGEFVRVGSNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYISRYVKTSRLKQEEYFGGAK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR KL VLD +YG GTANTAL+YH GKL+AL E DKPY +
Sbjct  141   FMKIGDLKGFFGLFMVLMQELRKKLNVLDATYGTGTANTALVYHHGKLMALSEADKPYVV  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H FTAHPKVDP T EMFTFGY+ + P+ TYRVI+KDG+M
Sbjct  201   KVLEDGDLQTLGLLDYDKRLKHPFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKDGVM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKKARFG+L 
Sbjct  261   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKARFGILQ  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFV-N  743
             RY K+E  I+WFELPNCFIFH ANAWEEG+EV++I+CRI NPDLD A+G     L+   N
Sbjct  321   RYEKDEKNIRWFELPNCFIFHNANAWEEGEEVILITCRINNPDLDKANGHQSIKLENSGN  380

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPR+NE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  381   ELYEMRFNMKTGAASQKQLSVSAVDFPRINESYTGRKQRYVYCTVLDSIAKVTGIIKFDL  440

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAE E+GK +LEVGGNV GI+DLGPGR+GSEA+FVP+E     EEDDGYLI FVHDENTG
Sbjct  441   HAEAESGKKQLEVGGNVRGIYDLGPGRYGSEAVFVPKEPGVSGEEDDGYLIFFVHDENTG  500

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             KS VNVIDAKTMSA+PVAVVELPNRVPYGFHAFFV EEQL  QA
Sbjct  501   KSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVNEEQLGRQA  544



>ref|XP_006664795.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Oryza brachyantha]
Length=548

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/524 (75%), Positives = 446/524 (85%), Gaps = 1/524 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE   V++ HD+SKPLH+LSGNFAP  +ETPP + LPV GHLPECL
Sbjct  22    PQPRRGLASWALDLLERVAVRLGHDASKPLHWLSGNFAPIRDETPPAQGLPVRGHLPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  82    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  141

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR KLKVLD +YG GTANTALIYH GKL+AL E DKPY +
Sbjct  142   FMKIGDLKGFFGLFMVQMQQLRKKLKVLDFTYGFGTANTALIYHHGKLMALSEADKPYVV  201

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMFTFGY+ + P+ TYRVI+KDG+M
Sbjct  202   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKDGVM  261

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP  VMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKKARFG+L 
Sbjct  262   LDPVPITIPEPVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKARFGILQ  321

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RY K++  I+WFELPNCFIFH ANAWEEGDEV++I+CR+++PDLD  +G   + L+ F N
Sbjct  322   RYEKDDKNIRWFELPNCFIFHNANAWEEGDEVILITCRLEDPDLDKVNGYQSEKLENFGN  381

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS S VDFPR+NE+YTGRKQRYVY T L  +AKV GIVKFDL
Sbjct  382   ELYEMRFNMKTGAASQKQLSVSTVDFPRINESYTGRKQRYVYCTSLDSIAKVTGIVKFDL  441

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE+GK +LEVGG V+GI+DLGPGRFGSEAIFVP+E     EEDDGYLI FVHDE TG
Sbjct  442   HAEPESGKKQLEVGGTVKGIYDLGPGRFGSEAIFVPKEPGVSGEEDDGYLIFFVHDEKTG  501

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             KS V+VIDAKTMSA+PVAVVELPNRVPYGFHAFFV EEQL  Q+
Sbjct  502   KSQVHVIDAKTMSADPVAVVELPNRVPYGFHAFFVNEEQLAKQS  545



>ref|XP_010088226.1| hypothetical protein L484_012508 [Morus notabilis]
 gb|EXB32778.1| hypothetical protein L484_012508 [Morus notabilis]
Length=581

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/526 (74%), Positives = 448/526 (85%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+++K +DW E  +VK+M+DSS   HYLSGNFAP P ETPP  DLPVSG LPECL
Sbjct  9     PKPKKGLSSKLVDWFENVVVKLMYDSSHSHHYLSGNFAPLPHETPPTTDLPVSGSLPECL  68

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVR+ PNPKF PVAGYHWFDGDGM+HG+RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  69    NGEFVRMCPNPKFRPVAGYHWFDGDGMVHGVRIKDGKATYVSRYVKTSRLKQEEYFGAAK  128

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             ++K GDLKG+ G     +QMLR  LKVLD+SYG GTANTAL+YH GKLLALHE DKPY +
Sbjct  129   YLKYGDLKGLSGFFMFIVQMLRGMLKVLDHSYGGGTANTALVYHSGKLLALHEVDKPYVL  188

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDL+TLGMLDYDKRL H+FTAHPK+DP TGEMF+FGYAQ  P+VTYRV SKDG M
Sbjct  189   KVLEDGDLETLGMLDYDKRLQHSFTAHPKIDPFTGEMFSFGYAQTPPYVTYRVTSKDGFM  248

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITIP  VMMHDFAITENYAIFMDLP +F+PKEMV + ++ Y+FD TKKARFGVLP
Sbjct  249   HDPVPITIPDPVMMHDFAITENYAIFMDLPFFFKPKEMVKENKMIYQFDTTKKARFGVLP  308

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDF-VN  743
             RYAKNELLIKWFELP+CFIFH ANAWEE DEVV+I+CR++NPDL +  G +++ L+  + 
Sbjct  309   RYAKNELLIKWFELPSCFIFHNANAWEEEDEVVLITCRLENPDLVIVGGKVQEKLENPLE  368

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKT LASQ+KLSE  VDFPR+NE+YTGRKQRYVY T L ++AKV GIVKFDL
Sbjct  369   ELYEMRFNMKTCLASQRKLSEKMVDFPRINESYTGRKQRYVYVTRLDNIAKVSGIVKFDL  428

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE+GKT +EVGGNV+G++D GPGRFGSEAIFVP+      EEDDGYLI F HDENTG
Sbjct  429   HAEPESGKTCIEVGGNVQGLYDPGPGRFGSEAIFVPKVPGITSEEDDGYLIFFAHDENTG  488

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+V+VIDAKTMS +PVAVV+LP+RVPYGFHA FVTE +    A I
Sbjct  489   KSSVHVIDAKTMSPDPVAVVDLPHRVPYGFHALFVTEPRRSKSARI  534



>gb|EEC69751.1| hypothetical protein OsI_39285 [Oryza sativa Indica Group]
Length=540

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/525 (75%), Positives = 448/525 (85%), Gaps = 2/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE A V++ HD+SKPL++LSGNFAP   ETPP   LPV GHLPECL
Sbjct  15    PRPRRGLASWALDLLERAAVRLGHDASKPLYWLSGNFAPVHHETPPAPALPVRGHLPECL  74

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  75    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  134

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG +GL  V +Q LR KLKVLD +YG+GTANTALIYH GKL+AL E DKPY +
Sbjct  135   FMKIGDLKGFYGLFMVQMQQLRKKLKVLDFTYGHGTANTALIYHHGKLMALSEADKPYVV  194

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMF FGY+ + P+ TYRVI+KDG M
Sbjct  195   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFAFGYSHEPPYCTYRVITKDGAM  254

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKKARFG+L 
Sbjct  255   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKARFGILQ  314

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RY K++  I+WFELPNCFIFH ANAWEEGDEV++I+CR++NPDLD  +G   D+L +F N
Sbjct  315   RYEKDDTNIRWFELPNCFIFHNANAWEEGDEVILITCRLENPDLDKVNGYQSDNLENFGN  374

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPR+NE+ TGRKQRYVY  +L+ +AKV GI+KFDL
Sbjct  375   ELYEMRFNMKTGAASQKQLSVSAVDFPRINESCTGRKQRYVYCAILNSIAKVAGIIKFDL  434

Query  562   HAEPE-TGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             HAEPE +GK +LEVGGNV GIFDLGPGRFGSEAIFVP+E     EEDDGYLI FVHDENT
Sbjct  435   HAEPEISGKKQLEVGGNVRGIFDLGPGRFGSEAIFVPKEPGVSGEEDDGYLIFFVHDENT  494

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             GKS VNVIDAKTMSA+PVAVVELP+RVPYGFHAFF+ EEQL  Q+
Sbjct  495   GKSEVNVIDAKTMSADPVAVVELPSRVPYGFHAFFINEEQLAKQS  539



>gb|ACO87673.1| carotenoid cleavage dioxygenase [Brachypodium sylvaticum]
Length=545

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/525 (74%), Positives = 443/525 (84%), Gaps = 1/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE   V++ HD ++PL++LSGNFAP  +ETPP  DLPV GHLPECL
Sbjct  20    PRPRKGVASWAVDLLERVAVRLAHDRTRPLYWLSGNFAPVTDETPPAHDLPVRGHLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVG NPKF PVAGYHWFDGDGMIH +RIKDGKA Y+SR+VKTSRLKQEE+FG AK
Sbjct  80    NGEFVRVGSNPKFVPVAGYHWFDGDGMIHAMRIKDGKAAYISRYVKTSRLKQEEYFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR +LKVLD +YG GTANTAL+YH GKL+AL E DKPY +
Sbjct  140   FMKIGDLKGFFGLFMVLMQELRKQLKVLDATYGTGTANTALVYHHGKLMALSEADKPYVV  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H FTAHPKVDP T EMFTFGY+ + P+ TYRVI+KDG+M
Sbjct  200   KVLEDGDLQTLGLLDYDKRLKHPFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKDGVM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKK+RFG+L 
Sbjct  260   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKSRFGILQ  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFV-N  743
             RY K+E  I+WFELPNCFIFH ANAWEEG+EV++I+CRI+NPDLD  +      L+   N
Sbjct  320   RYEKDEKNIRWFELPNCFIFHNANAWEEGEEVILITCRIENPDLDKVNSHQSIKLENSGN  379

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPR+NE+YTGRKQRYVY TML  +AKV GI+KFDL
Sbjct  380   ELYEMRFNMKTGAASQKQLSVSAVDFPRINESYTGRKQRYVYCTMLDSIAKVTGIIKFDL  439

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAE E+GK +LE+GGNV GI+DLGPGR+GSEA+FVP+E     EEDDGYLI FVHDENTG
Sbjct  440   HAEAESGKKQLEIGGNVSGIYDLGPGRYGSEAVFVPKEPGVSGEEDDGYLIFFVHDENTG  499

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS VNVIDAKTMSA+PVAVVELPNRVPYGFHAFFV EEQL  QAE
Sbjct  500   KSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVNEEQLGRQAE  544



>ref|XP_004510990.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Cicer arietinum]
Length=565

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/517 (78%), Positives = 451/517 (87%), Gaps = 1/517 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  +K +D LE  +VK+ +DSS P H+L+GNFAP  +ETPP  DL V G LP+CL
Sbjct  17    PKPSNGFTSKVVDLLEKVVVKLFYDSSLPHHWLAGNFAPVQDETPPTTDLTVKGFLPDCL  76

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEE+FG +K
Sbjct  77    NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEYFGGSK  136

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+ GLL V +QMLR KLKVLD SYG GTANTAL+YH  KLLAL EGDKPYAI
Sbjct  137   FMKIGDLKGLLGLLMVNVQMLRAKLKVLDVSYGTGTANTALVYHHRKLLALSEGDKPYAI  196

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLG+LDYDKRLGH+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  197   KVFEDGDLQTLGLLDYDKRLGHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGYM  256

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV  K L + FD+TKKARFGVLP
Sbjct  257   HDPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKNKTLIFSFDSTKKARFGVLP  316

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+E LI+WFELPNCFIFH ANAWEE DE+V+I+CR++NPDLDM SG +K+ L +F N
Sbjct  317   RYAKDEKLIRWFELPNCFIFHNANAWEEEDEIVLITCRLENPDLDMVSGAVKEKLENFNN  376

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+K+G ASQKKLS SAVDFPRVNE+YTGRKQRYVY T L  +AKV GI+KFDL
Sbjct  377   ELYEMRFNIKSGEASQKKLSASAVDFPRVNESYTGRKQRYVYGTTLDSIAKVTGIIKFDL  436

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HA+P++GKTKLEVGGNVEG++DLGPGRFGSEA++VPR   T  EEDDGYLI FVHDEN G
Sbjct  437   HAKPDSGKTKLEVGGNVEGLYDLGPGRFGSEAVYVPRIPGTDSEEDDGYLIFFVHDENIG  496

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTE  272
             KS V+VIDAKTMSA+PVAVVELP RVPYGFHAFFVTE
Sbjct  497   KSFVHVIDAKTMSADPVAVVELPQRVPYGFHAFFVTE  533



>gb|KDO83428.1| hypothetical protein CISIN_1g007605mg [Citrus sinensis]
Length=596

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/527 (75%), Positives = 449/527 (85%), Gaps = 2/527 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+AAK ID++E  IVK MHDSS+PLHYLSGNF P   ETPP  DLPV G L ECL
Sbjct  70    PKPQKGLAAKVIDFVEGLIVKFMHDSSRPLHYLSGNFGPVRHETPPTADLPVIGFLHECL  129

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEF+RVGPN KFAPVAGYHWFDGDGM+HGLRIKDGKA YVSR+VKTSRLKQEEFFG AK
Sbjct  130   NGEFIRVGPNSKFAPVAGYHWFDGDGMLHGLRIKDGKAAYVSRYVKTSRLKQEEFFGGAK  189

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F KIGD+KG+FGLL V + +LR   KVLD SYGNG  NTALIYH GKLL L E DKPY +
Sbjct  190   FTKIGDVKGLFGLLMVNMTLLRESFKVLDFSYGNGAGNTALIYHHGKLLVLSEIDKPYVL  249

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVL+DGDLQTLGMLDYDKRL H FTAHPK+DP T EMFTFGY Q  P+VTYRVISKDG M
Sbjct  250   KVLKDGDLQTLGMLDYDKRLNHPFTAHPKIDPYTDEMFTFGYTQTPPYVTYRVISKDGFM  309

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+ A +MMHDFAITENYAIF+DLP+ F+ KEMV + +L Y FD T KARFGVLP
Sbjct  310   HDPVPITMSAPIMMHDFAITENYAIFLDLPMCFRQKEMVKENKLIYAFDPTIKARFGVLP  369

Query  919   RYAKNELLIKWFELPNCFIFHTANAW-EEGDEVVMISCRIQNPDLDMASGTLKDSL-DFV  746
             RYA+++L I+WFELPNC+IFH ANAW EE DEVV+I+CR++NPDLDM +G LK++L D  
Sbjct  370   RYARDDLQIRWFELPNCYIFHNANAWEEEEDEVVLITCRVRNPDLDMFNGPLKETLEDQT  429

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
              ELYEMRFNMKTGLASQKKLS + VDFPR+NE+Y GRKQRYVY ++L ++AKV G++KFD
Sbjct  430   TELYEMRFNMKTGLASQKKLSPACVDFPRINEHYMGRKQRYVYGSILENIAKVTGMIKFD  489

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             L AEPETGKTKLEVGGNV+GIFDLGPGRFGSEA+FVPRE S+  EEDDGYLI  VHDENT
Sbjct  490   LRAEPETGKTKLEVGGNVKGIFDLGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENT  549

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKSAV VIDAKTMSA+PVAV+ELP+RVPYGFH  F++EEQL+  A++
Sbjct  550   GKSAVYVIDAKTMSADPVAVIELPHRVPYGFHGIFLSEEQLEELAKL  596



>ref|NP_001067395.2| Os12g0640600 [Oryza sativa Japonica Group]
 dbj|BAF30414.2| Os12g0640600 [Oryza sativa Japonica Group]
Length=540

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/525 (75%), Positives = 447/525 (85%), Gaps = 2/525 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE A V++ HD+SKPL++LSGNFAP   ETPP   LPV GHLPECL
Sbjct  15    PRPRRGLASWALDLLERAAVRLGHDASKPLYWLSGNFAPVHHETPPAPALPVRGHLPECL  74

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  75    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  134

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG +GL  V +Q LR KLKVLD +YG+GTANTALIYH GKL+AL E DKPY +
Sbjct  135   FMKIGDLKGFYGLFMVQMQQLRKKLKVLDFTYGHGTANTALIYHHGKLMALSEADKPYVV  194

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMF FGY+ + P+ TYRVI+KDG M
Sbjct  195   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFAFGYSHEPPYCTYRVITKDGAM  254

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKKARFG+L 
Sbjct  255   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKARFGILQ  314

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RY K++  I+WFELPNCFIFH ANAWEEGDEV++I+CR++NPDLD  +G   D+L +F N
Sbjct  315   RYEKDDTNIRWFELPNCFIFHNANAWEEGDEVILITCRLENPDLDKVNGYQSDNLENFGN  374

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPR+NE+YTGRKQRYVY  +L+ +AKV  I+KFDL
Sbjct  375   ELYEMRFNMKTGAASQKQLSVSAVDFPRINESYTGRKQRYVYCAILNSIAKVAXIIKFDL  434

Query  562   HAEPE-TGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             HAEPE +G  +LEVGGNV GIFDLGPGRFGSEAIFVPRE     EEDDGYLI FVHDENT
Sbjct  435   HAEPEISGFKQLEVGGNVRGIFDLGPGRFGSEAIFVPREPGVSGEEDDGYLIFFVHDENT  494

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             GKS VNVIDAKTMSA+PVAVVELP+RVPYGFHAFF+ EEQL  Q+
Sbjct  495   GKSEVNVIDAKTMSADPVAVVELPSRVPYGFHAFFINEEQLAKQS  539



>ref|XP_006439106.1| hypothetical protein CICLE_v10031014mg [Citrus clementina]
 gb|ESR52346.1| hypothetical protein CICLE_v10031014mg [Citrus clementina]
Length=597

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/528 (75%), Positives = 449/528 (85%), Gaps = 3/528 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+AAK ID LE  IVK  HDSS+PLHYLSGNF P   ETPP  DLPV G LPECL
Sbjct  70    PKPQKGLAAKVIDSLEGLIVKFKHDSSRPLHYLSGNFGPVRHETPPTADLPVIGFLPECL  129

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEF+RVGPN KFAPVAGYHWFDGDGM+HGLRIKDGKA YVSR+VKTSRLKQEEFFG AK
Sbjct  130   NGEFIRVGPNSKFAPVAGYHWFDGDGMLHGLRIKDGKAAYVSRYVKTSRLKQEEFFGGAK  189

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F KIGD+KG+FGLL V + +LR   KVLD SYGNG  NTALIYH GKLL L E DKPY +
Sbjct  190   FTKIGDVKGLFGLLMVNMTLLRESFKVLDFSYGNGAGNTALIYHHGKLLVLSEIDKPYVL  249

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVL+DGDLQTLGMLDYDKRL H FTAHPK+DP T EMFTFGY Q  P+VTYRVISKDG M
Sbjct  250   KVLKDGDLQTLGMLDYDKRLNHPFTAHPKIDPYTDEMFTFGYTQTPPYVTYRVISKDGFM  309

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+ A +MMHDFAITENYAIF+DLP+ F+ KEMV + +L Y FD T KARFGVLP
Sbjct  310   HDPVPITMSAPIMMHDFAITENYAIFLDLPMCFRQKEMVKENKLIYAFDPTIKARFGVLP  369

Query  919   RYAKNELLIKWFELPNCFIFHTANAW--EEGDEVVMISCRIQNPDLDMASGTLKDSL-DF  749
             RYA+++L I+WFELPNC+IFH ANAW  EE +EVV+I+CR++NPDLDM +G LK++L D 
Sbjct  370   RYARDDLQIRWFELPNCYIFHNANAWEEEEEEEVVLITCRVRNPDLDMFNGPLKETLEDQ  429

Query  748   VNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKF  569
               ELYEMRFNMKTGLASQKKLS + VDFPR+NE+Y GRKQRYVY ++L ++AKV GI+KF
Sbjct  430   TTELYEMRFNMKTGLASQKKLSPACVDFPRINEHYMGRKQRYVYGSILENIAKVTGIIKF  489

Query  568   DLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDEN  389
             DLHAEPETGKTKLEVGGNV+GIFDLGPGRFGSEA+FVPRE S+  EEDDGYLI  VHDEN
Sbjct  490   DLHAEPETGKTKLEVGGNVKGIFDLGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDEN  549

Query  388   TGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             TGKSAV VIDAKTMSA+PVAV+ELP+RVPYGFH  F++EEQL+  A++
Sbjct  550   TGKSAVYVIDAKTMSADPVAVIELPHRVPYGFHGIFLSEEQLEELAKL  597



>gb|ABA99623.2| 9,10-9',10' carotenoid cleavage dioxygenase 1, putative, expressed 
[Oryza sativa Japonica Group]
Length=547

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/532 (74%), Positives = 448/532 (84%), Gaps = 9/532 (2%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE A V++ HD+SKPL++LSGNFAP   ETPP   LPV GHLPECL
Sbjct  15    PRPRRGLASWALDLLERAAVRLGHDASKPLYWLSGNFAPVHHETPPAPALPVRGHLPECL  74

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  75    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  134

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPY--  1286
             FMKIGDLKG +GL  V +Q LR KLKVLD +YG+GTANTALIYH GKL+AL E DKP   
Sbjct  135   FMKIGDLKGFYGLFMVQMQQLRKKLKVLDFTYGHGTANTALIYHHGKLMALSEADKPCKF  194

Query  1285  -----AIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRV  1121
                   +KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMF FGY+ + P+ TYRV
Sbjct  195   SSHNDVVKVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFAFGYSHEPPYCTYRV  254

Query  1120  ISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKK  941
             I+KDG M DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKK
Sbjct  255   ITKDGAMLDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKK  314

Query  940   ARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKD  761
             ARFG+L RY K++  I+WFELPNCFIFH ANAWEEGDEV++I+CR++NPDLD  +G   D
Sbjct  315   ARFGILQRYEKDDTNIRWFELPNCFIFHNANAWEEGDEVILITCRLENPDLDKVNGYQSD  374

Query  760   SL-DFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVK  584
             +L +F NELYEMRFNMKTG ASQK+LS SAVDFPR+NE+YTGRKQRYVY  +L+ +AKV 
Sbjct  375   NLENFGNELYEMRFNMKTGAASQKQLSVSAVDFPRINESYTGRKQRYVYCAILNSIAKVA  434

Query  583   GIVKFDLHAEPE-TGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLIL  407
             GI+KFDLHAEPE +GK +LEVGGNV GIFDLGPGRFGSEAIFVPRE     EEDDGYLI 
Sbjct  435   GIIKFDLHAEPEISGKKQLEVGGNVRGIFDLGPGRFGSEAIFVPREPGVSGEEDDGYLIF  494

Query  406   FVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             FVHDENTGKS VNVIDAKTMSA+PVAVVELP+RVPYGFHAFF+ EEQL  Q+
Sbjct  495   FVHDENTGKSEVNVIDAKTMSADPVAVVELPSRVPYGFHAFFINEEQLAKQS  546



>ref|XP_010088227.1| hypothetical protein L484_012509 [Morus notabilis]
 gb|EXB32779.1| hypothetical protein L484_012509 [Morus notabilis]
Length=539

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/526 (75%), Positives = 442/526 (84%), Gaps = 1/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ +K ID  E  IVK+ + SS+  HYLSG FAP   ETPP  DLPVSG LPECL
Sbjct  14    PKPNRGLTSKLIDCFETVIVKLFYRSSQSHHYLSGTFAPVRHETPPTADLPVSGSLPECL  73

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPK  PVAGYHWFDGDGM+HG+RIKDGKATYVSR+VKTSRL+QEE+FG AK
Sbjct  74    NGEFVRVGPNPKLDPVAGYHWFDGDGMVHGVRIKDGKATYVSRYVKTSRLQQEEYFGGAK  133

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F+KIGDLKG+FGLL   +Q LR  LKVLD SYG+GTANTAL+YH GKLLALHEGDKPY +
Sbjct  134   FLKIGDLKGLFGLLMFNMQTLRRMLKVLDLSYGSGTANTALVYHSGKLLALHEGDKPYVL  193

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H FTAHPKVDP TGEMF+FGYA   P+VTYR+ISKDG M
Sbjct  194   KVLEDGDLQTLGMLDYDKRLQHPFTAHPKVDPFTGEMFSFGYATTPPYVTYRIISKDGFM  253

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVP+TI   VMMHDFAITENYAIFMDLPL  +PKEMVT+ +L Y FDA KKARFGVLP
Sbjct  254   HDPVPLTISDPVMMHDFAITENYAIFMDLPLIMKPKEMVTENRLIYSFDANKKARFGVLP  313

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFV-N  743
             RYAK+ELLIKWFELPNCFIFH A AWEE DEVV+I+CR+ N DLD   GT+K++L+    
Sbjct  314   RYAKDELLIKWFELPNCFIFHNATAWEEEDEVVLITCRVDNLDLDAGGGTVKENLEHSRT  373

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQ+KLS SAVDFPRVNE+YTGRKQRYVY T L  + K+ GIVKFDL
Sbjct  374   ELYEMRFNMKTGLASQRKLSASAVDFPRVNESYTGRKQRYVYGTKLGSIGKITGIVKFDL  433

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             H+EP++ KT LEVGG V+G++DLGP R GSEA+FVP+      EEDDGYLI FVHDE +G
Sbjct  434   HSEPDSDKTCLEVGGTVQGLYDLGPNRCGSEAVFVPKVPGVTSEEDDGYLIFFVHDEKSG  493

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAV+VIDAKTMS +PVAVV+LP+RVP GFHA FVTEEQLQ QA++
Sbjct  494   KSAVHVIDAKTMSPDPVAVVDLPSRVPPGFHALFVTEEQLQEQAKL  539



>ref|XP_006482868.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Citrus sinensis]
Length=597

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/528 (75%), Positives = 449/528 (85%), Gaps = 3/528 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+AAK ID LE  IVK  HDSS+PLHYLSGNF P   ETPP  DLPV G LPECL
Sbjct  70    PKPQKGLAAKVIDSLEGLIVKFKHDSSRPLHYLSGNFGPVRHETPPTADLPVIGFLPECL  129

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEF+RVGPN KFAPVAGYHWFDGDGM+HGLRIKDGKA YVSR+VKTSRLKQEEFFG AK
Sbjct  130   NGEFIRVGPNSKFAPVAGYHWFDGDGMLHGLRIKDGKAAYVSRYVKTSRLKQEEFFGGAK  189

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F KIGD+KG+FGLL V + +LR   KVLD SYGNG  NTALIYH GKLL L E DKPY +
Sbjct  190   FTKIGDVKGLFGLLMVNMTLLRESFKVLDFSYGNGAGNTALIYHHGKLLVLSEIDKPYVL  249

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVL+DGDLQTLGMLDYDKRL H FTAHPK+DP T EMFTFGY Q  P+VTYRVISKDG M
Sbjct  250   KVLKDGDLQTLGMLDYDKRLNHPFTAHPKIDPYTDEMFTFGYTQTPPYVTYRVISKDGFM  309

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+ A +MMHDFAITENYAIF+DLP+ F+ KEMV + +L Y FD T KARFGVLP
Sbjct  310   HDPVPITMSAPIMMHDFAITENYAIFLDLPMCFRQKEMVKENKLIYAFDPTIKARFGVLP  369

Query  919   RYAKNELLIKWFELPNCFIFHTANAW--EEGDEVVMISCRIQNPDLDMASGTLKDSL-DF  749
             RYA+++L I+WFELPNC+IFH ANAW  EE +EVV+I+CR++NPDLDM +G LK++L D 
Sbjct  370   RYARDDLQIRWFELPNCYIFHNANAWEEEEEEEVVLITCRVRNPDLDMFNGPLKETLEDQ  429

Query  748   VNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKF  569
               ELYEMRFNMKTGLASQKKLS + VDFPR+NE+Y GRKQRYVY ++L ++AKV G++KF
Sbjct  430   TTELYEMRFNMKTGLASQKKLSPACVDFPRINEHYMGRKQRYVYGSILENIAKVTGLIKF  489

Query  568   DLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDEN  389
             DLHAEPETGKTKLEVGGNV+GIFDLGPGRFGSEA+FVPRE S+  EEDDGYLI  VHDEN
Sbjct  490   DLHAEPETGKTKLEVGGNVKGIFDLGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDEN  549

Query  388   TGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             TGKSAV VIDAKTMSA+PVAV+ELP+RVPYGFH  F++EEQL+  A++
Sbjct  550   TGKSAVYVIDAKTMSADPVAVIELPHRVPYGFHGIFLSEEQLEELAKL  597



>gb|AGT17077.1| carotenoid cleavage dioxygenase [Saccharum hybrid cultivar R570]
Length=543

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/525 (75%), Positives = 446/525 (85%), Gaps = 6/525 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE  +V++ HD +KPLH+LSGNFAP  EETPP  +L V GHLPECL
Sbjct  22    PRPRKGLASWALDLLESLVVRLGHDKTKPLHWLSGNFAPVVEETPPAPNLTVRGHLPECL  81

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHW     MIH +RIKDGKATYVSR+VKT+RLKQEE FG AK
Sbjct  82    NGEFVRVGPNPKFVPVAGYHW-----MIHAMRIKDGKATYVSRYVKTARLKQEEDFGGAK  136

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG FGL  V +Q LR K KVLD +YG GTANTALIYH GKL+AL E DKPY +
Sbjct  137   FMKIGDLKGFFGLFMVQMQQLRKKFKVLDFTYGFGTANTALIYHHGKLMALSEADKPYVV  196

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+F+AHPKVDP T EMFTFGY+ + P+ TYRVI+K+G M
Sbjct  197   KVLEDGDLQTLGLLDYDKRLKHSFSAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKEGAM  256

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
               PVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKKARFG+LP
Sbjct  257   LVPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKARFGILP  316

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++ +I+WFELPNCFIFH ANAWEEGDEVV+I+CR++NPDLD  +G   D L +F N
Sbjct  317   RYAKDDKVIRWFELPNCFIFHNANAWEEGDEVVLITCRLENPDLDKVNGHQNDKLENFGN  376

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  377   ELYEMRFNMKTGAASQKQLSVSAVDFPRVNESYTGRKQRYVYCTILDSIAKVTGIIKFDL  436

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPE+GK +LEVGGN++GI++LGPGRFGSEAIFVP++     EEDDGYLI FVHDENTG
Sbjct  437   HAEPESGKKELEVGGNIQGIYNLGPGRFGSEAIFVPKQPGVSGEEDDGYLIFFVHDENTG  496

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             KS VNVIDAKTMSA+PVAVVELPNRVPYGFHAFFVTE+QL  QAE
Sbjct  497   KSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTEDQLAQQAE  541



>sp|C3VEQ4.1|CCD1_ONCHC RecName: Full=Carotenoid 9,10(9',10')-cleavage dioxygenase 1; 
AltName: Full=Carotenoid cleavage dioxygenase 1; Short=OgCCD1 
[Oncidium hybrid cultivar]
 gb|ACP27629.1| carotenoid cleavage dioxygenase [Oncidium hybrid cultivar]
Length=562

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/527 (74%), Positives = 448/527 (85%), Gaps = 3/527 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ GI +  ID +E  IV   HDSSKPLHYL+GNFAP  +ETPP   L V G LP CL
Sbjct  37    PKPRKGILSSTIDLIEKVIVYFAHDSSKPLHYLTGNFAPVRDETPPFAALTVHGSLPVCL  96

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKATYVSR+VKTS+L QEE+F  AK
Sbjct  97    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVKTSKLMQEEYFEGAK  156

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGL  V +++LR KLK+LD SYG  TANTA+IYH GKLLAL EGDKPY I
Sbjct  157   FMKIGDLKGLFGLFMVQMELLRAKLKILDVSYGRSTANTAMIYHHGKLLALSEGDKPYVI  216

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDY+KRL H+FTAHPKVDP T EMFTFGY+  +P++TYRVI+KDG+M
Sbjct  217   KVLEDGDLQTLGLLDYNKRLAHSFTAHPKVDPFTDEMFTFGYSHTSPYITYRVITKDGVM  276

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              +PVPITIP  +MMHDFAITENYAIF+DLPLYF+PKE + K +L + FD TKKA+FGVLP
Sbjct  277   LNPVPITIPEPIMMHDFAITENYAIFLDLPLYFRPKETI-KGKLIFTFDPTKKAKFGVLP  335

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+E LI+WF+LPNCFIFH ANAWE+GDEVV+I+CR++N DLD+ +G +K+ L +F N
Sbjct  336   RYAKDEQLIRWFDLPNCFIFHNANAWEDGDEVVLITCRLKNIDLDLVNGAVKEKLENFSN  395

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             +LYEMRFNMKTG A+QK+LS   VDFPR+NENYTGRKQRYVY T  +++ KV GIVKFDL
Sbjct  396   QLYEMRFNMKTGAATQKELSAPMVDFPRINENYTGRKQRYVYCTSFANIDKVNGIVKFDL  455

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPETGK  LEVGGNV GIFDLGPGRFGSEA+FVPREA T  EEDDGYLI FV+DE TG
Sbjct  456   HAEPETGKKVLEVGGNVLGIFDLGPGRFGSEAVFVPREAGTRVEEDDGYLIFFVYDETTG  515

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQ-TQAEI  245
             +S V VIDAKTMS EPVAVV+LP RVPYGFHAFFV EEQ+Q  QAEI
Sbjct  516   ESKVYVIDAKTMSPEPVAVVDLPCRVPYGFHAFFVNEEQIQKQQAEI  562



>gb|KEH19092.1| carotenoid 9,10(9',10')-cleavage dioxygenase [Medicago truncatula]
Length=575

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/526 (73%), Positives = 449/526 (85%), Gaps = 3/526 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+   ++KA+D LE  +VK+ +DSS P H+L+GNFAP  +ETPP KDLPV G+LP+CL
Sbjct  52    PKPRKCFSSKAVDLLEKLVVKLFYDSSLPHHWLAGNFAPVKDETPPTKDLPVKGYLPDCL  111

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEE+FG +K
Sbjct  112   NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEYFGGSK  171

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GD+KG+ G+L V +Q+LR KLK+LD SYG GTANT L+YH+  LLAL E DKPYAI
Sbjct  172   FMKVGDIKGLLGVLMVTIQILREKLKILDVSYGTGTANTGLVYHNAMLLALSERDKPYAI  231

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDL TLGMLDYDKRL H FTAHPKVDP TG+MFTFGY+Q  P++TYRVISKDG M
Sbjct  232   KVFEDGDLHTLGMLDYDKRLDHYFTAHPKVDPFTGDMFTFGYSQTPPYITYRVISKDGYM  291

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +M+HDFAITENYAIFMDLP+YF+PKEMV  K+L + FD+TKKARFGVLP
Sbjct  292   HDPVPITISNPIMVHDFAITENYAIFMDLPVYFRPKEMVKNKRLVFSFDSTKKARFGVLP  351

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++  I+WFELPNCFIFH ANAWEE DEVV+I+CR++N DLDM +  +KD L +F N
Sbjct  352   RYAKDDKHIRWFELPNCFIFHNANAWEEEDEVVLITCRLKNLDLDMVAEDIKDKLKNFSN  411

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG A+QKKLS  +VDFPRVNE YTGRKQ+YVY T+L   +   GI+KFDL
Sbjct  412   ELYEMRFNMKTGKAAQKKLSTYSVDFPRVNERYTGRKQKYVYGTILG--SNATGIIKFDL  469

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             +AEP  GKTKLEVGGN+ G++DLGPG F S+AI+VPR   T  +EDDGYLI FVHDENT 
Sbjct  470   NAEPNFGKTKLEVGGNIHGLYDLGPGTFCSDAIYVPRVPGTDSDEDDGYLIFFVHDENTR  529

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+V+VIDAKTMSA+PVAVVELP RVPYGFHAFFVTE+QLQ QA++
Sbjct  530   KSSVHVIDAKTMSADPVAVVELPQRVPYGFHAFFVTEDQLQEQAKL  575



>emb|CAD71148.1| carotenoid cleavage dioxygenase [Bixa orellana]
Length=544

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/526 (72%), Positives = 444/526 (84%), Gaps = 2/526 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G++ K +D LE  + + MHD + P+HYL GNF P  EE PP  +LPV G +P+ L
Sbjct  20    PRPTHGLSGKGVDMLERGLARFMHDGNMPVHYLCGNFGPIMEEAPPTCNLPVKGFMPDAL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             +GEFVRVGPNPKF  VAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEE+F   K
Sbjct  80    SGEFVRVGPNPKFGAVAGYHWFDGDGMIHGLRIKDGKATYVSRFVETSRLKQEEYFCAGK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKGMFGLL V+L+MLR KL+++D +YG+GT NTAL+YH GKLLAL E DKPYA+
Sbjct  140   FMKVGDLKGMFGLLMVFLEMLRTKLRLIDITYGSGTGNTALVYHHGKLLALSEADKPYAL  199

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDPVTGEMFTFGYA   P++TYRVISKDGLM
Sbjct  200   KVLEDGDLQTLGILDYDKRLSHSFTAHPKVDPVTGEMFTFGYAHTPPYITYRVISKDGLM  259

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI  S+MMHDFAITENY +FMDLPL F+PKEMV   +L Y FDATKKARFGVLP
Sbjct  260   HDPVPITISDSLMMHDFAITENYTVFMDLPLGFRPKEMVKNGKLIYTFDATKKARFGVLP  319

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKN+ +I+WFELPNCFIFH ANAWEE DE+V+I+CR+QNP+LD+  GT+K+ L +F N
Sbjct  320   RYAKNDGMIRWFELPNCFIFHNANAWEECDEIVLITCRLQNPELDLVGGTVKEKLENFSN  379

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS S VDFPR+NE YT RKQRYVY T+L  +  VKGI+KFDL
Sbjct  380   ELYEMRFNMKTGGASQKQLSASTVDFPRINEGYTCRKQRYVYGTVLDSICDVKGIIKFDL  439

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
               +   GK  LEVGGNV+G+FD+GPG++GSEAI++P++++  CEEDDGYL+ FVHDEN G
Sbjct  440   KVDCRCGKHALEVGGNVQGVFDIGPGKYGSEAIYLPKDSAVKCEEDDGYLVFFVHDENCG  499

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V  IDAKTMSA+PVA+VELP RVPYGFHAFFV+EEQLQ Q ++
Sbjct  500   KSNV-CIDAKTMSADPVALVELPTRVPYGFHAFFVSEEQLQDQTKV  544



>ref|XP_002300210.2| hypothetical protein POPTR_0001s27290g [Populus trichocarpa]
 gb|EEE85015.2| hypothetical protein POPTR_0001s27290g [Populus trichocarpa]
Length=526

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/526 (75%), Positives = 444/526 (84%), Gaps = 21/526 (4%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P PQ G+ +K +D LE  I+K+MHD+S+   YLSGNFAP  EET P KDLPV GHLPEC+
Sbjct  21    PKPQKGLTSKLVDCLEKLIMKLMHDTSQSHPYLSGNFAPV-EETAPVKDLPVEGHLPECM  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAP                   DGKA YVSRFV+TSRLKQEEFFG AK
Sbjct  80    NGEFVRVGPNPKFAP-------------------DGKAAYVSRFVRTSRLKQEEFFGGAK  120

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +Q+LR+K KVLD SYG GT NT LIYH+GKLLAL E DKPY +
Sbjct  121   FMKIGDLKGLFGLLMVNIQILRLKTKVLDRSYGIGTGNTNLIYHNGKLLALQEADKPYVV  180

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDLQTLG+LDYDKRL H FTAHPKVDP TGEMFTFGY+ + P+VTYRVISKDG M
Sbjct  181   KVMEDGDLQTLGLLDYDKRLKHPFTAHPKVDPFTGEMFTFGYSHEPPYVTYRVISKDGAM  240

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYA+F+DLPLYF+PKEMV  K+  + FDATKKARFGVLP
Sbjct  241   HDPVPITISDPIMMHDFAITENYAVFLDLPLYFRPKEMVKDKKFIFTFDATKKARFGVLP  300

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++LLIKWFELPNCFIFH ANAWEE DE+V+I+CR+Q+P LD+A+G +K+  + FV+
Sbjct  301   RYAKDDLLIKWFELPNCFIFHNANAWEEEDEIVLITCRLQDPGLDVANGAVKEKQENFVD  360

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+ASQKKLSESAVDFPRVNE+YTGRKQRYVY T+L  +AKV GIVKFDL
Sbjct  361   ELYEMRFNMKTGVASQKKLSESAVDFPRVNESYTGRKQRYVYGTLLDSIAKVTGIVKFDL  420

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             H+EPE GK K+EVGGNV+GIFDLGPGRFGSEAIF+PRE  T  EEDDGYLI F HDENTG
Sbjct  421   HSEPEPGKGKIEVGGNVKGIFDLGPGRFGSEAIFIPREPGTTSEEDDGYLIFFAHDENTG  480

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMSA PVAVVELP+RVPYGFHAFFV+EEQLQ Q ++
Sbjct  481   KSSVNVIDAKTMSANPVAVVELPHRVPYGFHAFFVSEEQLQEQEKL  526



>ref|XP_009365069.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like, 
partial [Pyrus x bretschneideri]
Length=508

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/508 (76%), Positives = 436/508 (86%), Gaps = 7/508 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G ++K +D +E  IVK M+DSS+P  YL+GNFAP  +ETPP  +LPV GHLPECL
Sbjct  6     PKPNKGFSSKVVDLIEKLIVKWMYDSSRPHPYLAGNFAPVADETPPTTNLPVIGHLPECL  65

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIKDGKATYVSR+++TSRLKQE++FG +K
Sbjct  66    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKDGKATYVSRYIRTSRLKQEQYFGGSK  125

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG  GL  + LQMLR KLK+LD SYG GT NTALIYH GKLLALHE DKPY +
Sbjct  126   FMKIGDLKGFLGLFMMNLQMLREKLKILDMSYGFGTGNTALIYHHGKLLALHEADKPYVL  185

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDPVTGEMFTFGY+   P+VTYRVISKDG M
Sbjct  186   KVLEDGDLQTVGLLDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHTPPYVTYRVISKDGFM  245

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITIP  VMMHDFAITENYAIFMDLPL F+PKEMV +K+  + FD TKKARFG+LP
Sbjct  246   HDPVPITIPDPVMMHDFAITENYAIFMDLPLIFKPKEMVKEKKFIFTFDQTKKARFGLLP  305

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFVNE  740
             RYAK+ELLI+WFELPNCFIFH ANAWEEGDEVV+I+CR +N DL+          +  NE
Sbjct  306   RYAKDELLIRWFELPNCFIFHNANAWEEGDEVVLITCRFENLDLEKLE-------NVTNE  358

Query  739   LYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLH  560
             LYEMRFN+KTGLASQKKLSE AVDFPRVNE+YT RKQRYVY T+L ++ KV G+ KFDLH
Sbjct  359   LYEMRFNLKTGLASQKKLSEPAVDFPRVNESYTSRKQRYVYGTLLDNIFKVTGVAKFDLH  418

Query  559   AEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGK  380
             AEPE GKT++EVGGNV+G++DLGPGRFGSEAIFVPR      EEDDGYLILFVHDENTGK
Sbjct  419   AEPEVGKTQIEVGGNVQGLYDLGPGRFGSEAIFVPRIPGVTSEEDDGYLILFVHDENTGK  478

Query  379   SAVNVIDAKTMSAEPVAVVELPNRVPYG  296
             SA++V+DAKTMS EPVAVVELP+RVPYG
Sbjct  479   SAIHVVDAKTMSPEPVAVVELPHRVPYG  506



>emb|CDY53711.1| BnaAnng12520D [Brassica napus]
Length=525

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 449/525 (86%), Gaps = 14/525 (3%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPV-SGHLPEC  1643
             P P  G+++K +D +E  +VK+MHD+S PLHYLSGNFAP  +ETPP KDLPV  G LPEC
Sbjct  11    PKPSKGLSSKLLDLVERVVVKLMHDASLPLHYLSGNFAPVRDETPPVKDLPVVHGFLPEC  70

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             LNGEFVRVGPNPKF         DGDGMIH +RIKDGKATYVSR+VKTSRLKQEEFFG  
Sbjct  71    LNGEFVRVGPNPKF---------DGDGMIHAVRIKDGKATYVSRYVKTSRLKQEEFFGAP  121

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KFMKIGDLKG+ GLL VYLQ LR KLKVLD SYG+GTANTAL+YH GKLLAL E DKPY 
Sbjct  122   KFMKIGDLKGLLGLLMVYLQQLRTKLKVLDVSYGHGTANTALVYHHGKLLALSEADKPYV  181

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             +KVLEDGDLQTLGM+DYDKRL H+FTAHPKVDP TGEMFTFGY+Q  P++TYRVIS+DG 
Sbjct  182   VKVLEDGDLQTLGMMDYDKRLTHSFTAHPKVDPTTGEMFTFGYSQTPPYLTYRVISEDGF  241

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             MHDPVPITI   +MMHDFAITE YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVL
Sbjct  242   MHDPVPITISEPIMMHDFAITETYAIFMDLPMHFRPKEMVKEKKMVYSFDPTKKARFGVL  301

Query  922   PRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FV  746
             PRYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM  G  K+ L+ F 
Sbjct  302   PRYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVGGDAKEKLENFS  361

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMKTG ASQKKLS SAVDFPR+NE YTG+KQRYVY T+L  +AKV GI+KFD
Sbjct  362   NELYEMRFNMKTGSASQKKLSPSAVDFPRINECYTGKKQRYVYGTILDSIAKVTGIIKFD  421

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAE ETGK  LEVGGN++GI++LG GR+GSEAI+VPREA    EEDDGYLI FVHDENT
Sbjct  422   LHAEAETGKEILEVGGNIKGIYELGQGRYGSEAIYVPREAG---EEDDGYLIFFVHDENT  478

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             GKS VNVIDAKTMSAEPVAVVELP+RVPYGFHAFFVTEEQLQ Q 
Sbjct  479   GKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHAFFVTEEQLQEQT  523



>ref|XP_002517824.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
 gb|EEF44631.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
Length=536

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/526 (73%), Positives = 448/526 (85%), Gaps = 10/526 (2%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P+P+ G+ +K ID+LE  IVK+MHD S+PLHYLSGNFAP  +ETPP  DLPV GHLPEC+
Sbjct  20    PSPRKGLTSKVIDFLEKLIVKLMHDPSQPLHYLSGNFAPV-DETPPVTDLPVKGHLPECM  78

