BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20143_g1_i1 len=1399 path=[1592:0-490 2083:491-1012 216:1013-1398]

Length=1399
                                                                      Score     E

ref|XP_009785171.1|  PREDICTED: uncharacterized protein LOC104233475    504   5e-174   
ref|XP_002307128.2|  hypothetical protein POPTR_0005s08630g             503   5e-174   Populus trichocarpa [western balsam poplar]
ref|XP_011090626.1|  PREDICTED: uncharacterized protein LOC105171...    503   7e-174   
ref|XP_011021935.1|  PREDICTED: uncharacterized protein LOC105123...    503   1e-173   
emb|CDP12902.1|  unnamed protein product                                502   2e-173   
ref|XP_002276081.1|  PREDICTED: uncharacterized protein LOC100264...    501   3e-173   Vitis vinifera
ref|XP_009605619.1|  PREDICTED: uncharacterized protein LOC104100151    501   1e-172   
ref|XP_010261112.1|  PREDICTED: uncharacterized protein LOC104600018    496   5e-171   
ref|XP_010027772.1|  PREDICTED: uncharacterized protein LOC104418200    496   7e-171   
gb|KDP35243.1|  hypothetical protein JCGZ_09402                         494   3e-170   
ref|XP_008232727.1|  PREDICTED: uncharacterized protein LOC103331836    493   4e-170   
ref|XP_004304856.1|  PREDICTED: uncharacterized protein LOC101297070    493   5e-170   
ref|XP_006346727.1|  PREDICTED: uncharacterized protein LOC102584063    493   9e-170   
ref|XP_008342852.1|  PREDICTED: uncharacterized protein LOC103405615    492   1e-169   
ref|XP_007205553.1|  hypothetical protein PRUPE_ppa008614mg             492   2e-169   
ref|XP_010937045.1|  PREDICTED: uncharacterized protein LOC105056...    491   3e-169   
ref|XP_007159758.1|  hypothetical protein PHAVU_002G264700g             490   7e-169   
ref|XP_010681086.1|  PREDICTED: uncharacterized protein LOC104896084    491   9e-169   
ref|XP_004236712.1|  PREDICTED: uncharacterized protein LOC101250205    489   2e-168   
ref|XP_009343096.1|  PREDICTED: uncharacterized protein LOC103935053    489   2e-168   
gb|EYU31085.1|  hypothetical protein MIMGU_mgv1a010183mg                489   3e-168   
ref|XP_008784603.1|  PREDICTED: uncharacterized protein LOC103703...    489   4e-168   
gb|KHN38221.1|  hypothetical protein glysoja_003886                     488   5e-168   
ref|XP_004504022.1|  PREDICTED: uncharacterized protein LOC101490185    488   2e-167   
emb|CAE03618.3|  OSJNBb0003B01.9                                        486   5e-167   
ref|XP_003525077.1|  PREDICTED: uncharacterized protein LOC100807...    486   6e-167   
gb|AFK43576.1|  unknown                                                 483   7e-166   
gb|AFK38312.1|  unknown                                                 481   5e-165   
ref|XP_010531414.1|  PREDICTED: uncharacterized protein LOC104807722    481   5e-165   
ref|XP_008457887.1|  PREDICTED: uncharacterized protein LOC103497464    480   7e-165   
ref|XP_004976987.1|  PREDICTED: uncharacterized protein LOC101752516    479   9e-165   
ref|XP_009416874.1|  PREDICTED: uncharacterized protein LOC103997398    479   2e-164   
ref|XP_004148439.1|  PREDICTED: uncharacterized protein LOC101209062    477   1e-163   
ref|XP_002448617.1|  hypothetical protein SORBIDRAFT_06g030240          476   2e-163   Sorghum bicolor [broomcorn]
gb|EPS69665.1|  hypothetical protein M569_05099                         475   2e-163   
ref|XP_003531378.1|  PREDICTED: uncharacterized protein LOC100306...    475   9e-163   
ref|NP_001140871.1|  hypothetical protein                               474   2e-162   Zea mays [maize]
ref|XP_007048114.1|  Uncharacterized protein isoform 1                  473   6e-162   
gb|ACG33936.1|  hypothetical protein                                    472   1e-161   Zea mays [maize]
ref|XP_011090627.1|  PREDICTED: uncharacterized protein LOC105171...    468   3e-160   
ref|XP_006653809.1|  PREDICTED: uncharacterized protein LOC102705433    466   8e-160   
ref|XP_003580649.1|  PREDICTED: uncharacterized protein LOC100846062    466   4e-159   
gb|EAZ32146.1|  hypothetical protein OsJ_16343                          459   1e-156   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006428030.1|  hypothetical protein CICLE_v10026110mg             458   3e-156   
ref|XP_002528682.1|  conserved hypothetical protein                     459   7e-156   Ricinus communis
ref|XP_006827099.1|  hypothetical protein AMTR_s00010p00242000          470   3e-154   
gb|EMS46681.1|  hypothetical protein TRIUR3_08218                       452   6e-154   
ref|XP_009140317.1|  PREDICTED: uncharacterized protein LOC103864311    452   1e-153   
ref|XP_002878582.1|  hypothetical protein ARALYDRAFT_900627             452   1e-153   
ref|NP_565523.1|  uncharacterized protein                               451   3e-153   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32851.1|  hypothetical protein AALP_AA6G295200                    450   6e-153   
emb|CDY15852.1|  BnaA04g12590D                                          449   1e-152   
dbj|BAJ96471.1|  predicted protein                                      447   4e-152   
ref|XP_006404650.1|  hypothetical protein EUTSA_v10000230mg             448   5e-152   
gb|AAM64802.1|  unknown                                                 447   6e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416953.1|  PREDICTED: uncharacterized protein LOC104702741    446   1e-151   
ref|XP_010472193.1|  PREDICTED: uncharacterized protein LOC104751845    446   1e-151   
ref|XP_006296468.1|  hypothetical protein CARUB_v10025652mg             446   2e-151   
ref|XP_010429116.1|  PREDICTED: uncharacterized protein LOC104713646    445   7e-151   
ref|XP_010099879.1|  hypothetical protein L484_020061                   440   4e-150   
tpg|DAA35769.1|  TPA: hypothetical protein ZEAMMB73_590939              433   7e-147   
ref|XP_010937046.1|  PREDICTED: uncharacterized protein LOC105056...    432   2e-146   
ref|XP_010652858.1|  PREDICTED: uncharacterized protein LOC100264...    422   8e-143   
ref|XP_011021936.1|  PREDICTED: uncharacterized protein LOC105123...    420   4e-142   
ref|XP_008784611.1|  PREDICTED: uncharacterized protein LOC103703...    416   2e-140   
ref|XP_010937047.1|  PREDICTED: uncharacterized protein LOC105056...    416   2e-140   
ref|XP_006580305.1|  PREDICTED: uncharacterized protein LOC100807...    412   1e-138   
emb|CDY46224.1|  BnaCnng13750D                                          411   4e-138   
ref|XP_002975329.1|  hypothetical protein SELMODRAFT_103319             405   3e-136   
ref|XP_002964467.1|  hypothetical protein SELMODRAFT_81106              405   5e-136   
gb|ACU14399.1|  unknown                                                 363   5e-120   Glycine max [soybeans]
ref|XP_006585308.1|  PREDICTED: uncharacterized protein LOC100306...    357   2e-117   
ref|XP_001768660.1|  predicted protein                                  359   9e-117   
ref|NP_001054033.1|  Os04g0639300                                       284   2e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010110466.1|  hypothetical protein L484_000351                   283   5e-90    
gb|EMT05966.1|  hypothetical protein F775_05675                         276   4e-87    
gb|KCW54372.1|  hypothetical protein EUGRSUZ_I00323                     273   1e-84    
ref|XP_001694244.1|  hypothetical protein CHLREDRAFT_205570             262   2e-79    Chlamydomonas reinhardtii
ref|XP_005847105.1|  hypothetical protein CHLNCDRAFT_134819             249   7e-70    
ref|XP_002503074.1|  predicted protein                                  236   7e-69    Micromonas commoda
ref|XP_005651950.1|  hypothetical protein COCSUDRAFT_52156              220   2e-63    
ref|XP_007511282.1|  predicted protein                                  214   3e-61    
ref|XP_001422227.1|  predicted protein                                  211   5e-61    Ostreococcus lucimarinus CCE9901
ref|XP_003084143.1|  unnamed protein product                            206   4e-58    
ref|XP_002952946.1|  hypothetical protein VOLCADRAFT_105755             202   8e-57    
ref|XP_003061089.1|  predicted protein                                  177   1e-46    
dbj|BAD36132.1|  unknown protein                                        162   3e-43    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85983.1|  predicted protein                                      154   3e-41    
gb|ABB47725.1|  hypothetical protein LOC_Os10g30980                     119   1e-28    Oryza sativa Japonica Group [Japonica rice]
gb|EJK71112.1|  hypothetical protein THAOC_07480                        116   2e-25    
ref|XP_002184911.1|  predicted protein                                  111   9e-25    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002294037.1|  predicted protein                                  102   2e-21    Thalassiosira pseudonana CCMP1335
ref|XP_005825652.1|  hypothetical protein GUITHDRAFT_46078              100   4e-21    
ref|WP_017309004.1|  hypothetical protein                               100   2e-20    
ref|WP_015083577.1|  hypothetical protein                             99.0    3e-20    
ref|WP_026735371.1|  hypothetical protein                             98.6    4e-20    
ref|WP_019492843.1|  hypothetical protein                             98.2    7e-20    
