BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20144_g1_i1 len=218 path=[356:0-127 632:128-129 54:130-167
671:168-217]

Length=218
                                                                      Score     E

emb|CDP06403.1|  unnamed protein product                              49.3    4e-05   
ref|XP_002533718.1|  conserved hypothetical protein                   46.6    2e-04   Ricinus communis
ref|XP_004302581.1|  PREDICTED: proactivator polypeptide-like 1-like  46.2    4e-04   



>emb|CDP06403.1| unnamed protein product [Coffea canephora]
Length=294

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (54%), Gaps = 14/84 (17%)
 Frame = +3

Query  9    NEDQCSLCKQIASNVITYFSENR------QTLYNLCNAILDWLPRCSKIVE--------E  146
            N+  C LC++ A   + YF+ N+      + LY  C+ +  +  +C+ +V+        E
Sbjct  110  NDQVCMLCEEFAVEAVNYFANNKTQTEILEILYKTCSKMHTFKQQCTSLVDYYAPLFFLE  169

Query  147  ISSSDPETLCKSLQLCEGVVSISQ  218
            ISS  P+  C+ + LCE +VSISQ
Sbjct  170  ISSVQPKDFCQKVDLCEDIVSISQ  193



>ref|XP_002533718.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28663.1| conserved hypothetical protein [Ricinus communis]
Length=199

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 43/84 (51%), Gaps = 14/84 (17%)
 Frame = +3

Query  6    GNEDQCSLCKQIASNVITYFSENRQ------TLYNLCNAILDWLPRCSKIVE--------  143
            GNE  C LC++ AS  + Y +EN+        L+  C+ +  +  +C  +V+        
Sbjct  18   GNEQVCVLCEEFASQALDYLTENKTQTEILGALHQACSRVPTFKQQCMTLVDYYAPLFFL  77

Query  144  EISSSDPETLCKSLQLCEGVVSIS  215
            E+SS  PE  C+ + LC+ +V IS
Sbjct  78   EVSSVQPEEFCQKVNLCQEIVFIS  101



>ref|XP_004302581.1| PREDICTED: proactivator polypeptide-like 1-like [Fragaria vesca 
subsp. vesca]
Length=229

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 46/85 (54%), Gaps = 14/85 (16%)
 Frame = +3

Query  3    SGNEDQCSLCKQIASNVITYFSENR------QTLYNLCNAILDWLPRCSKIVE-------  143
            SGNE+ C+LC++ AS  + Y SEN+      + L+N C+ +     +C  +V+       
Sbjct  43   SGNENVCTLCEEFASQALDYISENKTQTEIIEYLHNSCSQLKSLKQQCVTLVDYYAPLFF  102

Query  144  -EISSSDPETLCKSLQLCEGVVSIS  215
             E++S +P   C+ + LC+ V + S
Sbjct  103  LEVTSLEPVEFCRKVNLCQQVATFS  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509447715952