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYH      MIHG+RIK+GKATYV R+VKTSRLKQEEFFG +K
Sbjct  79    NGEFVRVGPNPKFSPVAGYHC-----MIHGMRIKNGKATYVRRYVKTSRLKQEEFFGGSK  133

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDL+G+FGLL V +QMLR K+KV D SYG GT N           +LH  D    +
Sbjct  134   FMKIGDLRGLFGLLMVNMQMLRAKMKVFDMSYGMGTGNFVDGNKSSPYWSLHSAD---VV  190

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDLQT+G+LDYDKRL H+FTAHPKVDP TGEMFTFGY  + P++TYRV+SKDG+M
Sbjct  191   KVMEDGDLQTVGLLDYDKRLKHSFTAHPKVDPFTGEMFTFGYGHEKPYITYRVVSKDGIM  250

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIF+DLP+YF+PKEMV +K+L Y FDATKKARFGVLP
Sbjct  251   HDPVPITISEPIMMHDFAITENYAIFLDLPMYFRPKEMVKEKKLIYTFDATKKARFGVLP  310

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++  ++WFELPNCFIFH ANAWEE DEVV+I+CR++NPDL+M SGT+K  L +F N
Sbjct  311   RYAKDDREMRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLNMVSGTVKGKLENFKN  370

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG+A QKKLS SAVDFPRVNE+YTGRKQR+VY T+L  +AKV G++KFDL
Sbjct  371   ELYEMRFNMKTGMALQKKLSVSAVDFPRVNESYTGRKQRFVYGTILDSIAKVTGVIKFDL  430

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEP+  K KLEVGGNV+GIFDLGPGRFGSEA+FVPRE  T  EEDDGYLILFV+DENTG
Sbjct  431   HAEPQLDKKKLEVGGNVKGIFDLGPGRFGSEAVFVPREPGTSSEEDDGYLILFVYDENTG  490

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS+VNVIDAKTMSA+PVAV+ELP+RVPYGFHAFFVTEEQLQ QA +
Sbjct  491   KSSVNVIDAKTMSADPVAVIELPHRVPYGFHAFFVTEEQLQEQATL  536



>gb|ACJ85687.1| unknown [Medicago truncatula]
Length=508

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/494 (78%), Positives = 430/494 (87%), Gaps = 1/494 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P +G  +KA+D LE  IVK+ +DSS P H+L+GNFAP  +ETPP KDLP+ GHLP+CL
Sbjct  15    PKPSNGFTSKAVDLLEKIIVKLFYDSSLPHHWLAGNFAPVKDETPPIKDLPIKGHLPDCL  74

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPN KFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEE+FG +K
Sbjct  75    NGEFVRVGPNSKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEYFGGSK  134

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGD+KG+FGLL V +QMLR KLKV+D SYG+GTANTAL+YH  KLLAL EGDKPYAI
Sbjct  135   FMKIGDMKGLFGLLMVNMQMLRAKLKVVDVSYGHGTANTALVYHHQKLLALSEGDKPYAI  194

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDLQTLGMLDYDKRLGH FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  195   KVFEDGDLQTLGMLDYDKRLGHNFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  254

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENY+IFMDLPLYF+PKEMV  K L + FD+TKKARFGVLP
Sbjct  255   HDPVPITISEPIMMHDFAITENYSIFMDLPLYFRPKEMVKNKTLIFSFDSTKKARFGVLP  314

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK+E  I+WFELPNCFIFH ANAWEE DE+V+I+CR++NP+LDM  G +K+ LD F N
Sbjct  315   RYAKDEKHIRWFELPNCFIFHNANAWEEEDEIVLITCRLENPNLDMVGGAVKEKLDNFAN  374

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS SAVDFPRVNE+YTGRKQRYVY T L  +AKV GIVKFDL
Sbjct  375   ELYEMRFNMKTGEASQKKLSASAVDFPRVNESYTGRKQRYVYGTELDSIAKVTGIVKFDL  434

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HA+P++GKTKLEVGGNV G +DLGPGRFGSEA++VPR   T  EEDDGYLI FVHDENTG
Sbjct  435   HAKPDSGKTKLEVGGNVVGHYDLGPGRFGSEAVYVPRVPGTDSEEDDGYLIFFVHDENTG  494

Query  382   KSAVNVIDAKTMSA  341
             KS V+V+DAKTMSA
Sbjct  495   KSFVHVLDAKTMSA  508



>gb|EYU27047.1| hypothetical protein MIMGU_mgv1a004951mg [Erythranthe guttata]
Length=503

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/483 (78%), Positives = 419/483 (87%), Gaps = 2/483 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+++KA+DWLEWA VK+MHD  KPLHYL+GNFAP  +ETPP  DLPV GHLPECL
Sbjct  22    PKPKKGLSSKAVDWLEWAFVKMMHDPKKPLHYLAGNFAPV-DETPPLTDLPVIGHLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAP AGYHWFDGDGMIHG+RIKDGKAT+VSRFVKTSRLKQEEF+G  K
Sbjct  81    NGEFVRVGPNPKFAPAAGYHWFDGDGMIHGMRIKDGKATFVSRFVKTSRLKQEEFYGGPK  140

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGD+KGMFGL  V +QMLR KLKVLD SYG GTANTA++YH GKLLAL EGDKPYAI
Sbjct  141   FMKIGDMKGMFGLFMVNMQMLRTKLKVLDVSYGFGTANTAMVYHHGKLLALSEGDKPYAI  200

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQT+GM+DYDKRL H FTAHPKVDP TGEMFTFGYAQ  P+VTYRVISK+G+M
Sbjct  201   KVLEDGDLQTIGMMDYDKRLSHTFTAHPKVDPFTGEMFTFGYAQAPPYVTYRVISKEGVM  260

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITI   VMMHDFAITENYAIFMDLPLYF+PKEMV   +  + FD TKKARFG+LP
Sbjct  261   EDPVPITIADPVMMHDFAITENYAIFMDLPLYFKPKEMVKDNKFIFSFDPTKKARFGILP  320

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAKNELLI+WFELPNCFIFH ANAWEEGDEVV+I+CR+QNPDLDM +G +K+ LD F N
Sbjct  321   RYAKNELLIRWFELPNCFIFHNANAWEEGDEVVLITCRLQNPDLDMVNGAVKEKLDNFTN  380

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+K G ASQK+LS SAVDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDL
Sbjct  381   ELYEMRFNLKNGRASQKRLSVSAVDFPRVNESYTGRKQRYVYGTILDSIAKVTGIIKFDL  440

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             HAEPET K KLEVGGN+ GIFDLGPGRFGSEA+FVPR+     EEDDGYLI F HDE  G
Sbjct  441   HAEPETDKEKLEVGGNISGIFDLGPGRFGSEAVFVPRQPGITSEEDDGYLIFFAHDEKLG  500

Query  382   KSA  374
               +
Sbjct  501   NPS  503



>ref|XP_009117091.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Brassica rapa]
Length=607

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/528 (73%), Positives = 445/528 (84%), Gaps = 6/528 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P    ++K ID LE  +VK+MHD+S PLHYLSGNFAP  +ETPP KDL V G LPECL
Sbjct  83    PKPSKCFSSKLIDLLEALVVKLMHDASLPLHYLSGNFAPLRDETPPVKDLHVHGFLPECL  142

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NG F+RVGPNPKF P+AGYHWFDGDGMIHG+RIKDGKATYVSRFVKTSRL+QEEFFG AK
Sbjct  143   NGIFLRVGPNPKFDPLAGYHWFDGDGMIHGVRIKDGKATYVSRFVKTSRLQQEEFFGDAK  202

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
              MKIGDLKG FGL+ V +Q LRIKLKVLD+SYGNGTANT+LIYH GKLLAL E DKPY I
Sbjct  203   LMKIGDLKGFFGLVMVIMQQLRIKLKVLDDSYGNGTANTSLIYHHGKLLALQETDKPYVI  262

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGM DYDKRL H+FTAHPKVDPVTGEMFTFG +   P++TYRVISKDG+M
Sbjct  263   KVLEDGDLQTLGMTDYDKRLTHSFTAHPKVDPVTGEMFTFGCSPMPPYLTYRVISKDGIM  322

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   VMMHDFAITE YAIFMDLP++F+P+EMV + ++ Y FD TK ARFGVLP
Sbjct  323   HDPVPITISKPVMMHDFAITETYAIFMDLPMHFRPEEMVKENKMIYSFDPTKNARFGVLP  382

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++L+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NP+LDM SG +++ L+ F N
Sbjct  383   RYAKDDLMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPNLDMVSGNVEEILESFSN  442

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYV--YATMLSDLAKVKGIVKF  569
             ELYEMRFNMKTG ASQKKLS S+  FPR+NE YTG+K RYV  Y T L  ++KV GI+K 
Sbjct  443   ELYEMRFNMKTGSASQKKLSASSNYFPRINECYTGKKNRYVYGYGTFLDGISKVTGIIKL  502

Query  568   DLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDEN  389
             DLHAE ETG   L+VGGN++GI+ LG G + S+AI+VPRE++   EEDDGYLI FVHDEN
Sbjct  503   DLHAEAETGNRILQVGGNIKGIYKLGQGIYCSDAIYVPRESA---EEDDGYLIFFVHDEN  559

Query  388   TGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             TGKS VNVIDA+TMSAEPVA+VELP+RVPYGFHA FVTE QLQ Q  I
Sbjct  560   TGKSCVNVIDARTMSAEPVAIVELPHRVPYGFHALFVTERQLQEQTLI  607



>emb|CBI24897.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/504 (76%), Positives = 430/504 (85%), Gaps = 22/504 (4%)
 Frame = -3

Query  1753  MHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWF  1574
             M+DSS+PLHYLSGNFAP  +ETPPCK+LPV G+LPECLNGEFVRVGPNPKF+PVAGYHWF
Sbjct  1     MYDSSQPLHYLSGNFAPVRDETPPCKNLPVIGYLPECLNGEFVRVGPNPKFSPVAGYHWF  60

Query  1573  DGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLR  1394
             DGDGMIHGLRIKDGKATYVSR+V+TSRLKQEE+FG AKF + GDLKG+FGLL V +QMLR
Sbjct  61    DGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEYFGGAKFTRFGDLKGLFGLLMVNMQMLR  120

Query  1393  IKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGH  1214
              KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +KVLEDGDLQTLG+LDYDKRL H
Sbjct  121   AKLKILDVSYGTGTGNTALVYHHGKLLALSEVDKPYVLKVLEDGDLQTLGLLDYDKRLTH  180

Query  1213  AFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITEN  1034
             +FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG MH+PVPITI   +MMHDFAITEN
Sbjct  181   SFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFMHEPVPITISDPIMMHDFAITEN  240

Query  1033  YAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHT  854
             YAIFMDLPLYF+PKEMV +K+L + FDATKKARFGVLPRYAKNEL IKWFELPNCFIFH 
Sbjct  241   YAIFMDLPLYFRPKEMVKEKKLIFTFDATKKARFGVLPRYAKNELHIKWFELPNCFIFHN  300

Query  853   ANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSES  677
             ANAWEE DEVV+I+CR++NPDLD+    +K+ L +F NELYEMRFNMKTG+ASQ+KLS S
Sbjct  301   ANAWEEEDEVVLITCRLENPDLDLVGRNVKEKLENFANELYEMRFNMKTGIASQRKLSAS  360

Query  676   AVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFD  497
             +VDFPRVNE+YTGRKQRYVY T+L  +                     LEVGGNV+GIFD
Sbjct  361   SVDFPRVNESYTGRKQRYVYGTILDSI---------------------LEVGGNVQGIFD  399

Query  496   LGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVEL  317
             LG GRFGSEA+FVPRE     EEDDGYLI FVHDE TGKS VNVI+AKTMS +PVA+VEL
Sbjct  400   LGVGRFGSEAVFVPREPGITSEEDDGYLIFFVHDEKTGKSYVNVINAKTMSPDPVAIVEL  459

Query  316   PNRVPYGFHAFFVTEEQLQTQAEI  245
             PNRVPYGFHAFFVTEEQL+ QA++
Sbjct  460   PNRVPYGFHAFFVTEEQLKEQAKL  483



>ref|XP_010088225.1| hypothetical protein L484_012507 [Morus notabilis]
 gb|EXB32777.1| hypothetical protein L484_012507 [Morus notabilis]
Length=544

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/517 (74%), Positives = 439/517 (85%), Gaps = 22/517 (4%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G+ +K ID  E  +VK+ +DSS+  HYLSGNFAP P+ETPP  DLPVSG+LPECL
Sbjct  20    PKPNKGLTSKLIDLFEKLVVKLGYDSSQIHHYLSGNFAPVPDETPPTVDLPVSGYLPECL  79

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEE+FG AK
Sbjct  80    NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEEYFGGAK  139

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMK+GDLKG FGL  V +Q+LR K KV+D S+G+GT                      A+
Sbjct  140   FMKVGDLKGFFGLFMVNMQILRAKFKVIDLSHGHGTD---------------------AL  178

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  179   KVLEDGDLQTLGLLDYDKRLQHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  238

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+   +MMHDFAITENYAIFMDLPL+F+PKEMV +K+L ++FD T+KARFGVLP
Sbjct  239   HDPVPITVSDPIMMHDFAITENYAIFMDLPLFFKPKEMVKEKKLIFQFDPTRKARFGVLP  298

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNELLIKWFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SG +K+ L +F N
Sbjct  299   RYAKNELLIKWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGKVKEKLQNFSN  358

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFN+KTGLASQ+KLSESAVDFPRVNE+YTGRKQRYVY T L  +AKV GIVKFDL
Sbjct  359   ELYEMRFNLKTGLASQRKLSESAVDFPRVNESYTGRKQRYVYGTTLDSIAKVTGIVKFDL  418

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
             H +PE+GKT++EVGGNV+G+++LGPGRFGSEAIFVP+      EEDDGYLI FVHDENTG
Sbjct  419   HGKPESGKTRIEVGGNVQGLYELGPGRFGSEAIFVPKVPGITSEEDDGYLIFFVHDENTG  478

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTE  272
             KSAV+VIDAKTMS +PVAVVELP+RVPYGFHAFFVTE
Sbjct  479   KSAVHVIDAKTMSPDPVAVVELPHRVPYGFHAFFVTE  515



>gb|KEH19090.1| carotenoid 9,10(9',10')-cleavage dioxygenase [Medicago truncatula]
Length=575

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/526 (73%), Positives = 441/526 (84%), Gaps = 3/526 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+    +KA+D LE  +VK  +DSS   H+++GNFAP  +ETPP KDLPV GHLP+CL
Sbjct  52    PKPRKCFTSKAVDLLENLVVKFFYDSSLSHHWIAGNFAPVKDETPPTKDLPVKGHLPDCL  111

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKATYVS FV+TSRLKQEE+FG  K
Sbjct  112   NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKATYVSHFVRTSRLKQEEYFGGCK  171

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGD+KG+ GLL V +Q LR KLK+LD SYG GTANT L+YH+GKLLAL E DKPYAI
Sbjct  172   FMKIGDVKGLLGLLMVTIQTLREKLKILDVSYGTGTANTGLVYHNGKLLALSERDKPYAI  231

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDL TLG+LDYDKRL H FT+HPK+DP TGEMFTFGYAQ  P++TYRVISKDG M
Sbjct  232   KVFEDGDLHTLGILDYDKRLDHYFTSHPKLDPYTGEMFTFGYAQTPPYITYRVISKDGYM  291

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             +DPVPITI   +M+HDFAITENYAIFMDLP+YF+PKEMV   +L + FD+TKKARFGVLP
Sbjct  292   YDPVPITISDPIMVHDFAITENYAIFMDLPVYFRPKEMVKNNKLIFSFDSTKKARFGVLP  351

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++ LI+WFELPNCFIFH ANAWEE DEVVMI+CR++N DLDM S  +KD L+ F N
Sbjct  352   RYAKDDKLIRWFELPNCFIFHNANAWEEEDEVVMITCRLKNLDLDMVSEDVKDKLESFSN  411

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQKKLS  ++DFPRVNE YTGRKQ+YVY T+L  +    GIVKFDL
Sbjct  412   ELYEMRFNMKTGKASQKKLSAFSIDFPRVNERYTGRKQKYVYGTILDSIT--TGIVKFDL  469

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
              A+P+ GKTKLEVGGNV GI+DLG G F S+ I+VPR   T  EEDDGYLI FVHDEN  
Sbjct  470   SAKPDFGKTKLEVGGNVHGIYDLGRGTFCSDPIYVPRVPGTDSEEDDGYLIFFVHDENIR  529

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V+VIDAKTMSA+PVAVVELP RVPYGFHAFF+TE+QLQ QA++
Sbjct  530   KSFVHVIDAKTMSADPVAVVELPQRVPYGFHAFFLTEDQLQEQAKL  575



>ref|XP_010241260.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Nelumbo nucifera]
Length=535

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/524 (73%), Positives = 439/524 (84%), Gaps = 9/524 (2%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P    GIA++ ID +E  IVK+M+DSS+   +L+GNFAP  +ETPPCK+LPV G LPECL
Sbjct  20    PKLSKGIASRVIDLVEKLIVKLMYDSSRLHPFLTGNFAPV-DETPPCKNLPVKGCLPECL  78

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFV+VGPN KFAP+AGYHWFDGDGM+HGLRIK+GKATYVSR+V+TSRLKQEEFFG  K
Sbjct  79    NGEFVKVGPNSKFAPMAGYHWFDGDGMVHGLRIKNGKATYVSRYVRTSRLKQEEFFGGPK  138

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F+KIGDL G+FGL    +  LR KLKVLD SYG GTANTAL+YH G+LLAL+E DKPY +
Sbjct  139   FLKIGDLTGLFGLFASGIHSLRAKLKVLDVSYGIGTANTALVYHHGRLLALYEADKPYVL  198

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFG +   P+VTYRVISKDG M
Sbjct  199   KVLEDGDLQTLGMLDYDKRLTHSFTAHPKVDPYTGEMFTFGNSLTPPYVTYRVISKDGFM  258

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HD VPITI   VMMHDFAITENYAIFMDLPLYF+ +EMV   +L + FDATKK+RFG+LP
Sbjct  259   HDQVPITISDPVMMHDFAITENYAIFMDLPLYFRREEMVKGNKLIFTFDATKKSRFGILP  318

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFVNE  740
             RYAK+EL I+WFELPNCFIFH ANAWEE DEVV+I+CR+QN DL++         +   E
Sbjct  319   RYAKDELQIRWFELPNCFIFHNANAWEEEDEVVLITCRLQNIDLEVLQ-------NLTIE  371

Query  739   LYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLH  560
             LYEMRFNMKTGL+SQKKLS  A+DFPRVNENYTGRKQR+VY  +L    KV GI+KFDL 
Sbjct  372   LYEMRFNMKTGLSSQKKLSAPAIDFPRVNENYTGRKQRFVYGAILDSTLKVTGIIKFDLQ  431

Query  559   AEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGK  380
             AEPE GKTKLEVGGNV+GIF+ GPG FGSEAIF+PRE    CEEDDGYLI FVHDENTGK
Sbjct  432   AEPENGKTKLEVGGNVQGIFNFGPGIFGSEAIFIPREPD-ACEEDDGYLIFFVHDENTGK  490

Query  379   SAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             S VNVIDAK+MS++P+AV+ELP+RVPYGFHA FVTEEQLQ QA+
Sbjct  491   STVNVIDAKSMSSDPIAVIELPDRVPYGFHALFVTEEQLQEQAK  534



>gb|KEH19087.1| carotenoid 9,10(9',10')-cleavage dioxygenase [Medicago truncatula]
Length=575

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/526 (73%), Positives = 441/526 (84%), Gaps = 3/526 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+   ++KA+D LE  +VK  +DSS   H+L+GNFAP  +ETPP KDLPV GHLP+CL
Sbjct  52    PKPRKCFSSKAVDLLEKLVVKFFYDSSLCHHWLAGNFAPVQDETPPIKDLPVKGHLPDCL  111

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYHWFDGDGMIHGLRIKDGKATYVS FV+TSRLKQEE+FG  K
Sbjct  112   NGEFVRVGPNPKFSPVAGYHWFDGDGMIHGLRIKDGKATYVSHFVRTSRLKQEEYFGGCK  171

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGD+KG+ GLL V +Q LR KLK+LD SYG GTANT L+YH+GKLLAL E DKPYAI
Sbjct  172   FMKIGDVKGLLGLLMVTIQTLREKLKILDVSYGTGTANTGLVYHNGKLLALSERDKPYAI  231

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV EDGDL TLGMLDY+KRL H FTAHPKVDP TGEMFTFGY+Q  P++TYRVISKDG M
Sbjct  232   KVFEDGDLHTLGMLDYEKRLDHYFTAHPKVDPFTGEMFTFGYSQTPPYITYRVISKDGYM  291

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             +DPVPITI   +M+HDFAITENYAIFMDLP+YF+PKEMV   +L + FD+TKKARFGVLP
Sbjct  292   YDPVPITISDPIMVHDFAITENYAIFMDLPVYFRPKEMVKNNKLIFSFDSTKKARFGVLP  351

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAK++ LI+WFELPNCFIFH ANAWEE D+VV+I+CR+ N DLDM S  +KD L+ F  
Sbjct  352   RYAKDDKLIRWFELPNCFIFHNANAWEEEDQVVLITCRLNNLDLDMVSEDVKDKLESFST  411

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             +LYEMRFNMKTG ASQKKLS  +VDFPRVNE YTGRKQ+YVY T+L  +    GIVKFDL
Sbjct  412   QLYEMRFNMKTGKASQKKLSAFSVDFPRVNERYTGRKQKYVYGTILDSIP--TGIVKFDL  469

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
              A+P+ GKTKLE+GGNV GI+DLG G F S+ I+VPR   T  +EDDGYLI FVHDENT 
Sbjct  470   SAKPDFGKTKLEIGGNVHGIYDLGQGTFCSDPIYVPRVPGTDSDEDDGYLIFFVHDENTR  529

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V+VIDAKTMSA+PVAVVELP RVPYGFH+FF+TE+QLQ QA++
Sbjct  530   KSFVHVIDAKTMSADPVAVVELPQRVPYGFHSFFMTEDQLQEQAKL  575



>emb|CDX76782.1| BnaC08g33680D [Brassica napus]
Length=612

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/528 (73%), Positives = 444/528 (84%), Gaps = 15/528 (3%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G ++K ID LE  +VK MHD+S PL+YLSGNFAP  +ETPP KDLPV G LPECL
Sbjct  97    PKPSKGFSSKLIDLLEALVVKFMHDTSLPLNYLSGNFAPLRDETPPVKDLPVHGFLPECL  156

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEF+RVGPNPKF         DGDGMIHG+RIKDGKATYVSR+VKTSRLKQEEFFG AK
Sbjct  157   NGEFLRVGPNPKF---------DGDGMIHGVRIKDGKATYVSRYVKTSRLKQEEFFGAAK  207

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
              MKIGDLKG+FGLL   +Q LR KLKVLD+SYGNGTANTAL+YH G+LLAL E DKPY I
Sbjct  208   LMKIGDLKGIFGLLMANMQQLRTKLKVLDDSYGNGTANTALVYHHGQLLALQETDKPYVI  267

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVL+DGDLQTLGM+DYDK+L H+FTAHPKVDPVTGEMFTFGY+   P++ YRVISKDG+M
Sbjct  268   KVLKDGDLQTLGMIDYDKKLTHSFTAHPKVDPVTGEMFTFGYSHMPPYLIYRVISKDGIM  327

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITI   +MMHDFAITENY+IFMDLP++F+PKEMV +K++ Y FD TKKARFGVLP
Sbjct  328   QDPVPITISEPIMMHDFAITENYSIFMDLPMHFRPKEMVKEKKMLYSFDPTKKARFGVLP  387

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK++L+IKWFELPNCFIFH ANAWEE +EVV+I+CR++NP+LDM SG  ++ L  F N
Sbjct  388   RYAKDDLMIKWFELPNCFIFHNANAWEEDEEVVLITCRLENPNLDMVSGNDEEVLRSFSN  447

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVY--ATMLSDLAKVKGIVKF  569
             ELYEMRFNMKTG ASQKKLS S+VDFPR+NE+YTG KQRYVY   T L  ++KV GI+KF
Sbjct  448   ELYEMRFNMKTGSASQKKLSASSVDFPRINESYTGEKQRYVYGIGTFLDGISKVTGIIKF  507

Query  568   DLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDEN  389
             DLHAE ET KT L++GGN++GI+ +G G +GS+ ++VPRE +   EEDDGYLI FVHDEN
Sbjct  508   DLHAEAETSKTMLQIGGNIKGIYKMGHGIYGSDPVYVPRETA---EEDDGYLIFFVHDEN  564

Query  388   TGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             TGKS VNVIDAKTMS+EPVAVVELP+RVPYGFHA FVTEEQLQ Q  I
Sbjct  565   TGKSCVNVIDAKTMSSEPVAVVELPHRVPYGFHALFVTEEQLQEQTLI  612



>gb|ABR17001.1| unknown [Picea sitchensis]
Length=540

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/526 (72%), Positives = 443/526 (84%), Gaps = 5/526 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVK--VMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPE  1646
             P P+ G+ +  +D +E  +V+   ++ S KP+ +LSGNFAP   ET P   LPV GHLP 
Sbjct  17    PHPKGGLVSWVVDMVEKLVVEASTLYGSRKPMQFLSGNFAPV-SETAPKSHLPVVGHLPS  75

Query  1645  CLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGR  1466
             CL+GEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+VKTSRLKQEE+FG+
Sbjct  76    CLDGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVKTSRLKQEEYFGK  135

Query  1465  AKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPY  1286
             AKFMKIGDLKGMFGL  V + +LR KL VLD SYGNGTANTALIYH GKLLAL E DKPY
Sbjct  136   AKFMKIGDLKGMFGLFIVQIHILREKLGVLDMSYGNGTANTALIYHHGKLLALQEADKPY  195

Query  1285  AIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDG  1106
              ++VLEDGDLQTLG++DYD +L H+FTAHPKVDP+TGEMFTFGY    P+VTYRV++K+G
Sbjct  196   VLRVLEDGDLQTLGLMDYDDKLAHSFTAHPKVDPITGEMFTFGYQHTPPYVTYRVVTKEG  255

Query  1105  LMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGV  926
             +M DPVPIT+P  VMMHDFAIT+NYAIFMDLPLYF PK+MV K  L   +D TKKARFG+
Sbjct  256   IMLDPVPITLPKPVMMHDFAITDNYAIFMDLPLYFSPKDMV-KGGLIMSYDTTKKARFGI  314

Query  925   LPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DF  749
             LPRYAK++L ++WFELPNC+IFH ANAWEEGDEV++ +CR+ + DL+M SG +K+++ +F
Sbjct  315   LPRYAKDDLQMQWFELPNCYIFHNANAWEEGDEVILYTCRLPDLDLEMVSGAVKENMKNF  374

Query  748   VNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKF  569
              NELYEMRFN+K+G ASQKKLSESAVDFPR+NE Y GRKQRYVY T+L  + +VKG+VKF
Sbjct  375   QNELYEMRFNLKSGEASQKKLSESAVDFPRINEKYIGRKQRYVYGTVLDSVTQVKGLVKF  434

Query  568   DLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDEN  389
             DL AEPE GK+++EVGGNV G+F  GPGRFGSEAIFVPR++    EEDDGYLI FVHDEN
Sbjct  435   DLQAEPEIGKSQIEVGGNVLGVFCFGPGRFGSEAIFVPRDSGPDLEEDDGYLICFVHDEN  494

Query  388   TGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             TGKS VNV DAKTMS EPVA+V LP RVPYGFHAFFV+EEQLQ QA
Sbjct  495   TGKSEVNVFDAKTMSPEPVAIVYLPTRVPYGFHAFFVSEEQLQNQA  540



>ref|XP_009365068.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Pyrus x bretschneideri]
Length=474

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/471 (79%), Positives = 422/471 (90%), Gaps = 1/471 (0%)
 Frame = -3

Query  1654  LPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEF  1475
             L ECLNGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIKDGKATYVSR+V+TSRLKQE++
Sbjct  4     LQECLNGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKDGKATYVSRYVRTSRLKQEQY  63

Query  1474  FGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGD  1295
             FG +KFMKIGDLKG  GL  + LQMLR KLK+LD SYG GT NTALIYH GKLLALHE D
Sbjct  64    FGGSKFMKIGDLKGFLGLFMMNLQMLREKLKILDMSYGFGTGNTALIYHHGKLLALHEAD  123

Query  1294  KPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVIS  1115
             KPY +KVLEDGDLQT+G+LDYDKRL H+FTAHPKVDP TGEMFTFGY+   P+VTYRVIS
Sbjct  124   KPYVLKVLEDGDLQTVGLLDYDKRLTHSFTAHPKVDPFTGEMFTFGYSPTPPYVTYRVIS  183

Query  1114  KDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKAR  935
             KDG MHDPVPITIP  VMMHDFAITENYAIFMDLPL F+PKEMV +K+L + FD TKKAR
Sbjct  184   KDGFMHDPVPITIPDPVMMHDFAITENYAIFMDLPLIFKPKEMVKEKKLIFTFDQTKKAR  243

Query  934   FGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL  755
             FG+LPRYAK+ELLI+WFELPNCFIFH ANAWEEGDEVV+I+CR +N DLD+ +G++K+ L
Sbjct  244   FGLLPRYAKDELLIRWFELPNCFIFHNANAWEEGDEVVLITCRFENLDLDLGNGSVKEKL  303

Query  754   D-FVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGI  578
             + F NELYEMRFN+KTGLASQKKLSE AVDFPRVNE+YTGRKQRYVY T+L ++ KV G+
Sbjct  304   ENFTNELYEMRFNLKTGLASQKKLSEPAVDFPRVNESYTGRKQRYVYGTLLDNIGKVTGV  363

Query  577   VKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVH  398
              KFDLHAEPE GKT++EVGGNV+G++DLGPGRFGSEAIFVPR      EEDDGYLILFVH
Sbjct  364   AKFDLHAEPEVGKTQIEVGGNVQGLYDLGPGRFGSEAIFVPRIPGVTSEEDDGYLILFVH  423

Query  397   DENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             DENTGKSA++V+DAKTMS EPVAVVELP+RVPYGFHAFFVTEEQLQ QA++
Sbjct  424   DENTGKSAIHVVDAKTMSPEPVAVVELPHRVPYGFHAFFVTEEQLQEQAKL  474



>gb|ABK24523.1| unknown [Picea sitchensis]
Length=540

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/526 (72%), Positives = 443/526 (84%), Gaps = 5/526 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVK--VMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPE  1646
             P P+ G+ +  +D +E  +V+   ++ S KP+ +LSGNFAP   ET P   LPV GHLP 
Sbjct  17    PHPKGGLVSWVVDMVEKLVVEASTLYGSRKPMQFLSGNFAPV-SETAPKSHLPVVGHLPS  75

Query  1645  CLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGR  1466
             CL+GEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+VKTSRLKQEE+FG+
Sbjct  76    CLDGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVKTSRLKQEEYFGK  135

Query  1465  AKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPY  1286
             AKFMKIGDLKGMFGL  V L +LR KL VLD SYGNGTANTALIYH GKLLAL E DKPY
Sbjct  136   AKFMKIGDLKGMFGLFFVQLHILREKLGVLDMSYGNGTANTALIYHHGKLLALQEADKPY  195

Query  1285  AIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDG  1106
              ++VLEDGDLQTLG++DYD +L H+FTAHPKVDP+TGEMFTFGY    P+VTYRV++K+G
Sbjct  196   VLRVLEDGDLQTLGLMDYDDKLAHSFTAHPKVDPITGEMFTFGYQHTPPYVTYRVVTKEG  255

Query  1105  LMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGV  926
             +M DPVPIT+P  VMMHDFAIT+NYAIFMDLPLYF PK+MV K  L   +D TKKARFG+
Sbjct  256   IMLDPVPITLPKPVMMHDFAITDNYAIFMDLPLYFSPKDMV-KGGLIMSYDTTKKARFGI  314

Query  925   LPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DF  749
             LPRYAK++L ++WFELPNC+IFH ANAWEEGDEV++ +CR+ + DL+M SG +K+++ +F
Sbjct  315   LPRYAKDDLQMQWFELPNCYIFHNANAWEEGDEVILYTCRLPDLDLEMVSGAVKENMKNF  374

Query  748   VNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKF  569
              NELYEMRFN+K+G ASQKKLSESAVDFPR+NE Y GRKQRYVY T+L  + +VKG+VKF
Sbjct  375   QNELYEMRFNLKSGEASQKKLSESAVDFPRINEKYIGRKQRYVYGTVLDSVTQVKGLVKF  434

Query  568   DLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDEN  389
             DL AEPE GK+++EVGGNV G+F  GPGRFGSEAIFVPR++    EEDDGYLI FVHDEN
Sbjct  435   DLQAEPEIGKSQIEVGGNVLGVFCFGPGRFGSEAIFVPRDSGPDLEEDDGYLICFVHDEN  494

Query  388   TGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             TGKS VNV DAKTMS EPVA+V LP RVPYGFHAFFV+EEQLQ QA
Sbjct  495   TGKSEVNVFDAKTMSPEPVAIVYLPTRVPYGFHAFFVSEEQLQNQA  540



>gb|AFC90006.1| carotenoid cleavage dioxygenase 1 [Diospyros kaki]
Length=485

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/472 (79%), Positives = 422/472 (89%), Gaps = 1/472 (0%)
 Frame = -3

Query  1657  HLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEE  1478
             H   CLNGEF RVG NPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSR+V+TSRLKQEE
Sbjct  14    HNQNCLNGEFARVGSNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRYVRTSRLKQEE  73

Query  1477  FFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEG  1298
             FFG AKFMKIGDLKG+FGLL V ++MLR KLKVLD SYG GTANTAL+YH GKLLAL E 
Sbjct  74    FFGGAKFMKIGDLKGLFGLLMVNMKMLRGKLKVLDVSYGTGTANTALVYHHGKLLALSEA  133

Query  1297  DKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVI  1118
             DKPY +KVLEDGDLQTLG+LDYDKRL H+FTAHPK+DP TGEMFTFGY+   P++TYRVI
Sbjct  134   DKPYVLKVLEDGDLQTLGLLDYDKRLSHSFTAHPKLDPFTGEMFTFGYSTTPPYITYRVI  193

Query  1117  SKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKA  938
             SKDG MHDPVPIT+P  +MMHDFAITENYAIFMDLPLYF+PKEMV +  L + FDATKKA
Sbjct  194   SKDGFMHDPVPITLPEPIMMHDFAITENYAIFMDLPLYFRPKEMVKENTLIFAFDATKKA  253

Query  937   RFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDS  758
             RFGVLPRYAK+ELLIKWFELPNCFIFH ANAWEEGDEV++I+CR++NP LD+A+GT+++ 
Sbjct  254   RFGVLPRYAKDELLIKWFELPNCFIFHNANAWEEGDEVILITCRLENPGLDIANGTIREK  313

Query  757   L-DFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKG  581
             L +F++ELYEMRFNMKTG+ASQ+KLS  AVDFPRVN++YTGRKQ+YVY T L   AKV G
Sbjct  314   LENFIDELYEMRFNMKTGMASQRKLSAPAVDFPRVNDSYTGRKQQYVYGTTLDSNAKVTG  373

Query  580   IVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFV  401
             I+KFDL AEPE+ KTKL+VGGNV+G+FDLGPGRFGSEA+FVPRE     EEDDGYLI FV
Sbjct  374   IIKFDLQAEPESEKTKLDVGGNVQGLFDLGPGRFGSEAVFVPREPGITSEEDDGYLIFFV  433

Query  400   HDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             HDE TGKSAVNVIDAKTMS++PVAVVELP+RVPYGFHAFFVTE+QLQ QA++
Sbjct  434   HDEVTGKSAVNVIDAKTMSSDPVAVVELPHRVPYGFHAFFVTEDQLQAQAKL  485



>ref|XP_009589880.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009589881.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
isoform X3 [Nicotiana tomentosiformis]
Length=494

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/441 (84%), Positives = 403/441 (91%), Gaps = 2/441 (0%)
 Frame = -3

Query  1561  MIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLK  1382
             MIHGL IKDGKATYVSRFV+TSRLKQEEFFG AKFMKIGDLKG+FGL +VY+ MLR KLK
Sbjct  54    MIHGLHIKDGKATYVSRFVRTSRLKQEEFFGGAKFMKIGDLKGLFGLFSVYIYMLREKLK  113

Query  1381  VLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTA  1202
             VLD SYGNGTANTA+IYH GKLLALHEGDKPY +KVLEDGDLQTLGMLDYDKRL H+FTA
Sbjct  114   VLDTSYGNGTANTAMIYHHGKLLALHEGDKPYVVKVLEDGDLQTLGMLDYDKRLQHSFTA  173

Query  1201  HPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIF  1022
             HPKVDPVTGEMFTFGY+Q  P+ TYRVISKDG+M DPVPITIPASVMMHDFAITENY+I 
Sbjct  174   HPKVDPVTGEMFTFGYSQTPPYATYRVISKDGVMQDPVPITIPASVMMHDFAITENYSIM  233

Query  1021  MDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAW  842
             MDLPLYF+PKEMV  K+LAY FD TKKARFG+LPRYAKNE LIKWFELPNCFIFH ANAW
Sbjct  234   MDLPLYFKPKEMVKNKKLAYSFDPTKKARFGILPRYAKNESLIKWFELPNCFIFHNANAW  293

Query  841   EEGDEVVMISCRIQNPDLDMASGTLKDSL--DFVNELYEMRFNMKTGLASQKKLSESAVD  668
             EEGD+VV+I+CR+QNPDLD+ +GT K+     F NELYEMRFN+KTGLASQKKLSESAVD
Sbjct  294   EEGDDVVLITCRLQNPDLDVINGTEKEQQRDGFTNELYEMRFNIKTGLASQKKLSESAVD  353

Query  667   FPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGP  488
             FPRVNENYTGRKQRYVY T+L+ +AK+ GIVKFDLHAEPETGKTKLEVGGNV GIFDLGP
Sbjct  354   FPRVNENYTGRKQRYVYGTILNHMAKITGIVKFDLHAEPETGKTKLEVGGNVLGIFDLGP  413

Query  487   GRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNR  308
             GRFGSEAIFVPR+  T CEEDDGYLILFVHDENTGKS+VNVIDAKTMSAEPVAVVELP R
Sbjct  414   GRFGSEAIFVPRQPGTECEEDDGYLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKR  473

Query  307   VPYGFHAFFVTEEQLQTQAEI  245
             VPYGFHAFFVTEEQ+  QA++
Sbjct  474   VPYGFHAFFVTEEQILEQAKL  494



>gb|EMT19111.1| hypothetical protein F775_00763 [Aegilops tauschii]
Length=560

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/533 (72%), Positives = 433/533 (81%), Gaps = 12/533 (2%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSK--PLHYLSGNFAPAPEETPPCKDLPVSGHLPE  1646
             P P+ G+A+ A+  LE   V++ HD  K  PL +LSGNFAP P+ETPP   L V GHLP+
Sbjct  30    PRPRKGVASWAVALLERLAVRLRHDDEKAEPLPWLSGNFAPVPDETPPAAGLSVRGHLPK  89

Query  1645  CLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGR  1466
             CLNGEFVRVGPNPKFAPVAG   FDGDGMIH +RIKDGKATYVSR+VKTSRL+QEE+FG 
Sbjct  90    CLNGEFVRVGPNPKFAPVAG---FDGDGMIHAMRIKDGKATYVSRYVKTSRLEQEEYFGG  146

Query  1465  AKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPY  1286
             AKF KIGDLKG+FGL  V  Q LR KLKVLD +YG GTANTALIYH GKL+AL E DKPY
Sbjct  147   AKFTKIGDLKGVFGLFMVLTQELRKKLKVLDVTYGFGTANTALIYHHGKLMALSESDKPY  206

Query  1285  AIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDG  1106
              +K+LEDGDLQTLG+LDYDKRL H FTAHPKVDP T EMFTFGY+ + P+ TYRVI+K G
Sbjct  207   VVKILEDGDLQTLGLLDYDKRLKHPFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKGG  266

Query  1105  LMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGV  926
             +M DPVPITIP SVMMHDFAITENY+IFMDLP++F+PKEM    +  YKFD TK ARFG+
Sbjct  267   IMLDPVPITIPESVMMHDFAITENYSIFMDLPMFFRPKEMAKNGEFIYKFDPTKNARFGI  326

Query  925   LPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DF  749
             L RY K+E  I+WFELPNCFIFH ANAWEEGDEV++I+CR+ N DLD  +G   D L D 
Sbjct  327   LQRYEKDEKTIRWFELPNCFIFHNANAWEEGDEVILITCRLNNLDLDQVNGHQSDKLEDP  386

Query  748   VNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKV------  587
              NELYEMRFNMKTG ASQK+LS SA+DFPR+NE+YTGRKQRYVY T+L    KV      
Sbjct  387   GNELYEMRFNMKTGAASQKQLSVSAIDFPRINESYTGRKQRYVYCTILESTVKVTGILKM  446

Query  586   KGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLIL  407
              GI+KFDLHAEPE+ K +LEVGGNV GI+DLGPGRF SEA+FVP+E S   EEDDGYLI 
Sbjct  447   TGIIKFDLHAEPESDKEQLEVGGNVRGIYDLGPGRFCSEAVFVPKEPSVLGEEDDGYLIF  506

Query  406   FVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             FVHDENTGKS +NVIDAKTMSA+PVAVVELP+RVPYGFHAFFV EEQL  Q E
Sbjct  507   FVHDENTGKSEINVIDAKTMSADPVAVVELPSRVPYGFHAFFVNEEQLGHQVE  559



>gb|KCW66099.1| hypothetical protein EUGRSUZ_G03374 [Eucalyptus grandis]
Length=514

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/526 (71%), Positives = 427/526 (81%), Gaps = 40/526 (8%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             PTP+ G+ +K +D++E  IVK M+DSS+P  YL+GNFAP  +ETPP  DLPV GHLP+CL
Sbjct  28    PTPKKGVTSKVVDYIEKLIVKFMYDSSRPHQYLAGNFAPVADETPPVTDLPVVGHLPDCL  87

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIK+GKATYVSR+V+TS+LKQEE++G AK
Sbjct  88    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKNGKATYVSRYVRTSKLKQEEYYGGAK  147

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +
Sbjct  148   FMKIGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVYHHGKLLALSEADKPYVL  207

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  208   KVLEDGDLQTLGMLDYDKRLSHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  267

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV   +L + FD TKK+RFGVLP
Sbjct  268   HDPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKDNKLIFTFDKTKKSRFGVLP  327

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RYAKNEL I+WFELPNCFIFH ANAWEE DEVV+++CR++N DLDM SGT+K+ L+ F N
Sbjct  328   RYAKNELQIRWFELPNCFIFHNANAWEEEDEVVLVTCRLENLDLDMVSGTVKEHLENFGN  387

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTGLASQKKLS  +VDFPR+NE YTG   RY ++                 
Sbjct  388   ELYEMRFNMKTGLASQKKLSAPSVDFPRINECYTG---RYSFS-----------------  427

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
                                +FDLGPGRFGSEA+FVPRE     EEDDGYLI FVHDE+TG
Sbjct  428   -------------------VFDLGPGRFGSEAVFVPREPGITSEEDDGYLIFFVHDESTG  468

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KSAVNVIDAK MS++PVAVVELP+RVPYGFHAFFVTEEQLQ  A++
Sbjct  469   KSAVNVIDAKNMSSDPVAVVELPHRVPYGFHAFFVTEEQLQELAKL  514



>ref|XP_006402263.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
 gb|ESQ43716.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
Length=491

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/481 (77%), Positives = 419/481 (87%), Gaps = 5/481 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPV-SGHLPEC  1643
             P P  G ++K +D LE  +VK+MHD+S PLHYLSGNFAP  +ETPP KDLPV  G LPEC
Sbjct  14    PKPSKGFSSKLLDLLERVVVKLMHDASLPLHYLSGNFAPLKDETPPVKDLPVVHGFLPEC  73

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             LNGEFVRVGPNPKF PVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEEFFG A
Sbjct  74    LNGEFVRVGPNPKFDPVAGYHWFDGDGMIHGVRIKDGKATYVSRYVKTSRLKQEEFFGAA  133

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KFMKIGDLKG FGLL V +Q LR KLKVLD+SYG GTANTAL+YH GKLLAL E DKPY 
Sbjct  134   KFMKIGDLKGFFGLLMVNMQQLRTKLKVLDDSYGYGTANTALVYHHGKLLALQEADKPYV  193

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             +KVLEDGDLQTLGM+DYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVIS+DG+
Sbjct  194   VKVLEDGDLQTLGMIDYDKRLTHSFTAHPKVDPATGEMFTFGYSHTPPYLTYRVISEDGI  253

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             M DPVPITI   +MMHDFAITE+YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVL
Sbjct  254   MLDPVPITISEPIMMHDFAITESYAIFMDLPMHFRPKEMVKEKKMIYSFDPTKKARFGVL  313

Query  922   PRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FV  746
             PRYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SG +K+ L+ F 
Sbjct  314   PRYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGNVKEKLENFS  373

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMKTG ASQ+KLS SAVDFPR+NE YTG+KQRYVY T+L  +AKV GI+KFD
Sbjct  374   NELYEMRFNMKTGSASQRKLSASAVDFPRINERYTGKKQRYVYGTILDSIAKVTGIIKFD  433

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAE ETGK  LEVGGN++GI++LG GR+GSEAI+VPREA+   EEDDGYLI FVHDENT
Sbjct  434   LHAEAETGKKMLEVGGNIKGIYELGQGRYGSEAIYVPREAA---EEDDGYLIFFVHDENT  490

Query  385   G  383
             G
Sbjct  491   G  491



>ref|XP_006302006.1| hypothetical protein CARUB_v10019983mg [Capsella rubella]
 gb|EOA34904.1| hypothetical protein CARUB_v10019983mg [Capsella rubella]
Length=619

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/528 (71%), Positives = 434/528 (82%), Gaps = 5/528 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P  G ++K +D LE  +VK MHD+S PL YLS NFAP  +ETPP KDLPV G LP CL
Sbjct  94    PKPCKGFSSKLLDLLESHVVKHMHDASLPLSYLSSNFAPLRDETPPIKDLPVHGTLPGCL  153