ref|WP_017739677.1|  hypothetical protein                             97.8    8e-20    
ref|WP_016866588.1|  hypothetical protein                             97.8    9e-20    
ref|WP_017320959.1|  hypothetical protein                             97.8    9e-20    
ref|WP_016862568.1|  hypothetical protein                             97.4    1e-19    
ref|WP_015152849.1|  hypothetical protein                             97.4    1e-19    
ref|WP_017314331.1|  hypothetical protein                             97.4    1e-19    
ref|XP_005706363.1|  hypothetical protein isoform 2                     100   1e-19    
ref|WP_027846109.1|  hypothetical protein                             96.7    2e-19    
ref|WP_026723708.1|  hypothetical protein                             96.7    2e-19    
ref|WP_015151609.1|  hypothetical protein                             96.3    4e-19    
ref|WP_008310822.1|  hypothetical protein                             96.3    4e-19    
ref|WP_039715373.1|  ATP-dependent Zn protease                        95.9    4e-19    
ref|WP_035150144.1|  ATP-dependent Zn protease                        95.1    8e-19    
ref|WP_017662825.1|  hypothetical protein                             95.1    9e-19    
ref|WP_039738878.1|  ATP-dependent Zn protease                        95.1    9e-19    
ref|WP_009455405.1|  MULTISPECIES: hypothetical protein               94.4    1e-18    
ref|WP_009557215.1|  ATP-dependent Zn protease                        94.4    1e-18    
ref|XP_005837211.1|  hypothetical protein GUITHDRAFT_151256           97.1    1e-18    
ref|WP_023065940.1|  hypothetical protein                             93.6    3e-18    
ref|WP_015207050.1|  hypothetical protein                             93.6    3e-18    
ref|WP_015190980.1|  hypothetical protein                             93.2    5e-18    
ref|WP_037224627.1|  ATP-dependent Zn protease                        91.7    1e-17    
ref|WP_009784766.1|  hypothetical protein                             91.7    1e-17    
ref|WP_029632698.1|  hypothetical protein [                           90.9    2e-17    
ref|WP_011317110.1|  hypothetical protein                             90.9    2e-17    
ref|XP_008447098.1|  PREDICTED: uncharacterized protein LOC103489...  91.3    3e-17    
ref|WP_012407348.1|  hypothetical protein                             90.5    3e-17    
ref|WP_023076788.1|  atp-dependent zn protease                        90.5    3e-17    
ref|WP_010996570.1|  hypothetical protein                             90.5    3e-17    
ref|XP_009768417.1|  PREDICTED: uncharacterized protein LOC104219423  92.4    5e-17    
ref|WP_016874006.1|  hypothetical protein                             89.7    6e-17    
ref|WP_038099010.1|  ATP-dependent Zn protease                        89.7    6e-17    
ref|XP_006346027.1|  PREDICTED: uncharacterized protein LOC102605389  91.7    6e-17    
ref|XP_004243971.1|  PREDICTED: uncharacterized protein LOC101254711  91.3    8e-17    
ref|WP_036002232.1|  ATP-dependent Zn protease                        89.7    8e-17    
ref|WP_027255391.1|  hypothetical protein                             89.4    8e-17    
ref|WP_015138693.1|  hypothetical protein                             89.4    9e-17    
ref|WP_039726475.1|  ATP-dependent Zn protease                        89.4    1e-16    
ref|WP_028083464.1|  hypothetical protein                             89.0    1e-16    
ref|XP_006858219.1|  hypothetical protein AMTR_s00062p00186450        90.5    1e-16    
gb|KDP25068.1|  hypothetical protein JCGZ_22603                       91.3    1e-16    
ref|WP_011613756.1|  hypothetical protein                             88.6    2e-16    
emb|CBI24181.3|  unnamed protein product                              90.9    2e-16    
ref|XP_007022576.1|  Uncharacterized protein isoform 1                90.9    2e-16    
ref|WP_015171342.1|  hypothetical protein                             88.6    2e-16    
ref|XP_010669996.1|  PREDICTED: uncharacterized protein LOC104887105  90.9    2e-16    
ref|XP_002263645.3|  PREDICTED: uncharacterized protein LOC100261626  90.5    2e-16    Vitis vinifera
ref|WP_006455994.1|  hypothetical protein                             88.2    2e-16    
ref|WP_015203927.1|  hypothetical protein                             88.2    2e-16    
ref|XP_009590707.1|  PREDICTED: uncharacterized protein LOC104087850  90.1    3e-16    
gb|KEI68740.1|  hypothetical protein A19Y_4027                        87.8    3e-16    
ref|XP_009039752.1|  hypothetical protein AURANDRAFT_72206            91.7    3e-16    
ref|XP_008447096.1|  PREDICTED: uncharacterized protein LOC103489...  90.1    3e-16    
ref|XP_004139896.1|  PREDICTED: uncharacterized protein LOC101213430  90.1    3e-16    
ref|XP_010060860.1|  PREDICTED: uncharacterized protein LOC104448685  89.7    4e-16    
ref|WP_038331353.1|  ATP-dependent Zn protease                        87.0    4e-16    
ref|WP_006518853.1|  hypothetical protein                             87.0    5e-16    
ref|WP_006633839.1|  hypothetical protein                             87.0    5e-16    
ref|NP_001046019.2|  Os02g0169000                                     89.4    5e-16    Oryza sativa Japonica Group [Japonica rice]
ref|WP_016951904.1|  hypothetical protein                             87.0    5e-16    
ref|WP_015115582.1|  hypothetical protein                             87.0    6e-16    
dbj|BAD25720.1|  unknown protein                                      89.0    6e-16    Oryza sativa Japonica Group [Japonica rice]
ref|WP_039200564.1|  ATP-dependent Zn protease                        87.0    7e-16    
ref|XP_003570102.1|  PREDICTED: uncharacterized protein LOC100846921  89.0    7e-16    
ref|WP_008179856.1|  hypothetical protein                             86.3    9e-16    
ref|XP_005706362.1|  hypothetical protein isoform 1                   88.2    1e-15    
ref|XP_010462482.1|  PREDICTED: uncharacterized protein LOC104743...  85.1    1e-15    
gb|AFK46324.1|  unknown                                               88.6    1e-15    
ref|XP_004951774.1|  PREDICTED: uncharacterized protein LOC101758555  88.6    1e-15    
emb|CDP13573.1|  unnamed protein product                              88.6    1e-15    
ref|XP_003596089.1|  hypothetical protein MTR_2g066060                88.2    1e-15    
ref|WP_026795707.1|  MULTISPECIES: hypothetical protein               85.9    1e-15    
ref|XP_011095720.1|  PREDICTED: uncharacterized protein LOC105175093  88.2    1e-15    
ref|WP_015175065.1|  hypothetical protein                             85.9    1e-15    
ref|WP_017718959.1|  hypothetical protein                             85.5    2e-15    
ref|XP_010260608.1|  PREDICTED: uncharacterized protein LOC104599679  87.8    2e-15    
ref|WP_027248908.1|  hypothetical protein                             85.5    2e-15    
ref|XP_004488764.1|  PREDICTED: uncharacterized protein LOC101507...  87.8    2e-15    
ref|XP_002453366.1|  hypothetical protein SORBIDRAFT_04g004670        87.8    2e-15    Sorghum bicolor [broomcorn]
gb|EYU27567.1|  hypothetical protein MIMGU_mgv1a008097mg              87.4    3e-15    
ref|WP_027404622.1|  hypothetical protein                             85.1    3e-15    
ref|XP_008798243.1|  PREDICTED: uncharacterized protein LOC103713192  87.4    3e-15    
gb|EEE69777.1|  hypothetical protein OsJ_29493                        81.6    3e-15    Oryza sativa Japonica Group [Japonica rice]
emb|CDY10505.1|  BnaC03g71090D                                        86.7    4e-15    
gb|ACF87710.1|  unknown                                               85.1    4e-15    Zea mays [maize]
gb|AAK32818.1|AF361805_1  At1g56180/F14G9_20                          86.7    4e-15    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001762437.1|  predicted protein                                85.1    5e-15    
ref|NP_564711.1|  uncharacterized protein                             86.7    5e-15    Arabidopsis thaliana [mouse-ear cress]
ref|WP_015145177.1|  hypothetical protein                             84.3    5e-15    
ref|XP_005831184.1|  hypothetical protein GUITHDRAFT_87555            86.3    5e-15    
gb|AAF02831.1|AC009894_2  Hypothetical protein                        86.3    5e-15    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106798.1|  PREDICTED: uncharacterized protein LOC103832...  86.3    5e-15    
ref|XP_010557268.1|  PREDICTED: uncharacterized protein LOC104826324  86.3    5e-15    
ref|XP_003546818.1|  PREDICTED: uncharacterized protein LOC100800880  86.3    5e-15    
ref|WP_026099936.1|  hypothetical protein                             84.0    5e-15    
ref|XP_002894564.1|  hypothetical protein ARALYDRAFT_474687           86.3    6e-15    
ref|NP_001130100.1|  uncharacterized protein LOC100191193             86.3    6e-15    Zea mays [maize]
gb|KHG21681.1|  ATP-dependent zinc metalloprotease FtsH 3             86.3    7e-15    
gb|ACG47252.1|  hypothetical protein                                  85.9    7e-15    Zea mays [maize]
ref|XP_011013836.1|  PREDICTED: uncharacterized protein LOC105117773  85.9    7e-15    
gb|KDO61590.1|  hypothetical protein CISIN_1g016454mg                 85.9    8e-15    
ref|XP_006393500.1|  hypothetical protein EUTSA_v10011505mg           86.3    8e-15    