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEF+R+GPNPKF P+AGYHWFDGDGMIHG+RIKDGKA YVSR+VKTSRLKQEEFFG AK
Sbjct  154   NGEFLRIGPNPKFVPLAGYHWFDGDGMIHGVRIKDGKAAYVSRYVKTSRLKQEEFFGAAK  213

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F KIGDLKG+FGLL   +Q++R KLKVLD+SYGNGTANT+LIYH+GKLLALHE DKPY I
Sbjct  214   FTKIGDLKGVFGLLMTIMQLVRHKLKVLDDSYGNGTANTSLIYHNGKLLALHESDKPYVI  273

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KV+EDGDL+TLGM+DYDKRL H+FTAHPKVDPVT EMF FGY+   P++TYRVISKDG M
Sbjct  274   KVMEDGDLKTLGMIDYDKRLTHSFTAHPKVDPVTCEMFIFGYSYTPPYLTYRVISKDGTM  333

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPV ITI    MMHDFAITENYAIFMDLP++ +PKEMV + +    +D TK ARFGVLP
Sbjct  334   HDPVTITISEPTMMHDFAITENYAIFMDLPMHIKPKEMVKEDKTVISYDPTKNARFGVLP  393

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFVN-  743
             RYAKN+L+IKWFELPNCFI H ANAWEE DEVV+I+CR  NPD+++ SG  K+ ++  + 
Sbjct  394   RYAKNDLMIKWFELPNCFIAHNANAWEEDDEVVLITCRHDNPDINIFSGNAKEKVEHCSR  453

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLA--KVKGIVKF  569
             ELYE+RFNMKTG ASQKKLS S ++ P++NE Y G+K RYVY T+L   A  KV GI+KF
Sbjct  454   ELYEIRFNMKTGSASQKKLSASPLELPKINEFYIGKKHRYVYGTVLDTTAVLKVTGIIKF  513

Query  568   DLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDEN  389
             DL AE ETG   L+VGGN+EGI++LG GR GSEA++VPR A+   EEDDGYL+ FVHDEN
Sbjct  514   DLQAEAETGNKILQVGGNIEGIYELGQGRSGSEAVYVPRGAAE--EEDDGYLLFFVHDEN  571

Query  388   TGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             TGKS + VIDAKTMSAE VAVVELP+RVPYGFHA F+TEEQLQ Q  I
Sbjct  572   TGKSCLKVIDAKTMSAETVAVVELPHRVPYGFHALFLTEEQLQGQTPI  619



>emb|CDX76783.1| BnaC08g33690D [Brassica napus]
Length=611

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/539 (71%), Positives = 440/539 (82%), Gaps = 17/539 (3%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P    ++K ID LE  +VK+MHD+S PL YLSGNFAP  +ETPP KDLPV G LPECL
Sbjct  76    PKPSKCFSSKLIDLLELLVVKLMHDASLPLRYLSGNFAPLRDETPPVKDLPVHGFLPECL  135

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDG--DGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGR  1466
             NG F RVGP+PKF P+AGYHW  G  D MIHG+RIKDGKATYVSRFVKTSRL+QEEFFG 
Sbjct  136   NGIFRRVGPHPKFDPLAGYHWHFGHSDRMIHGVRIKDGKATYVSRFVKTSRLQQEEFFGD  195

Query  1465  AKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPY  1286
             AK MKIGDLKG FGL+ V +Q LRIKLKVLD+SYGNGTANT+LIYH GKLLAL E DKP 
Sbjct  196   AKLMKIGDLKGFFGLVMVIMQQLRIKLKVLDDSYGNGTANTSLIYHHGKLLALQETDKPS  255

Query  1285  ---------AIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFV  1133
                       IKVLEDGDLQTLGM +YDKRL H+FTAHPKVDP   EMFTFG +   P++
Sbjct  256   IIFSFHFVDVIKVLEDGDLQTLGMTEYDKRLTHSFTAHPKVDPYFCEMFTFGCSPMPPYL  315

Query  1132  TYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFD  953
             T RVISKDG+MHDPVPITI   +MMHDFAITENYAIFMDLP++F+PKEMV +K++ Y FD
Sbjct  316   TDRVISKDGIMHDPVPITISKPIMMHDFAITENYAIFMDLPMHFRPKEMVKEKKMIYSFD  375

Query  952   ATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASG  773
              TKKARFGVLPRYAK++L+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NP+LDM SG
Sbjct  376   PTKKARFGVLPRYAKDDLMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPNLDMVSG  435

Query  772   TLKDSLD-FVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYV--YATMLS  602
              +++ L+ F NELYEMRFNMKTG ASQKKLS S+  FPR+NE YTG+K RYV  Y T+L 
Sbjct  436   NVEEILESFSNELYEMRFNMKTGSASQKKLSASSNYFPRINEWYTGKKNRYVYGYGTVLD  495

Query  601   DLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDD  422
              + +VKGI+KFDLHAE ETGKTKL VGGN++GI+++G G +G +AI+VP       EEDD
Sbjct  496   GIPRVKGIIKFDLHAEAETGKTKLRVGGNIKGIYEMGQGTYGPDAIYVP---GATAEEDD  552

Query  421   GYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GYLI + HDENTGKS VNVIDAKTMS+EPVAVVELP+RVPYGFHA FVTEEQLQ Q  I
Sbjct  553   GYLIFYAHDENTGKSCVNVIDAKTMSSEPVAVVELPHRVPYGFHALFVTEEQLQEQTLI  611



>ref|XP_009784266.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Nicotiana sylvestris]
Length=440

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/440 (82%), Positives = 399/440 (91%), Gaps = 1/440 (0%)
 Frame = -3

Query  1561  MIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLK  1382
             MIHGLRIKDGKATYVSR+V+TSRLKQEEFFG AKFMKIGDLKG+FGL TVY+Q+LR KLK
Sbjct  1     MIHGLRIKDGKATYVSRYVRTSRLKQEEFFGGAKFMKIGDLKGLFGLFTVYMQVLRAKLK  60

Query  1381  VLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTA  1202
             VLD +YGNGTANTAL+YH GKLLAL E DKPYA+KV+EDGDLQTLGMLDYDKRL H+FTA
Sbjct  61    VLDITYGNGTANTALVYHHGKLLALSEADKPYALKVMEDGDLQTLGMLDYDKRLAHSFTA  120

Query  1201  HPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIF  1022
             HPKVDPVTGEMFTFGY+Q  P++TYRVISK G+M DPVPITIP  +MMHDFAITENYAI 
Sbjct  121   HPKVDPVTGEMFTFGYSQNPPYITYRVISKGGIMQDPVPITIPEPIMMHDFAITENYAIM  180

Query  1021  MDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAW  842
             MDLPL F+PKEMV   QLA+ FDATK ARFGVLPRYAK+E LIKWFELPNCFIFH ANAW
Sbjct  181   MDLPLCFRPKEMVKNNQLAFFFDATKNARFGVLPRYAKSEALIKWFELPNCFIFHNANAW  240

Query  841   EEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESAVDF  665
             EEGDEVV+I+CR+QNP+LDM +G +K+ L +F NELYEMRFNMK+G ASQKKLSESAVDF
Sbjct  241   EEGDEVVLITCRVQNPNLDMVNGVVKEKLENFSNELYEMRFNMKSGAASQKKLSESAVDF  300

Query  664   PRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPG  485
             PR+NENYTGRKQRYVY T L  +AKV GI+KFDLHAEPETGK +LEVGGNV+GIFDLGPG
Sbjct  301   PRINENYTGRKQRYVYGTTLDSIAKVTGIIKFDLHAEPETGKAQLEVGGNVQGIFDLGPG  360

Query  484   RFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRV  305
             RFGSEA+FVPR+  T CEEDDGYLI FVHDENTGKSAVNVIDAKTMSAEPVAVVELP RV
Sbjct  361   RFGSEAVFVPRQPGTECEEDDGYLIFFVHDENTGKSAVNVIDAKTMSAEPVAVVELPKRV  420

Query  304   PYGFHAFFVTEEQLQTQAEI  245
             PYGFHAFFVTEEQ+Q QA++
Sbjct  421   PYGFHAFFVTEEQIQEQAKL  440



>ref|XP_006301637.1| hypothetical protein CARUB_v10022080mg, partial [Capsella rubella]
 gb|EOA34535.1| hypothetical protein CARUB_v10022080mg, partial [Capsella rubella]
Length=547

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/535 (68%), Positives = 438/535 (82%), Gaps = 14/535 (3%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P    ++K +D LE  +VK MHD+S PL YLS NFAP  +ETPP KDLPV G LP CL
Sbjct  13    PKPSKDFSSKLLDLLESLVVKHMHDASLPLSYLSRNFAPLRDETPPTKDLPVHGTLPGCL  72

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDG---------DGMIHGLRIKDGKATYVSRFVKTSRLK  1487
             NGEF+R+GPNPKF P+AGYHW            + MIHG+RIKDGKA YVSR+V+TSRLK
Sbjct  73    NGEFLRIGPNPKFVPLAGYHWHSFMDYLLAQVLESMIHGVRIKDGKAAYVSRYVRTSRLK  132

Query  1486  QEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLAL  1307
             QEEFFG AKFMKIGDLKG+FGLLT  +Q +R  LKVLDNSYG+GTANT+LIYH GKLLAL
Sbjct  133   QEEFFGAAKFMKIGDLKGVFGLLTTIMQQVRNNLKVLDNSYGDGTANTSLIYHHGKLLAL  192

Query  1306  HEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTY  1127
             HE DKPY +KVLEDGDL+TLGM+DYDKRL H+FTAHPKVDPVTGEMFTFGY+   P++TY
Sbjct  193   HEADKPYVVKVLEDGDLKTLGMIDYDKRLTHSFTAHPKVDPVTGEMFTFGYSVIPPYLTY  252

Query  1126  RVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDAT  947
             RVISK+G+MHDPV ITI   +MMHDFAIT+NYAIFMDLP+  +PKEMV + ++   FD T
Sbjct  253   RVISKNGIMHDPVTITISEPIMMHDFAITKNYAIFMDLPMLLKPKEMVKENKMIISFDPT  312

Query  946   KKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTL  767
             KKARFGVLPRYAK++L+I+WFELPNC+I HTANAWEE DEVV+I+CR++NP++DM  G +
Sbjct  313   KKARFGVLPRYAKDDLMIRWFELPNCYISHTANAWEEDDEVVLITCRLENPNIDMVGGYV  372

Query  766   KDSLDFV-NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLA-  593
             K+ L+   +ELYE+RFNMKTG ASQKKLS S ++FP++NE YT +K RYVY T+L + A 
Sbjct  373   KEKLEICSSELYEIRFNMKTGSASQKKLSASPIEFPKINEFYTLKKHRYVYGTILDNSAV  432

Query  592   -KVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGY  416
              KV G++KFDLHAE E GK  LEVGGN++GI++LG GR+GSEA++VPR A+   EEDDGY
Sbjct  433   LKVIGVIKFDLHAEAEEGKKMLEVGGNIKGIYELGQGRYGSEAVYVPRGAAE--EEDDGY  490

Query  415   LILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             L+ FVHDEN+GKS + VIDAKTMS E VAVVELP+RVPYGFHAFF+TEEQL  Q 
Sbjct  491   LLFFVHDENSGKSCLKVIDAKTMSDETVAVVELPHRVPYGFHAFFLTEEQLLKQT  545



>ref|XP_009589877.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Nicotiana tomentosiformis]
Length=440

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/440 (82%), Positives = 395/440 (90%), Gaps = 1/440 (0%)
 Frame = -3

Query  1561  MIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLK  1382
             MIHGLRIKDGKATYVSR+V+TSRLKQEEFFG AKFMKIGDLKG+FGL TVY+QMLR KLK
Sbjct  1     MIHGLRIKDGKATYVSRYVRTSRLKQEEFFGGAKFMKIGDLKGLFGLFTVYMQMLRAKLK  60

Query  1381  VLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTA  1202
             VLD +YGNGTANTAL+YH GKLLAL E DKPYA+KVLEDGDLQTLGMLDYDKRL H+FTA
Sbjct  61    VLDITYGNGTANTALVYHHGKLLALSEADKPYALKVLEDGDLQTLGMLDYDKRLAHSFTA  120

Query  1201  HPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIF  1022
             HPKVDPVTGEMFTFGY+   P++TYRVISKDG+M DPV ITIP  VMMHDFAITENYA+ 
Sbjct  121   HPKVDPVTGEMFTFGYSHNPPYITYRVISKDGIMQDPVSITIPEPVMMHDFAITENYAVM  180

Query  1021  MDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAW  842
             MDLPL F+PKEMV   QLA+ FD TKKARFGVLPRYAK+E LIKWFELPNCFIFH ANAW
Sbjct  181   MDLPLCFRPKEMVKNNQLAFSFDVTKKARFGVLPRYAKSEALIKWFELPNCFIFHNANAW  240

Query  841   EEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESAVDF  665
             EEGDEVV+I+CR+QNP+LDM +G +K+ L +F NELYEMRFNMK+G ASQKKLSESAVDF
Sbjct  241   EEGDEVVLITCRLQNPNLDMVNGVVKEKLENFTNELYEMRFNMKSGAASQKKLSESAVDF  300

Query  664   PRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPG  485
             PR+NENYTGRKQRYVY T L  +AKV G++KFDLHAEPETGK +LEVGGNV+GIFDLG G
Sbjct  301   PRINENYTGRKQRYVYGTTLDSIAKVTGVIKFDLHAEPETGKAQLEVGGNVQGIFDLGSG  360

Query  484   RFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRV  305
             RFGSEA+FVPR+  T  EEDDGYLI FVHDENTGKSAVNVIDAKTMS EPVAVVELP RV
Sbjct  361   RFGSEAVFVPRQPGTESEEDDGYLIFFVHDENTGKSAVNVIDAKTMSTEPVAVVELPKRV  420

Query  304   PYGFHAFFVTEEQLQTQAEI  245
             PYGFHAFFVTEEQ+Q QA++
Sbjct  421   PYGFHAFFVTEEQIQEQAKL  440



>gb|ABG22113.1| 9,10-9',10' carotenoid cleavage dioxygenase 1, putative, expressed 
[Oryza sativa Japonica Group]
Length=519

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/483 (75%), Positives = 410/483 (85%), Gaps = 2/483 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P+ G+A+ A+D LE A V++ HD+SKPL++LSGNFAP   ETPP   LPV GHLPECL
Sbjct  15    PRPRRGLASWALDLLERAAVRLGHDASKPLYWLSGNFAPVHHETPPAPALPVRGHLPECL  74

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKTSRLKQEE+FG AK
Sbjct  75    NGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTSRLKQEEYFGGAK  134

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG +GL  V +Q LR KLKVLD +YG+GTANTALIYH GKL+AL E DKPY +
Sbjct  135   FMKIGDLKGFYGLFMVQMQQLRKKLKVLDFTYGHGTANTALIYHHGKLMALSEADKPYVV  194

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMF FGY+ + P+ TYRVI+KDG M
Sbjct  195   KVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFAFGYSHEPPYCTYRVITKDGAM  254

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
              DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKKARFG+L 
Sbjct  255   LDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKARFGILQ  314

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVN  743
             RY K++  I+WFELPNCFIFH ANAWEEGDEV++I+CR++NPDLD  +G   D+L+ F N
Sbjct  315   RYEKDDTNIRWFELPNCFIFHNANAWEEGDEVILITCRLENPDLDKVNGYQSDNLENFGN  374

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             ELYEMRFNMKTG ASQK+LS SAVDFPR+NE+YTGRKQRYVY  +L+ +AKV GI+KFDL
Sbjct  375   ELYEMRFNMKTGAASQKQLSVSAVDFPRINESYTGRKQRYVYCAILNSIAKVAGIIKFDL  434

Query  562   HAEPE-TGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             HAEPE +GK +LEVGGNV GIFDLGPGRFGSEAIFVPRE     EEDDGYLI FVHDENT
Sbjct  435   HAEPEISGKKQLEVGGNVRGIFDLGPGRFGSEAIFVPREPGVSGEEDDGYLIFFVHDENT  494

Query  385   GKS  377
             G S
Sbjct  495   GYS  497



>gb|EMT18015.1| hypothetical protein F775_06220 [Aegilops tauschii]
Length=515

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/465 (78%), Positives = 402/465 (86%), Gaps = 4/465 (1%)
 Frame = -3

Query  1648  ECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFG  1469
             ECLNGEFVRVGPNPKF PVAGYHWFDGDGMIH +RIKDGKATYVSR+VKTSRLKQEE+FG
Sbjct  2     ECLNGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVKTSRLKQEEYFG  61

Query  1468  RAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKP  1289
              AKFMKIGDLKG FGL  V +Q LR KLK+LD +YG GTANTALIYH GKLLAL E DKP
Sbjct  62    GAKFMKIGDLKGFFGLFMVQMQALRKKLKILDVTYGFGTANTALIYHHGKLLALSEADKP  121

Query  1288  YAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKD  1109
             Y +KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T EMFTFGY+ + P+ TYRVI+KD
Sbjct  122   YVVKVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKD  181

Query  1108  GLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFG  929
             G+M DPVPITIP SVMMHDFAITENY+IFMDLPL F+PKEMV   +  YKFD TKK RFG
Sbjct  182   GVMLDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKGRFG  241

Query  928   VLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-  752
             +L RY K+E  I+WFELPNCFIFH ANAWEEGDEVV+I+CR++NPDLD  +GT  + L+ 
Sbjct  242   ILQRYEKDEKTIRWFELPNCFIFHNANAWEEGDEVVLITCRLENPDLDKVNGTQNEKLEN  301

Query  751   FVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTG---RKQRYVYATMLSDLAKVKG  581
             F NELYEMRFNMKTG ASQK+LS +AVDFPRVNE+YTG   RKQRYVY T+L  +AKV G
Sbjct  302   FGNELYEMRFNMKTGAASQKQLSVAAVDFPRVNESYTGSERRKQRYVYCTILDSIAKVTG  361

Query  580   IVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFV  401
             I+KFDLHAEPE+GK +LEVGGNV GI+DLGPGRFGSEA+FVP+E     EEDDGYLI FV
Sbjct  362   IIKFDLHAEPESGKKQLEVGGNVMGIYDLGPGRFGSEAVFVPKEPGVSGEEDDGYLIFFV  421

Query  400   HDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQ  266
             HDENTGKS VNVIDAKTMS +PVAVVELPNRVPYGFHAFFV E++
Sbjct  422   HDENTGKSEVNVIDAKTMSPDPVAVVELPNRVPYGFHAFFVNEQK  466



>gb|AEN94904.1| carotenoid cleavage dioxygenase, partial [Cucurbita moschata]
Length=442

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/442 (81%), Positives = 398/442 (90%), Gaps = 1/442 (0%)
 Frame = -3

Query  1567  DGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIK  1388
             DGMIHGLRIKDGKATYVSR+V+TSRLKQEE+FG AKFMKIGDLKG FGL+ V +Q+LR K
Sbjct  1     DGMIHGLRIKDGKATYVSRYVRTSRLKQEEYFGGAKFMKIGDLKGFFGLVMVNMQILRAK  60

Query  1387  LKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAF  1208
             LKVLD SYG GT NTALIYH GKLLAL E DKPY IKVLEDGDLQTLG+LDYDKRL H+F
Sbjct  61    LKVLDVSYGTGTGNTALIYHHGKLLALSEADKPYVIKVLEDGDLQTLGLLDYDKRLTHSF  120

Query  1207  TAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYA  1028
             TAHPKVDPVTGEMFTFGY+   P+VTYRVISKDGLMHDPVPITIP  VMMHDFAITENYA
Sbjct  121   TAHPKVDPVTGEMFTFGYSHTPPYVTYRVISKDGLMHDPVPITIPNPVMMHDFAITENYA  180

Query  1027  IFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTAN  848
             IFMDLPLYF+PKEMV + +L + FDATKKARFGVLPRYAK++LL++WFELPNCFIFH AN
Sbjct  181   IFMDLPLYFKPKEMVKENKLIFTFDATKKARFGVLPRYAKDDLLMRWFELPNCFIFHNAN  240

Query  847   AWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESAV  671
             AWEEGDEVV+I+CR++NPDLDM SG++K+ L +F NELYEMRFN+K+GL+SQ+KLSESAV
Sbjct  241   AWEEGDEVVLITCRLENPDLDMVSGSVKEKLENFSNELYEMRFNLKSGLSSQRKLSESAV  300

Query  670   DFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLG  491
             DFPRVNE YTGRKQRYVY T L  +AKV GI KFDLHA+ ETG+TK+EVGGNV G++DLG
Sbjct  301   DFPRVNECYTGRKQRYVYGTTLDSIAKVTGIAKFDLHAKRETGRTKIEVGGNVRGLYDLG  360

Query  490   PGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPN  311
             PGRFGSEAIFVPR   T  EEDDGYLILFVHDENTGKSAVNV+DAKTMS+EPVAVVELP+
Sbjct  361   PGRFGSEAIFVPRIPGTTSEEDDGYLILFVHDENTGKSAVNVVDAKTMSSEPVAVVELPH  420

Query  310   RVPYGFHAFFVTEEQLQTQAEI  245
             RVPYGFHAFFV+EEQLQ Q  +
Sbjct  421   RVPYGFHAFFVSEEQLQEQERL  442



>gb|AIG94929.1| carotenoid cleavage dioxygenase 2 [Crocus sativus]
Length=562

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/539 (66%), Positives = 431/539 (80%), Gaps = 18/539 (3%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSS-------------KPLHYLSGNFAPAPEETPPC  1679
             P P+ G+A+ A+D LE A V ++  +S             K  +YLSGN+AP   ETPP 
Sbjct  26    PKPRKGMASVAVDLLEKAFVYLLSGNSAADRSSSSGRRRRKEHYYLSGNYAPVGHETPPS  85

Query  1678  KDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKT  1499
               LP+ G LPECLNG F+RVGPNPKFAPVAGY+W DGDGMIHGLRIKDGKATY+SR++KT
Sbjct  86    DHLPIHGSLPECLNGVFLRVGPNPKFAPVAGYNWVDGDGMIHGLRIKDGKATYLSRYIKT  145

Query  1498  SRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGK  1319
             SR KQEE+FGRAKFMKIGDL+G+ G  T+ + +LR  LKV+D SYG GT NTAL+YH+G 
Sbjct  146   SRFKQEEYFGRAKFMKIGDLRGLLGFFTILILVLRTTLKVIDISYGRGTGNTALVYHNGL  205

Query  1318  LLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAP  1139
             LLAL E DKPY +KVLEDGDLQTLG+LDYDK+L H FTAHPK+DP+T EMFTFGY+   P
Sbjct  206   LLALSEEDKPYVVKVLEDGDLQTLGILDYDKKLSHPFTAHPKIDPLTDEMFTFGYSISPP  265

Query  1138  FVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYK  959
             ++TYRVISKDG+M DPV I+I +  +MHDFAITENYAIFMDLPLYFQP+EMV K +    
Sbjct  266   YLTYRVISKDGVMQDPVQISITSPTIMHDFAITENYAIFMDLPLYFQPEEMV-KGKFVSS  324

Query  958   FDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMA  779
             F  TK+AR GVLPRYAK+E  I+WF+LP+CF+ H ANAWEE DEVV+ +CR+++PDLDM 
Sbjct  325   FHPTKRARIGVLPRYAKDEHPIRWFDLPSCFMTHNANAWEENDEVVLFTCRLESPDLDML  384

Query  778   SGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLS  602
             SG  ++ + +  +ELYEMRFN+KTG+ SQK+LS  +VDFPR+N++YTGRKQ+YVY T+ +
Sbjct  385   SGPAEEEIGNSKSELYEMRFNLKTGITSQKQLSVPSVDFPRINQSYTGRKQQYVYCTLGN  444

Query  601   DLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDD  422
                K+KGIVKFDL  EPE GKT LEVGGNV+GIF+LGP R+GSEAIFVP +     +EDD
Sbjct  445   --TKIKGIVKFDLQIEPEAGKTMLEVGGNVQGIFELGPRRYGSEAIFVPCQPGIKSDEDD  502

Query  421   GYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQT-QAE  248
             GYLI FVHDEN GKS VNVIDAKTMSAEPVAVVELP+RVPYGFHA F+ EE+LQ  QAE
Sbjct  503   GYLIFFVHDENNGKSEVNVIDAKTMSAEPVAVVELPSRVPYGFHALFLNEEELQKHQAE  561



>ref|XP_010552740.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 isoform 
X2 [Tarenaya hassleriana]
Length=444

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/438 (79%), Positives = 393/438 (90%), Gaps = 1/438 (0%)
 Frame = -3

Query  1561  MIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLK  1382
             MIHG+RIKDGKATYVSR+VKTSRLKQE+FFG AKFMKIGD+KG+FGLL V +Q LR KLK
Sbjct  1     MIHGVRIKDGKATYVSRYVKTSRLKQEQFFGGAKFMKIGDVKGLFGLLMVNMQQLRTKLK  60

Query  1381  VLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTA  1202
             +LD+SYG GTANTALIYH GKLLAL E DKPY +KVLEDGDLQT+GM+DYDKRL H+FTA
Sbjct  61    ILDDSYGIGTANTALIYHHGKLLALQEADKPYVVKVLEDGDLQTVGMMDYDKRLTHSFTA  120

Query  1201  HPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIF  1022
             HPKVDPVTGEMFTFGY+ KAP++TYRVISKDG+MH+PVPITIP  +MMHDFAITENYAIF
Sbjct  121   HPKVDPVTGEMFTFGYSHKAPYITYRVISKDGVMHNPVPITIPEPIMMHDFAITENYAIF  180

Query  1021  MDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAW  842
             MDLP++F+PKEMV +K++ Y FD TKKARFGVLPRYAK+EL+I+WFELPNCFIFH ANAW
Sbjct  181   MDLPMHFRPKEMVKEKKMIYSFDLTKKARFGVLPRYAKDELMIRWFELPNCFIFHNANAW  240

Query  841   EEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVNELYEMRFNMKTGLASQKKLSESAVDF  665
             E+ DEVV+I+CR++NPDLDM SG +K+ L+ F NELYEMRFNM TG ASQ+KLS SAVDF
Sbjct  241   EDEDEVVLITCRLENPDLDMVSGNVKEKLENFGNELYEMRFNMATGAASQRKLSASAVDF  300

Query  664   PRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPG  485
             PR+NE YTGRKQRYVY T+L  +AKV GI+KFDLHAEPE GKT+LEVGGN+ GI+DLGPG
Sbjct  301   PRINEWYTGRKQRYVYGTILDSIAKVTGIIKFDLHAEPEPGKTELEVGGNIIGIYDLGPG  360

Query  484   RFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRV  305
             R+GSEAI+VP+E     EED GYLI FVHDE TGKS VNVIDAKTMSA+PVAVVELP+RV
Sbjct  361   RYGSEAIYVPQETGCTAEEDGGYLIFFVHDERTGKSYVNVIDAKTMSADPVAVVELPHRV  420

Query  304   PYGFHAFFVTEEQLQTQA  251
             PYGFHAFFVTEEQLQ QA
Sbjct  421   PYGFHAFFVTEEQLQEQA  438



>ref|XP_010413132.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Camelina sativa]
Length=437

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/440 (79%), Positives = 390/440 (89%), Gaps = 4/440 (1%)
 Frame = -3

Query  1561  MIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLK  1382
             MIHG+RIKDGKATYVSR+VKTSRL+QEE+FG +KFMKIGDLKG FGLL V +Q LR KL 
Sbjct  1     MIHGVRIKDGKATYVSRYVKTSRLQQEEYFGASKFMKIGDLKGFFGLLMVNMQQLRTKLN  60

Query  1381  VLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTA  1202
             +LDNSYG GTANTAL+YHDGKLLAL E DKPY +KVLEDGDLQTLGM+DYDKRL H+FTA
Sbjct  61    ILDNSYGIGTANTALVYHDGKLLALQEADKPYVVKVLEDGDLQTLGMIDYDKRLTHSFTA  120

Query  1201  HPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIF  1022
             HPKVDPVTGEMFTFGY+   P++TYRVISKDG+MHDPV ITI   +MMHDFAITE YAIF
Sbjct  121   HPKVDPVTGEMFTFGYSHTPPYLTYRVISKDGIMHDPVAITISEPIMMHDFAITEAYAIF  180

Query  1021  MDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAW  842
             MDLP++F+PKEMV +K++ Y FD TKKARFGVLPRYAK+EL+I+WFELPNCFIFH ANAW
Sbjct  181   MDLPMHFRPKEMVKEKKMIYSFDPTKKARFGVLPRYAKDELMIRWFELPNCFIFHNANAW  240

Query  841   EEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVNELYEMRFNMKTGLASQKKLSESAVDF  665
             EE DEVV+I+CR++NPDLDM SGT+K+ L+ F NELYEMRFNMKTG ASQKKLS SAVDF
Sbjct  241   EEEDEVVLITCRLENPDLDMVSGTVKEKLENFSNELYEMRFNMKTGSASQKKLSASAVDF  300

Query  664   PRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPG  485
             PR+NE YTG+KQRYVY T+L  +AKV GI+KFDLHAE ETGK  LEVGGN++GI+DLG G
Sbjct  301   PRINECYTGKKQRYVYGTILDSIAKVTGIIKFDLHAEAETGKRMLEVGGNIKGIYDLGQG  360

Query  484   RFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRV  305
             +FGSEAI+VPREA+   EEDDGYLI FVHDENTGKS VNVIDAKTMSAEPVAVVELP+RV
Sbjct  361   KFGSEAIYVPREAA---EEDDGYLIFFVHDENTGKSCVNVIDAKTMSAEPVAVVELPHRV  417

Query  304   PYGFHAFFVTEEQLQTQAEI  245
             PYGFHA FVTEEQLQ Q  I
Sbjct  418   PYGFHALFVTEEQLQEQTLI  437



>ref|XP_006402261.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
 gb|ESQ43714.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
Length=437

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/440 (78%), Positives = 389/440 (88%), Gaps = 4/440 (1%)
 Frame = -3

Query  1561  MIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLK  1382
             MIHG+RIKDGKATYVSR+VKTSRLKQEEFFG AKFMKIGDLKG FGLL V +Q LR KLK
Sbjct  1     MIHGVRIKDGKATYVSRYVKTSRLKQEEFFGAAKFMKIGDLKGFFGLLMVNMQQLRTKLK  60

Query  1381  VLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTA  1202
             VLD+SYG GTANTAL+YH GKLLAL E DKPY +KVLEDGDLQTLGM+DYDKRL H+FTA
Sbjct  61    VLDDSYGYGTANTALVYHHGKLLALQEADKPYVVKVLEDGDLQTLGMIDYDKRLTHSFTA  120

Query  1201  HPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIF  1022
             HPKVDP TGEMFTFGY+   P++TYRVIS+DG+M DPVPITI   +MMHDFAITE+YAIF
Sbjct  121   HPKVDPATGEMFTFGYSHTPPYLTYRVISEDGIMLDPVPITISEPIMMHDFAITESYAIF  180

Query  1021  MDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAW  842
             MDLP++F+PKEMV +K++ Y FD TKKARFGVLPRYAK+EL+I+WFELPNCFIFH ANAW
Sbjct  181   MDLPMHFRPKEMVKEKKMIYSFDPTKKARFGVLPRYAKDELMIRWFELPNCFIFHNANAW  240

Query  841   EEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVNELYEMRFNMKTGLASQKKLSESAVDF  665
             EE DEVV+I+CR++NPDLDM SG +K+ L+ F NELYEMRFNMKTG ASQ+KLS SAVDF
Sbjct  241   EEEDEVVLITCRLENPDLDMVSGNVKEKLENFSNELYEMRFNMKTGSASQRKLSASAVDF  300

Query  664   PRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPG  485
             PR+NE YTG+KQRYVY T+L  +AKV GI+KFDLHAE ETGK  LEVGGN++GI++LG G
Sbjct  301   PRINERYTGKKQRYVYGTILDSIAKVTGIIKFDLHAEAETGKKMLEVGGNIKGIYELGQG  360

Query  484   RFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRV  305
             R+GSEAI+VPREA+   EEDDGYLI FVHDENTGKS VNVIDAKTMSAEPVAVVELP+RV
Sbjct  361   RYGSEAIYVPREAA---EEDDGYLIFFVHDENTGKSCVNVIDAKTMSAEPVAVVELPHRV  417

Query  304   PYGFHAFFVTEEQLQTQAEI  245
             PYGFHA FVTEEQLQ Q  I
Sbjct  418   PYGFHALFVTEEQLQEQTRI  437



>emb|CDY34748.1| BnaA09g41150D [Brassica napus]
Length=483

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/472 (74%), Positives = 402/472 (85%), Gaps = 7/472 (1%)
 Frame = -3

Query  1648  ECLNGEFVRVGPNPKFAPVAGYHW-FDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFF  1472
             ECLNG F+RVGPNPKF P+AGYHW F G  MIHG+RIKDGKATYVSRFVKTSRL+QEEFF
Sbjct  15    ECLNGIFLRVGPNPKFDPLAGYHWHFLGRVMIHGVRIKDGKATYVSRFVKTSRLQQEEFF  74

Query  1471  GRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDK  1292
             G AK MKIGDLKG FGL+ V +Q LRIKLKVLD+SYGNGTANT+LIYH GKLLAL E DK
Sbjct  75    GDAKLMKIGDLKGFFGLVMVIMQQLRIKLKVLDDSYGNGTANTSLIYHHGKLLALQETDK  134

Query  1291  PYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISK  1112
             PY IKVLEDGDLQTLGM DYDKRL H+FTAHPKVDPVTGEMFTFG +   P++TYRVISK
Sbjct  135   PYVIKVLEDGDLQTLGMTDYDKRLTHSFTAHPKVDPVTGEMFTFGCSPMPPYLTYRVISK  194

Query  1111  DGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARF  932
             DG+MHDPVPITI   VMMHDFAITE YAIFMDLP++F+PKEMV +K++ Y FD TK ARF
Sbjct  195   DGIMHDPVPITISKPVMMHDFAITETYAIFMDLPMHFRPKEMVKEKKMIYSFDPTKNARF  254

Query  931   GVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD  752
             GVLPRYAK++L+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NP+LDM SG +++ L+
Sbjct  255   GVLPRYAKDDLMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPNLDMVSGNVEEILE  314

Query  751   -FVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYV--YATMLSDLAKVKG  581
              F NELYEMRFNMKTG ASQKKLS S+  FPR+NE YTG+K RYV  Y T L  ++KV G
Sbjct  315   SFSNELYEMRFNMKTGSASQKKLSASSNYFPRINECYTGKKNRYVYGYGTFLDGISKVTG  374

Query  580   IVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFV  401
             I+K DLHAE ETGK  L+VGGN++GI+ LG G + S+AI+VPRE++   EEDDGYLI F 
Sbjct  375   IIKLDLHAEAETGKRILQVGGNIKGIYKLGQGIYCSDAIYVPRESA---EEDDGYLIFFF  431

Query  400   HDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             HDENTGKS V+VIDA+TMSAEPVA+VELP+RVPYGFHA FVTE QLQ Q  I
Sbjct  432   HDENTGKSCVHVIDARTMSAEPVAIVELPHRVPYGFHALFVTERQLQEQTLI  483



>gb|EMS57571.1| hypothetical protein TRIUR3_09265 [Triticum urartu]
Length=544

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/529 (69%), Positives = 406/529 (77%), Gaps = 62/529 (12%)
 Frame = -3

Query  1654  LPECLNGEFVRVGPNPKFAPVAGYHWFDGDG---------------------MIHGLRIK  1538
             L ECLNGEFVRVGPNPKF PVAG   FDGDG                     MIH +RIK
Sbjct  19    LQECLNGEFVRVGPNPKFVPVAG---FDGDGLNLCSRLLLFGYTNFYIVSYRMIHAMRIK  75

Query  1537  DGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGN  1358
             DGKATYVSR+VKTSRLKQEE+FG AKFMKIGDLKG FGL  V +Q LR KLK+LD +YG 
Sbjct  76    DGKATYVSRYVKTSRLKQEEYFGGAKFMKIGDLKGFFGLFMVQMQALRKKLKILDVTYGF  135

Query  1357  GTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVT  1178
             GTANTALIYH GKLLAL E DKPY +KVLEDGDLQTLG+LDYDKRL H+FTAHPKVDP T
Sbjct  136   GTANTALIYHHGKLLALSEADKPYVVKVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFT  195

Query  1177  GEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQ  998
              EMFTFGY+ + P+ TYRVI+KDG+M DPVPITIP SVMMHDFAITENY+IFMDLPL F+
Sbjct  196   DEMFTFGYSHEPPYCTYRVITKDGVMLDPVPITIPESVMMHDFAITENYSIFMDLPLLFR  255

Query  997   PK------------------------------------EMVTKKQLAYKFDATKKARFGV  926
             PK                                    EMV   +  YKFD TKK RFG+
Sbjct  256   PKDALHRCIWDSHAFALALDKGYSSSQSGLIVLHSCTKEMVKNGEFIYKFDPTKKGRFGI  315

Query  925   LPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DF  749
             L RY K+E  I+WFELPNCFIFH ANAWEEGDEVV+I+CR++NPDLD  +GT  + L +F
Sbjct  316   LQRYEKDEKTIRWFELPNCFIFHNANAWEEGDEVVLITCRLENPDLDKVNGTQNEKLENF  375

Query  748   VNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKF  569
              NELYEMRFNMKTG ASQK+LS +AVDFPR+NE+YTGRKQRYVY T+L  +AKV G++KF
Sbjct  376   GNELYEMRFNMKTGAASQKQLSVAAVDFPRINESYTGRKQRYVYCTILDSIAKVTGVIKF  435

Query  568   DLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDEN  389
             DLHAEPE+GK +LEVGGNV GI+DLGPGRFGSEA+FVP+E     EEDDGYLILFVHDEN
Sbjct  436   DLHAEPESGKKQLEVGGNVMGIYDLGPGRFGSEAVFVPKEPGVSGEEDDGYLILFVHDEN  495

Query  388   TGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQL-QTQAEI  245
             TGKS VNVIDAKTMS +PVAVVELPNRVPYGFHAFFV EEQL   QAE+
Sbjct  496   TGKSEVNVIDAKTMSPDPVAVVELPNRVPYGFHAFFVNEEQLVHQQAEV  544



>gb|EMS66522.1| hypothetical protein TRIUR3_03973 [Triticum urartu]
Length=519

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/474 (74%), Positives = 393/474 (83%), Gaps = 10/474 (2%)
 Frame = -3

Query  1648  ECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFG  1469
             +CLNGEFVRVGPNPKFAP+AG   FDGDGMIH +RIKDGKATYVSR+VKTSRL+QEE+FG
Sbjct  48    KCLNGEFVRVGPNPKFAPLAG---FDGDGMIHAMRIKDGKATYVSRYVKTSRLEQEEYFG  104

Query  1468  RAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKP  1289
              AKF KIGDLKG+FGL  V  Q LR KLKVLD +YG GTANTALIYH GKL+AL E DKP
Sbjct  105   GAKFTKIGDLKGVFGLFMVLTQELRKKLKVLDATYGIGTANTALIYHHGKLMALSESDKP  164

Query  1288  YAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKD  1109
             Y +K+LEDGDLQTLG+LDYDKRL H FTAHPKVDP T EMFTFGY+ + P+ TYRVI+KD
Sbjct  165   YVVKILEDGDLQTLGLLDYDKRLKHPFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKD  224

Query  1108  GLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFG  929
             G+M DPVPITIP SVMMHDFAITENY+IFMDLP++F+PKEM    +  YKFD TK ARFG
Sbjct  225   GIMLDPVPITIPESVMMHDFAITENYSIFMDLPMFFRPKEMAKNGEFIYKFDPTKNARFG  284

Query  928   VLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-D  752
             +L RY K+E  I+WFELPNCFIFH ANAWEEGDEV++I+CR+ N DLD  +G   D L D
Sbjct  285   ILQRYEKDEKTIRWFELPNCFIFHNANAWEEGDEVILITCRLNNLDLDQVNGHQSDKLED  344

Query  751   FVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVK----  584
               NELYEMRFNMKTG ASQK+LS SA+DFPR+NE+YTGRKQRYVY T+L    KV     
Sbjct  345   PGNELYEMRFNMKTGAASQKQLSVSAIDFPRINESYTGRKQRYVYCTILESTVKVTGILK  404

Query  583   --GIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLI  410
               GI+KFDLHAEPE+ K +LEVGGNV GI+DLGPGRF SEA+FVP+E     EEDDGYLI
Sbjct  405   MIGIIKFDLHAEPESDKEQLEVGGNVRGIYDLGPGRFCSEAVFVPKEPGVLGEEDDGYLI  464

Query  409   LFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
              FVHDENTGKS +NVIDAKTM A+PVAVVELP+RVPYGFHAFFV EEQL  Q E
Sbjct  465   FFVHDENTGKSEINVIDAKTMCADPVAVVELPSRVPYGFHAFFVNEEQLGHQVE  518



>gb|AHE41421.1| carotenoid cleavage dioxygenase 1, partial [Lycium chinense]
Length=407

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/407 (81%), Positives = 368/407 (90%), Gaps = 1/407 (0%)
 Frame = -3

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KFMKIGDLKG+FGL TVY+QMLR KLKVLD SYGNGTANTAL+YH GKLLAL E DKPYA
Sbjct  1     KFMKIGDLKGLFGLFTVYMQMLRTKLKVLDISYGNGTANTALVYHHGKLLALSEADKPYA  60

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             +KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+   P++TYRVISKDG+
Sbjct  61    LKVLEDGDLQTLGMLDYDKRLAHSFTAHPKVDPVTGEMFTFGYSHTPPYITYRVISKDGI  120

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             M DPVPITIP ++MMHDFAITENYAI MDLPL F+PKEMV   +LA+ FD TKKARFGVL
Sbjct  121   MQDPVPITIPEAIMMHDFAITENYAIMMDLPLCFRPKEMVKNNKLAFTFDGTKKARFGVL  180

Query  922   PRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFV  746
              RYA NE LIKWFELPNCFIFH ANAWEE DEVV+I+CR+QNPDLDM +G +K++L +F 
Sbjct  181   ARYANNEALIKWFELPNCFIFHNANAWEEEDEVVLITCRVQNPDLDMVNGGVKENLENFC  240

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMK+G ASQKKLSESAVDFPR+NE+YTGRKQRYVY T L+ +AKV GI+KFD
Sbjct  241   NELYEMRFNMKSGAASQKKLSESAVDFPRINESYTGRKQRYVYGTTLNSIAKVTGIIKFD  300

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHAEPETGK++LEVGGNV+GIFDLGPGRFGSEA+FVPR+  + CEEDDGYLI FVHDENT
Sbjct  301   LHAEPETGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPRQPGSECEEDDGYLIFFVHDENT  360

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKSAVNVIDAKTMSAEPVAVVELP RVPYGFHAFFVTEEQ+Q QA++
Sbjct  361   GKSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTEEQIQEQAKL  407



>gb|AFW89636.1| white cap1 [Zea mays]
Length=467

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/443 (77%), Positives = 380/443 (86%), Gaps = 1/443 (0%)
 Frame = -3

Query  1573  DGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLR  1394
             D   MIH +RIKDGKATYVSR+VKT+RLKQEE+FG AKFMKIGDLKG FGL  V +Q LR
Sbjct  23    DSYRMIHAMRIKDGKATYVSRYVKTARLKQEEYFGGAKFMKIGDLKGFFGLFMVQMQQLR  82

Query  1393  IKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGH  1214
              K KVLD +YG GTANTALIYH GKL+AL E DKPY +KVLEDGDLQTLG+LDYDKRL H
Sbjct  83    KKFKVLDFTYGFGTANTALIYHHGKLMALSEADKPYVVKVLEDGDLQTLGLLDYDKRLKH  142

Query  1213  AFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITEN  1034
             +FTAHPKVDP T EMFTFGY+ + P+ TYRVI+K+G M DPVPITIP SVMMHDFAITEN
Sbjct  143   SFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVINKEGAMLDPVPITIPESVMMHDFAITEN  202

Query  1033  YAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHT  854
             Y+IFMDLPL F+PKEMV   +  YKFD TKK RFG+LPRYAK++ LI+WF+LPNCFIFH 
Sbjct  203   YSIFMDLPLLFRPKEMVKNGEFIYKFDPTKKGRFGILPRYAKDDKLIRWFQLPNCFIFHN  262

Query  853   ANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSES  677
             ANAWEEGDEVV+I+CR++NPDLD  +G   D L +F NELYEMRFNMKTG ASQK+LS S
Sbjct  263   ANAWEEGDEVVLITCRLENPDLDKVNGYQSDKLENFGNELYEMRFNMKTGAASQKQLSVS  322

Query  676   AVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFD  497
             AVDFPRVNE+YTGRKQRYVY T+L  +AKV GI+KFDLHAEPE+G  +LEVGGNV+GI+D
Sbjct  323   AVDFPRVNESYTGRKQRYVYCTILDSIAKVTGIIKFDLHAEPESGVKELEVGGNVQGIYD  382

Query  496   LGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVEL  317
             LGPGRFGSEAIFVP+      EEDDGYLI FVHDENTGKS VNVIDAKTMSA+PVAVVEL
Sbjct  383   LGPGRFGSEAIFVPKHPGVSGEEDDGYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVEL  442

Query  316   PNRVPYGFHAFFVTEEQLQTQAE  248
             PNRVPYGFHAFFVTE+QL  QAE
Sbjct  443   PNRVPYGFHAFFVTEDQLARQAE  465



>gb|ACD62475.1| carotenoid cleavage dioxygenase 2 [Crocus sativus]
Length=563

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/540 (64%), Positives = 421/540 (78%), Gaps = 19/540 (4%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSS-------------KPLHYLSGNFAPAPEETPPC  1679
             P P+ G+A+ A+D LE A V ++  +S             K  +YLSGN+AP   ETPP 
Sbjct  26    PKPRKGMASVAVDLLEKAFVYLLSGNSAADRSSSSGRRRRKEHYYLSGNYAPVGHETPPS  85