ref|XP_006422252.1|  hypothetical protein CICLE_v10005140mg           85.9    8e-15    
ref|XP_006393498.1|  hypothetical protein EUTSA_v10011505mg           85.9    9e-15    
ref|WP_012268290.1|  hypothetical protein                             83.2    1e-14    
ref|WP_002759281.1|  hypothetical protein                             83.2    1e-14    
dbj|GAL92028.1|  hypothetical protein N44_00316                       83.2    1e-14    
ref|XP_002513354.1|  conserved hypothetical protein                   85.5    1e-14    Ricinus communis
ref|XP_008372153.1|  PREDICTED: uncharacterized protein LOC103435538  84.3    1e-14    
ref|WP_015120691.1|  hypothetical protein                             83.2    1e-14    
dbj|BAJ87062.1|  predicted protein                                    85.1    1e-14    
ref|WP_015127389.1|  hypothetical protein                             82.8    1e-14    
ref|XP_007148977.1|  hypothetical protein PHAVU_005G030300g           85.1    2e-14    
gb|ACG45567.1|  hypothetical protein                                  84.3    2e-14    Zea mays [maize]
ref|XP_010941658.1|  PREDICTED: uncharacterized protein LOC105059...  84.7    2e-14    
ref|XP_010501263.1|  PREDICTED: uncharacterized protein LOC104778504  84.7    2e-14    
ref|WP_002766973.1|  hypothetical protein                             82.4    2e-14    
emb|CBJ28498.1|  conserved unknown protein                            85.9    2e-14    
ref|XP_006305012.1|  hypothetical protein CARUB_v10009377mg           84.7    2e-14    
ref|XP_008372156.1|  PREDICTED: uncharacterized protein LOC103435541  84.7    2e-14    
ref|XP_010941655.1|  PREDICTED: uncharacterized protein LOC105059...  84.7    2e-14    
ref|WP_016514760.1|  hypothetical protein                             82.0    2e-14    
gb|KFK35531.1|  hypothetical protein AALP_AA4G002700                  84.3    2e-14    
ref|WP_015133963.1|  M41 family peptidase                             82.0    3e-14    
ref|WP_008207088.1|  hypothetical protein                             81.6    3e-14    
ref|XP_006646935.1|  PREDICTED: uncharacterized protein LOC102702250  83.6    3e-14    
ref|XP_002316146.2|  hypothetical protein POPTR_0010s17850g           84.0    3e-14    Populus trichocarpa [western balsam poplar]
ref|WP_002797278.1|  hypothetical protein                             81.6    4e-14    
ref|XP_005845454.1|  hypothetical protein CHLNCDRAFT_25833            82.0    4e-14    
ref|XP_004308253.1|  PREDICTED: uncharacterized protein LOC101300106  84.0    4e-14    
ref|WP_004157250.1|  hypothetical protein                             81.6    4e-14    
ref|WP_015956166.1|  hypothetical protein                             81.3    4e-14    
ref|WP_006102119.1|  hypothetical protein                             81.3    5e-14    
ref|WP_002782267.1|  hypothetical protein                             81.3    5e-14    
ref|WP_002791119.1|  hypothetical protein                             80.9    6e-14    
ref|WP_015196605.1|  hypothetical protein                             80.9    6e-14    
ref|XP_008226132.1|  PREDICTED: uncharacterized protein LOC103325727  83.2    7e-14    
ref|XP_007212262.1|  hypothetical protein PRUPE_ppa006642mg           83.2    7e-14    
ref|XP_010093312.1|  hypothetical protein L484_006771                 82.8    8e-14    
ref|WP_026785972.1|  hypothetical protein                             80.5    8e-14    
ref|WP_002737425.1|  hypothetical protein                             80.5    8e-14    
ref|WP_002801455.1|  hypothetical protein                             80.5    8e-14    
ref|WP_012160852.1|  hypothetical protein                             80.5    9e-14    
ref|WP_006510695.1|  hypothetical protein                             80.1    1e-13    
gb|EPS65428.1|  hypothetical protein M569_09348                       81.6    1e-13    
ref|WP_010474621.1|  hypothetical protein                             80.1    1e-13    
ref|WP_002754791.1|  hypothetical protein                             79.3    2e-13    
ref|XP_010462483.1|  PREDICTED: uncharacterized protein LOC104743...  78.6    2e-13    
ref|WP_015194303.1|  hypothetical protein                             79.0    3e-13    
ref|XP_008356157.1|  PREDICTED: uncharacterized protein LOC103419845  80.1    3e-13    
ref|WP_007354337.1|  MULTISPECIES: hypothetical protein               78.2    5e-13    
ref|WP_015226966.1|  hypothetical protein                             78.2    5e-13    
ref|XP_008364245.1|  PREDICTED: uncharacterized protein LOC103427939  80.1    7e-13    
ref|WP_017288276.1|  hypothetical protein                             77.4    1e-12    
ref|XP_009106797.1|  PREDICTED: uncharacterized protein LOC103832...  79.3    1e-12    
ref|XP_006393499.1|  hypothetical protein EUTSA_v10011505mg           79.3    1e-12    
ref|WP_017711813.1|  hypothetical protein                             77.0    1e-12    
ref|WP_006619355.1|  hypothetical protein                             76.6    2e-12    
gb|EWM26562.1|  hypothetical protein Naga_100084g7                    79.3    2e-12    
ref|XP_009417744.1|  PREDICTED: uncharacterized protein LOC103998076  78.6    2e-12    
ref|WP_009634131.1|  hypothetical protein                             76.6    2e-12    
ref|WP_015215362.1|  hypothetical protein                             76.3    2e-12    
ref|WP_024545220.1|  hypothetical protein                             75.9    3e-12    
gb|AHJ30075.1|  hypothetical protein NSP_37720                        75.5    3e-12    
ref|WP_009342478.1|  hypothetical protein                             75.5    4e-12    
ref|WP_013322143.1|  hypothetical protein                             75.5    4e-12    
ref|WP_015229271.1|  hypothetical protein                             75.9    4e-12    
ref|WP_006198832.1|  hypothetical protein                             75.5    4e-12    
ref|WP_019509095.1|  hypothetical protein                             74.3    1e-11    
ref|XP_005646206.1|  hypothetical protein COCSUDRAFT_33740            74.7    1e-11    
ref|XP_005792829.1|  hypothetical protein EMIHUDRAFT_57188            72.8    2e-11    
ref|WP_006278247.1|  hypothetical protein                             73.6    2e-11    
ref|WP_035992000.1|  ATP-dependent Zn protease                        73.6    2e-11    
ref|WP_036483415.1|  ATP-dependent Zn protease                        73.6    2e-11    
ref|WP_006626173.1|  MULTISPECIES: hypothetical protein               72.8    3e-11    
gb|EWM21637.1|  hypothetical protein Naga_100012g41                   75.1    3e-11    
ref|XP_005762339.1|  hypothetical protein EMIHUDRAFT_45563            71.6    4e-11    
ref|XP_001779710.1|  predicted protein                                73.2    5e-11    
ref|WP_017294749.1|  hypothetical protein                             71.2    1e-10    
ref|WP_022603839.1|  hypothetical protein                             71.2    1e-10    
ref|WP_012626760.1|  hypothetical protein                             70.9    1e-10    
ref|WP_012308442.1|  hypothetical protein                             70.9    1e-10    
ref|XP_002287278.1|  predicted protein                                70.5    1e-10    
ref|WP_030007713.1|  hypothetical protein                             70.9    1e-10    
ref|WP_006529177.1|  ATP-dependent Zn protease                        70.5    2e-10    
ref|WP_015168331.1|  hypothetical protein                             69.7    3e-10    
ref|XP_002184685.1|  predicted protein                                68.9    4e-10    
ref|WP_015158285.1|  ATP-dependent Zn protease                        69.3    4e-10    
ref|WP_011243732.1|  hypothetical protein                             68.6    7e-10    
ref|WP_015784372.1|  hypothetical protein                             68.9    7e-10    
ref|WP_011377432.1|  hypothetical protein                             68.9    7e-10    
ref|XP_002961125.1|  hypothetical protein SELMODRAFT_75099            69.7    9e-10    
ref|XP_002966885.1|  hypothetical protein SELMODRAFT_168681           69.7    9e-10    
ref|XP_011078009.1|  PREDICTED: uncharacterized protein LOC105161...  69.7    1e-09    
ref|WP_017297519.1|  hypothetical protein                             68.2    1e-09    
ref|XP_005837475.1|  hypothetical protein GUITHDRAFT_135159           70.1    2e-09    
ref|WP_012596518.1|  hypothetical protein                             67.4    2e-09    
ref|WP_015220310.1|  hypothetical protein                             67.4    2e-09    
ref|WP_010872056.1|  hypothetical protein                             67.4    2e-09    
gb|EJK47513.1|  hypothetical protein THAOC_33760                      69.3    2e-09    
ref|XP_004302472.1|  PREDICTED: uncharacterized protein LOC101309267  68.6    3e-09    
ref|WP_021831046.1|  hypothetical protein                             66.6    3e-09    
ref|XP_005718663.1|  unnamed protein product                          68.2    3e-09    
ref|XP_001418869.1|  predicted protein                                67.8    3e-09    
ref|WP_021834046.1|  Sll1738 protein                                  66.6    3e-09    
ref|WP_007303478.1|  hypothetical protein                             66.6    4e-09    
ref|XP_006394980.1|  hypothetical protein EUTSA_v10004533mg           68.2    4e-09    