Query  1678  KDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKT  1499
               LPV G LPECLNG F+RVG  P FAPVAGY+W DGDGMIHGLRIKDGKATY+SR++KT
Sbjct  86    DHLPVHGSLPECLNGVFLRVGLTPSFAPVAGYNWVDGDGMIHGLRIKDGKATYLSRYIKT  145

Query  1498  SRLKQ-EEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDG  1322
             SR KQ       AKFMKIGDL+G+ G  T+ + +LR  LKV+D SYG GT NTAL+YH+G
Sbjct  146   SRFKQGRNILEGAKFMKIGDLRGLLGFFTILILVLRTTLKVIDISYGRGTGNTALVYHNG  205

Query  1321  KLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKA  1142
              LLAL E DKPY +KVLEDGDLQTLG+LDYDK+L H FTAHPK+DP+T EMFTFGY+   
Sbjct  206   LLLALSEEDKPYVVKVLEDGDLQTLGILDYDKKLSHPFTAHPKIDPLTDEMFTFGYSISP  265

Query  1141  PFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAY  962
             P++TYRVISKDG+M DPV I+I +  +MHDFAITENYAIFMDLPLYFQ + MV K ++  
Sbjct  266   PYLTYRVISKDGVMQDPVQISITSPTIMHDFAITENYAIFMDLPLYFQTRGMV-KGEIVS  324

Query  961   KFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDM  782
              F  TK+AR GVLPRYA++E  I+WF+LP+CF+ H ANAWEE DEVV+ +CR+++PDLDM
Sbjct  325   SFHPTKRARIGVLPRYAEDEHPIRWFDLPSCFMTHNANAWEENDEVVLFTCRLESPDLDM  384

Query  781   ASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATML  605
              SG  ++ + +  +ELYEMRFN+KTG+ SQK+LS  +VDFPR+N++YTGRKQ+YVY T+ 
Sbjct  385   LSGPAEEEIGNSKSELYEMRFNLKTGITSQKQLSVPSVDFPRINQSYTGRKQQYVYCTLG  444

Query  604   SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEED  425
             +   K+KGIVKFDL  EPE GKT LEVGGNV+GIF+LGP R+GSEAIFVP +     +ED
Sbjct  445   N--TKIKGIVKFDLQIEPEAGKTMLEVGGNVQGIFELGPRRYGSEAIFVPCQPGRKSDED  502

Query  424   DGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQT-QAE  248
             DGYLI FVHDEN GKS VNVIDAKTMSAEPVAVV+LP+RVPYGFHA F+ EE+LQ  QAE
Sbjct  503   DGYLIFFVHDENNGKSEVNVIDAKTMSAEPVAVVQLPSRVPYGFHALFLNEEELQKHQAE  562



>ref|XP_010241261.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Nelumbo nucifera]
Length=442

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/449 (75%), Positives = 380/449 (85%), Gaps = 8/449 (2%)
 Frame = -3

Query  1594  VAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLT  1415
             +AGYHWFDGDGM+HGLRIK+GKATYVSR+V+TSRLKQEEFFG  KF+KIGDL G+FGL  
Sbjct  1     MAGYHWFDGDGMVHGLRIKNGKATYVSRYVRTSRLKQEEFFGGPKFLKIGDLTGLFGLFA  60

Query  1414  VYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLD  1235
               +  LR KLKVLD SYG GTANTAL+YH G+LLAL+E DKPY +KVLEDGDLQTLGMLD
Sbjct  61    SGIHSLRAKLKVLDVSYGIGTANTALVYHHGRLLALYEADKPYVLKVLEDGDLQTLGMLD  120

Query  1234  YDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMH  1055
             YDKRL H+FTAHPKVDP TGEMFTFG +   P+VTYRVISKDG MHD VPITI   VMMH
Sbjct  121   YDKRLTHSFTAHPKVDPYTGEMFTFGNSLTPPYVTYRVISKDGFMHDQVPITISDPVMMH  180

Query  1054  DFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELP  875
             DFAITENYAIFMDLPLYF+ +EMV   +L + FDATKK+RFG+LPRYAK+EL I+WFELP
Sbjct  181   DFAITENYAIFMDLPLYFRREEMVKGNKLIFTFDATKKSRFGILPRYAKDELQIRWFELP  240

Query  874   NCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQ  695
             NCFIFH ANAWEE DEVV+I+CR+QN DL++         +   ELYEMRFNMKTGL+SQ
Sbjct  241   NCFIFHNANAWEEEDEVVLITCRLQNIDLEVLQ-------NLTIELYEMRFNMKTGLSSQ  293

Query  694   KKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGN  515
             KKLS  A+DFPRVNENYTGRKQR+VY  +L    KV GI+KFDL AEPE GKTKLEVGGN
Sbjct  294   KKLSAPAIDFPRVNENYTGRKQRFVYGAILDSTLKVTGIIKFDLQAEPENGKTKLEVGGN  353

Query  514   VEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEP  335
             V+GIF+ GPG FGSEAIF+PRE    CEEDDGYLI FVHDENTGKS VNVIDAK+MS++P
Sbjct  354   VQGIFNFGPGIFGSEAIFIPREPD-ACEEDDGYLIFFVHDENTGKSTVNVIDAKSMSSDP  412

Query  334   VAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             +AV+ELP+RVPYGFHA FVTEEQLQ QA+
Sbjct  413   IAVIELPDRVPYGFHALFVTEEQLQEQAK  441



>gb|EMT19110.1| hypothetical protein F775_23086 [Aegilops tauschii]
Length=509

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/486 (71%), Positives = 386/486 (79%), Gaps = 12/486 (2%)
 Frame = -3

Query  1684  PCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFV  1505
             P  DL  SG   ECLNGEF+RVG NPKFAPVAG   FDGDGMIH L IKDGKATYVSR+V
Sbjct  28    PRNDLVRSG--AECLNGEFLRVGANPKFAPVAG---FDGDGMIHALHIKDGKATYVSRYV  82

Query  1504  KTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHD  1325
              TSR KQEE+FG AKFMK+GDLKG+FGL  V  Q LR KL+VLD +YG G ANTA IYH 
Sbjct  83    TTSRFKQEEYFGGAKFMKVGDLKGLFGLFMVLTQELRKKLQVLDATYGTGPANTAFIYHH  142

Query  1324  GKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQK  1145
             GKL+AL E DKPY +++LEDGDLQTLG+L+YD+RL H FTAHPKVDP T EMFTFGY+ +
Sbjct  143   GKLMALSESDKPYVVRILEDGDLQTLGLLEYDQRLKHPFTAHPKVDPFTDEMFTFGYSHE  202

Query  1144  APFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLA  965
              P+ TYRVI+KDG+M DPVPITIP SVMMHDFAIT NY+IFMDLP+ F+PKEMV   +  
Sbjct  203   PPYCTYRVITKDGIMLDPVPITIPESVMMHDFAITANYSIFMDLPMLFRPKEMVKNDEFI  262

Query  964   YKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLD  785
             YKFD  KKARFG+L RY K+E  IKWFELPNCFIFH ANAWEEG EV++I+CR  N DLD
Sbjct  263   YKFDPAKKARFGILQRYEKDEKNIKWFELPNCFIFHNANAWEEGSEVILITCRHNNVDLD  322

Query  784   MASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATM  608
               +G   D L D  NELYEMRFNMKTG ASQK+LS SA+DFPR+NE+YTGRKQRY+Y  +
Sbjct  323   QVNGNQSDKLEDHGNELYEMRFNMKTGAASQKQLSVSAIDFPRINESYTGRKQRYIYCMI  382

Query  607   LSDLAKVK------GIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREA  446
             L    KV       GI+KFDLHA+PE  K  LEVGGNV GI+DL PG F SEA+FVP+E 
Sbjct  383   LESTVKVNGILKMTGIIKFDLHAKPERSKEHLEVGGNVTGIYDLSPGMFCSEAVFVPKEP  442

Query  445   STGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQ  266
                 EEDDGYLI FVHDENTGKS VNVIDAKTMSA+PVAVVELP+RVPYGFHAFFV EEQ
Sbjct  443   GVSGEEDDGYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPSRVPYGFHAFFVNEEQ  502

Query  265   LQTQAE  248
             L  Q E
Sbjct  503   LGHQVE  508



>gb|AAK00622.1| carotenoid cleavage dioxygenase 1 [Persea americana]
Length=524

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/498 (71%), Positives = 400/498 (80%), Gaps = 16/498 (3%)
 Frame = -3

Query  1723  LSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLR  1544
             LSGNF    EETP C++LP+ G       GEFVRVGPNPKFAPVAGYHWFDGDGM+HG+R
Sbjct  38    LSGNFPLRVEETP-CENLPIKGTSRIAWMGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMR  96

Query  1543  IKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTV--YLQMLRIKLKVLDN  1370
             IKDGKATYVSR+VKTSRLKQEE+FG AKFMKIGDLKGMFGL  V   +QMLR KLKVLD 
Sbjct  97    IKDGKATYVSRYVKTSRLKQEEYFGGAKFMKIGDLKGMFGLFMVNMQMQMLRAKLKVLDV  156

Query  1369  SYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKV  1190
             SYG GT NTALIYH GKLLAL E DKPY +KVLEDGDLQTLGMLDYDKRL H+FTAHPKV
Sbjct  157   SYGTGTGNTALIYHHGKLLALSEADKPYVLKVLEDGDLQTLGMLDYDKRLSHSFTAHPKV  216

Query  1189  DPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLP  1010
             DP T EM   G +   P++TYRVISKDG+MHDPVPITIP  VMMHDFAITENYAIFMDLP
Sbjct  217   DPFTDEMLHLGISH-TPYLTYRVISKDGIMHDPVPITIP-EVMMHDFAITENYAIFMDLP  274

Query  1009  LYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGD  830
             LYF+PK+MV K +L + FDATKKARFGVLPRYAK+EL ++WFELPNCFIFH ANAWEEG 
Sbjct  275   LYFRPKKMV-KGKLIFPFDATKKARFGVLPRYAKDELQMRWFELPNCFIFHNANAWEEGG  333

Query  829   EVVMISCRIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             E+V+I+CR+QNP LDM SG +K+ L +F NELYEMRF+MKTG ASQK+LS SAVDFPR+N
Sbjct  334   EIVLITCRLQNPGLDMVSGIVKEKLENFKNELYEMRFDMKTGAASQKQLSVSAVDFPRIN  393

Query  652   ENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGK--TKLEVGGNVEGIFDLGPGRF  479
             E+YTGRKQR+VY T+L+++  VKGI+K DL      G   + LEV       F   PG  
Sbjct  394   ESYTGRKQRFVYGTILNNITNVKGIIKSDLQLNQRDGNRSSMLEVIIKASLSFSWDPG--  451

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPY  299
                  FVPR+     EEDDGYLI FV  E TGKS VNVIDAKTMSA+PVA+VELP+RVP+
Sbjct  452   -----FVPRKPGVTSEEDDGYLIFFVLTERTGKSEVNVIDAKTMSADPVAIVELPHRVPF  506

Query  298   GFHAFFVTEEQLQTQAEI  245
             GF  FFV+EEQLQ QA+I
Sbjct  507   GFLPFFVSEEQLQQQAKI  524



>ref|XP_006850221.1| hypothetical protein AMTR_s00022p00253640 [Amborella trichopoda]
 gb|ERN11802.1| hypothetical protein AMTR_s00022p00253640 [Amborella trichopoda]
Length=438

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/430 (77%), Positives = 380/430 (88%), Gaps = 3/430 (1%)
 Frame = -3

Query  1561  MIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLK  1382
             MIHG+ IKDGKATYVSRFV+TSRLKQEE+FGR KFMK+GD KG+FGL TVY+ + R KLK
Sbjct  1     MIHGIHIKDGKATYVSRFVQTSRLKQEEYFGRPKFMKLGDFKGLFGLFTVYMNIFRSKLK  60

Query  1381  VLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTA  1202
             ++D SYG GT NTALIYH G+L+AL+EGDKPY IKVL DGDLQTLG+LDYDKRL H+FTA
Sbjct  61    IIDLSYGRGTGNTALIYHQGRLMALNEGDKPYVIKVLADGDLQTLGLLDYDKRLQHSFTA  120

Query  1201  HPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIF  1022
             HPKVDPVTGEMFTFGY+Q  P+ TYRVI+K+GLM DPVPITIP  +MMHDFAITENYAIF
Sbjct  121   HPKVDPVTGEMFTFGYSQTPPYCTYRVITKEGLMLDPVPITIPEPIMMHDFAITENYAIF  180

Query  1021  MDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAW  842
             MDLP+YF+PKEMV  K L Y FD TKKA FG+LPRYAK+E  I+WFELPNC+IFH ANAW
Sbjct  181   MDLPMYFRPKEMVKGKYL-YAFDKTKKAHFGILPRYAKDECEIRWFELPNCYIFHNANAW  239

Query  841   EEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVNELYEMRFNMKTGLASQKKLSESAVDF  665
             E+G EVV+I+CRI+NPDL++ASG++K  +D F+ ELYEMRFNMKTG A+QKKLS S VDF
Sbjct  240   EDGSEVVLITCRIENPDLELASGSVKGKVDSFMIELYEMRFNMKTGEATQKKLSASTVDF  299

Query  664   PRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPG  485
             PR+NENYTGRKQRYVY T+  +L KV GI+KFDLHAEP++GKTKLE+GGNV+GIFDLGPG
Sbjct  300   PRINENYTGRKQRYVYGTVFDNL-KVVGIIKFDLHAEPDSGKTKLEIGGNVQGIFDLGPG  358

Query  484   RFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRV  305
             R+GSEAIFVPRE  +  EEDDGYLILFVHDE+TGKS V+VIDAKTMS EPVAV+ELP RV
Sbjct  359   RYGSEAIFVPREPGSTLEEDDGYLILFVHDESTGKSEVDVIDAKTMSPEPVAVIELPKRV  418

Query  304   PYGFHAFFVT  275
             PYGFHAFFV+
Sbjct  419   PYGFHAFFVS  428



>gb|EMS46219.1| hypothetical protein TRIUR3_11060 [Triticum urartu]
Length=543

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/558 (63%), Positives = 406/558 (73%), Gaps = 58/558 (10%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDS-SKPLHYLSGNFAPAPEETPPCKDLPVSGHLP--  1649
             P P+ G+A+ A+D LE  +V++ HD  ++P  +LSGNFAP   ETPP   LPV GHLP  
Sbjct  9     PRPRKGVASWALDMLERLVVRLGHDKKAEPNPWLSGNFAPVLHETPPTAGLPVRGHLPRK  68

Query  1648  ------------------------ECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRI  1541
                                     ECLNGEF+RVG NPKF PVAG   FDGDGMIH L I
Sbjct  69    FPFSPAFCKNGLYANLLKIFFEQLECLNGEFLRVGANPKFDPVAG---FDGDGMIHALHI  125

Query  1540  KDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYG  1361
             KDGK TYVSR+VKTSR KQEE+FG AKFMK+GDLKG+FGL  V  Q LR KLKVLD +YG
Sbjct  126   KDGKPTYVSRYVKTSRFKQEEYFGGAKFMKVGDLKGLFGLFMVLTQELRKKLKVLDATYG  185

Query  1360  NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPV  1181
              G                     P  +K+LEDGDLQTLG+LDYD+RL H FTAHPKVDP 
Sbjct  186   IG---------------------PDVVKILEDGDLQTLGLLDYDQRLKHPFTAHPKVDPF  224

Query  1180  TGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYF  1001
             T EMFTFGY+ + P+ TYRVI+KDG+M DPVPITIP SVMMHDFAITENY+IFMDLP++F
Sbjct  225   TDEMFTFGYSHEPPYCTYRVITKDGVMLDPVPITIPESVMMHDFAITENYSIFMDLPMFF  284

Query  1000  QPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVV  821
             +PKEMV   +  YKFD  KKARFG+L RY K+E  IKWFELPNCFIFH ANAWEEG+EV+
Sbjct  285   RPKEMVKNDEFIYKFDPAKKARFGILQRYEKDEKNIKWFELPNCFIFHNANAWEEGNEVI  344

Query  820   MISCRIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENY  644
             +I+CR  N DLD  +G   D L D  N+LYEMRFNMKTG ASQK+LS SA+DFPR+NE+Y
Sbjct  345   LITCRHNNVDLDQVNGNQSDKLEDRGNKLYEMRFNMKTGAASQKQLSVSAIDFPRINESY  404

Query  643   TGRKQRYVYATMLSDLAKV------KGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGR  482
             TGRKQRY+Y  +L    KV       GI+KFDLHA+PE  K  LEVGGNV GI+DL PG 
Sbjct  405   TGRKQRYIYCMILESTVKVTGILKMTGIIKFDLHAKPERSKEHLEVGGNVTGIYDLAPGT  464

Query  481   FGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVP  302
             F SEA+FVP+E     EEDDGYLI FVHDENTGKS VNVI+AKTMSA+PVAVVELP+RVP
Sbjct  465   FCSEAVFVPKEHGVSGEEDDGYLIFFVHDENTGKSEVNVIEAKTMSADPVAVVELPSRVP  524

Query  301   YGFHAFFVTEEQLQTQAE  248
             YGFHAFFV EEQL  Q E
Sbjct  525   YGFHAFFVNEEQLGHQVE  542



>gb|KDO83429.1| hypothetical protein CISIN_1g007605mg [Citrus sinensis]
Length=441

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/441 (75%), Positives = 379/441 (86%), Gaps = 2/441 (0%)
 Frame = -3

Query  1561  MIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLK  1382
             M+HGLRIKDGKA YVSR+VKTSRLKQEEFFG AKF KIGD+KG+FGLL V + +LR   K
Sbjct  1     MLHGLRIKDGKAAYVSRYVKTSRLKQEEFFGGAKFTKIGDVKGLFGLLMVNMTLLRESFK  60

Query  1381  VLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTA  1202
             VLD SYGNG  NTALIYH GKLL L E DKPY +KVL+DGDLQTLGMLDYDKRL H FTA
Sbjct  61    VLDFSYGNGAGNTALIYHHGKLLVLSEIDKPYVLKVLKDGDLQTLGMLDYDKRLNHPFTA  120

Query  1201  HPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIF  1022
             HPK+DP T EMFTFGY Q  P+VTYRVISKDG MHDPVPIT+ A +MMHDFAITENYAIF
Sbjct  121   HPKIDPYTDEMFTFGYTQTPPYVTYRVISKDGFMHDPVPITMSAPIMMHDFAITENYAIF  180

Query  1021  MDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAW  842
             +DLP+ F+ KEMV + +L Y FD T KARFGVLPRYA+++L I+WFELPNC+IFH ANAW
Sbjct  181   LDLPMCFRQKEMVKENKLIYAFDPTIKARFGVLPRYARDDLQIRWFELPNCYIFHNANAW  240

Query  841   -EEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESAVD  668
              EE DEVV+I+CR++NPDLDM +G LK++L D   ELYEMRFNMKTGLASQKKLS + VD
Sbjct  241   EEEEDEVVLITCRVRNPDLDMFNGPLKETLEDQTTELYEMRFNMKTGLASQKKLSPACVD  300

Query  667   FPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGP  488
             FPR+NE+Y GRKQRYVY ++L ++AKV G++KFDL AEPETGKTKLEVGGNV+GIFDLGP
Sbjct  301   FPRINEHYMGRKQRYVYGSILENIAKVTGMIKFDLRAEPETGKTKLEVGGNVKGIFDLGP  360

Query  487   GRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNR  308
             GRFGSEA+FVPRE S+  EEDDGYLI  VHDENTGKSAV VIDAKTMSA+PVAV+ELP+R
Sbjct  361   GRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKTMSADPVAVIELPHR  420

Query  307   VPYGFHAFFVTEEQLQTQAEI  245
             VPYGFH  F++EEQL+  A++
Sbjct  421   VPYGFHGIFLSEEQLEELAKL  441



>ref|XP_006482869.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Citrus sinensis]
Length=485

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/443 (74%), Positives = 380/443 (86%), Gaps = 3/443 (1%)
 Frame = -3

Query  1564  GMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKL  1385
              M+HGLRIKDGKA YVSR+VKTSRLKQEEFFG AKF KIGD+KG+FGLL V + +LR   
Sbjct  43    SMLHGLRIKDGKAAYVSRYVKTSRLKQEEFFGGAKFTKIGDVKGLFGLLMVNMTLLRESF  102

Query  1384  KVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFT  1205
             KVLD SYGNG  NTALIYH GKLL L E DKPY +KVL+DGDLQTLGMLDYDKRL H FT
Sbjct  103   KVLDFSYGNGAGNTALIYHHGKLLVLSEIDKPYVLKVLKDGDLQTLGMLDYDKRLNHPFT  162

Query  1204  AHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAI  1025
             AHPK+DP T EMFTFGY Q  P+VTYRVISKDG MHDPVPIT+ A +MMHDFAITENYAI
Sbjct  163   AHPKIDPYTDEMFTFGYTQTPPYVTYRVISKDGFMHDPVPITMSAPIMMHDFAITENYAI  222

Query  1024  FMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANA  845
             F+DLP+ F+ KEMV + +L Y FD T KARFGVLPRYA+++L I+WFELPNC+IFH ANA
Sbjct  223   FLDLPMCFRQKEMVKENKLIYAFDPTIKARFGVLPRYARDDLQIRWFELPNCYIFHNANA  282

Query  844   W--EEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESA  674
             W  EE +EVV+I+CR++NPDLDM +G LK++L D   ELYEMRFNMKTGLASQKKLS + 
Sbjct  283   WEEEEEEEVVLITCRVRNPDLDMFNGPLKETLEDQTTELYEMRFNMKTGLASQKKLSPAC  342

Query  673   VDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDL  494
             VDFPR+NE+Y GRKQRYVY ++L ++AKV G++KFDLHAEPETGKTKLEVGGNV+GIFDL
Sbjct  343   VDFPRINEHYMGRKQRYVYGSILENIAKVTGLIKFDLHAEPETGKTKLEVGGNVKGIFDL  402

Query  493   GPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELP  314
             GPGRFGSEA+FVPRE S+  EEDDGYLI  VHDENTGKSAV VIDAKTMSA+PVAV+ELP
Sbjct  403   GPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKTMSADPVAVIELP  462

Query  313   NRVPYGFHAFFVTEEQLQTQAEI  245
             +RVPYGFH  F++EEQL+  A++
Sbjct  463   HRVPYGFHGIFLSEEQLEELAKL  485



>gb|KDO83426.1| hypothetical protein CISIN_1g015522mg [Citrus sinensis]
Length=405

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 355/405 (88%), Gaps = 1/405 (0%)
 Frame = -3

Query  1456  MKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIK  1277
             MKIGDLKG+FGLL V +QMLR KLKVLD SYGNGTANTAL+YH GKLLAL E DKPYA+K
Sbjct  1     MKIGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAVK  60

Query  1276  VLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMH  1097
             VLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGYA   P++TYRVISKDG MH
Sbjct  61    VLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGYAHTPPYITYRVISKDGFMH  120

Query  1096  DPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPR  917
             DPVPIT+   +MMHDFAITENYAIFMDLPLYF+PKEMV + +L + FD TKKARFG+LPR
Sbjct  121   DPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVKENKLIFTFDDTKKARFGILPR  180

Query  916   YAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVNE  740
             YAKNE  +KWFELPNCFIFH ANAWEE DEVV+I+CR+  PDLDM +G +K+ L+ F NE
Sbjct  181   YAKNEAQMKWFELPNCFIFHNANAWEEEDEVVLITCRLDKPDLDMVNGAVKEKLENFSNE  240

Query  739   LYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLH  560
             LYEMRFN+KTGLASQK+LS SAVDFPRVNE YTGRKQRYVY T+L  +AKV GI+KFDLH
Sbjct  241   LYEMRFNLKTGLASQKRLSASAVDFPRVNECYTGRKQRYVYGTILDSIAKVTGIIKFDLH  300

Query  559   AEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGK  380
             AEP+  KTKLEVGGNV GIFDLGPGRFGSEA+FVPRE  T  EED GYLI F HDE TGK
Sbjct  301   AEPDEEKTKLEVGGNVRGIFDLGPGRFGSEAVFVPREPGTSSEEDVGYLIFFSHDEKTGK  360

Query  379   SAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             S+VNVIDAKTMSA+PVAVVELP+RVPYGFHAFFV+EEQL+ QA++
Sbjct  361   SSVNVIDAKTMSADPVAVVELPHRVPYGFHAFFVSEEQLEEQAKL  405



>ref|XP_002962877.1| hypothetical protein SELMODRAFT_165469 [Selaginella moellendorffii]
 gb|EFJ36340.1| hypothetical protein SELMODRAFT_165469 [Selaginella moellendorffii]
Length=549

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/527 (61%), Positives = 401/527 (76%), Gaps = 11/527 (2%)
 Frame = -3

Query  1816  TPQSG--IAAKAIDWLEWAIVKVMHD-SSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPE  1646
             TP  G  IAAK  D +E  +V++    SSK   +L  NFAP   E+ P  DLPV+G LPE
Sbjct  29    TPGIGARIAAKLCDGIEALLVQLFSGASSKSNLFLQENFAPV-GESGPLADLPVTGALPE  87

Query  1645  CLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGR  1466
             CLNGEFVR GPNP+F P AGYHWFDGDGM+HGLRIKDGKA YVSR+VKTS+LKQEEF+G 
Sbjct  88    CLNGEFVRTGPNPRFEPTAGYHWFDGDGMLHGLRIKDGKANYVSRYVKTSKLKQEEFYGT  147

Query  1465  AKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPY  1286
               F+K+GDLKG+ G+    +  LR+ L V+D  YG GTANTA++YH+ KLLAL E DKPY
Sbjct  148   PTFLKVGDLKGILGIFLANVFRLRVALGVVDAEYGMGTANTAMVYHNKKLLALLEADKPY  207

Query  1285  AIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDG  1106
             AI++LEDG+L+T+G+LDYDKRL HA TAHPKVDPVTGEMF F Y Q+ P+V YRVISKDG
Sbjct  208   AIRMLEDGNLETIGVLDYDKRLSHAVTAHPKVDPVTGEMFFFCYQQQTPYVIYRVISKDG  267

Query  1105  LMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGV  926
              +HDPV I IP  VMMHDFAITENYA+FMDLP+ F+PK M   K +   FD+TKK+RFGV
Sbjct  268   TLHDPVSINIPDPVMMHDFAITENYAVFMDLPMTFKPKNMGEGKMII-SFDSTKKSRFGV  326

Query  925   LPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFV  746
             LPRYA ++  ++WF LP+C+IFHTANAWE+GDEVV+++CR+   D+++    +KD+ D V
Sbjct  327   LPRYALSDSQMRWFHLPSCYIFHTANAWEDGDEVVLVACRMPKFDMEL----MKDTNDHV  382

Query  745   NELYEMRFNMKTGLASQKKLSES-AVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKF  569
              ELYE RFNMK+G A Q+ LS+  AV+FPR+NENY GRKQRYVYA +  D  ++KG+ KF
Sbjct  383   LELYEFRFNMKSGAALQRPLSKGPAVEFPRINENYIGRKQRYVYAAVFHDQVRIKGVAKF  442

Query  568   DLHAEPETGKTKLE-VGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDE  392
             DLH +PE  +     VG NV G F  G  RFGSEA+FVP+ +    +EDDGY+I FV+DE
Sbjct  443   DLHKDPELSRDGGNPVGSNVVGEFMYGGRRFGSEAVFVPKSSDKDADEDDGYVISFVYDE  502

Query  391   NTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
               GKS   VIDAKTM+A+PVAVV +P R+PYGFH+ FV E+QL+ QA
Sbjct  503   GAGKSEAVVIDAKTMAADPVAVVSIPVRIPYGFHSIFVNEDQLENQA  549



>ref|XP_002989455.1| hypothetical protein SELMODRAFT_272067 [Selaginella moellendorffii]
 gb|EFJ09546.1| hypothetical protein SELMODRAFT_272067 [Selaginella moellendorffii]
Length=549

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/527 (62%), Positives = 400/527 (76%), Gaps = 11/527 (2%)
 Frame = -3

Query  1816  TPQSG--IAAKAIDWLEWAIVKVMHD-SSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPE  1646
             TP  G  IAAK  D +E  +V++    SSK   +L  NFAP   E+ P  DLPV+G LPE
Sbjct  29    TPGIGARIAAKLCDGIEALLVQLFSGASSKSNLFLQENFAPV-GESGPFADLPVTGALPE  87

Query  1645  CLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGR  1466
             CLNGEFVR GPNP+F P AGYHWFDGDGM+HGLRIKDGKA YVSR+VKTS+LKQEEF+G 
Sbjct  88    CLNGEFVRTGPNPRFEPTAGYHWFDGDGMLHGLRIKDGKANYVSRYVKTSKLKQEEFYGT  147

Query  1465  AKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPY  1286
               F+K+GDLKG+ G+    +  LR+ L V+D  YG GTANTA++YH+ KLLAL E DKPY
Sbjct  148   PTFLKVGDLKGILGIFLANVFRLRVALGVVDAEYGMGTANTAMVYHNKKLLALLEADKPY  207

Query  1285  AIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDG  1106
             AI++LEDG+L+T+G+LDYDKRL HA TAHPKVDPVTGEMF F Y Q+ P+V YRVISKDG
Sbjct  208   AIRMLEDGNLETIGVLDYDKRLSHAVTAHPKVDPVTGEMFFFCYQQQTPYVIYRVISKDG  267

Query  1105  LMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGV  926
              +HDPV I IP  VMMHDFAITENYAIFMDLP+ F+PK M   K +   FD+TK++RFGV
Sbjct  268   TLHDPVSINIPDPVMMHDFAITENYAIFMDLPMTFKPKNMGEGKMII-SFDSTKRSRFGV  326

Query  925   LPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFV  746
             LPRYA ++  ++WF LP+C+IFHTANAWE+GDEVV+++CR+   D+++    +KD+ D V
Sbjct  327   LPRYALSDSQMRWFHLPSCYIFHTANAWEDGDEVVLVACRMPKFDMEL----MKDTDDHV  382

Query  745   NELYEMRFNMKTGLASQKKLSES-AVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKF  569
              ELYE RFNMK+G A Q+ LS+  AV+FPR+NENY GRKQRYVYA +  D  ++KG+ KF
Sbjct  383   LELYEFRFNMKSGAALQRPLSKGPAVEFPRINENYIGRKQRYVYAAVFHDQVRIKGVAKF  442

Query  568   DLHAEPETGKTKLE-VGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDE  392
             DLH +PE  K     VG NV G F  G  RFGSEA+FVP+ +    +EDDGYLI FV+DE
Sbjct  443   DLHKDPELSKDGGNPVGSNVVGEFMYGGRRFGSEAVFVPKSSDKDADEDDGYLISFVYDE  502

Query  391   NTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
               GKS   VIDAKTM+A+PVAVV +P R+PYGFH+ FV E+QL  QA
Sbjct  503   GAGKSEAVVIDAKTMAADPVAVVSIPVRIPYGFHSIFVNEDQLGNQA  549



>gb|KCW66102.1| hypothetical protein EUGRSUZ_G03374 [Eucalyptus grandis]
Length=430

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/396 (76%), Positives = 346/396 (87%), Gaps = 1/396 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             PTP+ G+ +K +D++E  IVK M+DSS+P  YL+GNFAP  +ETPP  DLPV GHLP+CL
Sbjct  28    PTPKKGVTSKVVDYIEKLIVKFMYDSSRPHQYLAGNFAPVADETPPVTDLPVVGHLPDCL  87

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGM+HG+RIK+GKATYVSR+V+TS+LKQEE++G AK
Sbjct  88    NGEFVRVGPNPKFAPVAGYHWFDGDGMVHGMRIKNGKATYVSRYVRTSKLKQEEYYGGAK  147

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +
Sbjct  148   FMKIGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVYHHGKLLALSEADKPYVL  207

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVISKDG M
Sbjct  208   KVLEDGDLQTLGMLDYDKRLSHSFTAHPKVDPFTGEMFTFGYSHTPPYITYRVISKDGFM  267

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITI   +MMHDFAITENYAIFMDLPLYF+PKEMV   +L + FD TKK+RFGVLP
Sbjct  268   HDPVPITISDPIMMHDFAITENYAIFMDLPLYFRPKEMVKDNKLIFTFDKTKKSRFGVLP  327

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAKNEL I+WFELPNCFIFH ANAWEE DEVV+++CR++N DLDM SGT+K+ L +F N
Sbjct  328   RYAKNELQIRWFELPNCFIFHNANAWEEEDEVVLVTCRLENLDLDMVSGTVKEHLENFGN  387

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGR  635
             ELYEMRFNMKTGLASQKKLS  +VDFPR+NE YTGR
Sbjct  388   ELYEMRFNMKTGLASQKKLSAPSVDFPRINECYTGR  423



>ref|XP_006402262.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
 gb|ESQ43715.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
Length=444

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/417 (74%), Positives = 356/417 (85%), Gaps = 6/417 (1%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPV-SGHLPEC  1643
             P P  G ++K +D LE  +VK+MHD+S PLHYLSGNFAP  +ETPP KDLPV  G LPEC
Sbjct  14    PKPSKGFSSKLLDLLERVVVKLMHDASLPLHYLSGNFAPLKDETPPVKDLPVVHGFLPEC  73

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             LNGEFVRVGPNPKF PVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEEFFG A
Sbjct  74    LNGEFVRVGPNPKFDPVAGYHWFDGDGMIHGVRIKDGKATYVSRYVKTSRLKQEEFFGAA  133

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KFMKIGDLKG FGLL V +Q LR KLKVLD+SYG GTANTAL+YH GKLLAL E DKPY 
Sbjct  134   KFMKIGDLKGFFGLLMVNMQQLRTKLKVLDDSYGYGTANTALVYHHGKLLALQEADKPYV  193

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             +KVLEDGDLQTLGM+DYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVIS+DG+
Sbjct  194   VKVLEDGDLQTLGMIDYDKRLTHSFTAHPKVDPATGEMFTFGYSHTPPYLTYRVISEDGI  253

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             M DPVPITI   +MMHDFAITE+YAIFMDLP++F+PKEMV +K++ Y FD TKKARFGVL
Sbjct  254   MLDPVPITISEPIMMHDFAITESYAIFMDLPMHFRPKEMVKEKKMIYSFDPTKKARFGVL  313

Query  922   PRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FV  746
             PRYAK+EL+I+WFELPNCFIFH ANAWEE DEVV+I+CR++NPDLDM SG +K+ L+ F 
Sbjct  314   PRYAKDELMIRWFELPNCFIFHNANAWEEEDEVVLITCRLENPDLDMVSGNVKEKLENFS  373

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGR----KQRYVYATMLSDLAKV  587
             NELYEMRFNMKTG ASQ+KLS SAVDFPR+NE YTG+    +Q +  +  L +L+ +
Sbjct  374   NELYEMRFNMKTGSASQRKLSASAVDFPRINERYTGKDMCMEQFWTVSQRLQELSSL  430



>ref|XP_004158236.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Cucumis sativus]
Length=379

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/378 (80%), Positives = 334/378 (88%), Gaps = 8/378 (2%)
 Frame = -3

Query  1354  TANTALIYHDGKLLALHEGDKPY-------AIKVLEDGDLQTLGMLDYDKRLGHAFTAHP  1196
               NTALIYH GKLLAL EGDKP          KVLEDGDLQTLG+LDYDKRL H FTAHP
Sbjct  2     CCNTALIYHHGKLLALSEGDKPLVGSALCRCYKVLEDGDLQTLGLLDYDKRLKHTFTAHP  61

Query  1195  KVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             KVDPVTGEMFTFGY+   P+VTYRVISKDGLMHDPVPITIPA VMMHDFAITENYAIFMD
Sbjct  62    KVDPVTGEMFTFGYSHSPPYVTYRVISKDGLMHDPVPITIPAPVMMHDFAITENYAIFMD  121

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             LPLYF+PKEMV + +L + FDATKKARFGVLPRYAK++LLI+WFELPNCFIFH ANAWEE
Sbjct  122   LPLYFKPKEMVKENKLIFTFDATKKARFGVLPRYAKDDLLIRWFELPNCFIFHNANAWEE  181

Query  835   GDEVVMISCRIQNPDLDMASGTLKDSLD-FVNELYEMRFNMKTGLASQKKLSESAVDFPR  659
              DE+V+I+CR++NPDLDM SG++K+ L+ F NELYEMRFN+K+GLASQ+KLSESAVDFPR
Sbjct  182   EDELVLITCRLENPDLDMVSGSVKEKLENFSNELYEMRFNLKSGLASQRKLSESAVDFPR  241

Query  658   VNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
             VNE+YTGRKQ+YVY T L  +AKV GI KFDLHAEPETGKTK+EVGGNV+G++DLGPGRF
Sbjct  242   VNESYTGRKQQYVYGTTLDSIAKVTGIAKFDLHAEPETGKTKIEVGGNVQGLYDLGPGRF  301

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPY  299
             GSEAIFVPR   T  EEDDGYLILFVHDENTGKSAVNV+DAKTMS+EPVAVVELP+RVPY
Sbjct  302   GSEAIFVPRVPGTTSEEDDGYLILFVHDENTGKSAVNVVDAKTMSSEPVAVVELPHRVPY  361

Query  298   GFHAFFVTEEQLQTQAEI  245
             GFHAFFVTEEQLQ Q  +
Sbjct  362   GFHAFFVTEEQLQEQGRL  379



>ref|XP_002989454.1| hypothetical protein SELMODRAFT_447678 [Selaginella moellendorffii]
 gb|EFJ09545.1| hypothetical protein SELMODRAFT_447678 [Selaginella moellendorffii]
Length=563

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/541 (59%), Positives = 396/541 (73%), Gaps = 25/541 (5%)
 Frame = -3

Query  1816  TPQSG--IAAKAIDWLEWAIVKVMHD-SSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPE  1646
             TP  G  IAAK  D +E  +V++    SSK   +L  NFAP   E+ P  DLPV+G LPE
Sbjct  29    TPGIGARIAAKLCDGIEALLVQLFSSASSKSNLFLQDNFAPV-GESGPFVDLPVTGTLPE  87

Query  1645  CLNGEFVRVGPNPKFAPVAGYHWFDGDG--------------MIHGLRIKDGKATYVSRF  1508
             CLNGEFVR GPNP+F P AGYHW++                 M+HGLRIKDGKA YVSR+
Sbjct  88    CLNGEFVRTGPNPRFEPTAGYHWYESGSFFRFFFSILSPSYLMLHGLRIKDGKANYVSRY  147

Query  1507  VKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYH  1328
             VKTS+LKQEEF+G   F+K+GDLKG+ G+    +  LR+ L V+D  YG GTANTA++YH
Sbjct  148   VKTSKLKQEEFYGTPTFLKLGDLKGILGIFLANVFRLRVALGVVDAEYGMGTANTAMVYH  207

Query  1327  DGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQ  1148
             + KLLAL E DKPYAI++L+DG+L+T+G+LDYDKRL HA TAHPKVDPVTGEMF F Y Q
Sbjct  208   NKKLLALLEADKPYAIRMLDDGNLETIGVLDYDKRLSHAVTAHPKVDPVTGEMFFFCYQQ  267

Query  1147  KAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQL  968
             + P+V YRVISKDG +HDPV I IP  VMMHDFAITENYA+FMDLP+ F+PK M   K +
Sbjct  268   QTPYVIYRVISKDGTLHDPVSINIPDPVMMHDFAITENYAVFMDLPVPFKPKNMGEGKMI  327

Query  967   AYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDL  788
                FD+TKK+RFGVLPRYA ++  ++WF LP+C+IFHTANAWE+GDEVV+++CR+   D+
Sbjct  328   I-SFDSTKKSRFGVLPRYALSDSQMRWFHLPSCYIFHTANAWEDGDEVVLVACRMPKFDM  386

Query  787   DMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSES-AVDFPRVNENYTGRKQRYVYAT  611
             ++    +KD +D V ELYE RFNMK+G A Q+ LS+  AV+FPR+NENY GRKQRYVYA 
Sbjct  387   EL----MKDYVDHVLELYEFRFNMKSGAALQRPLSKGPAVEFPRINENYIGRKQRYVYAA  442

Query  610   MLSDLAKVKGIVKFDLHAEPETGKTKLE-VGGNVEGIFDLGPGRFGSEAIFVPREASTGC  434
             +  D  ++KG+ KFDLH +PE  K     VG NV G F  G  RFGSE +FVP+ +    
Sbjct  443   VFHDQVRIKGVAKFDLHKDPELSKDGGNPVGSNVVGEFMYGSRRFGSEVVFVPKSSDKDA  502

Query  433   EEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             +EDDGYLI FV+DE  GKS   VIDAKTM+A+PVAVV +P R+PYGFH  FV E+QL+ Q
Sbjct  503   DEDDGYLISFVYDERAGKSEAVVIDAKTMAADPVAVVSIPVRIPYGFHLIFVNEDQLENQ  562

Query  253   A  251
             A
Sbjct  563   A  563



>gb|KDO83430.1| hypothetical protein CISIN_1g007605mg [Citrus sinensis]
Length=408

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/407 (73%), Positives = 348/407 (86%), Gaps = 2/407 (0%)
 Frame = -3

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             F++IGD+KG+FGLL V + +LR   KVLD SYGNG  NTALIYH GKLL L E DKPY +
Sbjct  2     FLQIGDVKGLFGLLMVNMTLLRESFKVLDFSYGNGAGNTALIYHHGKLLVLSEIDKPYVL  61

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVL+DGDLQTLGMLDYDKRL H FTAHPK+DP T EMFTFGY Q  P+VTYRVISKDG M
Sbjct  62    KVLKDGDLQTLGMLDYDKRLNHPFTAHPKIDPYTDEMFTFGYTQTPPYVTYRVISKDGFM  121

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+ A +MMHDFAITENYAIF+DLP+ F+ KEMV + +L Y FD T KARFGVLP
Sbjct  122   HDPVPITMSAPIMMHDFAITENYAIFLDLPMCFRQKEMVKENKLIYAFDPTIKARFGVLP  181

Query  919   RYAKNELLIKWFELPNCFIFHTANAW-EEGDEVVMISCRIQNPDLDMASGTLKDSL-DFV  746
             RYA+++L I+WFELPNC+IFH ANAW EE DEVV+I+CR++NPDLDM +G LK++L D  
Sbjct  182   RYARDDLQIRWFELPNCYIFHNANAWEEEEDEVVLITCRVRNPDLDMFNGPLKETLEDQT  241

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
              ELYEMRFNMKTGLASQKKLS + VDFPR+NE+Y GRKQRYVY ++L ++AKV G++KFD
Sbjct  242   TELYEMRFNMKTGLASQKKLSPACVDFPRINEHYMGRKQRYVYGSILENIAKVTGMIKFD  301

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             L AEPETGKTKLEVGGNV+GIFDLGPGRFGSEA+FVPRE S+  EEDDGYLI  VHDENT
Sbjct  302   LRAEPETGKTKLEVGGNVKGIFDLGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENT  361

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKSAV VIDAKTMSA+PVAV+ELP+RVPYGFH  F++EEQL+  A++
Sbjct  362   GKSAVYVIDAKTMSADPVAVIELPHRVPYGFHGIFLSEEQLEELAKL  408



>ref|XP_001754114.1| predicted protein [Physcomitrella patens]
 gb|EDQ81015.1| predicted protein [Physcomitrella patens]
Length=538

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/521 (60%), Positives = 385/521 (74%), Gaps = 7/521 (1%)
 Frame = -3

Query  1798  AAKAIDWLEWAIVKVMHD--SSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFV  1625
             A K  D++E  I+    D  S K  +++  N+APA +E  P  +L V G +PEC+NGEF+
Sbjct  20    ADKFCDYIERGILWFFDDYNSKKTNYWIKNNYAPA-DEHDPATNLHVVGTIPECMNGEFL  78

Query  1624  RVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIG  1445
             RVGPNPKF PVA YHWFDGDGMIHGL+IKDG ATYVSR+VKTSRL+QEE +G AKF+K+G
Sbjct  79    RVGPNPKFQPVASYHWFDGDGMIHGLKIKDGNATYVSRYVKTSRLQQEEKYGAAKFLKMG  138

Query  1444  DLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLED  1265
             DL+G  G+L + L  LR +L V+D S G GT NTALIYH+ KLLAL+EGDKPYA++VLED
Sbjct  139   DLRGPKGMLYIRLHKLRARLGVIDLSRGAGTGNTALIYHNKKLLALNEGDKPYAMRVLED  198

Query  1264  GDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYA--QKAPFVTYRVISKDGLMHDP  1091
             GDL+TLG +DY  +L H FTAHPKVDP+TGEMFTFGY   +  P +TYRVISKDG+M DP
Sbjct  199   GDLETLGRVDYGGKLQHPFTAHPKVDPITGEMFTFGYEIDKSPPQITYRVISKDGIMQDP  258

Query  1090  VPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYA  911
             V I +P  VMMHDFAITENYAIFMDLPL    + M+ K     KFD TK+AR GVLPRYA
Sbjct  259   VCIHLPQIVMMHDFAITENYAIFMDLPLLMDGESMM-KGNFFIKFDETKEARLGVLPRYA  317

Query  910   KNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFVN-ELY  734
              NE  ++WF +P CFIFH ANAWEEGDE+V+ SCR++  +L  A+   K++      +L+
Sbjct  318   TNESQLRWFTIPVCFIFHNANAWEEGDEIVLHSCRMEEINLTTAADGFKENERISQPKLF  377

Query  733   EMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAE  554
             E R N+KTG   QK+LS   VDFPRVNE Y GRK +Y+Y  ++   +K+ G+ KFDL  E
Sbjct  378   EFRINLKTGEVRQKQLSVLVVDFPRVNEEYMGRKTQYMYGAIMDKESKMVGVGKFDLLKE  437

Query  553   PETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSA  374
             PE     LE GG++EG+F  GPGRFG EAIFVPR       EDDGYLI+FVHDE   KS 
Sbjct  438   PEVNPKSLEEGGDIEGVFLYGPGRFGGEAIFVPRNPGRDGPEDDGYLIVFVHDEIKDKSE  497

Query  373   VNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             V +IDAK M+A+PVAVV +P RVPYGFHAFFVTEEQL+ Q+
Sbjct  498   VVIIDAKAMAADPVAVVSMPTRVPYGFHAFFVTEEQLKNQS  538