ref|XP_008672986.1|  PREDICTED: stress regulated protein isoform X2   67.0    4e-09    
ref|XP_007515014.1|  predicted protein                                68.6    4e-09    
gb|KFM27635.1|  hypothetical protein F751_5599                        67.8    5e-09    
ref|XP_006857009.1|  hypothetical protein AMTR_s00197p00027670        67.4    5e-09    
tpg|DAA54593.1|  TPA: stress regulated protein                        67.4    7e-09    
gb|ACF82075.1|  unknown                                               67.4    7e-09    
ref|NP_001151260.1|  stress regulated protein                         67.4    7e-09    
emb|CEF98632.1|  unnamed product                                      65.9    7e-09    
gb|EHJ14939.1|  hypothetical protein CWATWH0003_0413                  65.1    8e-09    
ref|WP_015180856.1|  hypothetical protein                             65.5    1e-08    
ref|XP_001700231.1|  predicted protein                                65.9    1e-08    
ref|XP_009335653.1|  PREDICTED: uncharacterized protein LOC103928348  66.6    1e-08    
ref|XP_008246543.1|  PREDICTED: uncharacterized protein LOC103344701  66.6    1e-08    
ref|XP_006288255.1|  hypothetical protein CARUB_v10001500mg           65.5    1e-08    
ref|WP_009545321.1|  MULTISPECIES: hypothetical protein               64.7    1e-08    
ref|XP_005536786.1|  hypothetical protein, conserved                  66.2    2e-08    
ref|XP_006288256.1|  hypothetical protein CARUB_v10001500mg           65.5    2e-08    
ref|XP_010244616.1|  PREDICTED: uncharacterized protein LOC104588...  65.1    3e-08    
ref|XP_008370534.1|  PREDICTED: uncharacterized protein LOC103433999  65.1    3e-08    
ref|NP_001043093.1|  Os01g0382700                                     65.1    4e-08    
gb|EYU28387.1|  hypothetical protein MIMGU_mgv1a024158mg              64.7    4e-08    
ref|XP_007205504.1|  hypothetical protein PRUPE_ppa008298mg           65.1    4e-08    
gb|ABR17231.1|  unknown                                               65.1    5e-08    
gb|KDO37200.1|  hypothetical protein CISIN_1g019829mg                 64.7    5e-08    
ref|XP_002499536.1|  predicted protein                                63.5    5e-08    
ref|XP_009393244.1|  PREDICTED: uncharacterized protein LOC103978984  64.7    5e-08    
ref|XP_010025124.1|  PREDICTED: uncharacterized protein LOC104415507  64.3    6e-08    
ref|WP_009629358.1|  hypothetical protein                             63.2    6e-08    
ref|XP_004968786.1|  PREDICTED: uncharacterized protein LOC101776...  63.5    6e-08    
ref|XP_010494028.1|  PREDICTED: uncharacterized protein LOC104771231  64.3    7e-08    
ref|XP_010421644.1|  PREDICTED: uncharacterized protein LOC104707069  64.3    7e-08    
ref|XP_002872278.1|  hypothetical protein ARALYDRAFT_910860           64.3    7e-08    
ref|NP_568492.1|  uncharacterized protein                             64.3    7e-08    
tpg|DAA54594.1|  TPA: hypothetical protein ZEAMMB73_027015            63.9    7e-08    
ref|XP_010674978.1|  PREDICTED: uncharacterized protein LOC104891035  63.9    8e-08    
emb|CDP15829.1|  unnamed protein product                              63.9    1e-07    
ref|XP_006433241.1|  hypothetical protein CICLE_v10001775mg           63.5    1e-07    
ref|XP_002319039.2|  hypothetical protein POPTR_0013s03000g           63.5    1e-07    
ref|XP_002458075.1|  hypothetical protein SORBIDRAFT_03g026530        63.5    1e-07    
ref|XP_006433238.1|  hypothetical protein CICLE_v10001775mg           63.5    1e-07    
ref|XP_008807275.1|  PREDICTED: uncharacterized protein LOC103719691  63.5    1e-07    
ref|XP_004968785.1|  PREDICTED: uncharacterized protein LOC101776...  63.5    1e-07    
emb|CDY19716.1|  BnaA09g03690D                                        63.5    1e-07    
ref|XP_002512307.1|  conserved hypothetical protein                   63.2    1e-07    
gb|AAW65807.1|  stress regulated protein isoform 3                    63.2    2e-07    
ref|WP_017305499.1|  hypothetical protein                             61.6    2e-07    
ref|WP_011429303.1|  hypothetical protein                             61.6    2e-07    
emb|CDX99990.1|  BnaC09g03110D                                        62.8    2e-07    
ref|XP_003567712.1|  PREDICTED: uncharacterized protein LOC100844...  62.8    2e-07    
ref|XP_009111938.1|  PREDICTED: uncharacterized protein LOC103837...  62.8    2e-07    
gb|EMS52575.1|  hypothetical protein TRIUR3_14340                     62.8    2e-07    
gb|EMT23471.1|  hypothetical protein F775_15938                       62.8    2e-07    
ref|WP_019502731.1|  hypothetical protein                             60.8    3e-07    
ref|XP_009759314.1|  PREDICTED: uncharacterized protein LOC104211868  62.0    3e-07    
gb|ABN08173.1|  Peptidase, cysteine peptidase active site             62.0    4e-07    
ref|NP_001233778.1|  stress regulated protein                         62.0    4e-07    
ref|XP_002266105.1|  PREDICTED: uncharacterized protein LOC100267587  62.0    4e-07    
dbj|BAJ88888.1|  predicted protein                                    62.0    4e-07    
ref|WP_015222834.1|  hypothetical protein                             60.5    4e-07    
emb|CAN70022.1|  hypothetical protein VITISV_030170                   61.6    4e-07    
gb|KDP23574.1|  hypothetical protein JCGZ_23407                       61.6    5e-07    
ref|XP_010524890.1|  PREDICTED: uncharacterized protein LOC104802813  62.0    5e-07    
ref|XP_004157269.1|  PREDICTED: uncharacterized protein LOC101223311  61.2    5e-07    
ref|XP_004135643.1|  PREDICTED: uncharacterized protein LOC101213973  61.2    5e-07    
ref|XP_008450721.1|  PREDICTED: uncharacterized protein LOC103492...  61.6    6e-07    
ref|XP_008450722.1|  PREDICTED: uncharacterized protein LOC103492...  61.6    6e-07    
gb|AIE74336.1|  hypothetical protein D082_18080                       60.5    6e-07    
emb|CBJ34234.1|  conserved unknown protein                            58.9    6e-07    
ref|XP_006338258.1|  PREDICTED: uncharacterized protein LOC102604994  61.2    6e-07    
ref|WP_008277121.1|  hypothetical protein                             59.7    6e-07    
ref|XP_010941743.1|  PREDICTED: uncharacterized protein LOC105059...  61.2    7e-07    
ref|XP_010315882.1|  PREDICTED: stress regulated protein isoform X1   60.8    7e-07    
ref|XP_011023508.1|  PREDICTED: uncharacterized protein LOC105124970  60.8    7e-07    
gb|AAM65305.1|  unknown                                               60.8    9e-07    
ref|XP_006645915.1|  PREDICTED: uncharacterized protein LOC102713866  60.5    1e-06    
ref|XP_005822767.1|  hypothetical protein GUITHDRAFT_118063           60.8    1e-06    
ref|XP_004494650.1|  PREDICTED: uncharacterized protein LOC101514...  59.7    2e-06    
ref|XP_007030748.1|  A_TM021B04.11 protein                            59.7    2e-06    
ref|XP_003626343.1|  hypothetical protein MTR_7g114070                59.3    3e-06    
ref|XP_005792905.1|  hypothetical protein EMIHUDRAFT_251116           59.3    3e-06    
ref|XP_009601047.1|  PREDICTED: uncharacterized protein LOC104096...  58.5    3e-06    
ref|XP_003058284.1|  predicted protein                                58.2    5e-06    
ref|XP_009601046.1|  PREDICTED: uncharacterized protein LOC104096...  58.2    6e-06    
ref|XP_005782668.1|  hypothetical protein EMIHUDRAFT_456653           58.2    6e-06    
tpg|DAA54595.1|  TPA: hypothetical protein ZEAMMB73_027015            57.4    7e-06    
ref|XP_005777217.1|  hypothetical protein EMIHUDRAFT_457692           58.2    8e-06    
gb|KCW61717.1|  hypothetical protein EUGRSUZ_H04431                   57.8    8e-06    
ref|XP_005708761.1|  sarcosine dimethylglycine methyltransferase      58.2    1e-05    
ref|WP_015163685.1|  hypothetical protein                             57.0    1e-05    
ref|XP_008672985.1|  PREDICTED: stress regulated protein isoform X1   57.4    1e-05    
ref|XP_009111939.1|  PREDICTED: uncharacterized protein LOC103837...  57.4    1e-05    
gb|EPS73376.1|  hypothetical protein M569_01378                       58.2    1e-05    
ref|XP_010941744.1|  PREDICTED: uncharacterized protein LOC105059...  55.5    4e-05    
gb|KHN04030.1|  hypothetical protein glysoja_022716                   55.1    6e-05    
ref|XP_010244612.1|  PREDICTED: uncharacterized protein LOC104588403  54.7    8e-05    
gb|EEC70682.1|  hypothetical protein OsI_02018                        54.7    8e-05    
gb|EMS56117.1|  hypothetical protein TRIUR3_08893                     52.8    9e-05    
ref|WP_013191856.1|  hypothetical protein                             51.6    3e-04    
gb|EMT19149.1|  hypothetical protein F775_19494                       53.1    3e-04    
ref|XP_011078011.1|  PREDICTED: uncharacterized protein LOC105161...  52.4    4e-04    
ref|XP_004494651.1|  PREDICTED: uncharacterized protein LOC101514...  52.4    4e-04    
ref|XP_007147094.1|  hypothetical protein PHAVU_006G095900g           52.4    5e-04    
emb|CBN74291.1|  conserved unknown protein                            52.0    6e-04    
gb|KHG21903.1|  Eukaryotic translation initiation factor 3 subunit I  51.6    6e-04    
ref|XP_002181760.1|  predicted protein                                52.0    8e-04    
ref|XP_010497278.1|  PREDICTED: uncharacterized protein LOC104774...  48.9    0.001    



>ref|XP_009785171.1| PREDICTED: uncharacterized protein LOC104233475 [Nicotiana sylvestris]
Length=333

 Score =   504 bits (1298),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 242/273 (89%), Positives = 260/273 (95%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGVDL+ LQ+A+SKKDS AVKEALDQL EVGWA+ WSSQPYVSRRTTS+RELTTLGI+NA
Sbjct  50    PGVDLSTLQTAISKKDSNAVKEALDQLVEVGWARKWSSQPYVSRRTTSLRELTTLGIKNA  109

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISL+VL +GS SPG
Sbjct  110   ENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLVVLGIGSTSPG  169

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAIDGFSSFFPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+LEKL
Sbjct  170   LLQAAIDGFSSFFPDYQERIARHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLEKL  229

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLD+KE+DRLAVVAMAGLAAEGLKYDKV+GQSADLFTLQRF+NRSKP+LSKDQQQN
Sbjct  230   IYSGQLDSKELDRLAVVAMAGLAAEGLKYDKVIGQSADLFTLQRFLNRSKPSLSKDQQQN  289

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFAGSLLKNN  L+EALI AM+ KASV
Sbjct  290   LTRWAVLFAGSLLKNNSKLHEALITAMANKASV  322



>ref|XP_002307128.2| hypothetical protein POPTR_0005s08630g [Populus trichocarpa]
 gb|EEE94124.2| hypothetical protein POPTR_0005s08630g [Populus trichocarpa]
Length=321

 Score =   503 bits (1296),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 241/273 (88%), Positives = 258/273 (95%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGVDL  L+SAL+KKDS AVKEALDQL EVGWAK WSSQPYVSRRTTS+RELT+LGI+NA
Sbjct  38    PGVDLKTLESALAKKDSNAVKEALDQLREVGWAKRWSSQPYVSRRTTSLRELTSLGIKNA  97

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISL+VLAVGSISPG
Sbjct  98    ENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLVVLAVGSISPG  157

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI GFS+ FPDYQERIA HEAAHFL+ YL+GLPILDYSLDIGKEHVNLIDEKLEKL
Sbjct  158   LLQAAISGFSAVFPDYQERIARHEAAHFLIGYLIGLPILDYSLDIGKEHVNLIDEKLEKL  217

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVVAMAGLAAEGL+YDKVVGQSADLFTLQRFINRSKP +SKDQQQN
Sbjct  218   IYSGQLDAKELDRLAVVAMAGLAAEGLQYDKVVGQSADLFTLQRFINRSKPQISKDQQQN  277

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLF GSL+KNNK L+EAL+ AMS KA+V
Sbjct  278   LTRWAVLFGGSLIKNNKSLHEALMTAMSNKATV  310



>ref|XP_011090626.1| PREDICTED: uncharacterized protein LOC105171265 isoform X1 [Sesamum 
indicum]
Length=327

 Score =   503 bits (1296),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 256/303 (84%), Positives = 273/303 (90%), Gaps = 4/303 (1%)
 Frame = +3

Query  201   RTSTPNPRRKWRL----TITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEV  368
             R +T NP     L    +  L   +SSSAAPG+DLT L+SA +KKDS AVKEALDQLSEV
Sbjct  14    RPTTFNPAHDSNLLTKPSKRLKVRASSSAAPGIDLTTLESAFAKKDSDAVKEALDQLSEV  73

Query  369   GWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAG  548
             GWAK WSSQPYVSRRTTS+RELT+LGI+NAENL IPS RNDAAFLFTVVGTTGFLGVLAG
Sbjct  74    GWAKKWSSQPYVSRRTTSLRELTSLGIKNAENLAIPSTRNDAAFLFTVVGTTGFLGVLAG  133

Query  549   QLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLV  728
             QLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAI GFSSFFPDYQERIA HEAAHFLV
Sbjct  134   QLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIGGFSSFFPDYQERIARHEAAHFLV  193

Query  729   AYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYD  908
             AYLLGLPIL YSLDIGKEHVNLIDE+LEKLIYSGQLDAKE+DRLAVVAMAGLAAEGL+YD
Sbjct  194   AYLLGLPILGYSLDIGKEHVNLIDERLEKLIYSGQLDAKELDRLAVVAMAGLAAEGLQYD  253

Query  909   KVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKK  1088
             KVVGQSADLFTLQRFINRSKP LSKDQQQNLTRWAVLFA SL+KNN+ L+EAL+ AMS K
Sbjct  254   KVVGQSADLFTLQRFINRSKPQLSKDQQQNLTRWAVLFAASLIKNNRLLHEALMSAMSNK  313

Query  1089  ASV  1097
             A+V
Sbjct  314   ATV  316



>ref|XP_011021935.1| PREDICTED: uncharacterized protein LOC105123871 isoform X1 [Populus 
euphratica]
Length=316

 Score =   503 bits (1294),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 242/273 (89%), Positives = 258/273 (95%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGVDL  L+SAL+KKDS AVKEALDQLSEVGWAK WSSQPYVSRRTTS+R LTTLGI+NA
Sbjct  33    PGVDLKNLESALAKKDSNAVKEALDQLSEVGWAKRWSSQPYVSRRTTSLRVLTTLGIKNA  92

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISL+VLAVGSISPG
Sbjct  93    ENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLVVLAVGSISPG  152

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI GFS+ FPDYQERIA HEAAHFL+ YL+GLPILDYSLDIGKEHVNLIDEKLEKL
Sbjct  153   LLQAAISGFSAVFPDYQERIARHEAAHFLIGYLIGLPILDYSLDIGKEHVNLIDEKLEKL  212

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVVAMAGLAAEGL+YDKVVGQSADLFTLQRFINRSKP +SKDQQQN
Sbjct  213   IYSGQLDAKELDRLAVVAMAGLAAEGLQYDKVVGQSADLFTLQRFINRSKPQISKDQQQN  272

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLF GSL+KNNK L+EAL+ AMS KA+V
Sbjct  273   LTRWAVLFGGSLIKNNKSLHEALMTAMSNKATV  305