>ref|XP_001771028.1| predicted protein [Physcomitrella patens]
 gb|EDQ64183.1| predicted protein [Physcomitrella patens]
Length=576

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/519 (58%), Positives = 382/519 (74%), Gaps = 10/519 (2%)
 Frame = -3

Query  1798  AAKAIDWLEWAIVKVMHD--SSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFV  1625
             AA   D++E A+V       S K  + L  N+AP  EE  P  DLP+ G +PECLNGEFV
Sbjct  65    AASVCDFVERAVVWAFDAGLSDKKAYLLFDNYAPV-EELGPVGDLPIIGTIPECLNGEFV  123

Query  1624  RVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIG  1445
             RVGPNP+  P++GYHW     M+HGL IKDGKATYV+RFVKTSRL+QEE++G AKF+KIG
Sbjct  124   RVGPNPRLKPISGYHW-----MMHGLNIKDGKATYVARFVKTSRLQQEEYYGAAKFLKIG  178

Query  1444  DLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLED  1265
              LKG+ GL  + ++ LR+ L VLD S G    NTA +YH+ +LLALHE DKPYAI+VL+D
Sbjct  179   QLKGLRGLFYIAVEKLRLSLGVLDESNGLYGGNTAFVYHNNRLLALHEIDKPYAIRVLDD  238

Query  1264  GDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVP  1085
             GDLQT+G+ DY++RLGH+FTAHPK+D  TGE+F F Y +K P++ YRVISK+G + +PVP
Sbjct  239   GDLQTMGLQDYEQRLGHSFTAHPKIDSTTGELFMFAYQEKVPYLIYRVISKNGTLREPVP  298

Query  1084  ITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKN  905
             ITIP  VMMHDFAITENYA+FMDLPL F P  +  K +  +KFD +K++RFG+LPRYA +
Sbjct  299   ITIPECVMMHDFAITENYALFMDLPLRFNPTGL-PKGEFIFKFDPSKESRFGILPRYATD  357

Query  904   ELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKD-SLDFVNELYEM  728
             E  I+W ++P CFIFH ANAWEEGDEVV+I+CR+   +LD+     K+ +    ++L+E 
Sbjct  358   ESQIRWCKIPTCFIFHNANAWEEGDEVVLITCRMPGIELDLELEFKKEKAWSVFSKLFEF  417

Query  727   RFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPE  548
             R N+KTG   Q++LS  + DFPR+NE YTGRK R+VY  +  +L +V G+VK+DL  EP 
Sbjct  418   RMNLKTGEVKQRQLSSLSTDFPRINEEYTGRKTRFVYCGVFDELNRVIGVVKYDLDEEPC  477

Query  547   TGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVN  368
                  L+ GGNV G+F LGPGR GSEAIFVP +      EDDGYLILFV+DEN G S   
Sbjct  478   LTTGDLQKGGNVAGVFSLGPGRSGSEAIFVPLKRGMEGPEDDGYLILFVYDENKGTSEAV  537

Query  367   VIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             +IDAKTM+A+PVA V+LP RVPYGFHA FV++EQL  QA
Sbjct  538   IIDAKTMAADPVATVKLPRRVPYGFHAHFVSQEQLMQQA  576



>dbj|BAI47582.1| carotenoid cleavage dioxygenase 1 [Ipomoea sp. Kenyan]
Length=349

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/349 (80%), Positives = 316/349 (91%), Gaps = 1/349 (0%)
 Frame = -3

Query  1456  MKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIK  1277
             MKIGDLKG+FGLLTV++Q LR KLKVLD SYG  TANTALIYH GKLLAL E DKPY +K
Sbjct  1     MKIGDLKGLFGLLTVFIQTLRTKLKVLDISYGTSTANTALIYHHGKLLALSEADKPYVVK  60

Query  1276  VLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMH  1097
             VLEDGDLQTLGMLDYDKRL H+FTAHPKVDPVTGEMFTFGY+   P+VTYRV+SKDG+MH
Sbjct  61    VLEDGDLQTLGMLDYDKRLSHSFTAHPKVDPVTGEMFTFGYSHTPPYVTYRVVSKDGIMH  120

Query  1096  DPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPR  917
             DPVPIT+P  +MMHDFAITENYAIFMDLPLYF+PKEMV  K+  +KFD+TKKARFGVLPR
Sbjct  121   DPVPITVPEPIMMHDFAITENYAIFMDLPLYFRPKEMVKNKEFVFKFDSTKKARFGVLPR  180

Query  916   YAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVNE  740
             YAKNEL I+WFELPNCFIFH ANAWEEGDE+V+I+CR++N DLDM +GT +++L+ F NE
Sbjct  181   YAKNELAIQWFELPNCFIFHNANAWEEGDEIVLITCRLENLDLDMVNGTAEEALENFANE  240

Query  739   LYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLH  560
             LYEMRFNMK+ LA+QKKLSESAVDFPRVNENYTGRKQRYVY T+L+ +AKVKGI+KFDLH
Sbjct  241   LYEMRFNMKSYLATQKKLSESAVDFPRVNENYTGRKQRYVYGTILNSIAKVKGIIKFDLH  300

Query  559   AEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYL  413
             AEPETGKT+LEVGGNV+GI DLGPGRFGSEAIFVPR+  T C+EDDGY+
Sbjct  301   AEPETGKTQLEVGGNVQGISDLGPGRFGSEAIFVPRQQGTACDEDDGYI  349



>gb|ABB29859.1| carotene cleavage dioxygenase, partial [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=328

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/328 (83%), Positives = 299/328 (91%), Gaps = 2/328 (1%)
 Frame = -3

Query  1222  LGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAI  1043
             L H+FTAHPKVDPVTGEMFTFGY+Q  P+ TYRVISKDG+M DPVPITIPASVMMHDFAI
Sbjct  1     LQHSFTAHPKVDPVTGEMFTFGYSQTPPYATYRVISKDGVMQDPVPITIPASVMMHDFAI  60

Query  1042  TENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFI  863
             TENY+I MDLPLYF+PKEMV  K+LAY FD TKKARFG+LPRYAKNE LIKWFELPNCFI
Sbjct  61    TENYSIMMDLPLYFKPKEMVKNKKLAYSFDPTKKARFGILPRYAKNESLIKWFELPNCFI  120

Query  862   FHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD--FVNELYEMRFNMKTGLASQKK  689
             FH ANAWEEGD+VV+I+CR+QNPDLD  +GT K+     F NELYEMRFN+KTGLASQKK
Sbjct  121   FHNANAWEEGDDVVLITCRLQNPDLDAINGTEKEQQRDGFTNELYEMRFNIKTGLASQKK  180

Query  688   LSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVE  509
             LSESAVDFPR+NENYTGRKQRYVY T+L+++AK+ G+VKFDLHAEPETGKTKLEVGGNV 
Sbjct  181   LSESAVDFPRINENYTGRKQRYVYGTILNNVAKITGVVKFDLHAEPETGKTKLEVGGNVL  240

Query  508   GIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVA  329
             GIFDLGPGRFGSEAIFVPR+  T CEEDDGYLILFVHDENTGKS+VNVIDAKTMSAEPVA
Sbjct  241   GIFDLGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDENTGKSSVNVIDAKTMSAEPVA  300

Query  328   VVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             VVELP RVPYGFHAFFVTEEQ+Q QA++
Sbjct  301   VVELPKRVPYGFHAFFVTEEQIQEQAKL  328



>emb|CAN79030.1| hypothetical protein VITISV_032896 [Vitis vinifera]
Length=467

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/525 (59%), Positives = 357/525 (68%), Gaps = 78/525 (15%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             PTP  G  +KA+DWLE  IVK+MHDSS+PLHYLSGNFAP  +ETPPCK+LPV G+LPECL
Sbjct  21    PTPSKGFTSKAVDWLEKLIVKLMHDSSQPLHYLSGNFAPVRDETPPCKNLPVIGYLPECL  80

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKF+PVAGYH      MIHGL IKDGKATYVSR+V+TSRLKQEE+FG AK
Sbjct  81    NGEFVRVGPNPKFSPVAGYHC-----MIHGLXIKDGKATYVSRYVRTSRLKQEEYFGGAK  135

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FM+ GDLKG+FGLL V +QMLR KLK+LD SYG GT NTAL+YH GKLLAL E DKPY +
Sbjct  136   FMRXGDLKGLFGLLMVNMQMLRAKLKILDVSYGTGTGNTALVYHHGKLLALSEXDKPYVL  195

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLG LDYDKRL H+FTAHPKVDP TGEMF F                 G  
Sbjct  196   KVLEDGDLQTLGXLDYDKRLTHSFTAHPKVDPFTGEMFXF-----------------GYS  238

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             H P  IT    V+  D  + E   I +  P+                        F +  
Sbjct  239   HTPPYITY--RVISKDGFMHEPVPITISDPIMMH--------------------DFAITE  276

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFVNE  740
              YA       + +LP  F   T N+       V+    IQ             +   +  
Sbjct  277   NYAI------FMDLPLYFRPKTFNS-------VLRPQXIQR------------NRGLLXS  311

Query  739   LYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLH  560
              YEMRFNMKTG+ASQ+KLS S+VDFPRVNE+YTG    +          KV GI+KFDLH
Sbjct  312   RYEMRFNMKTGIASQRKLSASSVDFPRVNESYTGSHTTH---------TKVTGIIKFDLH  362

Query  559   AEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGK  380
             AEP+TGK+KLEVGGNV+GIFDLG GRFGSEA+FVPRE     EEDDGYLI FVHDE TGK
Sbjct  363   AEPDTGKSKLEVGGNVQGIFDLGVGRFGSEAVFVPREPGITSEEDDGYLIFFVHDEKTGK  422

Query  379   SAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             S VNVIDAKTMS +P+A+VELPNRVPYGFHAFFVTEEQL+ QA++
Sbjct  423   SYVNVIDAKTMSPDPIAIVELPNRVPYGFHAFFVTEEQLKEQAKL  467



>ref|XP_006439107.1| hypothetical protein CICLE_v10031039mg [Citrus clementina]
 gb|ESR52347.1| hypothetical protein CICLE_v10031039mg [Citrus clementina]
Length=410

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/323 (81%), Positives = 287/323 (89%), Gaps = 0/323 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECL  1640
             P P++G+ +K ID++E  IVK M+DSS+PLHYLSGNFAP P+ETPP KDL V GHLP+CL
Sbjct  64    PKPKNGVTSKVIDFVEKLIVKWMYDSSQPLHYLSGNFAPVPDETPPTKDLHVIGHLPDCL  123

Query  1639  NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAK  1460
             NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFV+TSRLKQEEFFG AK
Sbjct  124   NGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVRTSRLKQEEFFGGAK  183

Query  1459  FMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAI  1280
             FMKIGDLKG+FGLL V +QMLR KLKVLD SYGNGTANTAL+YH GKLLAL E DKPYA+
Sbjct  184   FMKIGDLKGLFGLLMVNMQMLRAKLKVLDVSYGNGTANTALVYHHGKLLALSEADKPYAV  243

Query  1279  KVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLM  1100
             KVLEDGDLQTLGMLDYDKRL H+FTAHPKVDP TGEMFTFGYA   P++TYRVISKDG M
Sbjct  244   KVLEDGDLQTLGMLDYDKRLQHSFTAHPKVDPYTGEMFTFGYAHTPPYITYRVISKDGFM  303

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPIT+   +MMHDFAITENYAIFMDLPLYF+PKEMV + +L + FD TKKARFG+LP
Sbjct  304   HDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRPKEMVKENKLIFTFDDTKKARFGILP  363

Query  919   RYAKNELLIKWFELPNCFIFHTA  851
             RYAKNE  +KWFELPNCFIFH  
Sbjct  364   RYAKNEAQMKWFELPNCFIFHNG  386



>gb|KDO83427.1| hypothetical protein CISIN_1g015522mg [Citrus sinensis]
Length=334

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/334 (78%), Positives = 291/334 (87%), Gaps = 1/334 (0%)
 Frame = -3

Query  1243  MLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASV  1064
             MLDYDKRL H+FTAHPKVDP TGEMFTFGYA   P++TYRVISKDG MHDPVPIT+   +
Sbjct  1     MLDYDKRLQHSFTAHPKVDPYTGEMFTFGYAHTPPYITYRVISKDGFMHDPVPITVSDPI  60

Query  1063  MMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWF  884
             MMHDFAITENYAIFMDLPLYF+PKEMV + +L + FD TKKARFG+LPRYAKNE  +KWF
Sbjct  61    MMHDFAITENYAIFMDLPLYFRPKEMVKENKLIFTFDDTKKARFGILPRYAKNEAQMKWF  120

Query  883   ELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FVNELYEMRFNMKTG  707
             ELPNCFIFH ANAWEE DEVV+I+CR+  PDLDM +G +K+ L+ F NELYEMRFN+KTG
Sbjct  121   ELPNCFIFHNANAWEEEDEVVLITCRLDKPDLDMVNGAVKEKLENFSNELYEMRFNLKTG  180

Query  706   LASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLE  527
             LASQK+LS SAVDFPRVNE YTGRKQRYVY T+L  +AKV GI+KFDLHAEP+  KTKLE
Sbjct  181   LASQKRLSASAVDFPRVNECYTGRKQRYVYGTILDSIAKVTGIIKFDLHAEPDEEKTKLE  240

Query  526   VGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTM  347
             VGGNV GIFDLGPGRFGSEA+FVPRE  T  EED GYLI F HDE TGKS+VNVIDAKTM
Sbjct  241   VGGNVRGIFDLGPGRFGSEAVFVPREPGTSSEEDVGYLIFFSHDEKTGKSSVNVIDAKTM  300

Query  346   SAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             SA+PVAVVELP+RVPYGFHAFFV+EEQL+ QA++
Sbjct  301   SADPVAVVELPHRVPYGFHAFFVSEEQLEEQAKL  334



>gb|KDO83431.1| hypothetical protein CISIN_1g007605mg [Citrus sinensis]
Length=335

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/335 (74%), Positives = 290/335 (87%), Gaps = 2/335 (1%)
 Frame = -3

Query  1243  MLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASV  1064
             MLDYDKRL H FTAHPK+DP T EMFTFGY Q  P+VTYRVISKDG MHDPVPIT+ A +
Sbjct  1     MLDYDKRLNHPFTAHPKIDPYTDEMFTFGYTQTPPYVTYRVISKDGFMHDPVPITMSAPI  60

Query  1063  MMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWF  884
             MMHDFAITENYAIF+DLP+ F+ KEMV + +L Y FD T KARFGVLPRYA+++L I+WF
Sbjct  61    MMHDFAITENYAIFLDLPMCFRQKEMVKENKLIYAFDPTIKARFGVLPRYARDDLQIRWF  120

Query  883   ELPNCFIFHTANAWEEG-DEVVMISCRIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKT  710
             ELPNC+IFH ANAWEE  DEVV+I+CR++NPDLDM +G LK++L D   ELYEMRFNMKT
Sbjct  121   ELPNCYIFHNANAWEEEEDEVVLITCRVRNPDLDMFNGPLKETLEDQTTELYEMRFNMKT  180

Query  709   GLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKL  530
             GLASQKKLS + VDFPR+NE+Y GRKQRYVY ++L ++AKV G++KFDL AEPETGKTKL
Sbjct  181   GLASQKKLSPACVDFPRINEHYMGRKQRYVYGSILENIAKVTGMIKFDLRAEPETGKTKL  240

Query  529   EVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKT  350
             EVGGNV+GIFDLGPGRFGSEA+FVPRE S+  EEDDGYLI  VHDENTGKSAV VIDAKT
Sbjct  241   EVGGNVKGIFDLGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKT  300

Query  349   MSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             MSA+PVAV+ELP+RVPYGFH  F++EEQL+  A++
Sbjct  301   MSADPVAVIELPHRVPYGFHGIFLSEEQLEELAKL  335



>ref|XP_001782366.1| predicted protein [Physcomitrella patens]
 gb|EDQ52820.1| predicted protein [Physcomitrella patens]
Length=518

 Score =   528 bits (1361),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 262/504 (52%), Positives = 344/504 (68%), Gaps = 13/504 (3%)
 Frame = -3

Query  1729  HYLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHG  1550
             +YLS +FAP  E  P    L + G +PEC+ GEF RVGPNP+F  + GYHWFDGDGMIHG
Sbjct  17    YYLSASFAPVSERAPTTA-LRIIGTIPECMFGEFFRVGPNPRFEALGGYHWFDGDGMIHG  75

Query  1549  LRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDN  1370
             L + +GKATYV R+V+TSRL+QEE +G  KF K+GD+KG+ G   + L+ LR  L VL+ 
Sbjct  76    LHLSEGKATYVVRYVRTSRLQQEERYGAPKFWKVGDMKGVKGYFCIALENLRRSLGVLNV  135

Query  1369  SYG-NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             S G  GT NT+L++H+ KLLALHE DKPY IKVLEDGDL T+G+ D+DKRL H+F AHPK
Sbjct  136   SSGYAGTGNTSLVFHNKKLLALHERDKPYRIKVLEDGDLVTVGLEDFDKRLQHSFAAHPK  195

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             +DPVTGEMF FGY  ++  + YR +SK+G++ DPV I +P + + HDFAITENYAI MDL
Sbjct  196   IDPVTGEMFFFGYHSESSDLIYRTVSKEGVLRDPVLIKLPTTTITHDFAITENYAILMDL  255

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             PL   P  M  +    ++FD  K++R GVLPRYA ++  I+WF +P C+I HT  AWEE 
Sbjct  256   PLVLDPLGMA-QGGFIFRFDPNKESRLGVLPRYATDDSQIRWFTIPTCYILHTVAAWEEE  314

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNE-----LYEMRFNMKTGLASQKKLSESAVD  668
             DE+++I CR    DL+   G  + +  + +      LYE R N K G   Q++LS  +++
Sbjct  315   DEIILICCRTDGIDLNPDFGVERKNKAYGDSYGSPTLYEYRMNFKNGHVHQRQLSNLSIE  374

Query  667   FPRVNENYTGRKQRYVYATML-SDLAKVKGIVKFDLHAEPETGKTKLE--VGGNVEGIFD  497
             FP +N +Y GRK RY Y  ++ ++L  + GIVK+DL+ +P T  T ++    GN   +F 
Sbjct  375   FPTINPHYVGRKTRYTYCGVVDNELDLMSGIVKYDLYLDPSTTDTAVDDKTKGNNCTVFH  434

Query  496   LGPGRFGSEAIFVP--REASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVV  323
              GP  + S+ IFVP  R  +    EDDG+LI FV D NTGKS   +IDAKTM   PVAVV
Sbjct  435   FGPNCYASDTIFVPNNRGMANDAAEDDGFLISFVQDLNTGKSEAIIIDAKTMGPTPVAVV  494

Query  322   ELPNRVPYGFHAFFVTEEQLQTQA  251
             ELP R+P GFHA+FVT+EQLQ QA
Sbjct  495   ELPGRIPKGFHAYFVTQEQLQQQA  518



>gb|AFK39230.1| unknown [Lotus japonicus]
Length=331

 Score =   503 bits (1294),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 233/311 (75%), Positives = 273/311 (88%), Gaps = 1/311 (0%)
 Frame = -3

Query  1174  EMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQP  995
             EMFTFGY+   P+VTYRVISKDG MHDPVPIT+   +MMHDFAITENYAIFMDLPLYF+P
Sbjct  21    EMFTFGYSHTPPYVTYRVISKDGFMHDPVPITVSDPIMMHDFAITENYAIFMDLPLYFRP  80

Query  994   KEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMI  815
             KEMV  K L + FD+TKKARFGVLPRYAK++  I+WFELPNCFIFH ANAWEE DEVV+I
Sbjct  81    KEMVKNKTLIFSFDSTKKARFGVLPRYAKDDKQIRWFELPNCFIFHNANAWEEEDEVVLI  140

Query  814   SCRIQNPDLDMASGTLKDSLD-FVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTG  638
             +CR++NP+L+   G +K+ L+ F NELYEMRFNMKTG ASQ+KLS S VDFPRVNE+YTG
Sbjct  141   TCRLENPELNNVGGAVKEKLESFSNELYEMRFNMKTGEASQQKLSASTVDFPRVNESYTG  200

Query  637   RKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFV  458
             RKQRYVY T+L  +AKV G+VKFDLHA+P++GKTKLEVGGNV+G++DLGPG+FGSEA++V
Sbjct  201   RKQRYVYGTILDSIAKVTGVVKFDLHAKPDSGKTKLEVGGNVQGLYDLGPGKFGSEAVYV  260

Query  457   PREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFV  278
             PR   T  EEDDGYLILF HDENTGKS V+VIDAKTMSA+P+AVVELP+RVPYGFHAFFV
Sbjct  261   PRVPGTDSEEDDGYLILFAHDENTGKSFVHVIDAKTMSADPIAVVELPHRVPYGFHAFFV  320

Query  277   TEEQLQTQAEI  245
             TE+QLQ QA++
Sbjct  321   TEDQLQEQAKL  331



>ref|XP_008349836.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Malus domestica]
Length=313

 Score =   484 bits (1245),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 229/301 (76%), Positives = 257/301 (85%), Gaps = 1/301 (0%)
 Frame = -3

Query  1753  MHDSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWF  1574
             M+DSS+P HYL+GNFAP  +ETPP  +LPV GHLP CLNGEFVRVGPNPKFAPVAG HWF
Sbjct  1     MYDSSQPHHYLAGNFAPVADETPPTTNLPVIGHLP-CLNGEFVRVGPNPKFAPVAGXHWF  59

Query  1573  DGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLR  1394
             DGDGM+HG+ IKDGKATYVSR+V+TS LKQEE+FG +KFMKIGDLKG  GL  + LQMLR
Sbjct  60    DGDGMVHGMXIKDGKATYVSRYVRTSHLKQEEYFGASKFMKIGDLKGFLGLFMMNLQMLR  119

Query  1393  IKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGH  1214
              KLK+LD SYG GT NTAL YH GKLLALHE DKPY +KV+EDGDLQT+G+LDYDKRL H
Sbjct  120   EKLKILDMSYGFGTGNTALXYHHGKLLALHEADKPYVLKVMEDGDLQTVGLLDYDKRLTH  179

Query  1213  AFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITEN  1034
             +FTAHPKVDP TGEMFTFG +   P+VTYRVISKDG MHDP+ ITIP  VMMHDF IT N
Sbjct  180   SFTAHPKVDPFTGEMFTFGXSPTPPYVTYRVISKDGFMHDPITITIPDPVMMHDFXITXN  239

Query  1033  YAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHT  854
             YAIFMDLPL F+PKEMV + +L + FD TKKARFG+LPRYAK+ELLI+WFELPNCFIFH 
Sbjct  240   YAIFMDLPLIFKPKEMVKEXKLIFTFDHTKKARFGLLPRYAKDELLIRWFELPNCFIFHN  299

Query  853   A  851
              
Sbjct  300   G  300



>gb|AFK46945.1| unknown [Medicago truncatula]
Length=287

 Score =   471 bits (1212),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/287 (78%), Positives = 251/287 (87%), Gaps = 1/287 (0%)
 Frame = -3

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             MHDPVPITI   +MMHDFAITENY+IFMDLPLYF+PKEMV  K L + FD+TKKARFGVL
Sbjct  1     MHDPVPITISEPIMMHDFAITENYSIFMDLPLYFRPKEMVKNKTLIFSFDSTKKARFGVL  60

Query  922   PRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLD-FV  746
             PRYAK+E  I+WFELPNCFIFH ANAWEE DE+V+I+CR++NP+LDM  G +K+ LD F 
Sbjct  61    PRYAKDEKHIRWFELPNCFIFHNANAWEEEDEIVLITCRLENPNLDMVGGAVKEKLDNFA  120

Query  745   NELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFD  566
             NELYEMRFNMKTG ASQKKLS SAVDFPRVNE+YTGRKQRYVY T L  +AKV GIVKFD
Sbjct  121   NELYEMRFNMKTGEASQKKLSASAVDFPRVNESYTGRKQRYVYGTELDSIAKVTGIVKFD  180

Query  565   LHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENT  386
             LHA+P++GKTKLEVGGNV G +DLGPGRFGSEA++VPR   T  EEDDGYLI FVHDENT
Sbjct  181   LHAKPDSGKTKLEVGGNVVGHYDLGPGRFGSEAVYVPRVPGTDSEEDDGYLIFFVHDENT  240

Query  385   GKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             GKS V+V+DAKTMSA+PVAVVELP RVPYGFHAFFVTEEQLQ QA++
Sbjct  241   GKSFVHVLDAKTMSADPVAVVELPQRVPYGFHAFFVTEEQLQEQAKL  287



>dbj|BAJ94401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score =   464 bits (1195),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 219/307 (71%), Positives = 254/307 (83%), Gaps = 1/307 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMH-DSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLPEC  1643
             P P+ G+A+ A+D LE   V++ H   ++P+ +LSGNFAP P+ETPP   L V GHLP+C
Sbjct  23    PRPRKGVASWAVDMLERLAVRLSHGKKAEPVPWLSGNFAPVPDETPPAAGLTVRGHLPKC  82

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             LNGEFVRVGPNPKF P+AGYHWFDGDGMIH +RIKDGKATY+SR+VKTSRL+QEE+FG  
Sbjct  83    LNGEFVRVGPNPKFTPIAGYHWFDGDGMIHAMRIKDGKATYISRYVKTSRLEQEEYFGGP  142

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KF KIGDLKG+ GL  V  Q LR KLKVLD +YG GTANTALIYH GKL+AL E DKPY 
Sbjct  143   KFTKIGDLKGVLGLFMVLTQELRKKLKVLDATYGIGTANTALIYHHGKLMALSESDKPYV  202

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             IK+LEDGDLQTLG+LDYDKRL H FTAHPKVDP T EMFTFGY+ + P+ TYRVI+KDG+
Sbjct  203   IKILEDGDLQTLGLLDYDKRLKHPFTAHPKVDPFTDEMFTFGYSHEPPYCTYRVITKDGI  262

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVL  923
             M DPVPITIP SVMMHDFAITENY+IFMDLP++F+PKEMV   +  YKFD TKKARFG+L
Sbjct  263   MLDPVPITIPESVMMHDFAITENYSIFMDLPMFFRPKEMVKNSEFIYKFDPTKKARFGIL  322

Query  922   PRYAKNE  902
              RY K+E
Sbjct  323   QRYEKDE  329



>dbj|BAJ33786.1| unnamed protein product [Thellungiella halophila]
Length=308

 Score =   454 bits (1168),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 216/277 (78%), Positives = 241/277 (87%), Gaps = 1/277 (0%)
 Frame = -3

Query  1819  PTPQSGIAAKAIDWLEWAIVKVMHDSSKPLHYLSGNFAPAPEETPPCKDLPV-SGHLPEC  1643
             P P  G ++K +D LE  +VK+MHD+S PLHYLSGNFAP  +ETPP KDLPV  G LPEC
Sbjct  14    PKPSKGFSSKLLDLLERVVVKLMHDASLPLHYLSGNFAPLKDETPPVKDLPVVHGFLPEC  73

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             LNGEFVRVGPNPKF PVAGYHWFDGDGMIHG+RIKDGKATYVSR+VKTSRLKQEEFFG A
Sbjct  74    LNGEFVRVGPNPKFDPVAGYHWFDGDGMIHGVRIKDGKATYVSRYVKTSRLKQEEFFGAA  133

Query  1462  KFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPYA  1283
             KFMKIGDLKG FGLL V +Q LR KLKVLD+SYG GTANTAL+YH GKLLAL E DKPY 
Sbjct  134   KFMKIGDLKGFFGLLMVNMQQLRTKLKVLDDSYGYGTANTALVYHHGKLLALQEADKPYV  193

Query  1282  IKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGYAQKAPFVTYRVISKDGL  1103
             +KVLEDGDLQTLGM+DYDKRL H+FTAHPKVDP TGEMFTFGY+   P++TYRVIS+DG+
Sbjct  194   VKVLEDGDLQTLGMIDYDKRLTHSFTAHPKVDPATGEMFTFGYSHTPPYLTYRVISEDGI  253

Query  1102  MHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPK  992
             M DPVPITI   +MMHDFAITE+YAIFMDLP++F+PK
Sbjct  254   MLDPVPITISEPIMMHDFAITESYAIFMDLPMHFRPK  290



>gb|ABK21471.1| unknown [Picea sitchensis]
Length=326

 Score =   453 bits (1166),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 234/369 (63%), Positives = 268/369 (73%), Gaps = 44/369 (12%)
 Frame = -3

Query  1357  GTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVT  1178
             GT NTAL+YH G+LLAL+EGDKPYA+KVLEDGDLQTLG++DYDKRL H+FTAHPKVDPVT
Sbjct  2     GTGNTALVYHHGRLLALNEGDKPYALKVLEDGDLQTLGLMDYDKRLTHSFTAHPKVDPVT  61

Query  1177  GEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQ  998
             GEMFTFGY   AP+VTY V++K+G M DPVPITI   VMMHDFAITENYAIFMDLPLYF+
Sbjct  62    GEMFTFGYQFTAPYVTYHVVTKEGYMLDPVPITISEPVMMHDFAITENYAIFMDLPLYFR  121

Query  997   PKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVM  818
             PK M+ +  L           F  L  Y    L+++W +             E+G   + 
Sbjct  122   PKPMLGRTVLKL---------FFTLVDY--QTLILRWLQ----------GLSEKGWATIE  160

Query  817   ISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTG  638
             ++C                        YE+RFN+ TG ASQKKLSESAVDFPR+NE Y G
Sbjct  161   MNCG-----------------------YEIRFNLNTGEASQKKLSESAVDFPRINEKYIG  197

Query  637   RKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFV  458
             RKQR+VYAT L  LAKV+GIVKFDL  EPE GK ++EVGGNV+GIF  G GR+GSEAIFV
Sbjct  198   RKQRFVYATRLDSLAKVEGIVKFDLQLEPEVGKEQIEVGGNVKGIFQFGHGRYGSEAIFV  257

Query  457   PREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFV  278
             PRE+  G EEDDGYLI FVHDENT KS VNVIDAKTMS+EPVAVV LP RVPYGFHAFFV
Sbjct  258   PRESDVGLEEDDGYLICFVHDENTRKSEVNVIDAKTMSSEPVAVVPLPARVPYGFHAFFV  317

Query  277   TEEQLQTQA  251
             TEEQL+ Q 
Sbjct  318   TEEQLKYQV  326



>gb|AGS79172.1| carotenoid cleavage dioxygenase 1, partial [Fagopyrum tataricum]
Length=284

 Score =   449 bits (1154),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 213/286 (74%), Positives = 245/286 (86%), Gaps = 3/286 (1%)
 Frame = -3

Query  1099  HDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFGVLP  920
             HDPVPITIPASVMMHDFAITENYAIFMDLPLYF+PKEMV K +LAY +DAT+ ARFG+LP
Sbjct  1     HDPVPITIPASVMMHDFAITENYAIFMDLPLYFKPKEMVMKNKLAYIYDATQPARFGILP  60

Query  919   RYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSL-DFVN  743
             RYAK+ELLIKWFELPNCFIFH  NAWEEGDEV++I+CR +NPD+DM    +   L  F +
Sbjct  61    RYAKDELLIKWFELPNCFIFHNGNAWEEGDEVILITCRFENPDIDMDRTAINGKLAGFSS  120

Query  742   ELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKFDL  563
             EL+EMRFNMKTGLA Q+KLS  AVDFPRVNENYTGRKQRYVY  + +++A+V   VKFDL
Sbjct  121   ELFEMRFNMKTGLAYQRKLSAPAVDFPRVNENYTGRKQRYVYGGVFANVAQVNAFVKFDL  180

Query  562   HAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTG  383
              AEP+  KTKLEVGGNV+GIF LGPGRFGSEA+FVP ++ST  EEDDGYL  F HDEN+G
Sbjct  181   EAEPDHSKTKLEVGGNVKGIFHLGPGRFGSEAVFVPSQSST--EEDDGYLFFFSHDENSG  238

Query  382   KSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAEI  245
             KS V VIDA+TMSA+PVAV+ELP+RVPYG HAFFVTEEQL+ QA +
Sbjct  239   KSFVYVIDARTMSADPVAVIELPHRVPYGIHAFFVTEEQLKEQAAL  284



>ref|XP_005644307.1| carotenoid oxygenase [Coccomyxa subellipsoidea C-169]
 gb|EIE19763.1| carotenoid oxygenase [Coccomyxa subellipsoidea C-169]
Length=537

 Score =   444 bits (1143),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 233/498 (47%), Positives = 320/498 (64%), Gaps = 21/498 (4%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAG-YHWFDGDGMIHG  1550
             +L+ NFAP   ET   ++L V G LP+ L+G + R+GPNP   P++G YHWFDGDGM+H 
Sbjct  50    FLADNFAPVSAETDQ-QNLKVVGKLPKALDGVYARIGPNPVL-PISGDYHWFDGDGMVHA  107

Query  1549  LRIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDN  1370
              RIKDGKA Y +R V+T+RLK+E   G   + + GD++G++G+    L  LR+KL V   
Sbjct  108   CRIKDGKAAYSNRLVQTNRLKRERKLGFPVYQRFGDMRGLWGVFHAGLSQLRLKLGVTPP  167

Query  1369  SYGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKV  1190
             S G GTANTAL+YH  KLLALHEGD PYA+++L +G + TLG L +  ++ H FTAHPKV
Sbjct  168   SEGIGTANTALVYHANKLLALHEGDLPYALRILCNGIVDTLGRLTFGGKVNHPFTAHPKV  227

Query  1189  DPVTGEMFTFGYA--QKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             DP+TGE+F  GY   ++   V Y  + KDG +   V + +   VMMHD AIT++YAI +D
Sbjct  228   DPITGELFFIGYQIDKQPAGVHYAGLDKDGKLQFDVRVDLQEGVMMHDMAITQDYAIVLD  287

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             +PL F+P+ MVTK +L   +D ++ ARFGV+P+  K+   + WFELP   IFH ANAW+E
Sbjct  288   VPLVFRPEVMVTKNRLPLVYDKSRPARFGVMPKRPKSGKEVVWFELPAVMIFHVANAWQE  347

Query  835   GDEVV-MISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPR  659
               +V+ + +C  ++ DLD++   L DS  F   + EM FN+ TG A+ ++L++   +FPR
Sbjct  348   SKDVIKLFACCFEDFDLDLSEDNLPDS--FQPRMREMTFNLATGEATTRQLADVICEFPR  405

Query  658   VNENYTGRKQRYVYATMLSDLA---KVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGP  488
             V E+ TG + RY YA+ +   A   K +GI K D+ A           GG V G    G 
Sbjct  406   VPEHLTGLRTRYTYASCMDGAAMAGKFQGIAKLDMGATN---------GGAVAGRLSHGK  456

Query  487   GRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNR  308
             GR+G EA+FV     +   EDDGYL+ +VHDE + KS + V DA+TMS  PVA V+LP R
Sbjct  457   GRWGGEAVFVSAGGPSAA-EDDGYLMTYVHDETSNKSELVVYDARTMSDAPVARVQLPQR  515

Query  307   VPYGFHAFFVTEEQLQTQ  254
             VPYGFH   V+E Q Q Q
Sbjct  516   VPYGFHGMHVSEAQFQQQ  533



>ref|WP_015140676.1| lignostilbene-alpha,beta-dioxygenase-like protein [Nostoc sp. 
PCC 7524]
 ref|YP_007077863.1| lignostilbene-alpha,beta-dioxygenase-like protein [Nostoc sp. 
PCC 7524]
 gb|AFY50266.1| lignostilbene-alpha,beta-dioxygenase-like enzyme [Nostoc sp. 
PCC 7524]
Length=463

 Score =   419 bits (1076),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 225/495 (45%), Positives = 312/495 (63%), Gaps = 42/495 (8%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  EET     L V G LP  L+G FVR GPNP++AP+  YHWFDGDGM+HG+
Sbjct  9     YLDGNFAPVREETT-TDTLKVIGELPTDLSGMFVRNGPNPQYAPIGHYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKATY +R+ +T + + E   G+A +  +                  ++    D  
Sbjct  68    RISNGKATYRNRYTRTQKWQMEHQAGKAIWTGL------------------MEAPKPDLP  109

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
              GN TANTALI+H G+LLAL EG  P+AIKV E   L+TLG   Y+ +L  AFTAHPKVD
Sbjct  110   SGN-TANTALIWHAGQLLALWEGGAPHAIKVPE---LETLGEFTYNNKLTSAFTAHPKVD  165

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
             PVTGEM  FGY+  +PF++Y V+S  G +   VPI +P +VMMHDFAITENY IFMDLPL
Sbjct  166   PVTGEMMFFGYSFASPFLSYGVVSAQGELLRTVPIDLPMAVMMHDFAITENYTIFMDLPL  225

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
              F P+ M  + +    F+  + +RFG+LPR+  N   I+WFE P+C++FHT NA+E+ DE
Sbjct  226   TFSPERM-QRGEPMLMFERDRPSRFGILPRHGDNN-NIRWFESPSCYVFHTLNAYEDQDE  283

Query  826   VVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNEN  647
             VV+I+CR+ +  +     +  D    +  L+  RFN+ TG  +++ L + A +FPRVNEN
Sbjct  284   VVLIACRMSSTTVLAIDNSQTDPQADIPLLHRWRFNLTTGKVTEEVLDDVAAEFPRVNEN  343

Query  646   YTGRKQRYVYATMLS--DLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGS  473
               GR   Y YA  ++   L   +G++K+D     ++GK++         I   G GR+G 
Sbjct  344   LLGRFTSYGYAGKMAKGSLPLFEGVIKYDF----DSGKSQ---------IHTFGKGRYGG  390

Query  472   EAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGF  293
             E++FVPR  +T   EDDG+L+ +VHD     S + V++A+ +S+EP+A V +P RVPYGF
Sbjct  391   ESVFVPRPGAT--VEDDGWLVTYVHDTAEDSSELVVVNAQDVSSEPIARVLIPQRVPYGF  448

Query  292   HAFFVTEEQLQTQAE  248
             H  +VTE QL ++AE
Sbjct  449   HGAWVTEAQLNSEAE  463



>ref|WP_015202538.1| 9-cis-epoxycarotenoid dioxygenase [Crinalium epipsammum]
 ref|YP_007141927.1| 9-cis-epoxycarotenoid dioxygenase [Crinalium epipsammum PCC 9333]
 gb|AFZ12417.1| 9-cis-epoxycarotenoid dioxygenase [Crinalium epipsammum PCC 9333]
Length=495

 Score =   411 bits (1057),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 224/493 (45%), Positives = 308/493 (62%), Gaps = 44/493 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL  NFAP   E    + L V G LP  L+G FVR G NP+F P+  YHWFDGDGM+HG+
Sbjct  38    YLEENFAPVSTEIT-AEKLTVIGELPPTLSGMFVRNGSNPQFPPIGKYHWFDGDGMLHGV  96

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKA+Y +RFV+T   + E   GRA                ++  ML       +N 
Sbjct  97    RISNGKASYCNRFVRTKGYQIEHDAGRA----------------IWSGMLEPPQP--NNP  138

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             YG     ANTAL++H G+++AL EG +P+AIK+    DL T+G   Y  +L  AFTAHPK
Sbjct  139   YGAFKNVANTALVWHAGQMMALWEGGEPHAIKL---PDLDTIGGYTYSGQLKSAFTAHPK  195

Query  1192  VDPVTGEMFTFGYAQKAP-FVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             VDPVTGEM  FGY+  AP FV Y V+S +G +   VPI +P  VMMHDFAITE+Y+IF+D
Sbjct  196   VDPVTGEMMFFGYSLFAPPFVKYSVVSAEGDLLQTVPIDLPVGVMMHDFAITEHYSIFLD  255

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             LPL F+P+ M  + Q A+ F++ + +RFG++PR+  N   I+WFE   C+I+HT NA+EE
Sbjct  256   LPLTFRPERM-QRGQPAFMFESDRSSRFGIVPRHGDNSS-IRWFESSPCYIYHTLNAYEE  313

Query  835   GDEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRV  656
             GDEVV+++CR+ +  + M+     ++ D    LY  RFN+KTG   ++ L +++ DFPRV
Sbjct  314   GDEVVLLACRVASTTVLMSDVKKSETEDESPHLYRWRFNLKTGAVREEMLDDASSDFPRV  373

Query  655   NENYTGRKQRYVYATML--SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGR  482
             NEN  GRK RY Y   L  S +    G++K D      +GK++             G GR
Sbjct  374   NENLLGRKTRYGYTAKLTASAIPLFDGVIKHDF----SSGKSETHT---------FGHGR  420

Query  481   FGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVP  302
             +G EA+FVPR  +T   EDDG+LI FV+DE +  S + V++A+ ++ EPVA V +P RVP
Sbjct  421   YGGEAVFVPRPDAT--NEDDGWLITFVYDEESNSSELVVVNAEDVTGEPVARVIIPQRVP  478

Query  301   YGFHAFFVTEEQL  263
             YGFH  +++EEQL
Sbjct  479   YGFHGIWISEEQL  491



>gb|AFW89635.1| white cap1 [Zea mays]
Length=250

 Score =   401 bits (1030),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 213/248 (86%), Gaps = 1/248 (0%)
 Frame = -3

Query  988  MVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISC  809
            MV   +  YKFD TKK RFG+LPRYAK++ LI+WF+LPNCFIFH ANAWEEGDEVV+I+C
Sbjct  1    MVKNGEFIYKFDPTKKGRFGILPRYAKDDKLIRWFQLPNCFIFHNANAWEEGDEVVLITC  60

Query  808  RIQNPDLDMASGTLKDSL-DFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRK  632
            R++NPDLD  +G   D L +F NELYEMRFNMKTG ASQK+LS SAVDFPRVNE+YTGRK
Sbjct  61   RLENPDLDKVNGYQSDKLENFGNELYEMRFNMKTGAASQKQLSVSAVDFPRVNESYTGRK  120

Query  631  QRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPR  452
            QRYVY T+L  +AKV GI+KFDLHAEPE+G  +LEVGGNV+GI+DLGPGRFGSEAIFVP+
Sbjct  121  QRYVYCTILDSIAKVTGIIKFDLHAEPESGVKELEVGGNVQGIYDLGPGRFGSEAIFVPK  180

Query  451  EASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTE  272
                  EEDDGYLI FVHDENTGKS VNVIDAKTMSA+PVAVVELPNRVPYGFHAFFVTE
Sbjct  181  HPGVSGEEDDGYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTE  240

Query  271  EQLQTQAE  248
            +QL  QAE
Sbjct  241  DQLARQAE  248



>ref|WP_015111403.1| 9-cis-epoxycarotenoid dioxygenase [Nostoc sp. PCC 7107]
 ref|YP_007048313.1| 9-cis-epoxycarotenoid dioxygenase [Nostoc sp. PCC 7107]
 gb|AFY41163.1| 9-cis-epoxycarotenoid dioxygenase [Nostoc sp. PCC 7107]
Length=462

 Score =   408 bits (1048),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 216/491 (44%), Positives = 313/491 (64%), Gaps = 41/491 (8%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  +E    ++L V G LP  L+G FVR GPNP+++P+  YHWFDGDGM+HG+
Sbjct  9     YLDGNFAPVQKEIT-AENLQVIGELPPELSGMFVRNGPNPQYSPIGEYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKA Y +R+V+T + + E   G+A             +LT  L+  +     +  +
Sbjct  68    RISEGKAVYRNRYVQTQKWQAEHDAGKA-------------ILTGLLEPPQADHPHISRN  114

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
                  ANTAL++H G+LLA+ E   P+ I++ E   L+T+G   Y+ +L  AFTAHPKVD
Sbjct  115   ----AANTALVWHGGQLLAVWEAGAPHTIQMPE---LKTIGEHTYNGKLKSAFTAHPKVD  167

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
             P+TGEM  FGY+   P++ Y ++S  G +   VPI IPA VMMHDFAITENY IFMDLP+
Sbjct  168   PITGEMVFFGYSFMPPYLQYGIVSAAGELLSTVPIEIPAPVMMHDFAITENYTIFMDLPV  227

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
               +P+ M   K +   F++ + +RFG+LPR+  N   I+WFE P C++FHT NA+E+GDE
Sbjct  228   TIRPERMQQGKPMI-MFESDRPSRFGILPRHGDNS-NIRWFESPACYVFHTLNAYEQGDE  285

Query  826   VVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNEN  647
             VV+I+CR+ +  +   SG + D    +  L++ RFN+ TG  S+ +L + A +FPRVNEN
Sbjct  286   VVLIACRMSSTSVLGFSG-IDDPDANIPRLHQWRFNLNTGAMSESRLDDHAGEFPRVNEN  344

Query  646   YTGRKQRYVYA--TMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGS  473
             + GR+ RY Y   +  + +   +G++K+D H     G +++ +          G GR+G 
Sbjct  345   FLGRQTRYGYVNKSAPTPVPLFEGVMKYDFH----NGTSQINL---------FGQGRYGG  391

Query  472   EAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGF  293
             E++F PR  +T   EDDG+L+ FVHDE    S + V++A+ ++AEPVA V +P RVPYGF
Sbjct  392   ESVFAPRPQATA--EDDGWLMTFVHDETANTSELLVLNAQDITAEPVARVLIPQRVPYGF  449

Query  292   HAFFVTEEQLQ  260
             HA +VTE+QLQ
Sbjct  450   HAAWVTEKQLQ  460



>ref|WP_015127264.1| 9-cis-epoxycarotenoid dioxygenase [Calothrix sp. PCC 7507]
 ref|YP_007064275.1| 9-cis-epoxycarotenoid dioxygenase [Calothrix sp. PCC 7507]
 gb|AFY31441.1| 9-cis-epoxycarotenoid dioxygenase [Calothrix sp. PCC 7507]
Length=470

 Score =   406 bits (1044),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 216/492 (44%), Positives = 307/492 (62%), Gaps = 43/492 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             +L+GNFAP  +E    + L + G LP  L+G FVR GPNP+++P+  YHWFDGDGM+HG+
Sbjct  14    FLAGNFAPVRDEIT-DETLQIIGQLPPGLSGMFVRNGPNPQWSPIGKYHWFDGDGMLHGV  72

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             +I +GKA+Y  R+V+T   K E   G+A +                     ++   +DN 
Sbjct  73    KISNGKASYRDRYVQTKAWKIEHQAGKAVWSGF------------------LEPPQMDNP  114

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             +G    TANTAL++H G+LLAL EG  P+AIKV    DL+T+G   YD +L  AFTAHPK
Sbjct  115   HGPSKNTANTALVWHAGQLLALWEGGAPHAIKV---PDLETIGEYTYDGKLVSAFTAHPK  171

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             VDP+T EM  FGY+   P++ Y V+S  G +   VPI +P  VMMHDFAI+ENY IFMDL
Sbjct  172   VDPLTNEMMFFGYSFAPPYLQYSVVSPQGKLLRTVPIELPMGVMMHDFAISENYTIFMDL  231

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             PL F   E V K +   KF+  + +RFG++PR+  N   I+WFE P C++FHT NA+EEG
Sbjct  232   PLTFS-VERVQKGEALMKFEGDRPSRFGIVPRFGDNS-NIRWFESPPCYVFHTLNAYEEG  289

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             DEVV+I+CR+ +  + +A  TL+D    +  L++ RFN+KTG   +++L +   +FPRVN
Sbjct  290   DEVVLIACRMSSTSVLVAENTLQDPDGDIPRLHQWRFNLKTGTVHEERLDDVPGEFPRVN  349

Query  652   ENYTGRKQRYVY--ATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
             +N+ G+K RY Y   +  + L    G++K+D      T +T            + G GR+
Sbjct  350   DNFLGQKTRYGYIAKSAPTPLPLFDGLIKYDFSK--STSQTH-----------EFGEGRY  396

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPY  299
             G E +F PR  +T   EDDG+L+ FV+DE    S + V++A+ M++EPVA V +P RVPY
Sbjct  397   GGEPVFAPRPGATA--EDDGWLVTFVYDEGAETSELVVVNAQDMTSEPVARVIIPQRVPY  454

Query  298   GFHAFFVTEEQL  263
             GFH  +++E QL
Sbjct  455   GFHGAWISEGQL  466



>dbj|BAF31903.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31908.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score =   410 bits (1055),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 226/533 (42%), Positives = 317/533 (59%), Gaps = 30/533 (6%)
 Frame = -3

Query  1816  TPQSGIAAKAIDWLEWAIVKVMHD------SSKPLHYLSGNFAPAPEETPPCKDLPVSGH  1655
              P   +AA A+D +E + +  +        ++ P   ++GNF+P PE +P   +L V G 
Sbjct  109   NPVQRLAAAALDAMEKSFIMALEKKFPLPKTADPEIQIAGNFSPVPE-SPVQHELEVVGQ  167

Query  1654  LPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEF  1475
             +P+CL G +VR G NP F P+AG+H+FDGDGM+H +R+K G A+Y SRF +T RL +EE 
Sbjct  168   IPQCLEGVYVRNGANPLFEPLAGHHFFDGDGMVHAVRLKQGIASYCSRFTRTYRLVEEEK  227

Query  1474  FGRAKFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEG  1298
              GRA + K IG+L G  G+  + L   R    ++D S G G AN  LIY +G+LLA+ E 
Sbjct  228   LGRAFYPKAIGELHGHSGIARLMLYYARSMFGLVDRSKGMGVANAGLIYFNGRLLAMSED  287

Query  1297  DKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRV  1121
             D PYA++V EDGDL TLG  D+D +L  A  AHPK+DP T E+F   Y   K P++ Y +
Sbjct  288   DLPYAVRVTEDGDLATLGRFDFDGQLQSAMIAHPKIDPETKELFALSYNVIKKPYLKYFM  347

Query  1120  ISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKK  941
              S DG     V I++    MMHDFAIT+ Y +  D  L F+ +EMV        +D  K 
Sbjct  348   FSPDGRKGPDVTISVKEPTMMHDFAITDKYVVVPDQQLVFKLQEMVAGGSPVI-YDKEKV  406

Query  940   ARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG-DEVVMISCRIQNPD--LDMASGT  770
              RFG+LP+Y  +E  +KW E+P+CF FH  NAWEE  DEVV+I   +  PD   + +   
Sbjct  407   PRFGILPKYDSDESRMKWIEVPDCFCFHLWNAWEENEDEVVVIGSCMTPPDSIFNESDAA  466

Query  769   LKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAK  590
             L+  L       E+R N+KTG +S+++L+   ++  +VN N  GRK RYVY  +     K
Sbjct  467   LRSVLS------EIRLNLKTGKSSRRQLAPMNLEAGQVNRNKLGRKARYVYLAIAEPWPK  520

Query  589   VKGIVKFDLHAE-PETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYL  413
             V GI K DL AE PE           V G  +   G +G E  FVPR ++    EDDGY+
Sbjct  521   VSGIAKVDLEAESPE----------RVVGKIEYKKGCYGGEPFFVPRTSNPEAPEDDGYV  570

Query  412   ILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             + F+H+E T +S + ++DAK+ + EPVA V+LP+RVPYGFH  F+T ++L  Q
Sbjct  571   LTFMHNEETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFITSQELDQQ  623



>dbj|BAF31898.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31901.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31924.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31926.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score =   409 bits (1052),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 226/533 (42%), Positives = 317/533 (59%), Gaps = 30/533 (6%)
 Frame = -3

Query  1816  TPQSGIAAKAIDWLEWAIVKVMHD------SSKPLHYLSGNFAPAPEETPPCKDLPVSGH  1655
              P   +AA A+D +E + +  +        ++ P   ++GNF+P PE +P   +L V G 
Sbjct  109   NPVQRLAAAALDAVEKSFIMALEKKFPLPKTADPEIQIAGNFSPVPE-SPVQHELEVVGQ  167

Query  1654  LPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEF  1475
             +P+CL G +VR G NP F P+AG+H+FDGDGM+H +R+K G A+Y SRF +T RL +EE 
Sbjct  168   IPQCLEGVYVRNGANPLFEPLAGHHFFDGDGMVHAVRLKQGIASYCSRFTRTYRLVEEEK  227

Query  1474  FGRAKFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEG  1298
              GRA + K IG+L G  G+  + L   R    ++D S G G AN  LIY +G+LLA+ E 
Sbjct  228   LGRAFYPKAIGELHGHSGIARLMLYYARSMFGLVDRSKGMGVANAGLIYFNGRLLAMSED  287

Query  1297  DKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRV  1121
             D PYA++V EDGDL TLG  D+D +L  A  AHPK+DP T E+F   Y   K P++ Y +
Sbjct  288   DLPYAVRVTEDGDLATLGRFDFDGQLQSAMIAHPKIDPETKELFALSYNVIKKPYLKYFM  347

Query  1120  ISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKK  941
              S DG     V I++    MMHDFAIT+ Y +  D  L F+ +EMV        +D  K 
Sbjct  348   FSPDGRKGPDVTISVKEPTMMHDFAITDKYVVVPDQQLVFKLQEMVAGGSPVI-YDKEKV  406

Query  940   ARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG-DEVVMISCRIQNPD--LDMASGT  770
              RFG+LP+Y  +E  +KW E+P+CF FH  NAWEE  DEVV+I   +  PD   + +   
Sbjct  407   PRFGILPKYDSDESRMKWIEVPDCFCFHLWNAWEENEDEVVVIGSCMTPPDSIFNESDAA  466

Query  769   LKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAK  590
             L+  L       E+R N+KTG +S+++L+   ++  +VN N  GRK RYVY  +     K
Sbjct  467   LRSVLS------EIRLNLKTGKSSRRQLAPMNLEAGQVNRNKLGRKARYVYLAIAEPWPK  520

Query  589   VKGIVKFDLHAE-PETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYL  413
             V GI K DL AE PE           V G  +   G +G E  FVPR ++    EDDGY+
Sbjct  521   VSGIAKVDLEAESPE----------RVVGKIEYKKGCYGGEPFFVPRTSNPEAPEDDGYV  570

Query  412   ILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             + F+H+E T +S + ++DAK+ + EPVA V+LP+RVPYGFH  F+T ++L  Q
Sbjct  571   LTFMHNEETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFITSQELDQQ  623



>dbj|BAF31922.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score =   409 bits (1051),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 225/533 (42%), Positives = 317/533 (59%), Gaps = 30/533 (6%)
 Frame = -3

Query  1816  TPQSGIAAKAIDWLEWAIVKVMHD------SSKPLHYLSGNFAPAPEETPPCKDLPVSGH  1655
              P   +AA A+D +E + +  +        ++ P   ++GNF+P PE +P   +L V G 
Sbjct  109   NPVQRLAAAALDAVEKSFITALEKKFPLPKTADPEIQMAGNFSPVPE-SPVQHELEVVGQ  167

Query  1654  LPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEF  1475
             +P+CL G +VR G NP F P+AG+H+FDGDGM+H +R+K G A+Y SRF +T RL +EE 
Sbjct  168   IPQCLEGVYVRNGANPLFEPLAGHHFFDGDGMVHAVRLKQGIASYCSRFTRTYRLVEEEK  227

Query  1474  FGRAKFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEG  1298
              GRA + K IG+L G  G+  + L   R    ++D S G G AN  LIY +G+LLA+ E 
Sbjct  228   LGRAFYPKAIGELHGHSGIARLMLYYARSMFGLVDRSKGMGVANAGLIYFNGRLLAMSED  287

Query  1297  DKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRV  1121
             D PYA++V EDGDL T+G  D+D +L  A  AHPK+DP T E+F   Y   K P++ Y +
Sbjct  288   DLPYAVRVTEDGDLATVGRFDFDGQLQSAMIAHPKIDPETKELFALSYNVIKKPYLKYFM  347

Query  1120  ISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKK  941
              S DG     V I++    MMHDFAIT+ Y +  D  L F+ +EMV        +D  K 
Sbjct  348   FSPDGRKGPDVTISVKEPTMMHDFAITDKYVVVPDQQLVFKLQEMVAGGSPVI-YDKEKV  406

Query  940   ARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG-DEVVMISCRIQNPD--LDMASGT  770
              RFG+LP+Y  +E  +KW E+P+CF FH  NAWEE  DEVV+I   +  PD   + +   
Sbjct  407   PRFGILPKYDSDESRMKWIEVPDCFCFHLWNAWEENEDEVVVIGSCMTPPDSIFNESDAA  466

Query  769   LKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAK  590
             L+  L       E+R N+KTG +S+++L+   ++  +VN N  GRK RYVY  +     K
Sbjct  467   LRSVLS------EIRLNLKTGKSSRRQLAPMNLEAGQVNRNKLGRKARYVYLAIAEPWPK  520

Query  589   VKGIVKFDLHAE-PETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYL  413
             V GI K DL AE PE           V G  +   G +G E  FVPR ++    EDDGY+
Sbjct  521   VSGIAKVDLEAESPE----------RVVGKIEYKKGCYGGEPFFVPRTSNPEAPEDDGYV  570

Query  412   ILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             + F+H+E T +S + ++DAK+ + EPVA V+LP+RVPYGFH  F+T ++L  Q
Sbjct  571   LTFMHNEETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFITSQELDQQ  623



>dbj|BAF31929.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score =   409 bits (1051),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 225/533 (42%), Positives = 317/533 (59%), Gaps = 30/533 (6%)
 Frame = -3

Query  1816  TPQSGIAAKAIDWLEWAIVKVMHD------SSKPLHYLSGNFAPAPEETPPCKDLPVSGH  1655
              P   +AA A+D +E + +  +        ++ P   ++GNF+P PE +P   +L V G 
Sbjct  109   NPVQRLAAAALDAVEKSFITALEKKFPLPKTADPEIQIAGNFSPVPE-SPVQHELEVVGQ  167

Query  1654  LPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEF  1475
             +P+CL G +VR G NP F P+AG+H+FDGDGM+H +R+K G A+Y SRF +T RL +EE 
Sbjct  168   IPQCLEGVYVRNGANPLFEPLAGHHFFDGDGMVHAVRLKQGIASYCSRFTRTYRLVEEEK  227

Query  1474  FGRAKFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEG  1298
              GRA + K IG+L G  G+  + L   R    ++D S G G AN  LIY +G+LLA+ E 
Sbjct  228   LGRAFYPKAIGELHGHSGIARLMLYYARSMFGLVDRSKGMGVANAGLIYFNGRLLAMSED  287

Query  1297  DKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRV  1121
             D PYA++V EDGDL T+G  D+D +L  A  AHPK+DP T E+F   Y   K P++ Y +
Sbjct  288   DLPYAVRVTEDGDLATVGRFDFDGQLQSAMIAHPKIDPETKELFALSYNVIKKPYLKYFM  347

Query  1120  ISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKK  941
              S DG     V I++    MMHDFAIT+ Y +  D  L F+ +EMV        +D  K 
Sbjct  348   FSPDGRKGPDVTISVKEPTMMHDFAITDKYVVVPDQQLVFKLQEMVAGGSPVI-YDKEKV  406

Query  940   ARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG-DEVVMISCRIQNPD--LDMASGT  770
              RFG+LP+Y  +E  +KW E+P+CF FH  NAWEE  DEVV+I   +  PD   + +   
Sbjct  407   PRFGILPKYDSDESRMKWIEVPDCFCFHLWNAWEENEDEVVVIGSCMTPPDSIFNESDAA  466

Query  769   LKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAK  590
             L+  L       E+R N+KTG +S+++L+   ++  +VN N  GRK RYVY  +     K
Sbjct  467   LRSVLS------EIRLNLKTGKSSRRQLAPMNLEAGQVNRNKLGRKARYVYLAIAEPWPK  520

Query  589   VKGIVKFDLHAE-PETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYL  413
             V GI K DL AE PE           V G  +   G +G E  FVPR ++    EDDGY+
Sbjct  521   VSGIAKVDLEAESPE----------RVVGKIEYKKGCYGGEPFFVPRTSNPEAPEDDGYV  570

Query  412   ILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             + F+H+E T +S + ++DAK+ + EPVA V+LP+RVPYGFH  F+T ++L  Q
Sbjct  571   LTFMHNEETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFITSQELDQQ  623



>dbj|BAF31900.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31902.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31904.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31907.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31909.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31910.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31911.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31912.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31914.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31915.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31916.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31923.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31925.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31927.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31928.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31932.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31934.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31935.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31936.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31938.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31939.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31940.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31941.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31942.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31944.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31945.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score =   409 bits (1051),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 225/533 (42%), Positives = 317/533 (59%), Gaps = 30/533 (6%)
 Frame = -3

Query  1816  TPQSGIAAKAIDWLEWAIVKVMHD------SSKPLHYLSGNFAPAPEETPPCKDLPVSGH  1655
              P   +AA A+D +E + +  +        ++ P   ++GNF+P PE +P   +L V G 
Sbjct  109   NPVQRLAAAALDAVEKSFITALEKKFPLPKTADPEIQIAGNFSPVPE-SPVQHELEVVGQ  167

Query  1654  LPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEF  1475
             +P+CL G +VR G NP F P+AG+H+FDGDGM+H +R+K G A+Y SRF +T RL +EE 
Sbjct  168   IPQCLEGVYVRNGANPLFEPLAGHHFFDGDGMVHAVRLKQGIASYCSRFTRTYRLVEEEK  227

Query  1474  FGRAKFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEG  1298
              GRA + K IG+L G  G+  + L   R    ++D S G G AN  LIY +G+LLA+ E 
Sbjct  228   LGRAFYPKAIGELHGHSGIARLMLYYARSMFGLVDRSKGMGVANAGLIYFNGRLLAMSED  287

Query  1297  DKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRV  1121
             D PYA++V EDGDL T+G  D+D +L  A  AHPK+DP T E+F   Y   K P++ Y +
Sbjct  288   DLPYAVRVTEDGDLATVGRFDFDGQLQSAMIAHPKIDPETKELFALSYNVIKKPYLKYFM  347

Query  1120  ISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKK  941
              S DG     V I++    MMHDFAIT+ Y +  D  L F+ +EMV        +D  K 
Sbjct  348   FSPDGRKGPDVTISVKEPTMMHDFAITDKYVVVPDQQLVFKLQEMVAGGSPVI-YDKEKV  406

Query  940   ARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG-DEVVMISCRIQNPD--LDMASGT  770
              RFG+LP+Y  +E  +KW E+P+CF FH  NAWEE  DEVV+I   +  PD   + +   
Sbjct  407   PRFGILPKYDSDESRMKWIEVPDCFCFHLWNAWEENEDEVVVIGSCMTPPDSIFNESDAA  466

Query  769   LKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAK  590
             L+  L       E+R N+KTG +S+++L+   ++  +VN N  GRK RYVY  +     K
Sbjct  467   LRSVLS------EIRLNLKTGKSSRRQLAPMNLEAGQVNRNKLGRKARYVYLAIAEPWPK  520

Query  589   VKGIVKFDLHAE-PETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYL  413
             V GI K DL AE PE           V G  +   G +G E  FVPR ++    EDDGY+
Sbjct  521   VSGIAKVDLEAESPE----------RVVGKIEYKKGCYGGEPFFVPRTSNPEAPEDDGYV  570

Query  412   ILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             + F+H+E T +S + ++DAK+ + EPVA V+LP+RVPYGFH  F+T ++L  Q
Sbjct  571   LTFMHNEETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFITSQELDQQ  623



>dbj|BAF31905.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score =   409 bits (1050),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 225/533 (42%), Positives = 317/533 (59%), Gaps = 30/533 (6%)
 Frame = -3

Query  1816  TPQSGIAAKAIDWLEWAIVKVMHD------SSKPLHYLSGNFAPAPEETPPCKDLPVSGH  1655
              P   +AA A+D +E + +  +        ++ P   ++GNF+P PE +P   +L V G 
Sbjct  109   NPVQRLAAAALDAVEKSFITALEKKFPLPKTADPEIQIAGNFSPVPE-SPVQHELEVVGQ  167

Query  1654  LPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEF  1475
             +P+CL G +VR G NP F P+AG+H+FDGDGM+H +R+K G A+Y SRF +T RL +EE 
Sbjct  168   IPQCLEGVYVRNGANPLFEPLAGHHFFDGDGMVHAVRLKQGIASYCSRFTRTYRLVEEEK  227

Query  1474  FGRAKFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEG  1298
              GRA + K IG+L G  G+  + L   R    ++D S G G AN  LIY +G+LLA+ E 
Sbjct  228   LGRAFYPKAIGELHGHSGIARLMLYYARSMFGLVDRSKGMGVANAGLIYFNGRLLAMSED  287

Query  1297  DKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRV  1121
             D PYA++V EDGDL T+G  D+D +L  A  AHPK+DP T E+F   Y   K P++ Y +
Sbjct  288   DLPYAVRVTEDGDLATVGRFDFDGQLQSAMIAHPKIDPETKELFALSYNVIKKPYLKYFM  347

Query  1120  ISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKK  941
              S DG     V I++    MMHDFAIT+ Y +  D  L F+ +EMV        +D  K 
Sbjct  348   FSPDGRKGPDVTISVKEPTMMHDFAITDKYVVVPDQQLVFKLQEMVAGGSPVI-YDKEKV  406

Query  940   ARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG-DEVVMISCRIQNPD--LDMASGT  770
              RFG+LP+Y  +E  +KW E+P+CF FH  NAWEE  DEVV+I   +  PD   + +   
Sbjct  407   PRFGILPKYDSDESRMKWIEVPDCFCFHLWNAWEENEDEVVVIGSCMTPPDSIFNESDAA  466

Query  769   LKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAK  590
             L+  L       E+R N+KTG +S+++L+   ++  +VN N  GRK RYVY  +     K
Sbjct  467   LRSVLS------EIRLNLKTGKSSRRQLAPMNLEAGQVNRNKLGRKARYVYLAIAEPWPK  520

Query  589   VKGIVKFDLHAE-PETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYL  413
             V GI K DL AE PE           V G  +   G +G E  FVPR ++    EDDGY+
Sbjct  521   VSGIAKVDLEAESPE----------RVVGKIEYKKGCYGGEPFFVPRTSNPEAPEDDGYV  570

Query  412   ILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             + F+H+E T +S + ++DAK+ + EPVA V+LP+RVPYGFH  F+T ++L  Q
Sbjct  571   LTFMHNEETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFITSQELDQQ  623



>dbj|BAF31899.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31917.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31919.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31920.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31921.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31930.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31933.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31937.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31943.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score =   409 bits (1050),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 226/533 (42%), Positives = 317/533 (59%), Gaps = 30/533 (6%)
 Frame = -3

Query  1816  TPQSGIAAKAIDWLEWAIVKVMHD------SSKPLHYLSGNFAPAPEETPPCKDLPVSGH  1655
              P   +AA A+D +E + +  +        ++ P   ++GNF+P PE +P   +L V G 
Sbjct  109   NPVQRLAAAALDAVEKSFIMALEKKFPLPKTADPEIQIAGNFSPVPE-SPVQHELEVVGQ  167

Query  1654  LPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEF  1475
             +P+CL G +VR G NP F P+AG+H+FDGDGM+H +R+K G A+Y SRF +T RL +EE 
Sbjct  168   IPQCLEGVYVRNGANPLFEPLAGHHFFDGDGMVHTVRLKQGIASYCSRFTRTYRLVEEEK  227

Query  1474  FGRAKFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEG  1298
              GRA + K IG+L G  G+  + L   R    ++D S G G AN  LIY +G+LLA+ E 
Sbjct  228   LGRAFYPKAIGELHGHSGIARLMLYYARSMFGLVDRSKGMGVANAGLIYFNGRLLAMSED  287

Query  1297  DKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRV  1121
             D PYA++V EDGDL TLG  D+D +L  A  AHPK+DP T E+F   Y   K P++ Y +
Sbjct  288   DLPYAVRVTEDGDLATLGRFDFDGQLQSAMIAHPKIDPETKELFALSYNVIKKPYLKYFM  347

Query  1120  ISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKK  941
              S DG     V I++    MMHDFAIT+ Y +  D  L F+ +EMV        +D  K 
Sbjct  348   FSPDGRKGPDVTISVKEPTMMHDFAITDKYVVVPDQQLVFKLQEMVAGGSPVI-YDKEKV  406

Query  940   ARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG-DEVVMISCRIQNPD--LDMASGT  770
              RFG+LP+Y  +E  +KW E+P+CF FH  NAWEE  DEVV+I   +  PD   + +   
Sbjct  407   PRFGILPKYDSDESRMKWIEVPDCFCFHLWNAWEENEDEVVVIGSCMTPPDSIFNESDAA  466

Query  769   LKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAK  590
             L+  L       E+R N+KTG +S+++L+   ++  +VN N  GRK RYVY  +     K
Sbjct  467   LRSVLS------EIRLNLKTGKSSRRQLAPMNLEAGQVNRNKLGRKARYVYLAIAEPWPK  520

Query  589   VKGIVKFDLHAE-PETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYL  413
             V GI K DL AE PE           V G  +   G +G E  FVPR ++    EDDGY+
Sbjct  521   VSGIAKVDLEAESPE----------RVVGKIEYKKGCYGGEPFFVPRTSNPEAPEDDGYV  570

Query  412   ILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             + F+H+E T +S + ++DAK+ + EPVA V+LP+RVPYGFH  F+T ++L  Q
Sbjct  571   LTFMHNEETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFITSQELDQQ  623



>dbj|BAF31906.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31913.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31918.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31931.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score =   409 bits (1050),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 225/533 (42%), Positives = 317/533 (59%), Gaps = 30/533 (6%)
 Frame = -3

Query  1816  TPQSGIAAKAIDWLEWAIVKVMHD------SSKPLHYLSGNFAPAPEETPPCKDLPVSGH  1655
              P   +AA A+D +E + +  +        ++ P   ++GNF+P PE +P   +L V G 
Sbjct  109   NPVQRLAAAALDAMEKSFIMALEKKFPLPKTADPEIQIAGNFSPVPE-SPVQHELEVVGQ  167

Query  1654  LPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEF  1475
             +P+CL G +VR G NP F P+AG+H+FDGDGM+H +R+K G A+Y SRF +T RL +EE 
Sbjct  168   IPQCLEGVYVRNGANPLFEPLAGHHFFDGDGMVHAVRLKQGIASYCSRFTRTYRLVEEEK  227

Query  1474  FGRAKFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEG  1298
              GRA + K IG+L G  G+  + L   R    ++D S G G AN  LIY +G+LLA+ E 
Sbjct  228   LGRAFYPKAIGELHGHSGIARLMLYYARSMFGLVDRSKGMGVANAGLIYFNGRLLAMSED  287

Query  1297  DKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRV  1121
             D PYA++V EDGDL TLG  D+D +L  A  AHPK+DP T E+F   Y   K P++ Y +
Sbjct  288   DLPYAVRVTEDGDLATLGRFDFDGQLQSAMIAHPKIDPETKELFALSYNVIKKPYLKYFM  347

Query  1120  ISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKK  941
              S DG     V I++    MMHDFAIT+ Y +  D  L F+ +EMV        +D  K 
Sbjct  348   FSPDGRKGPDVTISVKEPTMMHDFAITDKYVVVPDQQLVFKLQEMVAGGSPVI-YDKEKV  406

Query  940   ARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG-DEVVMISCRIQNPD--LDMASGT  770
              RFG+LP+Y  +E  +KW E+P+CF FH  NAWEE  DEVV+I   +  PD   + +   
Sbjct  407   PRFGILPKYDSDESRMKWIEVPDCFCFHLWNAWEENEDEVVVIGSCMTPPDSIFNESDAA  466

Query  769   LKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAK  590
             L+  L       E+R N+KTG +S+++L+   ++  +VN N  GRK +YVY  +     K
Sbjct  467   LRSVLS------EIRLNLKTGKSSRRQLAPMNLEAGQVNRNKLGRKAQYVYLAIAEPWPK  520

Query  589   VKGIVKFDLHAE-PETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYL  413
             V GI K DL AE PE           V G  +   G +G E  FVPR ++    EDDGY+
Sbjct  521   VSGIAKVDLEAESPE----------RVVGKIEYKKGCYGGEPFFVPRTSNPEAPEDDGYV  570

Query  412   ILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQ  254
             + F+H+E T +S + ++DAK+ + EPVA V+LP+RVPYGFH  F+T ++L  Q
Sbjct  571   LTFMHNEETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFITSQELDQQ  623



>ref|WP_012409393.1| carotenoid oxygenase [Nostoc punctiforme]
 ref|YP_001866345.1| carotenoid oxygenase [Nostoc punctiforme PCC 73102]
 gb|ACC81402.1| Carotenoid oxygenase [Nostoc punctiforme PCC 73102]
Length=460

 Score =   401 bits (1030),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 218/491 (44%), Positives = 306/491 (62%), Gaps = 44/491 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL  NFAP  EE    K LPV G LP  L+G FVR GPNP++ P+  YHWFDGDGM+HG+
Sbjct  9     YLDRNFAPIREEITTDK-LPVIGELPLDLSGMFVRNGPNPQWTPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             +I +G ATY +R+V+TS  K+E   G A +          GLL         +   +DN 
Sbjct  68    QISNGVATYRNRYVQTSGWKKEREAGEALWS---------GLL---------EPPRMDNP  109

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             +G    TANTAL++H G++LAL+E  KP+AIK+ E   L+T+G   Y+ +L  AFTAHPK
Sbjct  110   HGPRKNTANTALVWHAGQMLALNESGKPHAIKLPE---LETIGEYSYNGKLISAFTAHPK  166

Query  1192  VDPVTGEMFTFGYAQ-KAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             VDPVTGEM  FGY+    P++ Y V+S  G +   VPI +   VMMHDFAITENY IFMD
Sbjct  167   VDPVTGEMIFFGYSVFTPPYLQYSVVSAQGELLRTVPIDLSIGVMMHDFAITENYTIFMD  226

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             LPL F   E   + +    F+  + +RFG++PR+  N   I+WFE P+C++FHT NA+E+
Sbjct  227   LPLTFS-AERSQRGEPVMMFERDRPSRFGIVPRHGDNSN-IRWFESPSCYVFHTLNAYED  284

Query  835   GDEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRV  656
             GDEVV+I+CR+ +  + ++  +  D    +  LY  RFN+ TG   ++ L +   +FPR+
Sbjct  285   GDEVVLIACRMSSTTVLISDDSQPDPEGNIPRLYRWRFNLSTGTVREEMLDDVTSEFPRI  344

Query  655   NENYTGRKQRYVYATMLSD--LAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGR  482
             NEN  GR+ RY Y   +++  +   +GI+K+D      +GK++             G GR
Sbjct  345   NENLLGRQTRYGYTNKIANSPVPLFEGIIKYDF----SSGKSQTH---------KFGQGR  391

Query  481   FGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVP  302
             +GSEA+F PR  +    EDDG+L+ FVHDEN+  S + V++A+ ++AEPVA V +P RVP
Sbjct  392   YGSEAVFAPRPGAIA--EDDGWLVTFVHDENSNTSELVVVNAQDVTAEPVARVIIPQRVP  449

Query  301   YGFHAFFVTEE  269
             YGFH  +V +E
Sbjct  450   YGFHGTWVAQE  460



>ref|WP_015118911.1| lignostilbene-alpha,beta-dioxygenase-like protein [Rivularia 
sp. PCC 7116]
 ref|YP_007055889.1| lignostilbene-alpha,beta-dioxygenase-like protein [Rivularia 
sp. PCC 7116]
 gb|AFY55342.1| lignostilbene-alpha,beta-dioxygenase-like enzyme [Rivularia sp. 
PCC 7116]
Length=465

 Score =   400 bits (1029),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 213/493 (43%), Positives = 307/493 (62%), Gaps = 43/493 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             +L GN+AP  EE     +L + G LP  L+G FVR GPNP++ P   YHWFDGDGM+HG+
Sbjct  9     FLDGNYAPVREEIT-ADNLKIIGELPPDLSGMFVRNGPNPQWQPKGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKA+Y +R+V+T   + E   G+A                V+  ML  +   +DN 
Sbjct  68    RISNGKASYRNRYVRTKGWQIEHQEGKA----------------VWSGML--EPPQMDNP  109

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             +G     ANTAL++H G+ LAL EG  P+AIK+ E   L T G  +Y+ +L  AFTAHPK
Sbjct  110   HGAYKNAANTALVWHAGEFLALWEGGAPHAIKLPE---LDTFGEYNYNGKLQSAFTAHPK  166

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             VD VTGEM  FGY+   PF+ Y V+S +G +   VPI +P  VMMHDFAIT NY IFMDL
Sbjct  167   VDAVTGEMMFFGYSFAPPFLHYSVVSSEGELLKTVPIELPMGVMMHDFAITANYTIFMDL  226

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             PL F P  M  K +    F+  + +RFG++PR+  N   I+WFE P+CF++HT NA+EEG
Sbjct  227   PLTFNPMRM-QKGEPGMMFEKDRASRFGIVPRHGDNN-DIRWFEAPSCFVWHTLNAYEEG  284

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             DEV++++CR+ + ++   +   +D+   +  LY  RFN+K G   ++KL +   +FPRVN
Sbjct  285   DEVILVACRMNSTNVLATNNEQRDAEGDIPYLYRWRFNLKDGSVREEKLDDVPSEFPRVN  344

Query  652   ENYTGRKQRYVYATMLSD--LAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
             +N+ G+  RY YA  +    +   +G++K++L+    +GK++           + G GR+
Sbjct  345   DNFLGQPTRYGYAGKMGQGAMPSFEGVIKYELN----SGKSQTH---------EFGKGRY  391

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPY  299
             G EA+F PR    G  ED+G++I FV+D N   S + V+DA+ M++EPVA V +P RVPY
Sbjct  392   GGEAVFAPRAGGNG--EDEGWVITFVYDSNEDISELVVVDAQDMTSEPVARVLIPQRVPY  449

Query  298   GFHAFFVTEEQLQ  260
             GFH  +V+EE++Q
Sbjct  450   GFHGDWVSEEKMQ  462



>ref|WP_015153132.1| Carotenoid oxygenase [Chroococcidiopsis thermalis]
 ref|YP_007090452.1| Carotenoid oxygenase [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY86583.1| Carotenoid oxygenase [Chroococcidiopsis thermalis PCC 7203]
Length=464

 Score =   399 bits (1026),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 214/490 (44%), Positives = 303/490 (62%), Gaps = 41/490 (8%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             +L GNFAP  EE      L V G LP  L+G FVR GPNP++ P+  YHWFDGDGM+HG+
Sbjct  10    FLEGNFAPVREEMT-SDPLKVIGELPTDLSGMFVRNGPNPQWTPIGQYHWFDGDGMLHGV  68

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
              I+ GKA+Y +R+V+T   + E+  G+A +          GLL           +   N 
Sbjct  69    EIRHGKASYRNRYVRTRGFEIEQKAGKAVWS---------GLLE--------PPQPDSNG  111

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
             Y N  ANTAL++H G+LLA  EG  P+AI+V +   L+T G   Y+ +L  AFTAHPKVD
Sbjct  112   YKNA-ANTALVWHAGQLLATWEGGAPHAIEVSQ---LETKGEYTYNGKLASAFTAHPKVD  167

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
             PVTGEM  FGY+   PFV Y ++S  G +   +PI +P  VMMHDFAIT NY IFMDLP+
Sbjct  168   PVTGEMMFFGYSFAPPFVKYSIVSPQGELLRTIPIELPMGVMMHDFAITANYTIFMDLPM  227

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
              F P  M  + +L   F+  + +RFG+LPR+  ++  I+WFE P+C++FHT NA+EEGDE
Sbjct  228   TFNPARM-QRGELGLMFERDRPSRFGILPRHGDSD-SIRWFESPSCYVFHTLNAYEEGDE  285

Query  826   VVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNEN  647
             VV+I+CR+ + ++ +     +D    +  L+  RFN+ TG A ++ L + + +FPRVNEN
Sbjct  286   VVLIACRMSSTNVFVTQPEQRDPDGDIPRLHSWRFNLSTGTAREEMLDDVSGEFPRVNEN  345

Query  646   YTGRKQRYVYATML--SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGS  473
               GRK RY Y   +  + L    G +K+DL A                  ++ G GR+G 
Sbjct  346   LLGRKTRYGYVGKMAPTPLPLFDGSIKYDLQA-------------GYSQTYEYGKGRYGG  392

Query  472   EAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGF  293
             EA+FVPR  +T   EDDG+L+ +V+D + G S + V++A+ +S++PVA V +P RVPYGF
Sbjct  393   EAVFVPRPDAT--IEDDGWLVTYVYDTDAGTSELLVLNARDLSSDPVARVLIPQRVPYGF  450

Query  292   HAFFVTEEQL  263
             H  +V+++QL
Sbjct  451   HGTWVSQQQL  460



>ref|WP_029637704.1| 9-cis-epoxycarotenoid dioxygenase [[Scytonema hofmanni] UTEX 
B 1581]
Length=462

 Score =   399 bits (1026),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 220/491 (45%), Positives = 298/491 (61%), Gaps = 40/491 (8%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  +E      L V G LP  L+G FVR GPNP++ P+  YHWFDGDGM+HG+
Sbjct  9     YLDGNFAPVHKEIT-TDTLKVIGELPPDLSGMFVRNGPNPQWTPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKATY +R+V+T   + E   G+A                V+  +L    K   ++
Sbjct  68    RISNGKATYRNRYVQTKGWQIEHEAGKA----------------VWSGILEPSQKDNPHN  111

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
             +   TANTAL +H G+ LAL EG  P+ IKV    +L T+G   Y+ +L  AFTAHPKVD
Sbjct  112   FYKNTANTALTWHAGQFLALWEGGAPHVIKV---PNLDTIGEYTYNGKLKSAFTAHPKVD  168

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
             PVTGEM  FGY+   P++ Y V+S  G +   VPI +P +VMMHDFAITENY IFMDLPL
Sbjct  169   PVTGEMMFFGYSFALPYLQYSVVSASGELLRTVPIDLPMAVMMHDFAITENYTIFMDLPL  228

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
              F  + M  K +    F++ + +RFG++PR+  N   I+WFE P CF+ HT NA+EEG+E
Sbjct  229   TFSIERM-QKGEPTMMFESDRPSRFGIIPRHGDNS-NIRWFESPACFVSHTLNAYEEGNE  286

Query  826   VVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNEN  647
             VV+I CR+ +  L  +  +     D +  LY  RFN+ TG   ++ L +   +FPRVNEN
Sbjct  287   VVLIGCRVTSTMLGFSQASHDPEAD-IPRLYRWRFNLTTGTVREEMLDDVPGEFPRVNEN  345

Query  646   YTGRKQRYVYATML--SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGS  473
               GRK RY Y   +  S +    G++K+D      +GK++           + G GR+G 
Sbjct  346   LLGRKMRYGYTAKITPSTVLLFDGLIKYDF----SSGKSETH---------EFGQGRYGG  392

Query  472   EAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGF  293
             EAIFVP   +T   ED+G+LI FVHD     S + V++A+ ++AEPVA V +P RVPYGF
Sbjct  393   EAIFVPSPNAT--SEDEGWLITFVHDTTEDTSELVVVNAQDVNAEPVARVLIPQRVPYGF  450

Query  292   HAFFVTEEQLQ  260
             HA +V+EEQL 
Sbjct  451   HAAWVSEEQLS  461



>dbj|BAF32138.1| putative 9-cis-epoxycarotenoid dioxygenase [Taxodium distichum]
Length=631

 Score =   405 bits (1040),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 225/532 (42%), Positives = 318/532 (60%), Gaps = 26/532 (5%)
 Frame = -3

Query  1816  TPQSGIAAKAIDWLEWAIVKVMHD------SSKPLHYLSGNFAPAPEETPPCKDLPVSGH  1655
              P   +AA A+D +E + +  +        ++ P   ++GNFAP PE +P   +L V G 
Sbjct  115   NPVQRLAAAALDVVEKSFIAGLEKKFPLPKTADPEIQIAGNFAPVPE-SPVQHELQVVGE  173

Query  1654  LPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEF  1475
             +P+CL G +VR G NP F P+AG+H+FDGDGM+H +R+K G A+Y SRF +T RL +EE 
Sbjct  174   IPQCLEGVYVRNGANPLFEPLAGHHFFDGDGMVHAVRLKQGIASYCSRFTRTHRLVEEEK  233

Query  1474  FGRAKFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEG  1298
              GRA + K IG+L G  G+  + L   R    ++D S G G AN  LIY +G+LLA+ E 
Sbjct  234   LGRAFYPKAIGELHGHSGIARLMLFYARSMFGLVDPSKGMGVANAGLIYFNGRLLAMSED  293

Query  1297  DKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRV  1121
             D PYA++V EDGDL T+G  D+D +L  A  AHPK+DP T E+F   Y   K P++ Y +
Sbjct  294   DLPYAVRVTEDGDLSTVGRFDFDGQLQSAMIAHPKIDPETKELFALSYDVIKKPYLKYFM  353

Query  1120  ISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKK  941
                DG     V I++    MMHDFAIT+ Y +  D  + F+ +EMVT       +D  K 
Sbjct  354   FYPDGRKGPDVRISVKEPTMMHDFAITDKYVVVPDQQVVFKLQEMVTGGSPVI-YDKEKV  412

Query  940   ARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG-DEVVMISCRIQNPDLDMASGTLK  764
              RFG+LP+Y  +E  +KW E+P+CF FH  NAWEE  DEVV+I   +  PD    S   +
Sbjct  413   PRFGILPKYDSDESRMKWVEVPDCFCFHLWNAWEENEDEVVVIGSCMTPPD----SIFNE  468

Query  763   DSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVK  584
                D  + L E+R N+KTG +S+++++   ++  +VN N  GRK RY Y  +     KV 
Sbjct  469   SDEDLRSVLSEIRLNLKTGKSSRREIAPMNLEAGQVNRNKLGRKARYAYLAIAEPWPKVS  528

Query  583   GIVKFDLHAE-PETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLIL  407
             GI K DL AE PE+          V G  +   G +G E  FVPR ++    EDDGY++ 
Sbjct  529   GIAKVDLEAESPES----------VVGKIEYKQGCYGGEPFFVPRTSNPEAPEDDGYVLT  578

Query  406   FVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             F+H+E T +S + ++DAK+ + EPVA V+LP+RVPYGFH  F+T ++L  QA
Sbjct  579   FMHNEETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFITSQELDQQA  630



>ref|WP_017319350.1| Retinal pigment epithelial membrane protein [Mastigocladopsis 
repens]
Length=466

 Score =   399 bits (1025),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 221/492 (45%), Positives = 300/492 (61%), Gaps = 40/492 (8%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             +L  NFAP  EE      L V G LP  L+G FVR GPNP++ P+  YHWFDGDGM+HG+
Sbjct  9     FLDSNFAPVHEEIT-ANTLQVIGELPPDLSGMFVRNGPNPQWTPIGKYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKATY +R+V+T   K E   G+A                ++  ++    K     
Sbjct  68    RISNGKATYRNRYVRTKAWKIENEAGKA----------------LWTGLVEPPQKDKPQK  111

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
                  ANTAL++H G+LLAL EG  P+AI+V E   L+T+G   Y+ +L  A TAHPKVD
Sbjct  112   PSKNPANTALVWHAGQLLALWEGGAPHAIRVPE---LKTIGEYTYNGKLVSAVTAHPKVD  168

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
              VTGEM  FGY    P++ Y V+S +G +    PI IP +VMMHDFAITE+Y IFMDLPL
Sbjct  169   SVTGEMMFFGYGFTRPYLQYSVVSPEGELLQTEPIDIPTAVMMHDFAITEDYTIFMDLPL  228

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
              F  + M   K L   F+  K +RFG++PRY  N   I+WFE P C+IFHT NA+EEGDE
Sbjct  229   TFSKERMKGGKPLMM-FERDKPSRFGIVPRYGNNS-NIRWFESPACYIFHTLNAYEEGDE  286

Query  826   VVMISCRIQNPD-LDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNE  650
             VV+++CR+ +   L +   T  DS   +  L+  RFN+KTG  S++ L + A +FPRVNE
Sbjct  287   VVLVACRMNSTTVLSVPQDTHTDSQADIPRLHRWRFNLKTGKVSEEMLDDVASEFPRVNE  346

Query  649   NYTGRKQRYVYATML--SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFG  476
             N  G+K RY Y   +  S L    G++K+DL     +GK++           + G G +G
Sbjct  347   NLLGQKTRYGYTGRMAKSSLPLFDGLIKYDL----SSGKSETH---------EFGQGCYG  393

Query  475   SEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYG  296
              EA+FVPR ++T   EDDG+L+ FV+D     S + V++A+ ++ EPVA V +P RVPYG
Sbjct  394   GEAVFVPRPSATA--EDDGWLVTFVYDTGEETSELVVVNAQDITGEPVARVLIPQRVPYG  451

Query  295   FHAFFVTEEQLQ  260
             FH  +V+EEQL+
Sbjct  452   FHGAWVSEEQLK  463



>ref|WP_017745616.1| Retinal pigment epithelial membrane protein [Scytonema hofmanni]
Length=467

 Score =   399 bits (1025),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 219/498 (44%), Positives = 301/498 (60%), Gaps = 43/498 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             +LSGNFAP  +E      L V G LP  L+G FVR G NP++ P+  YHWFDGDGM+HG+
Sbjct  9     FLSGNFAPVQKEMT-SSTLQVKGKLPSHLSGMFVRNGSNPQWEPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI DGKATY +R+V+T   K E    +A                ++   L  + K  DN 
Sbjct  68    RISDGKATYRNRYVRTKGWKVEHEANKA----------------IWSGFLEPRSK--DNP  109

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
              G    TANTAL++H G+LLAL EG  P+AI+V     L+T+    Y   L   FTAHPK
Sbjct  110   GGMYKNTANTALVWHAGQLLALWEGGAPHAIQVPH---LETISEYTYKGNLASPFTAHPK  166

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             VDP TGEM  FGY+  +P++ Y V+S +G +   VPI IP  VMMHDFAIT+NY IFMDL
Sbjct  167   VDPKTGEMMFFGYSFASPYLQYGVVSAEGELLRTVPIDIPQPVMMHDFAITQNYTIFMDL  226

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             P+ F  + + T K     F+  + +RFG++PR+  N L I+WFE P C++FHT NA+E G
Sbjct  227   PMTFNQERVQTGKPWIM-FEPDRPSRFGIVPRFGDN-LNIRWFESPACYVFHTLNAYENG  284

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             DEVV+I+CR+ +  +  +     D    +  L++ RFN+  G  +++ L + A DFPR+N
Sbjct  285   DEVVLIACRMSSSTVLGSDDAQSDPEANIPRLHQWRFNLSIGNVNEEMLDDVASDFPRIN  344

Query  652   ENYTGRKQRYVYATML--SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
             EN  G+K RY Y   +  S L   +GI+K+DL+    TGK++             G GR+
Sbjct  345   ENLLGQKTRYGYTGKIAQSSLPLFEGIIKYDLN----TGKSETH---------KFGQGRY  391

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPY  299
             G EA+FVPR  +T   EDDG+L+ FV+D N   S + V++A+ ++ EP+A V LP RVPY
Sbjct  392   GGEAVFVPRPGATA--EDDGWLVTFVYDTNEDASELVVVNAQDITGEPIARVLLPQRVPY  449

Query  298   GFHAFFVTEEQLQTQAEI  245
             GFH  +++EEQL     I
Sbjct  450   GFHGAWISEEQLSGSLRI  467



>ref|WP_006099204.1| Retinal pigment epithelial membrane protein [Coleofasciculus 
chthonoplastes]
 gb|EDX77091.1| Retinal pigment epithelial membrane protein [Coleofasciculus 
chthonoplastes PCC 7420]
Length=466

 Score =   399 bits (1024),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 212/498 (43%), Positives = 306/498 (61%), Gaps = 59/498 (12%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             +L+GNFAP   E     +L V G LP+ L+G FVR GPNP+F   A YHWF GDGM+HG+
Sbjct  14    FLAGNFAPVQNEIT-ADELTVIGELPQDLSGMFVRNGPNPQFPSSANYHWFGGDGMLHGV  72

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             +I +GKA+Y  R+V+T R ++E   G+A       L+G    LT  +Q       + +  
Sbjct  73    QISNGKASYRDRYVRTPRFEKERETGQA-------LEG----LTASVQNQESSPSLTNR-  120