>emb|CDP12902.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   502 bits (1293),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 251/294 (85%), Positives = 270/294 (92%), Gaps = 0/294 (0%)
 Frame = +3

Query  216   NPRRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQ  395
             N R  +R  ++    +SSSAA GVDL+ L+SA+SKK+S AVKE LDQLSEVGWAK WSSQ
Sbjct  25    NNRTCFRHPMSWRIRASSSAASGVDLSILESAISKKESDAVKEVLDQLSEVGWAKRWSSQ  84

Query  396   PYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFF  575
             PYVSRRTTS+RELTTLGI+NAENL IPS+RNDAAFLFTVVGTTGFLGVL  QLPGDWGFF
Sbjct  85    PYVSRRTTSLRELTTLGIKNAENLAIPSVRNDAAFLFTVVGTTGFLGVLTSQLPGDWGFF  144

Query  576   VPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPIL  755
             +PYLIGSISLIVLAVGS+SPGLLQAAI GF+SFFPDYQERIA HEAAHFLVAYLLGLPIL
Sbjct  145   LPYLIGSISLIVLAVGSVSPGLLQAAIGGFASFFPDYQERIARHEAAHFLVAYLLGLPIL  204

Query  756   DYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADL  935
              YSLDIGKEHVNLIDEKLEKLIYSGQLDAKE+DRLAV+AMAGLAAEGL YDKVVGQSADL
Sbjct  205   GYSLDIGKEHVNLIDEKLEKLIYSGQLDAKELDRLAVIAMAGLAAEGLTYDKVVGQSADL  264

Query  936   FTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             FTLQRFINRSKP LSKDQQQNLTRWAVLF+GSLLKNNK L+EALI AMSKKA+V
Sbjct  265   FTLQRFINRSKPQLSKDQQQNLTRWAVLFSGSLLKNNKALHEALISAMSKKATV  318



>ref|XP_002276081.1| PREDICTED: uncharacterized protein LOC100264638 isoform X1 [Vitis 
vinifera]
 ref|XP_010652856.1| PREDICTED: uncharacterized protein LOC100264638 isoform X1 [Vitis 
vinifera]
 ref|XP_010652857.1| PREDICTED: uncharacterized protein LOC100264638 isoform X1 [Vitis 
vinifera]
 emb|CBI21505.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   501 bits (1291),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 249/309 (81%), Positives = 269/309 (87%), Gaps = 7/309 (2%)
 Frame = +3

Query  171   TQYNTLQFIPRTSTPNPRRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEAL  350
             ++   + F    +     RKWR+  +       SAAPGVDL  LQSA+  KDS AVKEAL
Sbjct  12    SELRCIGFESHHTCFRNTRKWRIRSS-------SAAPGVDLNTLQSAIDMKDSNAVKEAL  64

Query  351   DQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGF  530
             DQL EVGWAK WSSQPYVSRR TS+RELTTLG++NAENL IPS+RNDAAFLFTVVGTTGF
Sbjct  65    DQLREVGWAKKWSSQPYVSRRMTSLRELTTLGMKNAENLAIPSVRNDAAFLFTVVGTTGF  124

Query  531   LGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHE  710
             LGVLAGQLPGDWGFFVPYLIGSISLIVLA+GSISPGLLQ AI GFSSFFPDYQERIA HE
Sbjct  125   LGVLAGQLPGDWGFFVPYLIGSISLIVLAIGSISPGLLQVAIGGFSSFFPDYQERIARHE  184

Query  711   AAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAA  890
             AAHFLVAYLLGLPIL YSLDIGKEHVNLIDE+LEKLIYSGQLD KE+DRLAVVAMAGLAA
Sbjct  185   AAHFLVAYLLGLPILGYSLDIGKEHVNLIDERLEKLIYSGQLDTKELDRLAVVAMAGLAA  244

Query  891   EGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALI  1070
             EGL+YDKVVGQSADLFTLQRFINRSKP LSKDQQQNLTRWAVLFAGSL+KNNK ++EAL+
Sbjct  245   EGLQYDKVVGQSADLFTLQRFINRSKPQLSKDQQQNLTRWAVLFAGSLIKNNKAIHEALM  304

Query  1071  GAMSKKASV  1097
              AMSKK +V
Sbjct  305   TAMSKKGTV  313



>ref|XP_009605619.1| PREDICTED: uncharacterized protein LOC104100151 [Nicotiana tomentosiformis]
Length=337

 Score =   501 bits (1289),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 241/273 (88%), Positives = 259/273 (95%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGVDL+ LQ+A+SKKDS AVKEALDQL EVGWA+ WSSQPYVSRRTTS+RELT LGI+NA
Sbjct  54    PGVDLSTLQTAISKKDSNAVKEALDQLVEVGWARKWSSQPYVSRRTTSLRELTILGIKNA  113

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISL+VL +GS SPG
Sbjct  114   ENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLVVLGIGSTSPG  173

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAIDGFSSFFPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+LEKL
Sbjct  174   LLQAAIDGFSSFFPDYQERIARHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLEKL  233

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLD+KE+DRLAVVAMAGLAAEGLKYDKV+GQSADLFTLQRF+NRSKP+LSKDQQQN
Sbjct  234   IYSGQLDSKELDRLAVVAMAGLAAEGLKYDKVIGQSADLFTLQRFLNRSKPSLSKDQQQN  293

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFAGSLLKNN  L+EALI AM+ KASV
Sbjct  294   LTRWAVLFAGSLLKNNSKLHEALITAMANKASV  326



>ref|XP_010261112.1| PREDICTED: uncharacterized protein LOC104600018 [Nelumbo nucifera]
Length=324

 Score =   496 bits (1277),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 246/308 (80%), Positives = 273/308 (89%), Gaps = 14/308 (5%)
 Frame = +3

Query  174   QYNTLQFIPRTSTPNPRRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALD  353
             +YN   F       N +++W          +SSAAPGVDL  L++AL+KKD+ AVKEALD
Sbjct  20    EYNHKSF-------NTQKRW-------TTRASSAAPGVDLKTLEAALAKKDTDAVKEALD  65

Query  354   QLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFL  533
             QLSEVGW K WSSQPYVSRR+TS+RELTTLGI+NAENL IPS+RNDAAFLFTVVGTTGFL
Sbjct  66    QLSEVGWTKKWSSQPYVSRRSTSLRELTTLGIKNAENLAIPSVRNDAAFLFTVVGTTGFL  125

Query  534   GVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEA  713
             GVLAGQLPGDWGFFVPYLIGSISLIVLA+GSISPGLLQAAI GFSSFFPDYQER+A HEA
Sbjct  126   GVLAGQLPGDWGFFVPYLIGSISLIVLAIGSISPGLLQAAIGGFSSFFPDYQERVARHEA  185

Query  714   AHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAE  893
             AHFLVAYL+GLPIL YSLDIGKEHVNL+DE+L+KLIYSGQLDAKE+DRLAVV+MAGLAAE
Sbjct  186   AHFLVAYLIGLPILGYSLDIGKEHVNLVDERLQKLIYSGQLDAKELDRLAVVSMAGLAAE  245

Query  894   GLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIG  1073
             GLKYDKVVGQSADLFTLQRFINRSKP +SK+QQQNLTRWAVLF+GSLLKNNK  +EAL+ 
Sbjct  246   GLKYDKVVGQSADLFTLQRFINRSKPQISKEQQQNLTRWAVLFSGSLLKNNKVAHEALMS  305

Query  1074  AMSKKASV  1097
             AMS KA+V
Sbjct  306   AMSNKATV  313



>ref|XP_010027772.1| PREDICTED: uncharacterized protein LOC104418200 [Eucalyptus grandis]
 gb|KCW54371.1| hypothetical protein EUGRSUZ_I00323 [Eucalyptus grandis]
Length=343

 Score =   496 bits (1278),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 247/294 (84%), Positives = 269/294 (91%), Gaps = 8/294 (3%)
 Frame = +3

Query  219   PRR-KWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQ  395
             PR+ +WR++ +       SAAPGVDL  L+SA++KKDS AVK+ALDQLSE+GWAK W SQ
Sbjct  46    PRQLQWRISAS-------SAAPGVDLNALESAIAKKDSDAVKDALDQLSELGWAKKWGSQ  98

Query  396   PYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFF  575
             PYVSRRTTS+RELTTLG++NAENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFF
Sbjct  99    PYVSRRTTSLRELTTLGMKNAENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFF  158

Query  576   VPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPIL  755
             VPYL+GSISLIVL VGS SPGLLQAAI GFSS FPDYQERIA HEAAHFLVAYL+GLPIL
Sbjct  159   VPYLVGSISLIVLGVGSTSPGLLQAAISGFSSVFPDYQERIARHEAAHFLVAYLIGLPIL  218

Query  756   DYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADL  935
              YSLDIGKEHVNLID++LEKLIYSGQLD+KE+DRLAVVAMAGLAAEGLKYDKVVGQSADL
Sbjct  219   GYSLDIGKEHVNLIDKRLEKLIYSGQLDSKELDRLAVVAMAGLAAEGLKYDKVVGQSADL  278