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
                  ANT++I+H    LAL+EG +PY IK+ E   L+T+G   ++ +L  AFTAHPK+D
Sbjct  121   -----ANTSVIWHSDHFLALYEGGEPYGIKLPE---LETIGAYTFEDKLASAFTAHPKID  172

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
             PVTGEM  FGY+ + PF+TY ++S+ G +   VPI +P  VMMHDFAIT++Y +FMDLP+
Sbjct  173   PVTGEMMFFGYSPQPPFLTYSIVSRSGELVRTVPIDLPEPVMMHDFAITQDYTLFMDLPM  232

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
              F P     + +   +F + + +RFG++PR+  N   I+WFE P+C+ FH  NA++EGDE
Sbjct  233   VFNP-----QGEAMLQFKSERPSRFGIVPRHGDNS-SIRWFESPSCYAFHILNAYQEGDE  286

Query  826   VVMISCRIQNPDLDMASGTLKDSLDFVN--------ELYEMRFNMKTGLASQKKLSESAV  671
             VV+I+CR       M+S T+  +L+            LY+ RFN++TG   +K L E   
Sbjct  287   VVLIACR-------MSSCTVLTALEETGGDPDSNKPRLYQWRFNLRTGNVQEKPLDERIS  339

Query  670   DFPRVNENYTGRKQRYVYATMLSD--LAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFD  497
             DFPR+NE   GRK RY Y   ++D  +   +G++K+D     + G ++         +  
Sbjct  340   DFPRINEQLMGRKMRYGYTAKMADNPMPLFEGVIKYDF----DNGTSQ---------VHH  386

Query  496   LGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVEL  317
              G GR+G EA+F PR    G  EDDG+LI FVHD N+  S + V++A+ ++AEPVA V +
Sbjct  387   YGAGRYGGEAVFAPR--PNGTAEDDGWLITFVHDHNSDTSELVVLNAQDLTAEPVARVLM  444

Query  316   PNRVPYGFHAFFVTEEQL  263
             P RVPYGFH  +V++EQL
Sbjct  445   PQRVPYGFHGTWVSQEQL  462



>ref|WP_015183663.1| lignostilbene-alpha,beta-dioxygenase-like protein [Microcoleus 
sp. PCC 7113]
 ref|YP_007122928.1| lignostilbene-alpha,beta-dioxygenase-like protein [Microcoleus 
sp. PCC 7113]
 gb|AFZ19522.1| lignostilbene-alpha,beta-dioxygenase-like enzyme [Microcoleus 
sp. PCC 7113]
Length=466

 Score =   398 bits (1022),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 219/493 (44%), Positives = 297/493 (60%), Gaps = 44/493 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             +L GNFAP   E      L V G LP  L+G FVR GPNP+F P+  YHWFDGDGM+HG+
Sbjct  9     FLEGNFAPIRNEIT-ADSLTVIGQLPLDLSGMFVRNGPNPQFPPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             +I +G+A Y +R+++T     E   G A +          GLL         +   LDN 
Sbjct  68    QIGNGQAQYHNRYIQTQGFNIERDAGHAIWT---------GLL---------EPPQLDNP  109

Query  1366  YGNG--TANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             +G G  TANTALI+H G+  AL EG  P+AIK+     L T G+  YD++L   FTAHPK
Sbjct  110   HGPGKNTANTALIWHAGQFFALWEGGAPHAIKL---PSLDTAGVYTYDQKLVSPFTAHPK  166

Query  1192  VDPVTGEMFTFGYAQKAP-FVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             VDPVTGEM  FGY+  AP ++ Y ++S  G +   VPI +P  VMMHDFAITE+Y IFMD
Sbjct  167   VDPVTGEMMFFGYSPAAPPYLHYGIVSASGELLRTVPIDLPIGVMMHDFAITEHYTIFMD  226

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             LPL F P+ M  + +    F+  + +RFG++PRY  N   I+WFE P C++FHT NA+EE
Sbjct  227   LPLTFSPQRM-QRGEPVLMFEPERPSRFGIVPRYGDNHN-IRWFESPACYVFHTLNAYEE  284

Query  835   GDEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRV  656
             GDEVV+++CR+    + ++  T  ++      LY  RFN+ TG   ++ L E   DFPRV
Sbjct  285   GDEVVLVACRMSRTSVLVSEPTPGETDGDQARLYRWRFNLNTGTVQEEALDERPSDFPRV  344

Query  655   NENYTGRKQRYVYATMLS--DLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGR  482
             NE Y GR  RY Y   L+   +    G++K+DL      G ++           + G GR
Sbjct  345   NEQYLGRATRYGYTARLAPDPIPLFDGLIKYDL----SNGSSQTH---------EFGAGR  391

Query  481   FGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVP  302
             +G EA+FVPR  +T   EDDG+L+ FV+D     S + V++A+ +SAEPVA V +P RVP
Sbjct  392   YGGEAVFVPRSGATA--EDDGWLVTFVYDTGEETSELVVVNAQDVSAEPVARVLMPQRVP  449

Query  301   YGFHAFFVTEEQL  263
             YGFH  +V++EQL
Sbjct  450   YGFHGAWVSQEQL  462



>ref|WP_010995279.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_485149.1| hypothetical protein all1106 [Nostoc sp. PCC 7120]
 dbj|BAB73063.1| all1106 [Nostoc sp. PCC 7120]
Length=475

 Score =   397 bits (1020),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 214/491 (44%), Positives = 304/491 (62%), Gaps = 42/491 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  EE      L V G LP  L+G FVR GPNP++ P+  YHWFDGDGM+HG+
Sbjct  21    YLEGNFAPVHEEIT-TDTLKVIGELPPELSGMFVRNGPNPQWTPIGQYHWFDGDGMLHGV  79

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKATY +R+V+T R + E   G+A             + T  ++  + +L      
Sbjct  80    RISNGKATYRNRYVRTQRWQIEHEAGQA-------------IWTGLMEPPQTELP-----  121

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
                 T NTALI+H G+LLAL EG  PYAI+V    DL ++G   Y+ +L  AFTAHPKVD
Sbjct  122   -SRNTGNTALIWHAGQLLALWEGGAPYAIQV---PDLASIGEYTYNNQLSSAFTAHPKVD  177

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
             PVTGEM  FGY+   P++ Y V+S  G +   VPI +P  VMMHDFAIT NY IFMDLPL
Sbjct  178   PVTGEMMFFGYSFAPPYLHYSVVSATGELVRTVPIDLPMGVMMHDFAITANYTIFMDLPL  237

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
              F  + M  + +    F++ + +RFG+LPR+  N   I+WFE P+C++FHT NA+E+ DE
Sbjct  238   TFSVERM-QRGEPMLMFESDRPSRFGILPRHGDNS-QIRWFEAPSCYVFHTLNAYEDKDE  295

Query  826   VVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNEN  647
             VV+ +C +++  +  +  +  D    +  L+  RF++KTG   ++ L + A +FPR+NEN
Sbjct  296   VVLFACPMRSTTVLASPDSQTDPEADIPRLHRWRFHLKTGKVHEEMLDDVASEFPRINEN  355

Query  646   YTGRKQRYVYATMLS--DLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGS  473
             + G+  +Y Y + L+   +   +G++K+DL       K++          ++ G GR+GS
Sbjct  356   FLGQPTQYGYTSRLAKGSIPLFEGLIKYDL----SNAKSQ---------NYEYGQGRYGS  402

Query  472   EAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGF  293
             EA+FVPR  +T   EDDG+LI +V+D     S + VI+A+ +++EP+A V LP RVPYGF
Sbjct  403   EAVFVPRPGAT--VEDDGWLITYVYDTGEESSELVVINAQDINSEPIARVLLPQRVPYGF  460

Query  292   HAFFVTEEQLQ  260
             H  +VTEEQL 
Sbjct  461   HGIWVTEEQLN  471



>ref|WP_038074680.1| 9-cis-epoxycarotenoid dioxygenase [Tolypothrix bouteillei]
 gb|KIE10616.1| 9-cis-epoxycarotenoid dioxygenase [Tolypothrix bouteillei VB521301]
Length=465

 Score =   397 bits (1019),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 213/493 (43%), Positives = 302/493 (61%), Gaps = 39/493 (8%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             +LSGNFAP   E      L V G LP  L+G FVR GPNP++ P+  YHWFDGDGM+HG+
Sbjct  9     FLSGNFAPVQTEIT-SSTLQVKGKLPSHLSGIFVRNGPNPQWEPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKATY +R+++T + + E   G+A                    +L  + K    +
Sbjct  68    RISNGKATYCNRYIRTKKWQVEHEAGKANSSG----------------LLEKRAKNSSEN  111

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
                 TANTALI+H+G+LLAL EG  P+AI+V    +L+T+    Y  +L  +FTAHPKVD
Sbjct  112   LFRNTANTALIWHNGQLLALWEGGAPHAIQV---PNLETIEEYTYKGKLVSSFTAHPKVD  168

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
             P TGEM  FGY+  +P++ Y V+S +G +   VPI IP  VMMHDFAIT++Y IFMDLP+
Sbjct  169   PKTGEMMFFGYSFISPYLQYGVVSAEGELLRTVPIDIPQPVMMHDFAITQHYTIFMDLPM  228

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
              F  + M  K +    F+  K +RFG++PR+  N   I+WFE P C++FHT NA+E+GDE
Sbjct  229   TFSGERM-QKGKPWIMFEPDKPSRFGIVPRFGDNR-NIRWFESPACYVFHTLNAYEDGDE  286

Query  826   VVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNEN  647
             VV+I+CR+ +  +  +  +  D    +  LY+ RFN+ TG  S++ L + A +FPR+NEN
Sbjct  287   VVLIACRMSSSTVLGSDDSQFDPEADIPRLYKWRFNLSTGTVSEEMLDDVASEFPRINEN  346

Query  646   YTGRKQRYVYA--TMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGS  473
               G K RY Y   T    L   +GI+K+D +    TGK++             G GR+G 
Sbjct  347   LLGHKTRYGYTNKTAKDPLPLFEGIIKYDFN----TGKSETH---------KFGEGRYGG  393

Query  472   EAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGF  293
             EA+F PR  +T   EDDG+L+ FV+D +   S + ++DA+ M+ +PVA V LP RVPYGF
Sbjct  394   EAVFAPRPGATA--EDDGWLVTFVYDTSEDASELVIVDAQDMTGKPVARVLLPQRVPYGF  451

Query  292   HAFFVTEEQLQTQ  254
             H  +++EE L++ 
Sbjct  452   HGAWISEEHLRSS  464



>ref|WP_009783644.1| Retinal pigment epithelial membrane protein [Lyngbya sp. PCC 
8106]
 gb|EAW37771.1| Retinal pigment epithelial membrane protein [Lyngbya sp. PCC 
8106]
Length=461

 Score =   395 bits (1016),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 212/492 (43%), Positives = 299/492 (61%), Gaps = 43/492 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  +E      L V G LP  L+G F+R GPNP+F+P+  YHWFDGDGMIHG+
Sbjct  10    YLDGNFAPIRDEIT-ADHLKVIGELPAGLSGMFLRNGPNPQFSPIGQYHWFDGDGMIHGV  68

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI+DGKA+Y +R+V+T   K E   G A                ++  +     + L   
Sbjct  69    RIQDGKASYHNRYVRTLGYKTEHEAGTA----------------LWSGIFEPPQQNLPGG  112

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
                 T NTAL++H G+  AL EG +P+A+K+ E   + T+G  ++D +L  AFTAHPKVD
Sbjct  113   PSKNTGNTALVWHAGQFFALWEGGEPHALKLPE---IDTVGAYNFDGKLTCAFTAHPKVD  169

Query  1186  PVTGEMFTFGYAQKA-PFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLP  1010
             P TGEM   GY+  A P++ Y  +  DG +    PI +P  VMMHDFAIT+NY IFMDLP
Sbjct  170   PQTGEMRFIGYSMSAPPYLQYGWVGADGKLKQINPIELPVGVMMHDFAITKNYTIFMDLP  229

Query  1009  LYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGD  830
             L F+  E + + + A  F+    +RFG++PR+  N   +KWFE P+CFIFHT NA+E+G 
Sbjct  230   LTFR-MERIQRGEPAIMFEKETPSRFGIVPRHGDNS-QVKWFECPSCFIFHTLNAYEQGS  287

Query  829   EVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNE  650
             EVV+I+CR+++  +   +G   D    +  LY  RFNM+TG   Q++L ++  +FP +N 
Sbjct  288   EVVLIACRMESTSVLAMTG---DDASDIPLLYCWRFNMETGEVKQEQLDDAPSEFPTINN  344

Query  649   NYTGRKQRYVYA--TMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFG  476
              +TG + RY Y   T  ++L K++GI K+D                N   +   G GRFG
Sbjct  345   QFTGLQTRYGYTGKTAKTELPKLEGINKYDFEK-------------NTCQVHRFGEGRFG  391

Query  475   SEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYG  296
              EA+FVPR  S    ED+G+L+ FVHDEN  +S + ++DA+ +++EPVA V +P RVPYG
Sbjct  392   GEAVFVPR--SDDSAEDEGWLVTFVHDENQNQSELVIVDAQNITSEPVARVIIPQRVPYG  449

Query  295   FHAFFVTEEQLQ  260
             FH  +V++EQ Q
Sbjct  450   FHGTWVSQEQFQ  461



>ref|WP_039743349.1| 9-cis-epoxycarotenoid dioxygenase [Hassallia byssoidea]
 gb|KIF35765.1| 9-cis-epoxycarotenoid dioxygenase [Hassallia byssoidea VB512170]
Length=458

 Score =   395 bits (1016),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 219/492 (45%), Positives = 296/492 (60%), Gaps = 48/492 (10%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  +E      L V G LP  L+G FVR GPNP++ P+  YHWFDGDGM+HG+
Sbjct  9     YLDGNFAPVHKEIT-SDTLKVIGELPPDLSGMFVRNGPNPQWTPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKATY +R+V+T   K E   G A +  I +                      DN 
Sbjct  68    RISNGKATYRNRYVQTKGWKIEHEAGIALWSGILEPSK-------------------DNP  108

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             +G    TANTALI+H G+ LAL EG  P+ IKV    +L T+G   Y+ +L  AFTAHPK
Sbjct  109   HGYYKNTANTALIWHAGQFLALWEGGAPHLIKV---PNLDTIGEYTYNGKLKSAFTAHPK  165

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             VDPVTGEM  FGY+   P++ Y V+S  G +   VPI +P  VMMHDFAITENY IFMDL
Sbjct  166   VDPVTGEMMFFGYSFAPPYLQYSVVSSSGELLRTVPIDLPMGVMMHDFAITENYTIFMDL  225

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             PL F P+    + +    F+  + +RFG++PR+  N   I+WFE P C++FHT NA+EEG
Sbjct  226   PLTFSPQR-AQRGEPGMMFERDRPSRFGIVPRHGDNS-NIRWFESPACYVFHTLNAYEEG  283

Query  832   DEVVMISCRIQNPDLDMA-SGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRV  656
             DEVV+I+CR+ +  +  +   T  D    +  L++ RFN+ TG   ++ L +   +FPRV
Sbjct  284   DEVVLIACRMNSTTIFASPQDTHADPQANITRLHQWRFNLSTGAVREEMLDDVPTEFPRV  343

Query  655   NENYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFG  476
             NEN+ GR+ RY YA     L   +G++K+DL      GK++           + G GR+G
Sbjct  344   NENFLGRQTRYGYA-----LKMEEGLIKYDL----SNGKSQTH---------NFGKGRYG  385

Query  475   SEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYG  296
              EA+F P    T   ED+G+LI FVHD     S + V++A+ ++AEPVA V +P RVP+G
Sbjct  386   GEAVFAPSPNPT--SEDEGWLITFVHDTTEDTSELVVVNAQDVNAEPVARVLIPQRVPHG  443

Query  295   FHAFFVTEEQLQ  260
             FH  +V+EEQL 
Sbjct  444   FHGAWVSEEQLS  455



>ref|WP_011320410.1| retinal pigment epithelial membrane protein [Anabaena variabilis]
 ref|YP_324210.1| retinal pigment epithelial membrane protein [Anabaena variabilis 
ATCC 29413]
 gb|ABA23315.1| Retinal pigment epithelial membrane protein [Anabaena variabilis 
ATCC 29413]
Length=463

 Score =   394 bits (1012),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 211/491 (43%), Positives = 304/491 (62%), Gaps = 42/491 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  EE      L V G LP  L+G F+R GPNP++ P+  YHWFDGDGM+HG+
Sbjct  9     YLEGNFAPVHEEIT-TDTLKVIGELPPDLSGMFIRNGPNPQWTPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKATY +R+V+T R + E   G+A             + T +++  + +L      
Sbjct  68    RISNGKATYRNRYVRTQRWQIEHEAGQA-------------IWTGFMEPPQPELP-----  109

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
                 T NTALI+H G+LLAL EG  P+AI+V    DL+T+G   Y+ +L  AFTAHPKVD
Sbjct  110   -SRNTGNTALIWHAGQLLALWEGGAPHAIQV---PDLETIGEYTYNNQLSSAFTAHPKVD  165

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
             P TGEM  FGY+   P++ Y V+S  G +   +PI +P  VMMHDFAIT NY IFMDLPL
Sbjct  166   PATGEMMFFGYSFAPPYLHYSVVSATGELVRTIPIDLPMGVMMHDFAITANYTIFMDLPL  225

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
              F  + M  + +    F++ + +RFG+LPR+  N   I+WF  P+C++FHT NA+E+ DE
Sbjct  226   TFSVERM-QRGEPMLMFESDRPSRFGILPRHGDNS-HIRWFTAPSCYVFHTLNAYEDKDE  283

Query  826   VVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNEN  647
             VV+ +C +++  +  +  +  D    +  L+  RFN+KTG   ++ L + A +FPR+NEN
Sbjct  284   VVLFACPMRSTTVLASPDSQTDPEADIPRLHRWRFNLKTGKVHEEMLDDVASEFPRINEN  343

Query  646   YTGRKQRYVYATMLS--DLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGS  473
             + G+  +Y Y + L+   +   +G++K+DL       K++          ++ G GR+GS
Sbjct  344   FLGQATKYGYTSRLAKGSIPLFEGLIKYDL----SNAKSQ---------NYEYGQGRYGS  390

Query  472   EAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGF  293
             EA+FVPR  +T   EDDG+LI +V+D     S + VI+A+ +++EP+A V LP RVPYGF
Sbjct  391   EAVFVPRPGAT--VEDDGWLITYVYDIGEDSSELVVINAQDINSEPIARVLLPQRVPYGF  448

Query  292   HAFFVTEEQLQ  260
             H  +VTEEQL 
Sbjct  449   HGIWVTEEQLN  459



>ref|WP_026098555.1| 9-cis-epoxycarotenoid dioxygenase [Oscillatoria sp. PCC 10802]
Length=466

 Score =   394 bits (1011),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 213/493 (43%), Positives = 304/493 (62%), Gaps = 44/493 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP   E     +L V G LP  L+G F+R GPNP+F P+  YHWFDGDGM+HG+
Sbjct  9     YLEGNFAPVRSEIA-ADELKVIGELPSDLSGMFLRNGPNPQFPPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKA+Y++R+V+T   + E   G+A +          GLL         +   +DN 
Sbjct  68    RISNGKASYLNRYVRTRGFEIERDAGQAVWT---------GLL---------EPPQMDNP  109

Query  1366  YGNG--TANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             +G G   ANTAL++H G+LLAL E   P+AIK+     L+T+G   Y  +LG  FTAHPK
Sbjct  110   HGPGKNVANTALVWHAGQLLALWEAGAPHAIKLP---SLETVGEQTYGGKLGSPFTAHPK  166

Query  1192  VDPVTGEMFTFGYAQ-KAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             VDP +GEM  FGY+  + P++ Y V+S +G +   VP+ +P  VMMHDFAITENY IFMD
Sbjct  167   VDPGSGEMMFFGYSPVEPPYLQYGVVSAEGELLQTVPVELPVGVMMHDFAITENYTIFMD  226

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             LPL F   E + + +  + F+  + +RFG++PRY  N   I+WFE   CF++HT NAWEE
Sbjct  227   LPLTFS-GERIRRGEPVFMFERERASRFGIVPRYGDNSN-IRWFESRACFVWHTLNAWEE  284

Query  835   GDEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRV  656
             GDEVV+++CR+ + ++ ++    +D    +  L++ RFN+ TG   ++ L++   +FPR+
Sbjct  285   GDEVVLVACRMNSTNVFVSEEKDRDPEGDIPRLHQWRFNLNTGTVREEMLNDVPAEFPRM  344

Query  655   NENYTGRKQRYVYATMLSDLAK--VKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGR  482
             NE + GRK RY YA   + +      G++K+DL     TGK++           + G GR
Sbjct  345   NEQFVGRKTRYGYAGKQAPMPVPLFDGLIKYDLI----TGKSETH---------EFGAGR  391

Query  481   FGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVP  302
             +G EA+FVPR  +    EDDG+L+ FV+D     S + V+ A  ++  PVA V +P RVP
Sbjct  392   YGGEAVFVPRRGA--VSEDDGWLLTFVYDGGEDTSELVVVSAGDLTGVPVARVIIPQRVP  449

Query  301   YGFHAFFVTEEQL  263
             YGFHA +V+EEQL
Sbjct  450   YGFHAGWVSEEQL  462



>ref|WP_016874878.1| Retinal pigment epithelial membrane protein [Chlorogloeopsis 
fritschii]
Length=468

 Score =   393 bits (1009),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 220/493 (45%), Positives = 300/493 (61%), Gaps = 44/493 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  +E      L V G LP  L+G FVR GPNP++ P+  YHWFDGDGM+HG+
Sbjct  9     YLDGNFAPVHKEII-TDTLKVIGELPPDLSGMFVRNGPNPQWTPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKATY +R+V+T   K E   G+A +          GLL         +    DN 
Sbjct  68    RISNGKATYRNRYVRTRGWKIEHEAGKAIWT---------GLL---------EPPQRDNP  109

Query  1366  YGN--GTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             YG+   TANTAL++H G+ LAL EG  P+AIK+ E   L+T+G   Y+ +L   FTAHPK
Sbjct  110   YGSYKNTANTALVWHAGQFLALWEGGAPHAIKLPE---LETIGEYTYNGKLISPFTAHPK  166

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             VDPVTGEM  FGY+   P++ Y V+S  G +   VPI +P  VMMHDFAITENY IFMDL
Sbjct  167   VDPVTGEMMFFGYSFSPPYLQYGVVSASGELLHTVPIDLPIPVMMHDFAITENYTIFMDL  226

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             PL F  + M   + L   F+  + +RFG+LPR+  N   I+WFE P C+IFHT NA+EE 
Sbjct  227   PLTFSTERMQRGEPLM-MFERDRPSRFGILPRHGDNS-NIRWFESPACYIFHTLNAYEEK  284

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             DEVV+I+CR+ +  +  +  +  D    +  L+   FN+ +G   ++ L +   +FPRVN
Sbjct  285   DEVVLIACRMNSTTVLASEDSQGDPQGNIPHLHRWHFNLSSGTVREEMLDDIPSEFPRVN  344

Query  652   ENYTGRKQRYVYATML--SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
             EN  GRK  Y Y   +  S +    GIVK++LH     G ++           + G GR+
Sbjct  345   ENLLGRKTEYGYTGKMVKSSMPLFDGIVKYNLH----NGTSQTH---------EFGQGRY  391

Query  478   GSEAIFVPREASTGCE---EDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNR  308
             G EA+FVPR +S+  E   ED+G+LI FV+D  +  S + V+DA+ ++++PVA V +P R
Sbjct  392   GGEAVFVPRVSSSQGETKGEDNGWLITFVYDNASESSELVVVDAQDVTSQPVARVLIPQR  451

Query  307   VPYGFHAFFVTEE  269
             VPYGFH  +V+EE
Sbjct  452   VPYGFHGAWVSEE  464



>ref|WP_015213082.1| 9-cis-epoxycarotenoid dioxygenase [Anabaena cylindrica]
 ref|YP_007155339.1| 9-cis-epoxycarotenoid dioxygenase [Anabaena cylindrica PCC 7122]
 gb|AFZ56429.1| 9-cis-epoxycarotenoid dioxygenase [Anabaena cylindrica PCC 7122]
Length=463

 Score =   392 bits (1008),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 211/492 (43%), Positives = 307/492 (62%), Gaps = 45/492 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  +E      L V G LP  L+G FVR GPNP+ +P+  YHWFDGDGM+HG+
Sbjct  9     YLDGNFAPVRQEIT-TDSLKVIGELPSDLSGMFVRNGPNPQHSPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             +I +GKA Y +R+V+T     E   G+A +       GM            ++   +DN 
Sbjct  68    QISNGKAIYCNRYVRTRGWNIEHEAGKAVW------SGM------------LEPPQMDNP  109

Query  1366  YGNG--TANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             +G G  TANTAL++H G+ LA+ EG  P+ I++ +   L+T+    Y+ +L   FTAHPK
Sbjct  110   HGPGKNTANTALVWHAGQFLAVWEGGAPHNIQLPK---LETISEYTYNNQLVSPFTAHPK  166

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             VDPVTGEM  FGY+   P++ Y V+S +G +   VPI IP  VMMHDFAITENY IFMDL
Sbjct  167   VDPVTGEMMFFGYSFAPPYLQYGVVSAEGELLRTVPIDIPMGVMMHDFAITENYTIFMDL  226

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             PL F P+ M  K +    F++ + +RFG++PR+  N   I+WFE P+CFIFHT NA+E+G
Sbjct  227   PLTFSPERM-QKGEPMMMFESDRPSRFGIVPRHGNNS-NIRWFETPSCFIFHTLNAYEDG  284

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             +EVV+I+CR+ + ++ ++  T  D    +  L+  RFN+ TG   ++ L +   +FPR+N
Sbjct  285   EEVVLIACRMSSTNVLISQPT--DPTADIPLLHSWRFNLSTGTVKEEMLDDVPAEFPRIN  342

Query  652   ENYTGRKQRYVYATMLSD--LAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
             EN  GRK +Y YA  +++  +   +G++K++       GK++           + G GR+
Sbjct  343   ENALGRKTQYGYAGKMANSPVPLFEGVIKYNF----SNGKSQTH---------EFGQGRY  389

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPY  299
             G EA+F PR  +T   EDDG+LI FV+D+N+  S + VI+A+ +++EPV  V +P RVPY
Sbjct  390   GGEAVFAPRLHAT--TEDDGWLITFVYDQNSETSELIVINAQDVTSEPVTRVIIPQRVPY  447

Query  298   GFHAFFVTEEQL  263
             GFH  +++E QL
Sbjct  448   GFHGAWISESQL  459



>ref|WP_019489052.1| Retinal pigment epithelial membrane protein [Calothrix sp. PCC 
7103]
Length=457

 Score =   389 bits (1000),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 216/488 (44%), Positives = 291/488 (60%), Gaps = 41/488 (8%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP   E      L V G +P  L+G F+R GPNP++AP+  YHWFDGDGM+HG+
Sbjct  9     YLEGNFAPVNNEMT-SDALKVIGTIPSELSGMFLRNGPNPQWAPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
              I +GKATY +R+++T     E   G+A                V+  +L        + 
Sbjct  68    YINNGKATYRNRYIRTRGWNIENQVGKA----------------VWSGLLEPPQPNNPHG  111

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
              G  TANTAL++H G+LLA  EG  P+AIK  E   L T+G   Y+ +L  AFTAHPKVD
Sbjct  112   PGKNTANTALVWHAGQLLATWEGGAPHAIKTPE---LDTIGEYTYNGKLTSAFTAHPKVD  168

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
             PVTGEM  FGY    P+V Y V+S  G +   VPI IP +VMMHDFAITENY IFMDLPL
Sbjct  169   PVTGEMMFFGYGFAPPYVKYSVVSATGELLRTVPIDIPMAVMMHDFAITENYTIFMDLPL  228

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
              F  + M  +      F++ K +RFG+LPR+  N   I+WFE   C+IFHT NA+EEGDE
Sbjct  229   TFSMQRM-QQGVPGLMFESNKPSRFGILPRHGNNS-NIRWFETSACYIFHTLNAYEEGDE  286

Query  826   VVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNEN  647
             VV+I+CR+ +  + M+  T  D    +  LY  +FN+KTG   ++ L ++  +FPR+NEN
Sbjct  287   VVLIACRMSHTSVLMSEKTEGDGD--IPRLYRWKFNLKTGSVREEMLDDTPSEFPRINEN  344

Query  646   YTGRKQRYVYA--TMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGS  473
               GRK RY Y+     + +    G++K+D   E  T +           I + G GR+G 
Sbjct  345   LQGRKNRYGYSGKAAPTSVPLFDGVIKYDF--EKSTSQ-----------IHNFGKGRYGG  391

Query  472   EAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGF  293
             EA+F P   +T   ED G+LI FV D NT  S + +I+A+ +++EPVA V +P RVPYGF
Sbjct  392   EAVFAPSNKNT--YEDQGWLITFVFDSNTETSELVIINAQDITSEPVARVLIPQRVPYGF  449

Query  292   HAFFVTEE  269
             H  +V+ E
Sbjct  450   HGAWVSFE  457



>ref|WP_028084014.1| 9-cis-epoxycarotenoid dioxygenase [Dolichospermum circinale]
Length=460

 Score =   389 bits (1000),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 210/488 (43%), Positives = 302/488 (62%), Gaps = 43/488 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP   E      L V G LP  L+G FVR GPNP+  P+  YHWFDGDGM+HG+
Sbjct  11    YLQGNFAPINTEIT-TDTLEVIGELPPELSGMFVRNGPNPQRNPIGQYHWFDGDGMLHGV  69

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             ++  GKATY +R+V+T     E   G+A                ++  ML  +   LDN 
Sbjct  70    QLNHGKATYKNRYVRTKGWNIEHEAGKA----------------IWTGML--EPPQLDNP  111

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             YG    TANTAL++H+ +LLAL EG  P+ I +    DL+T+G   Y+ +L  AFTAHPK
Sbjct  112   YGISKNTANTALVWHNKQLLALWEGGAPHHISI---PDLETIGEYTYNDKLVSAFTAHPK  168

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             VDPVTGEM  FGY  + P++ Y ++S  G +   VPI IP +VMMHDFAITENY+IFMDL
Sbjct  169   VDPVTGEMMFFGYGFRPPYLQYGIVSAQGELLSTVPIEIPMAVMMHDFAITENYSIFMDL  228

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             PL F  + M  + +    F+  + +RFG++PR+  N   I+WFE P+C++FHT NA+E G
Sbjct  229   PLTFSVERM-QRGEPMLMFEKHRPSRFGIIPRHGDNS-NIRWFECPSCYVFHTLNAYEVG  286

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             DEVV+I+CR+ + ++ +++ T  D L+ +  L+  RFN+ TG  ++++L +   +FPRVN
Sbjct  287   DEVVLIACRMNSTNVLISNDTYSDPLEGIPFLHRWRFNLSTGTVTEEQLDDVPGEFPRVN  346

Query  652   ENYTGRKQRYVY--ATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
             EN  GRK +Y Y    + S     +G++K+D     E G ++           + G  R 
Sbjct  347   ENLLGRKTQYGYLGKIVYSQNPLFEGVIKYDF----EKGTSQTH---------EFGKNRH  393

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPY  299
             G E++FVP   +T   ED G+L+ FV+DEN+ +S + VI+A+ M++EP+A V +P RVPY
Sbjct  394   GGESVFVPSHNAT--TEDAGWLVTFVYDENSQRSELLVINAEDMTSEPIARVIIPQRVPY  451

Query  298   GFHAFFVT  275
             GFH  +++
Sbjct  452   GFHGTWIS  459



>ref|WP_028090825.1| 9-cis-epoxycarotenoid dioxygenase [Dolichospermum circinale]
Length=460

 Score =   389 bits (999),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 210/488 (43%), Positives = 302/488 (62%), Gaps = 43/488 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP   E      L V G LP  L+G FVR GPNP+  P+  YHWFDGDGM+HG+
Sbjct  11    YLQGNFAPINTEIT-TDTLEVIGELPPDLSGMFVRNGPNPQQNPIGQYHWFDGDGMLHGV  69

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             ++  GKATY +R+V+T     E   G+A                ++  ML  +   LDN 
Sbjct  70    QLHHGKATYKNRYVRTKGWNIEHEAGKA----------------IWTGML--EPPQLDNP  111

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             YG    TANTAL++H+ +LLAL EG  P+ I +    DL+T+G   Y+ +L  AFTAHPK
Sbjct  112   YGISKNTANTALVWHNKQLLALWEGGAPHHISI---PDLETIGEYTYNDKLVSAFTAHPK  168

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             VDPVTGEM  FGY  + P++ Y ++S  G +   VPI IP +VMMHDFAITENY+IFMDL
Sbjct  169   VDPVTGEMMFFGYGFRPPYLQYGIVSSQGELLSTVPIEIPMAVMMHDFAITENYSIFMDL  228

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             PL F   E + + +    F+  + +RFG++PR+  N   I+WFE P+C++FHT NA+E G
Sbjct  229   PLTFS-MERMQRGEPMLMFEKHRPSRFGIIPRHGDNS-NIRWFECPSCYVFHTLNAYEVG  286

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             DEVV+I+CR+ + ++ +++ T  D L+ +  L+  RFN+ TG  ++++L +   +FPRVN
Sbjct  287   DEVVLIACRMNSTNVLISNDTYSDPLEGIPFLHRWRFNLSTGTVTEEQLDDVPGEFPRVN  346

Query  652   ENYTGRKQRYVY--ATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
             EN  GRK +Y Y    + S     +G++K+D     E G ++           + G  R 
Sbjct  347   ENLLGRKTQYGYLGKIVYSQNPLFEGVIKYDF----EKGTSQTH---------EFGKNRH  393

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPY  299
             G E++FVP   +T   ED G+L+ FV+DEN+ +S + VI+A+ M++EP+A V +P RVPY
Sbjct  394   GGESVFVPSPNAT--TEDAGWLVTFVYDENSQRSELIVINAEDMTSEPIARVIIPQRVPY  451

Query  298   GFHAFFVT  275
             GFH  +++
Sbjct  452   GFHGTWIS  459



>ref|WP_016952678.1| Retinal pigment epithelial membrane protein [Anabaena sp. PCC 
7108]
Length=464

 Score =   389 bits (999),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 213/493 (43%), Positives = 302/493 (61%), Gaps = 46/493 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  +E      L V G LP  L+G FVR GPNP+ +P+  YHWFDGDGM+HG+
Sbjct  9     YLDGNFAPVGQELT-TDTLQVIGELPADLSGMFVRNGPNPQHSPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             +I +GKATY +R+V+T   K E   G+A +          G +    Q         DN 
Sbjct  68    QITNGKATYRNRYVRTRGWKIENEAGKAVWS---------GFMEPPQQ---------DNP  109

Query  1366  YGNG--TANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             +G G  TANTAL++H G+ L L EG  P+ I++ E   L+T+G   Y+ +L   FTAHPK
Sbjct  110   HGIGKNTANTALVWHAGQFLTLWEGGAPHNIQLPE---LETIGEYTYNNQLVSPFTAHPK  166

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             VDPVTGEM  FGY+   P++ Y V+S  G +   VPI IP  VMMHDFAITENY+IFMDL
Sbjct  167   VDPVTGEMMFFGYSFAPPYLQYGVVSAQGELLRTVPIDIPTGVMMHDFAITENYSIFMDL  226

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             PL F P+ M  + +    F++ + +RFG++PR+  N   I+WFE   C++FHT NA+EEG
Sbjct  227   PLTFSPERM-QRGEPMMMFESDRPSRFGIVPRHGDNS-NIRWFESSPCYVFHTLNAYEEG  284

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             DEVV+I+CR+ +  + M       + D +   +  RFN+ TG   +++L +   +FPRVN
Sbjct  285   DEVVLIACRMSSTSILMGDSQTDPTAD-IPFFHCWRFNLSTGAVKEEQLDDIPAEFPRVN  343

Query  652   ENYTGRKQRYVYATML--SDLAKVKGIVKFDL-HAEPETGKTKLEVGGNVEGIFDLGPGR  482
             EN  GRK +Y YA  +  S +   +G++K++  H + +T               + G GR
Sbjct  344   ENLLGRKTKYGYAGKMAKSPVPLFEGVIKYNFSHGQSQT--------------HEFGKGR  389

Query  481   FGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVP  302
             +G E++F P   +T   EDDG+LI FV+D+N+  S + VI+A+ +++EPVA V +P RVP
Sbjct  390   YGGESVFAPSLNAT--TEDDGWLITFVYDQNSETSELVVINAQDITSEPVARVIIPQRVP  447

Query  301   YGFHAFFVTEEQL  263
             YGFH  +++E QL
Sbjct  448   YGFHGAWISEAQL  460



>ref|WP_015198082.1| 9-cis-epoxycarotenoid dioxygenase [Calothrix parietina]
 ref|YP_007137411.1| 9-cis-epoxycarotenoid dioxygenase [Calothrix sp. PCC 6303]
 gb|AFZ01439.1| 9-cis-epoxycarotenoid dioxygenase [Calothrix sp. PCC 6303]
Length=465

 Score =   388 bits (996),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 209/490 (43%), Positives = 295/490 (60%), Gaps = 39/490 (8%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  +E      L V G +P  L+G FVR GPNP++ P+  YHWFDGDGM+HG+
Sbjct  9     YLDGNFAPVDKEIT-TDTLKVIGEIPPDLSGMFVRNGPNPQWTPIGQYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +GKATY +R+V+T   K E   G                L V+  ML    +   + 
Sbjct  68    RISNGKATYRNRYVQTKGWKIEREAG----------------LAVWSGMLEPPQQNNPHG  111

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
             +    ANTALI+H G+ LAL EG  P+ I++    +L T+G   Y+ +L  AFTAHPKVD
Sbjct  112   FYKNAANTALIWHAGQFLALWEGGAPHHIQI---PNLDTIGEYTYNSQLKSAFTAHPKVD  168

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
             PVTGEM  FGY+   P++ Y V+S  G +   VPI +P  V+MHDFAITENY IFMDLPL
Sbjct  169   PVTGEMMFFGYSFAPPYLQYSVVSASGELLRTVPIDLPMGVIMHDFAITENYTIFMDLPL  228

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
                P+    K +    F+  + +RFG++PR+  N   I+WFE P C++FHT NA+EEGDE
Sbjct  229   TLSPQR-AQKGEPMMMFERDRSSRFGIVPRHGDNS-NIRWFESPACYVFHTLNAYEEGDE  286

Query  826   VVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNEN  647
             VV+I CR+ + ++     T  D    +  L++ RF++ TG   ++ L +   +FPRVNEN
Sbjct  287   VVLIGCRMSSTNVLSTKDTQSDPDGDIPRLHQWRFHLITGEVREQMLDDVPAEFPRVNEN  346

Query  646   YTGRKQRYVYATMLS--DLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGS  473
             + GR+ RY Y   ++   +    G++K+D     + GK++           + G GR+G 
Sbjct  347   FLGRQTRYGYVGKIAQGSMPLFDGLIKYDH----DNGKSQTH---------EFGQGRYGG  393

Query  472   EAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGF  293
             EA+FVP   +T   ED+G+LI FV+D     S + +++A+ ++AEPVA V +P RVPYGF
Sbjct  394   EAVFVPFPNAT--SEDEGWLITFVYDSKEDTSELVIVNAQDINAEPVARVLIPQRVPYGF  451

Query  292   HAFFVTEEQL  263
             H  +V+EEQL
Sbjct  452   HGAWVSEEQL  461



>ref|XP_002981140.1| hypothetical protein SELMODRAFT_113788 [Selaginella moellendorffii]
 gb|EFJ17841.1| hypothetical protein SELMODRAFT_113788 [Selaginella moellendorffii]
Length=655

 Score =   394 bits (1012),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 215/531 (40%), Positives = 308/531 (58%), Gaps = 24/531 (5%)
 Frame = -3

Query  1813  PQSGIAAKAIDWLEWAIVKVMH-----DSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLP  1649
             P   +AA A+DW+E  ++ ++       ++ P   L GNFAP PE       LPV+G LP
Sbjct  140   PAQKMAAAALDWIEQRVIPILEGDHLPSTANPAVQLEGNFAPVPECPASGTRLPVTGRLP  199

Query  1648  ECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFG  1469
             + L+G +VR G NP+F PVAG+H FDGDGM+H +R+  G ATY SRF +T+RL QEE  G
Sbjct  200   DGLDGLYVRNGANPRFKPVAGHHLFDGDGMLHAVRLSGGTATYCSRFTRTNRLCQEERLG  259

Query  1468  RAKFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDK  1292
             RA F K +G+L G  G   + L  LR    ++D   G G AN  +++ DGKLLA+ E D+
Sbjct  260   RAFFPKAVGELHGHGGAARLALYYLRSLAGLVDAGKGMGPANAGVVFFDGKLLAMSEDDQ  319

Query  1291  PYAIKVLEDGDLQTLGMLDYDKRL-GHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRVI  1118
             PYA+++  DGD+ T+G  D+  +L   +  AHPK DP TGE+F   Y   K P++ Y   
Sbjct  320   PYALRIEGDGDVSTIGRYDFHGQLKASSMIAHPKKDPRTGELFALSYDVVKKPYLRYFSF  379

Query  1117  SKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKA  938
             + DG     V I +P + MMHDFAIT+ + +  D  + FQ   M+  K     +D  KKA
Sbjct  380   AADGTKRPDVEIPLPGATMMHDFAITDRFVVIPDQQVVFQLLRMLLGKSPVV-YDPKKKA  438

Query  937   RFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG-DEVVMISCRIQNPDLDMASGTLKD  761
             RFGVLP+YA     +KW E+P+CF FH  NAWE   DEVV++   +  PD  + + +   
Sbjct  439   RFGVLPKYATTSDELKWVEVPDCFCFHVWNAWEASEDEVVVLGSCMTPPDC-VFNESPNG  497

Query  760   SLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKG  581
               +  + L E+R N+ TG +++  ++   ++   VN    GR+ RY+Y  +     K+ G
Sbjct  498   HEEMSSVLCEIRLNLTTGTSTRTPIAGLNLEAGTVNRRVLGRQCRYLYLAVADPWPKISG  557

Query  580   IVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFV  401
             I K DL  + E  + + E               FG E  FVPR +     EDDGY++ FV
Sbjct  558   IAKVDLSLKKEKAEVETE-------------NCFGGEPFFVPRTSDPDAAEDDGYVLTFV  604

Query  400   HDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             H+E+TG S + V+DA T + E +A V+LP RVPYGFH  FV+EE+L +Q++
Sbjct  605   HNESTGVSELLVLDAATDNLELLASVQLPARVPYGFHGTFVSEEELASQSD  655



>ref|WP_006197241.1| Retinal pigment epithelial membrane protein [Nodularia spumigena]
 gb|EAW44608.1| Retinal pigment epithelial membrane protein [Nodularia spumigena 
CCY9414]
 gb|AHJ28514.1| Lignostilbene-alpha,beta-dioxygenase [Nodularia spumigena CCY9414]
Length=472

 Score =   387 bits (994),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 216/500 (43%), Positives = 305/500 (61%), Gaps = 52/500 (10%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL+ NFAP  +E      L V G LP  L+G FVR GPNP+++P+  YHWFDGDGM+HG+
Sbjct  9     YLNHNFAPVRDEIT-TDTLKVIGELPANLSGMFVRNGPNPQWSPIGKYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI +G+ATY +R+V+T   K E+  G+A +          GLL         +   +DN 
Sbjct  68    RISNGQATYCNRYVRTKGWKIEQEAGKAVWS---------GLL---------EPPQMDNP  109

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             +G    TANTAL++H G++LAL+EG  P+AIK+    DLQT+G   Y+ +L  AFTAHPK
Sbjct  110   HGGYKNTANTALVWHAGQMLALNEGGAPHAIKL---PDLQTIGEYTYNNQLVSAFTAHPK  166

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             VDP  GEM  FGY+   P++ Y ++S  G +   VPI +P  VMMHDFAITENY IFMDL
Sbjct  167   VDPKNGEMMFFGYSFAPPYLQYSIVSAAGEIVKTVPIDLPMGVMMHDFAITENYTIFMDL  226

Query  1012  PLYFQPKEMVTKKQLAYKFDAT-------KKARFGVLPRYAKNELLIKWFELPNCFIFHT  854
             PL F P E   + + A  F++        + +RFG++PR+  N   I+WFE   C++FHT
Sbjct  227   PLTFSP-ERAQRGEPAMMFESDVYDGLRLRPSRFGIIPRHGDNS-NIRWFESSPCYVFHT  284

Query  853   ANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESA  674
              NA+E+ DE+V+++CR+ +  +  A  +  D    +  L+  RFN+ TG   ++ L + +
Sbjct  285   LNAYEDQDEIVLVACRMSSTSVLKADDSQTDPEADIPRLHRWRFNLSTGKVQEEMLDDVS  344

Query  673   VDFPRVNENYTGRKQRYVYATML--SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIF  500
              +FPR+NEN  G+  RY YA  +  S L    G++K+DL+     GK++           
Sbjct  345   AEFPRINENLLGQATRYGYAGRMDNSPLPLFDGLIKYDLN----NGKSQTHA--------  392

Query  499   DLGPGRFGSEAIFVPREASTGCE-EDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVV  323
                 G +G EA+F P   S G + EDDG+LI FVHDE   KS + V++A+ ++AEPVA V
Sbjct  393   -FKQGCYGGEAVFAP---SIGAKHEDDGWLITFVHDEALQKSEIVVLNAQDVTAEPVARV  448

Query  322   ELPNRVPYGFHAFFVTEEQL  263
              +P RVPYGFH  +V+EEQL
Sbjct  449   LIPQRVPYGFHGTWVSEEQL  468



>ref|WP_015079490.1| carotenoid oxygenase [Anabaena sp. 90]
 ref|YP_006996141.1| carotenoid oxygenase [Anabaena sp. 90]
 gb|AFW94328.1| carotenoid oxygenase [Anabaena sp. 90]
Length=459

 Score =   386 bits (992),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 207/488 (42%), Positives = 303/488 (62%), Gaps = 43/488 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL+GNFAP   E     +L V G +P  L+G FVR GPNP+++P+  YHWFDGDGM+HG+
Sbjct  11    YLAGNFAPINTEVS-TDNLEVIGEIPPELSGMFVRNGPNPQWSPIGQYHWFDGDGMLHGV  69

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             +I DGKATY +R+V+T     E   G+A +          GLL         +   +DN 
Sbjct  70    QINDGKATYHNRYVRTRGWNIEHEAGKAVWS---------GLL---------EPPQMDNP  111

Query  1366  YGNG--TANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             +G G  TANTAL++H+ +LLAL EG  P+ I      DL T+G   Y+ +L  AFTAHPK
Sbjct  112   HGPGKNTANTALVWHNQQLLALWEGGAPHHINT---ADLATIGEHTYNGKLISAFTAHPK  168

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             VDPVTGEM  FGY  + P++ Y V+S  G +   VPI IP +VMMHDFAITENY IFMDL
Sbjct  169   VDPVTGEMMFFGYGFRPPYLQYGVVSAQGELLRTVPIEIPTAVMMHDFAITENYTIFMDL  228

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             PL F  + M+  + +   F++ + +RFG++PR+  +   I+WFE P C++FHT NA+E G
Sbjct  229   PLTFSAERMMRGEPMM-MFESDRPSRFGIMPRHGDSS-NIRWFECPPCYVFHTLNAYEAG  286

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             DEV++I+CR+ + ++ ++  T  D    +  L+  RFN+ TG+ ++++L +   +FPRVN
Sbjct  287   DEVLLIACRMNSTNVLISQDTHSDPKGDIPFLHRWRFNLSTGVVTEEQLDDVPGEFPRVN  346

Query  652   ENYTGRKQRYVYATMLSDLAK--VKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
             E   GRK +Y Y   +++       G++K+D     E GK++           + G  R+
Sbjct  347   EKLLGRKTQYGYVGKMANNPNPLFDGLIKYDF----ENGKSQTH---------EFGKNRY  393

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPY  299
             G EA+F P   ST   ED G+L+ F++DEN+  S + VI+A+ +++EP+A V +P RVPY
Sbjct  394   GGEAVFAPDPNST--VEDKGWLVTFIYDENSQTSELVVINAQDITSEPIARVMIPQRVPY  451

Query  298   GFHAFFVT  275
             GFH  +++
Sbjct  452   GFHGIWIS  459



>ref|XP_002982621.1| hypothetical protein SELMODRAFT_116420 [Selaginella moellendorffii]
 gb|EFJ16374.1| hypothetical protein SELMODRAFT_116420 [Selaginella moellendorffii]
Length=655

 Score =   392 bits (1008),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 214/531 (40%), Positives = 308/531 (58%), Gaps = 24/531 (5%)
 Frame = -3

Query  1813  PQSGIAAKAIDWLEWAIVKVMH-----DSSKPLHYLSGNFAPAPEETPPCKDLPVSGHLP  1649
             P   +AA A+DW+E  ++ ++       ++ P   L GNFAP PE       LPV+G LP
Sbjct  140   PAQKMAAGALDWIEQRVIPILEGDHLPSTANPAVQLEGNFAPVPECPASGIRLPVTGRLP  199

Query  1648  ECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFG  1469
             + L+G +VR G NP+F PVAG+H FDGDGM+H +R+  G ATY SRF +T+RL QEE  G
Sbjct  200   DGLDGLYVRNGANPRFKPVAGHHLFDGDGMLHAVRLSGGTATYCSRFTRTNRLCQEERLG  259

Query  1468  RAKFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDK  1292
             RA F K +G+L G  G   + L  LR    ++D   G G AN  +++ DGKLLA+ E D+
Sbjct  260   RAFFPKAVGELHGHGGAARLALYYLRSLAGLVDAGKGMGPANAGVVFFDGKLLAMSEDDQ  319

Query  1291  PYAIKVLEDGDLQTLGMLDYDKRL-GHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRVI  1118
             PYA+++  DGD+ T+G  D+  +L   +  AHPK DP TGE+F   Y   K P++ Y   
Sbjct  320   PYALRIEGDGDVSTIGRYDFHGQLKASSMIAHPKKDPRTGELFALSYDVVKKPYLRYFSF  379

Query  1117  SKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKA  938
             + DG     V I +P + MMHDFAIT+ + +  D  + FQ   M+  K     +D  KKA
Sbjct  380   AADGTKRPDVEIPLPGATMMHDFAITDRFVVIPDQQVVFQLLRMLLGKSPVV-YDPKKKA  438

Query  937   RFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG-DEVVMISCRIQNPDLDMASGTLKD  761
             RFGVLP+YA     +KW E+P+CF FH  NAWE   DE+V++   +  PD  + + +   
Sbjct  439   RFGVLPKYATTSDELKWVEVPDCFCFHVWNAWEASEDEIVVLGSCMTPPDC-VFNESPNG  497

Query  760   SLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKG  581
               +  + L E+R N+ TG +++  ++   ++   VN    GR+ RY+Y  +     K+ G
Sbjct  498   HEEMSSVLCEIRLNLTTGTSTRTPIAGLNLEAGTVNRRVLGRQCRYLYLAVADPWPKISG  557

Query  580   IVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFV  401
             I K DL  + E  + + E               FG E  FVPR +     EDDGY++ FV
Sbjct  558   IAKVDLSLKKEKAEVETE-------------NCFGGEPFFVPRTSDPDAAEDDGYVLTFV  604

Query  400   HDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQAE  248
             H+E+TG S + V+DA T + E +A V+LP RVPYGFH  FV+EE+L +Q++
Sbjct  605   HNESTGVSELLVLDAATDNLELLASVQLPARVPYGFHGTFVSEEELASQSD  655



>ref|WP_039716095.1| 9-cis-epoxycarotenoid dioxygenase [Scytonema millei]
 gb|KIF18582.1| 9-cis-epoxycarotenoid dioxygenase [Scytonema millei VB511283]
Length=464

 Score =   386 bits (991),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 206/490 (42%), Positives = 294/490 (60%), Gaps = 41/490 (8%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             +L GNFAP  EE      L V G LP  L+G FVR GPNP++ P+  YHWFDGDGM+HG+
Sbjct  10    FLEGNFAPVREEIT-SDPLKVIGELPTDLSGMFVRNGPNPQWTPIGQYHWFDGDGMLHGV  68

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
              I+ GKA+Y +R+V+T   + E+  G+A +  I                  ++    D+ 
Sbjct  69    EIRHGKASYRNRYVRTRGFEIEQKAGKAVWGGI------------------LEPPQPDSD  110

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
                  ANTAL++H G+LLA  EG  P+AI+V +   L+T G   Y+ +L  AFTAHPKVD
Sbjct  111   GYKNAANTALVWHAGQLLATWEGGAPHAIEVPQ---LETKGESTYNGKLASAFTAHPKVD  167

Query  1186  PVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPL  1007
             PVTGEM  FGY+   PFV Y ++S  G +   +PI +P  VMMHDFAIT NY IFMDLP+
Sbjct  168   PVTGEMMFFGYSFAPPFVKYSIVSPQGELLRTIPIDLPMGVMMHDFAITANYTIFMDLPM  227

Query  1006  YFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGDE  827
              F P  M  + +    F+  + +RFG+LPR+  +   I+WFE P+C++FHT NA+EEGDE
Sbjct  228   TFNPARM-QRGEPGLMFERDRPSRFGILPRHGDSN-SIRWFESPSCYVFHTFNAYEEGDE  285

Query  826   VVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNEN  647
             VV+++CR+ +  +        D    +  L+  RFN+ TG   ++ L +  ++FPRVNEN
Sbjct  286   VVLVACRMSSTTIVTPQLKPTDPDSDIPRLHSWRFNLSTGTVREEMLDDVPIEFPRVNEN  345

Query  646   YTGRKQRYVYATML--SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGS  473
               GRK R+ YA  +  + L    G +K+DL A                  ++ G GR+G 
Sbjct  346   LLGRKTRFGYAGKIVPTPLPLFDGSIKYDLQA-------------GYAQTYEYGKGRYGG  392

Query  472   EAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGF  293
             E +FVPR  +T   EDDG+L+ FV+D +   S + V++A+ +S++PVA V +P RVPYGF
Sbjct  393   ETVFVPRPDAT--VEDDGWLVTFVYDTDADTSELLVLNAQDLSSDPVARVLIPQRVPYGF  450

Query  292   HAFFVTEEQL  263
             H  +V+++QL
Sbjct  451   HGTWVSQQQL  460



>ref|WP_008274084.1| Retinal pigment epithelial membrane protein [Cyanothece sp. CCY0110]
 gb|EAZ92937.1| Retinal pigment epithelial membrane protein [Cyanothece sp. CCY0110]
Length=459

 Score =   385 bits (990),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 212/490 (43%), Positives = 298/490 (61%), Gaps = 45/490 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YLSGNFAP   E     +L V+G +P+ L G F+R GPNP+F+P+  YHWFDGDGMIHG+
Sbjct  10    YLSGNFAPVSREIT-AHNLTVTGEIPKNLRGMFLRNGPNPQFSPIGEYHWFDGDGMIHGV  68

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
              I+DGK +Y +RFV+T     E+   +  +       GM            ++   +DN 
Sbjct  69    HIEDGKVSYRNRFVQTRGYCLEKEANKPLWT------GM------------LEPPQMDNP  110

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             YG    TANTAL+YH  +LLAL EG +P+A+ V E   L TLG  ++D +L   FTAHPK
Sbjct  111   YGPLKNTANTALVYHADRLLALWEGGEPHALMVPE---LDTLGSYNFDGKLTSPFTAHPK  167

Query  1192  VDPVTGEMFTFGYAQ-KAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             +DPVTGEM  FGY+  + P++ Y ++S  G +   VPI +P  VMMHDFAITENY IF+D
Sbjct  168   IDPVTGEMMFFGYSMIQPPYLQYGIVSSQGELLKTVPIDLPVGVMMHDFAITENYTIFLD  227

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             LP  F+P  M  K +   KF+    +RFG++PR   NE  I+WFE  +C+IFHT NA+E+
Sbjct  228   LPFTFRPDRM-QKGESPLKFENDTPSRFGIVPRQGNNE-DIRWFESNSCYIFHTLNAYEK  285

Query  835   GDEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRV  656
             GDE+V+I+CR+ N    +   T +     +  L+E  FN+KTG   ++KL +   +FPR+
Sbjct  286   GDEIVLIACRM-NATTVLGEATEETEESDIPHLHEWHFNLKTGEVKEQKLCDLPSEFPRI  344

Query  655   NENYTGRKQRYVYATMLSDLA--KVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGR  482
             NE YTGRK  Y Y+  ++D +  K  GI+K D            E GG    I   G  R
Sbjct  345   NEQYTGRKTCYGYSGKMADSSEPKFNGIIKHD-----------FEKGGF--DIHHFGRHR  391

Query  481   FGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVP  302
             +GSE IF P   +   +ED+G+L+ F+HDE +  S + +IDA+  +A P+A +++P RVP
Sbjct  392   YGSEPIFAPNPDAE--KEDEGWLLTFIHDEGSNTSELVIIDAQDFTASPIAKIQIPQRVP  449

Query  301   YGFHAFFVTE  272
             YGFH  ++ +
Sbjct  450   YGFHGMWLAQ  459



>ref|WP_036478419.1| 9-cis-epoxycarotenoid dioxygenase [Myxosarcina sp. GI1]
Length=475

 Score =   385 bits (988),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 215/505 (43%), Positives = 300/505 (59%), Gaps = 53/505 (10%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL  NFAP   E      L + G LP  L+G F+R GPNP+++P+  YHWFDGDGMIHG+
Sbjct  9     YLDDNFAPVQREIT-SDTLEIIGELPPQLSGMFLRNGPNPQYSPIGQYHWFDGDGMIHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             R+ +G+A Y +R+V+T   + E   G+A +          GLL         +   LDN 
Sbjct  68    RLHNGRANYCNRYVRTRGWQLEHEAGKAIWS---------GLL---------EPPQLDNP  109

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
              G    TANTAL++H G +LA  EG  P+AI V     L T+G   YD +L  +FTAHPK
Sbjct  110   DGPTKNTANTALVWHAGTMLATWEGGAPHAIDVPT---LDTIGKYTYDGKLSSSFTAHPK  166

Query  1192  VDPVTGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDL  1013
             +DP+TGEM  FGY+   P++ Y V+S  G +   VPI IP +VMMHDFAITE+Y IFMDL
Sbjct  167   IDPMTGEMMFFGYSFSPPYLQYSVVSSGGKLLRTVPIEIPMAVMMHDFAITEHYTIFMDL  226

Query  1012  PLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEG  833
             PL F  +E + + +    F+  K +RFG++PR++ N   I+WFE   C++FHT NA+EEG
Sbjct  227   PLTFN-RERMQRGEPPLMFENNKPSRFGIVPRHSDNS-DIRWFETSACYVFHTLNAYEEG  284

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             DEVV+I+CR+ + ++ +   T     D    L++ RFN+ TG  S+  L + A DFPRVN
Sbjct  285   DEVVLIACRMNSTNV-LTENTESALEDSTPRLHQWRFNLNTGTISETMLDDVAADFPRVN  343

Query  652   ENYTGRKQRYVYATMLS--DLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
             EN+ G   RY YA  ++   +    G++K+DL+    TGK++           + G  RF
Sbjct  344   ENFLGLATRYGYAGRMTGGSMPLFDGVIKYDLN----TGKSQTH---------EFGSERF  390

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHD---------ENTGKSAVNVIDAKTMSAEPVAV  326
             G EA+F P     G +EDDG+LI FV D          ++  S + +IDAK +++EPVA 
Sbjct  391   GGEAVFAPH--PDGKDEDDGWLITFVRDCAPRSGKANRHSETSELVIIDAKDVTSEPVAR  448

Query  325   VELPNRVPYGFHAFFVTEEQLQTQA  251
             V +P RVPYGFH  ++ E QL+T  
Sbjct  449   VLIPQRVPYGFHGAWIDEAQLETSC  473



>ref|WP_015227792.1| 9-cis-epoxycarotenoid dioxygenase [Halothece sp. PCC 7418]
 ref|YP_007170135.1| 9-cis-epoxycarotenoid dioxygenase [Halothece sp. PCC 7418]
 gb|AFZ45921.1| 9-cis-epoxycarotenoid dioxygenase [Halothece sp. PCC 7418]
Length=465

 Score =   383 bits (983),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 203/494 (41%), Positives = 301/494 (61%), Gaps = 43/494 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GN+AP  EET   ++L + G LP  ++G FVR GPNP+F P   YHWFDGDGM+HG+
Sbjct  9     YLEGNYAPIREETT-AENLKIIGELPVEISGMFVRNGPNPQFTPPGTYHWFDGDGMVHGI  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             R+  G+ATY +R+V+T   + E+  G+A                ++  +L    +  D +
Sbjct  68    RLHQGEATYRNRYVRTQGFETEQEAGQA----------------LWKGLLEPSDQNPDGT  111

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
               N  ANTAL++H G+LLAL EG  P+A++V    DL+T+G+  Y+ +L  +FTAHPKVD
Sbjct  112   VKN-VANTALVWHSGQLLALWEGGAPHALQV---PDLETIGIQTYNGKLSSSFTAHPKVD  167

Query  1186  PVTGEMFTFGYA-QKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLP  1010
             PVTGEM T+GY+  + PF+ Y ++S  G +   +PI +P  V+MHD AIT++Y IF+DLP
Sbjct  168   PVTGEMITYGYSLAEPPFLQYSLVSSAGELLWTIPIDLPRGVLMHDCAITQHYTIFLDLP  227

Query  1009  LYFQPKEMVTKKQLAYKFDATKKARFGVLPRYA-KNELLIKWFELPNCFIFHTANAWEEG  833
             L F   E + + + A  F+  + ARFG++PR+  KN   I+WFE P+C++FHT NA+EEG
Sbjct  228   LTFS-VERLQRGEPALMFERDQPARFGIMPRHGDKNS--IRWFEAPSCYVFHTLNAYEEG  284

Query  832   DEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             DEVV+I+CR+ + ++ +      D    +  L++ RFN+ TG   ++ L  +  +FP +N
Sbjct  285   DEVVLIACRMSSTNVLVNDSAFSDPEGDIPRLHQWRFNLTTGTVKEENLEPTPSEFPALN  344

Query  652   ENYTGRKQRYVYATML--SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
             + + G   RY Y   +  S+     G++K D   +             +      G GR+
Sbjct  345   DRWLGYPTRYGYTAQMANSETPLFSGVIKHDFQEK-------------ISEFHSFGEGRY  391

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPY  299
             G +  FVPR  ST  +EDDG+L+  VHD  T  S + VID K  +A+PVA V +P RVPY
Sbjct  392   GGDPSFVPRLGST--QEDDGWLLTLVHDHQTETSELLVIDGKNFTADPVARVIIPQRVPY  449

Query  298   GFHAFFVTEEQLQT  257
             GFH+ +VTE+QL++
Sbjct  450   GFHSAWVTEQQLKS  463



>ref|WP_007312440.1| Retinal pigment epithelial membrane protein [Crocosphaera watsonii]
 gb|EHJ10688.1| Retinal pigment epithelial membrane protein [Crocosphaera watsonii 
WH 0003]
 emb|CCQ59800.1| Lignostilbene-alpha,beta-dioxygenase and related enzymes [Crocosphaera 
watsonii WH 0401]
 emb|CCQ51723.1| Lignostilbene-alpha,beta-dioxygenase and related enzymes [Crocosphaera 
watsonii WH 8502]
 emb|CCQ59217.1| Lignostilbene-alpha,beta-dioxygenase and related enzymes [Crocosphaera 
watsonii WH 0005]
 emb|CCQ70591.1| Lignostilbene-alpha,beta-dioxygenase and related enzymes [Crocosphaera 
watsonii WH 0402]
Length=462

 Score =   382 bits (982),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 218/491 (44%), Positives = 298/491 (61%), Gaps = 47/491 (10%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YLSGNFAP  +ET    +L V G +P  L G F+R GPNP+F P+  YHWFDGDGMIHG+
Sbjct  10    YLSGNFAPVNQETTE-NNLTVIGEIPRNLRGMFLRNGPNPQFLPIGQYHWFDGDGMIHGV  68

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
              I++GKA+Y +RFV+T     E+   +  +          GLL         +   +DN 
Sbjct  69    HIENGKASYCNRFVQTRGYGLEKEANKPLWT---------GLL---------EPPQMDNP  110

Query  1366  YGNGT--ANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             YG     ANTAL+YH G+LLAL EG +P+A+ V E   L +LG  ++D +L   FTAHPK
Sbjct  111   YGTSKNPANTALVYHAGRLLALWEGGEPHALTVPE---LNSLGSYNFDNKLVSPFTAHPK  167

Query  1192  VDPVTGEMFTFGYA-QKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             VDPVTGEM  FGY+  + P++ Y +IS  G +   VPI IP  VMMHD AITENY IF+D
Sbjct  168   VDPVTGEMMFFGYSFAQPPYLQYGIISPQGELLKTVPIDIPVGVMMHDCAITENYTIFLD  227

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             LPL F+P+ M  K +   +F+    +RFG+ PR   NE  ++WFE  +C+IFHT NA+EE
Sbjct  228   LPLTFRPERMY-KGEPPLQFEHNTPSRFGITPRQGNNE-DVRWFESDSCYIFHTLNAYEE  285

Query  835   GDEVVMISCRIQNPD-LDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPR  659
             GDEVV+I+CR+     L  A+  +KDS   +  L++ RFN+ TG   ++ L +   +FPR
Sbjct  286   GDEVVLIACRMNATTVLGEANEDVKDSD--IPRLHQWRFNLTTGEVKEQPLCDLPSEFPR  343

Query  658   VNENYTGRKQRYVYATML--SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPG  485
             +NE YTGRK RY Y+  +  S   K  GI+K D               GN E I + G  
Sbjct  344   INEQYTGRKTRYGYSGKMAASSEPKFDGIIKHDFEK------------GNFE-IHNFGSH  390

Query  484   RFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRV  305
             R+G E IF P  ++   E+  G+L+ FV+DE +  S + +IDA+  +A PVA +++P RV
Sbjct  391   RYGGEPIFAPNPSAVTDEQ--GWLLTFVYDEASKVSELVIIDAQDFTASPVAKIQIPQRV  448

Query  304   PYGFHAFFVTE  272
             PYGFH  ++ E
Sbjct  449   PYGFHGMWLNE  459



>ref|XP_001784596.1| predicted protein [Physcomitrella patens]
 gb|EDQ50571.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   384 bits (985),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 204/522 (39%), Positives = 300/522 (57%), Gaps = 28/522 (5%)
 Frame = -3

Query  1801  IAAKAIDWLEWAIVKVMHDSSKPLH-------YLSGNFAPAPEETPPCKDLPVSGHLPEC  1643
             IA K I+ +E  +  +   + +PL         L GNF P  EE+P   +L V G+LPEC
Sbjct  26    IADKVIEAVEKNLENLHLGNREPLPSTVDPHVQLEGNFFPV-EESPAHHNLEVEGNLPEC  84

Query  1642  LNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYVSRFVKTSRLKQEEFFGRA  1463
             L G +VR GPNP+F P   +H FDGDGM+H +    G  +Y  R+ +T R  +EE  GRA
Sbjct  85    LEGVYVRNGPNPQFFPTGRHHLFDGDGMLHAVSFNGGSVSYACRYTRTYRFMEEEKHGRA  144

Query  1462  KFMK-IGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHEGDKPY  1286
              F K IG+L G  G+  + +   R    +LD S G G AN  L+Y + +LLA+ E D P 
Sbjct  145   FFPKPIGELHGYGGVAKLMMYWARSLFGILDASQGMGMANAGLVYFNSRLLAISEDDLPV  204

Query  1285  AIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYRVISKD  1109
              +++ ED D++T+G  D+  +L H+  AHPK+DP TGE+F+  Y    AP++ Y + S D
Sbjct  205   EVRITEDNDIETVGRYDFHGQLTHSMIAHPKIDPHTGELFSLSYNVLSAPYLKYLIFSAD  264

Query  1108  GLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATKKARFG  929
             G     VP+ +P + M HDFAITEN+ +  D  + F+ KEM+T        D  K  RFG
Sbjct  265   GEKKAEVPVALPEAAMTHDFAITENFVVIPDQQIVFRLKEMLTGGS-PVVLDPKKTPRFG  323

Query  928   VLPRYAKNELLIKWFELPNCFIFHTANAWEEGDEVVMISCRIQNPDLDMASGTLKDSLDF  749
             V+P+YA +E  +KW  +P+CF FH  NAWEEGDEVV+I   +   D+   +  +  ++  
Sbjct  324   VMPKYATSEDELKWIGVPDCFFFHLYNAWEEGDEVVVIGSSMTPADIIFKTSEVPRAI--  381

Query  748   VNELYEMRFNMKTGLASQKKLSESAVDFPRVNENYTGRKQRYVYATMLSDLAKVKGIVKF  569
                L E+R N +TG +++++L+E  ++  ++N  + G K +Y+Y  ++    KV GI K 
Sbjct  382   ---LTEVRLNRRTGTSTKRELAELNLEVGKMNPQFVGVKTQYMYLAIVEPWPKVSGIAKV  438

Query  568   DLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPREASTGCEEDDGYLILFVHDEN  389
             DL +            G V    + G  R+G E +FVPR +     EDDG+L+ F H+E+
Sbjct  439   DLQS------------GQVVARHNYGTHRYGGEPVFVPRTSDPSAPEDDGFLLAFCHNED  486

Query  388   TGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQL  263
             +G+S + V+DA T + E VA V LP+RVPYGFH  F+    L
Sbjct  487   SGESQLLVLDAATPTLEQVASVSLPSRVPYGFHGAFIPAADL  528



>ref|WP_007303189.1| Retinal pigment epithelial membrane protein [Crocosphaera watsonii]
 gb|EAM52872.1| Retinal pigment epithelial membrane protein [Crocosphaera watsonii 
WH 8501]
Length=462

 Score =   381 bits (979),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 218/491 (44%), Positives = 298/491 (61%), Gaps = 47/491 (10%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YLSGNFAP  +ET    +L V G +P  L G F+R GPNP+F P+  YHWFDGDGMIHG+
Sbjct  10    YLSGNFAPVNQETTE-NNLTVIGEIPRNLRGMFLRNGPNPQFLPIGQYHWFDGDGMIHGV  68

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
              I++GKA+Y +RFV+T     E+   +  +          GLL         +   +DN 
Sbjct  69    HIENGKASYRNRFVQTRGYGLEKEANKPLWT---------GLL---------EPPQMDNP  110

Query  1366  YGNGT--ANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             YG     ANTAL+YH G+LLAL EG +P+A+ V E   L +LG  ++D +L   FTAHPK
Sbjct  111   YGTSKNPANTALVYHAGRLLALWEGGEPHALTVPE---LNSLGSYNFDNKLVSPFTAHPK  167

Query  1192  VDPVTGEMFTFGYA-QKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             VDPVTGEM  FGY+  + P++ Y +IS  G +   VPI IP  VMMHD AITENY IF+D
Sbjct  168   VDPVTGEMMFFGYSFAQPPYLQYGIISPQGELLRTVPIDIPVGVMMHDCAITENYTIFLD  227

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             LPL F+P+ M  K +   +F+    +RFG+ PR   NE  ++WFE  +C+IFHT NA+EE
Sbjct  228   LPLTFRPERMY-KGEPPLQFEHNTPSRFGITPRQGNNE-DVRWFESDSCYIFHTLNAYEE  285

Query  835   GDEVVMISCRIQNPD-LDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPR  659
             GDEVV+I+CR+     L  A+  +KDS   +  L++ RFN+ TG   ++ L +   +FPR
Sbjct  286   GDEVVLIACRMNATTVLGEANEDVKDSD--IPRLHQWRFNLTTGEVKEQPLCDLPSEFPR  343

Query  658   VNENYTGRKQRYVYATML--SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPG  485
             +NE YTGRK RY Y+  +  S   K  GI+K D               GN E I + G  
Sbjct  344   INEQYTGRKTRYGYSGKMAASSEPKFDGIIKHDFEK------------GNFE-IHNFGSH  390

Query  484   RFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRV  305
             R+G E IF P  ++   E+  G+L+ FV+DE +  S + +IDA+  +A PVA +++P RV
Sbjct  391   RYGGEPIFAPNPSAVTDEQ--GWLLTFVYDEASKVSELVIIDAQDFTASPVAKIQIPQRV  448

Query  304   PYGFHAFFVTE  272
             PYGFH  ++ E
Sbjct  449   PYGFHGMWLNE  459



>ref|WP_009546963.1| MULTISPECIES: 9-cis-epoxycarotenoid dioxygenase [Cyanothece]
 ref|YP_001803631.1| retinal pigment epithelial membrane protein [Cyanothece sp. ATCC 
51142]
 gb|ACB51565.1| probable retinal pigment epithelial membrane protein [Cyanothece 
sp. ATCC 51142]
Length=459

 Score =   381 bits (978),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 212/491 (43%), Positives = 301/491 (61%), Gaps = 47/491 (10%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YLSGNFAP   E     +L V+G +P+ L G F+R GPNP+F+P+  YHWFDGDGM+HG+
Sbjct  10    YLSGNFAPVSREIT-AHNLTVTGEIPQNLRGIFLRNGPNPQFSPIGEYHWFDGDGMVHGV  68

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
              I+DGKA+Y +RF++T     E+   +  +          GLL         +   +DN 
Sbjct  69    HIEDGKASYRNRFIQTRGYCLEKEANKPIWT---------GLL---------EPPQMDNP  110

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             YG    TANTAL+YH  +LLAL EG +P+A+ V E   L TLG  +++ +L   FTAHPK
Sbjct  111   YGPSKNTANTALVYHADRLLALWEGGEPHALTVPE---LDTLGPDNFEGKLMSPFTAHPK  167

Query  1192  VDPVTGEMFTFGYAQ-KAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             +DP+TGEM  FGY+  + P++ Y +IS  G +   VPI +P  VMMHDFAITENY IF+D
Sbjct  168   IDPMTGEMMFFGYSMVQPPYLQYGIISPQGDLLKTVPIDLPVGVMMHDFAITENYTIFLD  227

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             LPL F+P+ M  K +   +F+    +RFG++PR   N+  ++WFE  +C+IFHT NA+EE
Sbjct  228   LPLTFRPERM-QKGESPLQFEHDTPSRFGIVPRQGNND-DVRWFEGNSCYIFHTLNAYEE  285

Query  835   GDEVVMISCRIQNPD-LDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPR  659
             GDE+V+I+CR+     L       K+S   +  L+E RFN+KTG   ++ L +   +FPR
Sbjct  286   GDEIVLIACRMNGTTVLGEVREETKESD--IPRLHEWRFNLKTGEVKEQGLCDLPSEFPR  343

Query  658   VNENYTGRKQRYVYATMLSDLA--KVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPG  485
             +NE YTGRK RY Y+  +++ +  K  GI+K D            E GG    I   G  
Sbjct  344   INEQYTGRKSRYGYSGKMAESSNPKFNGIIKHD-----------FEKGGF--DIHHFGSH  390

Query  484   RFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRV  305
             ++G E IF P   +   +EDDG+L+ FVHDE +  S + +IDA+  +A PVA +++P RV
Sbjct  391   KYGGEPIFAPNPDAD--KEDDGWLLTFVHDEGSNTSELVIIDAQDFTASPVATIQIPQRV  448

Query  304   PYGFHAFFVTE  272
             PYGFH  ++ +
Sbjct  449   PYGFHGMWLAQ  459



>ref|WP_023064357.1| carotenoid 9,10(9',10')-cleavage dioxygenase [Lyngbya aestuarii]
 gb|ERT09477.1| carotenoid 9,10(9',10')-cleavage dioxygenase [Lyngbya aestuarii 
BL J]
Length=461

 Score =   380 bits (977),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 208/493 (42%), Positives = 293/493 (59%), Gaps = 45/493 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  +E     +L V G LP  L+G F+R GPNP+F P+  YHWFDGDGMIH +
Sbjct  10    YLEGNFAPVRDEIT-ADNLKVIGELPAGLSGMFLRNGPNPQFPPIGQYHWFDGDGMIHAV  68

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             RI DGKA+Y +R+V+T   K E   G A                ++  +     + L   
Sbjct  69    RILDGKASYRNRYVRTQGYKIEHEAGTA----------------LWSGIFEPPQENLPGG  112

Query  1366  YGNGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVD  1187
                 T NTAL++H GK LAL EG +P+A+ + E   + T+G  D++ +L   FTAHPKVD
Sbjct  113   PSKNTGNTALVWHAGKFLALWEGGEPHALTLPE---VNTVGADDFEGKLTSPFTAHPKVD  169

Query  1186  PVTGEMFTFGYAQKA-PFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLP  1010
             P TGEM   GY+  A P++ Y  ++ DG +    PI IP  VMMHDFAIT+NY IFMDLP
Sbjct  170   PETGEMRFIGYSMSAPPYLQYGWVTPDGKLQQINPIEIPVGVMMHDFAITKNYTIFMDLP  229

Query  1009  LYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEEGD  830
             L F+  E + + +    F+    +RFG++PR+  +   +KWFE P+CFIFHT NA+E+G 
Sbjct  230   LTFR-MERIQRGEHPIMFEKETPSRFGIVPRHGDSS-QVKWFECPSCFIFHTLNAYEQGS  287

Query  829   EVVMISCRIQNPD-LDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVN  653
             EVV+I+CR+++   L M      D    +  LY  RFNM+TG   Q+++ ++  +FP +N
Sbjct  288   EVVLIACRMESTSVLAMTDNEASD----IPLLYRWRFNMETGEVKQEQMDDTPGEFPTIN  343

Query  652   ENYTGRKQRYVY--ATMLSDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRF  479
              ++TG++ RY Y   T  ++L K +GI K+D                N   +   G GRF
Sbjct  344   NHFTGQQTRYGYIGKTAQTELPKFEGINKYDFDK-------------NSCQVHHFGEGRF  390

Query  478   GSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPY  299
             G EA+FVPR   +   ED G+L+ FVHDEN  +S + ++DA+ +++EPVA V +P RVPY
Sbjct  391   GGEAVFVPRPDDSA--EDAGWLVTFVHDENEQQSELVIVDAQNITSEPVARVIIPQRVPY  448

Query  298   GFHAFFVTEEQLQ  260
             GFH  +V + Q Q
Sbjct  449   GFHGTWVPQSQFQ  461



>ref|WP_016870978.1| hypothetical protein [Fischerella thermalis]
Length=469

 Score =   381 bits (978),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 214/494 (43%), Positives = 298/494 (60%), Gaps = 44/494 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP  EE     +L V G LP  L+G FVR GPNPKFAP+  + WFDGDGM+HG+
Sbjct  9     YLDGNFAPVQEEIT-ADELVVIGELPPDLSGMFVRNGPNPKFAPIGRHQWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             +I  GKA+Y +R+V+T  LK E   GR+ +      KG        L          +N 
Sbjct  68    QINHGKASYRNRYVQTRALKMEIEAGRSLW------KGPTEPPNFELPH--------NNL  113

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
             +G    TANTA+++H GKLLAL EG +PY I V    +L+T+G  +Y  +L   FTAHPK
Sbjct  114   FGPFKNTANTAVVWHGGKLLALWEGAEPYEIAV---PNLETVGPYNYQGKLASRFTAHPK  170

Query  1192  VDPVTGEMFTFGYA-QKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             VDP TGEM  +GYA    P++ Y V+S++G +   V I IPA VMMHDFAITE+Y IFM 
Sbjct  171   VDPETGEMMFYGYAVTSQPYLQYNVVSREGELTKTVTIDIPAPVMMHDFAITEHYTIFMY  230

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             LPL F   E + + + AY F++   + FG+LPRY  N   I+WFE P+C+IFHT NA+E 
Sbjct  231   LPLTFS-MERIMRGESAYLFESDVPSCFGILPRYGDNS-NIQWFEAPSCYIFHTVNAYEA  288

Query  835   GDEVVMISCRIQ-NPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPR  659
             G+E+V+I+CR+     LD+ +    D  D    LY  RFN++TG   ++ L + A DFP 
Sbjct  289   GEEIVLIACRMSGTTSLDIPT-KFSDGQDDKPRLYRWRFNLRTGAVYEEPLDDLASDFPS  347

Query  658   VNENYTGRKQRYVYATMLSDLAKVK----GIVKFDLHAEPETGKTKLEVGGNVEGIFDLG  491
             +N+   GR+ RY Y   ++   ++     G++K+DL               N   +++LG
Sbjct  348   LNQQRLGRQSRYAYTAKMASGQRIAFSFDGLLKYDLTT-------------NSSQVYELG  394

Query  490   PGRFGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPN  311
              GR+G EA+FVPR  +    EDDG+L+ FV+D     S + V++A+ ++ EPVA V +P 
Sbjct  395   LGRYGGEAVFVPRPNTN--TEDDGWLMTFVYDSTQQASELLVLNAQDLTTEPVARVLIPQ  452

Query  310   RVPYGFHAFFVTEE  269
             RVPYGFH  ++ +E
Sbjct  453   RVPYGFHGIWIPQE  466



>ref|XP_002459356.1| hypothetical protein SORBIDRAFT_02g003230 [Sorghum bicolor]
 gb|EER95877.1| hypothetical protein SORBIDRAFT_02g003230 [Sorghum bicolor]
Length=569

 Score =   384 bits (985),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 224/539 (42%), Positives = 306/539 (57%), Gaps = 39/539 (7%)
 Frame = -3

Query  1816  TPQSGIAAKAIDWLEWAIVKVMHDSSKPLH-------YLSGNFAPAPEETPPCKDLPVSG  1658
              P   +AA A+D +E  +V    + + PL         ++GN+AP  E  PP  DLPVSG
Sbjct  53    NPLQRLAAAALDAVEEGLVAGFLERAHPLPRTADPAVQIAGNYAPVGER-PPTGDLPVSG  111

Query  1657  HLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKA-TYVSRFVKTSRLKQE  1481
              +P CL+G +VR G NP  AP AG+H FDGDGM+H +R++ G+A +Y  RF +T+RL+QE
Sbjct  112   RVPACLDGVYVRNGANPLHAPRAGHHLFDGDGMLHAVRLRAGRAESYACRFTETARLRQE  171

Query  1480  EFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYGNGTANTALIYHDGKLLALHE  1301
                GR     IG+L G  G+  + L   R    +LD S G G AN  L+YHD +LLA+ E
Sbjct  172   RAIGRPA---IGELHGHSGVARLLLFGARSLCGLLDASRGVGVANAGLVYHDNRLLAMSE  228

Query  1300  GDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPVTGEMFTFGY-AQKAPFVTYR  1124
              D PY ++V  DGDL+T+G  D+  +L  A  AHPK+DP TGE+F+  Y     PF+ Y 
Sbjct  229   DDLPYHVRVTADGDLETVGRYDFGGQLDTAMIAHPKLDPATGELFSLSYNVVTKPFLKYF  288

Query  1123  VISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYFQPKEMVTKKQLAYKFDATK  944
               + DG     V I + A  MMHDFA+TEN+AI  D  + F+ +EM+        +D  K
Sbjct  289   YFTADGRKSPDVEIPVDAPTMMHDFAVTENHAIIPDQQIVFKLQEMLLGGSPVV-YDKNK  347

Query  943   KARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE---GDEVVMISCRIQNPDLDMASG  773
              ARFGVLP+ A +   ++W E+P+CF FH  NAWE+   GD VV+ SC      +   S 
Sbjct  348   TARFGVLPKRATDASRLQWVEVPDCFCFHLWNAWEDDATGDIVVIGSCMTPADAVFNESA  407

Query  772   TLKDSLDFVNELYEMRFNMKTGLASQKKLSESA----VDFPRVNENYTGRKQRYVYATML  605
               ++S  F + L E+R + +TG +S++ +   A    ++   VN    GRK RY Y  + 
Sbjct  408   AGEES--FRSVLSEIRLDPRTGTSSRRAVLSDADQVNLEAGMVNRQLLGRKTRYAYLAIA  465

Query  604   SDLAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGRFGSEAIFVPR-EASTGCEE  428
                 KV G  K DL A            G VE  F  G GR+G E  FVPR +A  G  E
Sbjct  466   EPWPKVSGFAKVDLEA------------GTVEK-FIYGEGRYGGEPCFVPRPDAPAGAAE  512

Query  427   DDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFVTEEQLQTQA  251
             DDGY++ +VHDE  G S + V++A+ M AE  A V+LP RVPYG H  F+  E+LQ QA
Sbjct  513   DDGYVLCYVHDEGRGASEMLVVNARDMRAE--AAVKLPGRVPYGLHGTFIVGEELQRQA  569



>ref|XP_001769871.1| predicted protein [Physcomitrella patens]
 gb|EDQ65433.1| predicted protein [Physcomitrella patens]
Length=699

 Score =   387 bits (995),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 222/549 (40%), Positives = 305/549 (56%), Gaps = 86/549 (16%)
 Frame = -3

Query  1801  IAAKAIDWLEWAIVKVMHDSSK----PLHYLSGNFAPAPEETPPCKDLPVSGHLP-----  1649
             +A    D+LE  +++++ +         ++L  ++AP PE   P  +LPV G +P     
Sbjct  121   LATSFCDYLEERVLQLLGNEDSCDGDTCYFLLDHYAPVPE-MAPTTNLPVFGSIPVCTTA  179

Query  1648  -------ECLNGEFVRVGPNPKFAPVAGYHW-----------------FDGDGMIHGLRI  1541
                     CL+GEF+R+GPNP+F P+ GYHW                  DGDGMIHGLR+
Sbjct  180   VHYILSQACLDGEFLRIGPNPRFQPLNGYHWHAHFSRPARAGFPSIFTIDGDGMIHGLRV  239

Query  1540  KDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNSYG  1361
             KDGKA+YV+R+V+TSRL+QEE +G  KF+++GDL+GM GL    ++ LR    VLD S G
Sbjct  240   KDGKASYVARYVQTSRLQQEEMYGGPKFIRVGDLQGMRGLSVGIIEALRKTFGVLDGSKG  299

Query  1360  NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPKVDPV  1181
             +GT NTA+++H+ KLLALHE D PY IKV +DGDLQT+G  DYD +L H FTAH      
Sbjct  300   DGTGNTAMVFHNNKLLALHERDLPYIIKVQDDGDLQTVGHEDYDHKLRHPFTAH------  353

Query  1180  TGEMFTFGYAQKAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMDLPLYF  1001
                                            P   P +  MH FA    Y +     +Y 
Sbjct  354   -------------------------------PKINPVTGEMHFFA----YEVVTPHLIY-  377

Query  1000  QPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTA--NAWEEGDE  827
                 MV+K  +         AR     R A+     +   +    + H    NAWEEGDE
Sbjct  378   ---RMVSKDGVVGGASTNHTARSF---RDARLRHHRELRRILRPSVAHKCRVNAWEEGDE  431

Query  826   VVMISCRIQNPDLD-MASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRVNE  650
             VV+I CR ++ D+  +     ++ +   + L+E R N+K G  +Q++LS    +FPR+NE
Sbjct  432   VVLICCRNESFDIKPLTKSKRENGMTLGSRLFEFRMNLKDGKVTQRELSNLCTEFPRINE  491

Query  649   NYTGRKQRYVYATMLSDLAKVKGIVKFDLHAEPETGKTK-LEVGGNVEGIFDLGPGRFGS  473
              YTGR+ RY Y ++  D   + G+ K+DL  EP    ++ L+VGGN+ G+F  G  R G 
Sbjct  492   EYTGRRTRYGYCSVFDDEEMIIGVAKYDLTMEPSPDASRELKVGGNIVGVFHYGQERTGH  551

Query  472   EAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVPYGF  293
             EAIFVPR   +   EDDGYLI +VHD  TGKS V +IDA TM AEPVAVV+LP RVP GF
Sbjct  552   EAIFVPRNPGSNGLEDDGYLIAYVHDNTTGKSDVVIIDAITMKAEPVAVVKLPRRVPLGF  611

Query  292   HAFFVTEEQ  266
             HA+FV++  
Sbjct  612   HAYFVSQHN  620



>ref|WP_015210868.1| lignostilbene-alpha,beta-dioxygenase-like enzyme [Cylindrospermum 
stagnale]
 ref|YP_007150314.1| lignostilbene-alpha,beta-dioxygenase-like enzyme [Cylindrospermum 
stagnale PCC 7417]
 gb|AFZ27634.1| lignostilbene-alpha,beta-dioxygenase-like enzyme [Cylindrospermum 
stagnale PCC 7417]
Length=465

 Score =   379 bits (972),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 209/494 (42%), Positives = 298/494 (60%), Gaps = 44/494 (9%)
 Frame = -3

Query  1726  YLSGNFAPAPEETPPCKDLPVSGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGL  1547
             YL GNFAP   E      L V G LP  L+G F+R GPNP+++P   YHWFDGDGM+HG+
Sbjct  9     YLDGNFAPVHAEIT-TDTLQVIGELPPELSGIFLRNGPNPQWSPKGNYHWFDGDGMLHGV  67

Query  1546  RIKDGKATYVSRFVKTSRLKQEEFFGRAKFMKIGDLKGMFGLLTVYLQMLRIKLKVLDNS  1367
             +I +GKATY +R+++T+  K E+  G+A +    +   M                  +N 
Sbjct  68    QISNGKATYRNRYIQTAGWKTEQAAGKALWTGFAEPPQM------------------ENP  109

Query  1366  YG--NGTANTALIYHDGKLLALHEGDKPYAIKVLEDGDLQTLGMLDYDKRLGHAFTAHPK  1193
              G     ANTAL++H G+LLAL EG  P+AIKV E   L+T+G   Y+ +L  AFTAHPK
Sbjct  110   QGPYKNVANTALVWHAGQLLALWEGGAPHAIKVPE---LETIGEYTYNDKLVSAFTAHPK  166

Query  1192  VDPVTGEMFTFGYAQ-KAPFVTYRVISKDGLMHDPVPITIPASVMMHDFAITENYAIFMD  1016
             VDPV GEM  FGY+    P++ Y V+S +G +   VPI +P  VMMHDFAITENY IFMD
Sbjct  167   VDPVIGEMMFFGYSPLTPPYLKYSVVSAEGELLSTVPIDLPIGVMMHDFAITENYTIFMD  226

Query  1015  LPLYFQPKEMVTKKQLAYKFDATKKARFGVLPRYAKNELLIKWFELPNCFIFHTANAWEE  836
             LPL F  K M   + +   F+  + +RFG++PR+  N   I+WFE P C++FHT NA+EE
Sbjct  227   LPLTFSSKRMQRGEPMML-FERDRPSRFGIVPRFGNNSN-IRWFESPACYVFHTLNAYEE  284

Query  835   GDEVVMISCRIQNPDLDMASGTLKDSLDFVNELYEMRFNMKTGLASQKKLSESAVDFPRV  656
              DE+V+I+CR+ + ++ +A G   D    +  L++ RFN+  G   ++ L ++  +FP V
Sbjct  285   EDEIVLIACRMSSTNVLVAEGMQPDPDGDIPRLHQWRFNLSKGTVREEMLDDTPGEFPCV  344

Query  655   NENYTGRKQRYVYATMLSD--LAKVKGIVKFDLHAEPETGKTKLEVGGNVEGIFDLGPGR  482
             NEN  G+K +Y Y    +D  L    G++K+DL+    +GK++               G 
Sbjct  345   NENLLGQKTQYGYIGKWADATLPLFDGLIKYDLN----SGKSETHT---------FRQGC  391

Query  481   FGSEAIFVPREASTGCEEDDGYLILFVHDENTGKSAVNVIDAKTMSAEPVAVVELPNRVP  302
             +G  A F PR  +T  +EDDG+LI FVH+E  G S + V++A+ ++ E  A V +P RVP
Sbjct  392   YGGAAAFAPRPGAT--DEDDGWLITFVHNEGKGTSELVVLNAQDVTGEAAARVLIPQRVP  449

Query  301   YGFHAFFVTEEQLQ  260
             YGFH+ +V+E QL+
Sbjct  450   YGFHSAWVSEAQLR  463



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5588171237268