Query  936   FTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             FTLQRFINRSKP LSKDQQQNLTRWAVLFAGSLLKNN  LYEAL+ AMS+KASV
Sbjct  279   FTLQRFINRSKPQLSKDQQQNLTRWAVLFAGSLLKNNVVLYEALMAAMSRKASV  332



>gb|KDP35243.1| hypothetical protein JCGZ_09402 [Jatropha curcas]
Length=313

 Score =   494 bits (1271),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 241/273 (88%), Positives = 256/273 (94%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             P VDL  LQSAL KKDS AVKEALDQL E GWA+ WSSQPYVSRRTTSVRELTTLGI+NA
Sbjct  30    PRVDLNTLQSALDKKDSNAVKEALDQLKEDGWAQRWSSQPYVSRRTTSVRELTTLGIKNA  89

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG
Sbjct  90    ENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  149

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI GFSS FPDYQ+RIA HEAAHFL+AYLLGLPILDYSLDIGKEHVNLID++LEKL
Sbjct  150   LLQAAISGFSSVFPDYQDRIARHEAAHFLIAYLLGLPILDYSLDIGKEHVNLIDQRLEKL  209

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVVAMAGLAAEGL+YDKV+GQSADLF+LQRFINRSKP LSKDQQQN
Sbjct  210   IYSGQLDAKELDRLAVVAMAGLAAEGLQYDKVIGQSADLFSLQRFINRSKPQLSKDQQQN  269

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFAGSL+KNNK L+EAL+ AM  KA+V
Sbjct  270   LTRWAVLFAGSLVKNNKLLHEALMKAMLSKANV  302



>ref|XP_008232727.1| PREDICTED: uncharacterized protein LOC103331836 [Prunus mume]
Length=323

 Score =   493 bits (1270),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 237/273 (87%), Positives = 256/273 (94%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGVDL  LQSA++KKDS AVKEALDQLSEVGWAK WSSQPYVSRRTTS+RELTTLGI+NA
Sbjct  40    PGVDLNTLQSAIAKKDSSAVKEALDQLSEVGWAKKWSSQPYVSRRTTSLRELTTLGIKNA  99

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             E L +PS+RNDAAFLFTVVGTTGFLG+LAGQLPGDWGFFVPYL+GSISLIVL VGS +PG
Sbjct  100   ETLAVPSVRNDAAFLFTVVGTTGFLGLLAGQLPGDWGFFVPYLLGSISLIVLGVGSTAPG  159

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI  FSSFFPDYQERIA HEAAHFLVAYLLGLPIL YSLDIGKEHVNLIDE+LEKL
Sbjct  160   LLQAAISSFSSFFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDERLEKL  219

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVVAMAGLAAEGL YDKV+GQSADLF+LQRFINRSKP LSK+QQQN
Sbjct  220   IYSGQLDAKELDRLAVVAMAGLAAEGLTYDKVIGQSADLFSLQRFINRSKPQLSKEQQQN  279

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFAGSLLKN+K ++EALI AMS KA++
Sbjct  280   LTRWAVLFAGSLLKNDKEIHEALITAMSNKATI  312



>ref|XP_004304856.1| PREDICTED: uncharacterized protein LOC101297070 [Fragaria vesca 
subsp. vesca]
Length=322

 Score =   493 bits (1270),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 246/290 (85%), Positives = 269/290 (93%), Gaps = 1/290 (0%)
 Frame = +3

Query  228   KWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVS  407
             KWRL    S+AS+SSAAPGVDLT LQSA+ KKDS AVKEALDQL E GWAK WSSQPYVS
Sbjct  23    KWRLGAA-SSASASSAAPGVDLTTLQSAIEKKDSGAVKEALDQLKEAGWAKKWSSQPYVS  81

Query  408   RRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYL  587
             RRTTS+RELTTLGI+NAE L +PS+RNDAAFLFTVVGTTGF+G+LAGQLPGDWGFFVPYL
Sbjct  82    RRTTSIRELTTLGIKNAETLAVPSVRNDAAFLFTVVGTTGFIGLLAGQLPGDWGFFVPYL  141

Query  588   IGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSL  767
             +GSISL+VL VGS SPGLLQAAI  FSSFFPDYQERIA+HEAAHFLVAYLLGLPIL YSL
Sbjct  142   VGSISLVVLGVGSTSPGLLQAAISSFSSFFPDYQERIASHEAAHFLVAYLLGLPILGYSL  201

Query  768   DIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQ  947
             DIGKEHVNLID++LEKLIYSGQLDAKE+DRLAVVAMAGLAAEGLKYDKV+GQSADLFTLQ
Sbjct  202   DIGKEHVNLIDQRLEKLIYSGQLDAKELDRLAVVAMAGLAAEGLKYDKVIGQSADLFTLQ  261

Query  948   RFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             RFINRSKP +SKDQQQNLTRWAVLFAGSL+KN+K ++EALI AMS KA++
Sbjct  262   RFINRSKPQISKDQQQNLTRWAVLFAGSLIKNDKAMHEALIAAMSNKATI  311



>ref|XP_006346727.1| PREDICTED: uncharacterized protein LOC102584063 [Solanum tuberosum]
Length=328

 Score =   493 bits (1269),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 236/272 (87%), Positives = 256/272 (94%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             GVDL+ LQ+A+SKKDS AVKEALDQL E+GW+K W SQPYVSRRTTS+RELTTLGI+NAE
Sbjct  46    GVDLSNLQTAISKKDSNAVKEALDQLVEIGWSKKWGSQPYVSRRTTSLRELTTLGIKNAE  105

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
             NL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISL+VL +GS SP L
Sbjct  106   NLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLVVLGIGSTSPAL  165

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAIDGFSSFFPDYQERIA HEAAHFLV+YL+G+PIL YSLDIGKEHVNLIDE+LEKLI
Sbjct  166   LQAAIDGFSSFFPDYQERIARHEAAHFLVSYLIGVPILGYSLDIGKEHVNLIDERLEKLI  225

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD+KE+DRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRF+NRSKP+LSKDQQQNL
Sbjct  226   YSGQLDSKELDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFLNRSKPSLSKDQQQNL  285

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVLFA SLLKNN  L+EALI AM+ KASV
Sbjct  286   TRWAVLFAASLLKNNSKLHEALITAMTNKASV  317



>ref|XP_008342852.1| PREDICTED: uncharacterized protein LOC103405615 [Malus domestica]
Length=322

 Score =   492 bits (1267),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 237/272 (87%), Positives = 257/272 (94%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             GVDL  LQSA++KKDS AVK+ALDQLS++GWAK WSSQPYVSRRTTS+RELTTLGI+NAE
Sbjct  40    GVDLNTLQSAIAKKDSSAVKQALDQLSDIGWAKKWSSQPYVSRRTTSLRELTTLGIKNAE  99

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L +PS+RNDAAFLFTVVGTTGFLG+LAGQLPGDWGFFVPYL+GSISLIVL VGS +PGL
Sbjct  100   TLAVPSVRNDAAFLFTVVGTTGFLGLLAGQLPGDWGFFVPYLLGSISLIVLGVGSTAPGL  159

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFSSFFPDYQERIA HEAAHFLVAYLLGLPIL YSLDIGKEHVNLIDE+LEKLI
Sbjct  160   LQAAISGFSSFFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDERLEKLI  219

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLDAKE+DRLAVVAMAGLAAEGLKYDKV+GQSADLFTLQRFINRSKP LSKDQQQNL
Sbjct  220   YSGQLDAKELDRLAVVAMAGLAAEGLKYDKVIGQSADLFTLQRFINRSKPQLSKDQQQNL  279

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVLFAGSLLKN+K ++EALI AMS KA++
Sbjct  280   TRWAVLFAGSLLKNDKVIHEALITAMSNKATI  311



>ref|XP_007205553.1| hypothetical protein PRUPE_ppa008614mg [Prunus persica]
 gb|EMJ06752.1| hypothetical protein PRUPE_ppa008614mg [Prunus persica]
Length=325

 Score =   492 bits (1267),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 236/273 (86%), Positives = 256/273 (94%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGV+L  LQSA++KKDS AVKEALDQLSEVGWAK WSSQPYVSRRTTS+RELTTLGI+NA
Sbjct  42    PGVELNTLQSAIAKKDSSAVKEALDQLSEVGWAKKWSSQPYVSRRTTSLRELTTLGIKNA  101

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             E L +PS+RNDAAFLFTVVGTTGFLG+LAGQLPGDWGFFVPYLIGSISL+VL VGS +PG
Sbjct  102   ETLAVPSVRNDAAFLFTVVGTTGFLGLLAGQLPGDWGFFVPYLIGSISLVVLGVGSTAPG  161

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI  FSSFFPDYQERIA HEAAHFLVAYLLGLPIL YSLDIGKEHVNLIDE+LEKL
Sbjct  162   LLQAAISSFSSFFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDERLEKL  221

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVVAMAGLAAEGL YDKV+GQSADLF+LQRFINRSKP LSK+QQQN
Sbjct  222   IYSGQLDAKELDRLAVVAMAGLAAEGLTYDKVIGQSADLFSLQRFINRSKPQLSKEQQQN  281

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFAGSLLKN+K ++EALI AMS KA++
Sbjct  282   LTRWAVLFAGSLLKNDKEIHEALITAMSNKATI  314



>ref|XP_010937045.1| PREDICTED: uncharacterized protein LOC105056527 isoform X1 [Elaeis 
guineensis]
Length=324

 Score =   491 bits (1265),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 241/291 (83%), Positives = 265/291 (91%), Gaps = 7/291 (2%)
 Frame = +3

Query  225   RKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYV  404
             +KWR+  +       SAAPGVDL  L++A++KKDS AVKE LDQLS++GWAK WSSQPYV
Sbjct  30    KKWRIGAS-------SAAPGVDLKALEAAIAKKDSNAVKEILDQLSQIGWAKKWSSQPYV  82

Query  405   SRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPY  584
             SRRTTS+RELTTLGI+NAENL IPS+RNDAAFLFTVVG TGFLGV+AGQLPGDWGFFVPY
Sbjct  83    SRRTTSLRELTTLGIKNAENLAIPSVRNDAAFLFTVVGVTGFLGVIAGQLPGDWGFFVPY  142

Query  585   LIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYS  764
             L+GSISLIVLA+GSISPGLLQAAI GFSSFFPDYQERIA HEAAHFLVAYL+GLPIL YS
Sbjct  143   LLGSISLIVLAIGSISPGLLQAAIGGFSSFFPDYQERIARHEAAHFLVAYLIGLPILGYS  202

Query  765   LDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTL  944
             LDIGKEHVNL+DE LEKL+YSGQLD KE+DRLAVV+MAGLAAEGLKYDKVVGQSADLFTL
Sbjct  203   LDIGKEHVNLVDESLEKLVYSGQLDDKELDRLAVVSMAGLAAEGLKYDKVVGQSADLFTL  262

Query  945   QRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QRFINRSKP +SK+QQ+NLTRWAVLFAGSLLKNN   YEAL+ AMSKKASV
Sbjct  263   QRFINRSKPQISKEQQKNLTRWAVLFAGSLLKNNAVAYEALMSAMSKKASV  313



>ref|XP_007159758.1| hypothetical protein PHAVU_002G264700g [Phaseolus vulgaris]
 gb|ESW31752.1| hypothetical protein PHAVU_002G264700g [Phaseolus vulgaris]
Length=322

 Score =   490 bits (1262),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 238/273 (87%), Positives = 255/273 (93%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PG+DL  LQSA+SKKDS AVKEALDQL EVGWAK WSSQPYVSRRTTS+RELTTLGI+NA
Sbjct  39    PGIDLNTLQSAISKKDSDAVKEALDQLGEVGWAKKWSSQPYVSRRTTSLRELTTLGIKNA  98

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGF  VLAGQLPGDWGFFVPYLIGSISL+VLAVGSISPG
Sbjct  99    ENLAIPSVRNDAAFLFTVVGTTGFFAVLAGQLPGDWGFFVPYLIGSISLVVLAVGSISPG  158

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI  FSS FPDYQERIA HEAAHFL+AYLLGLPIL YSLDIGKEHVNLID++LEKL
Sbjct  159   LLQAAISSFSSLFPDYQERIARHEAAHFLIAYLLGLPILGYSLDIGKEHVNLIDDRLEKL  218

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVV+MAGLAAEGL YDKV+GQSADLFTLQRF+NR+KP LSKDQQQN
Sbjct  219   IYSGQLDAKELDRLAVVSMAGLAAEGLTYDKVIGQSADLFTLQRFLNRTKPPLSKDQQQN  278

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFA SLLKNNK L+EAL+ AM+KKASV
Sbjct  279   LTRWAVLFAASLLKNNKVLHEALMEAMAKKASV  311



>ref|XP_010681086.1| PREDICTED: uncharacterized protein LOC104896084 [Beta vulgaris 
subsp. vulgaris]
Length=343

 Score =   491 bits (1264),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 240/292 (82%), Positives = 266/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  222   RRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPY  401
             R K RLTI  S++S+++A P VD  PLQSAL KKDS AVKEALDQL E GWAK W+SQPY
Sbjct  42    RCKKRLTIITSSSSTANALPAVDFNPLQSALEKKDSDAVKEALDQLREAGWAKRWTSQPY  101

Query  402   VSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVP  581
             VSRRTTS+RELTTLGI+NAENL IPS+RNDAAFLFTVVG+TGFLG+LAGQLPGDWGFFVP
Sbjct  102   VSRRTTSLRELTTLGIKNAENLAIPSVRNDAAFLFTVVGSTGFLGLLAGQLPGDWGFFVP  161

Query  582   YLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDY  761
             YL+GSISL+VLAVGS +PGLLQAAI GFS  FPDYQERI++HEAAHFLVAYLLGLPILDY
Sbjct  162   YLLGSISLVVLAVGSTAPGLLQAAIGGFSVVFPDYQERISSHEAAHFLVAYLLGLPILDY  221

Query  762   SLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFT  941
             SLDIGKEHVNLI +KLEKLIYSGQLD+KE+DRLAVV+MAGLAAEGLKYDKV+GQSADLF+
Sbjct  222   SLDIGKEHVNLISDKLEKLIYSGQLDSKELDRLAVVSMAGLAAEGLKYDKVIGQSADLFS  281

Query  942   LQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LQRFINRS P LSKDQQQNLTRWA LFA SLLKNNK ++EAL+  MSKKA+V
Sbjct  282   LQRFINRSTPQLSKDQQQNLTRWAALFAASLLKNNKTVHEALMAEMSKKATV  333



>ref|XP_004236712.1| PREDICTED: uncharacterized protein LOC101250205 [Solanum lycopersicum]
Length=330

 Score =   489 bits (1260),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 234/271 (86%), Positives = 255/271 (94%), Gaps = 0/271 (0%)
 Frame = +3

Query  285   VDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAEN  464
             VDL+ L++A+SKKDS AVKEALDQL E+GW+K W SQPYVSRRTTS+RELTTLGI+NAEN
Sbjct  49    VDLSTLRTAISKKDSNAVKEALDQLVEIGWSKKWGSQPYVSRRTTSLRELTTLGIKNAEN  108

Query  465   LGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLL  644
             L IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISL+VL +GS SP LL
Sbjct  109   LAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLVVLGIGSTSPALL  168

Query  645   QAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIY  824
             QAAIDGFSSFFPDYQERIA HEAAHFLV+YL+G+PIL YSLDIGKEHVNLIDE+LEKLIY
Sbjct  169   QAAIDGFSSFFPDYQERIARHEAAHFLVSYLIGVPILGYSLDIGKEHVNLIDERLEKLIY  228

Query  825   SGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLT  1004
             SGQLD+KE+DRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRF+NRSKP+LSKDQQQNLT
Sbjct  229   SGQLDSKELDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFLNRSKPSLSKDQQQNLT  288

Query  1005  RWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             RWAVLFA SLLKNN  L+EALI AM+ KASV
Sbjct  289   RWAVLFAASLLKNNSKLHEALIAAMTNKASV  319



>ref|XP_009343096.1| PREDICTED: uncharacterized protein LOC103935053 [Pyrus x bretschneideri]
Length=329

 Score =   489 bits (1260),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 234/272 (86%), Positives = 256/272 (94%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             GV+L  LQSA++KKDS AVK+ALDQLSE+GWAK WSSQPYVSRRTTS+RELTTLGI+NAE
Sbjct  47    GVELNTLQSAIAKKDSSAVKQALDQLSEIGWAKKWSSQPYVSRRTTSLRELTTLGIKNAE  106

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L +PS+RNDAAFLFTVVGTTGFLG+LAGQLPGDWGFFVPYL+GSISL+VL VGS +PGL
Sbjct  107   TLAVPSVRNDAAFLFTVVGTTGFLGLLAGQLPGDWGFFVPYLVGSISLVVLGVGSTAPGL  166

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFSSFFPDYQERIA HEAAHFLVAYLLGLPIL YSLDIGKEHVNL DE+LEKLI
Sbjct  167   LQAAISGFSSFFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLTDERLEKLI  226

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLDAKE+DRLAVVAMAGLAAEGLKYDKV+GQSADLFTLQRFINRSKP LSKDQQQNL
Sbjct  227   YSGQLDAKELDRLAVVAMAGLAAEGLKYDKVIGQSADLFTLQRFINRSKPQLSKDQQQNL  286

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVLFAGSLLKN++ ++EALI AMS KA++
Sbjct  287   TRWAVLFAGSLLKNDRVIHEALITAMSNKATI  318



>gb|EYU31085.1| hypothetical protein MIMGU_mgv1a010183mg [Erythranthe guttata]
Length=320

 Score =   489 bits (1258),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 233/273 (85%), Positives = 258/273 (95%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PG+D T L+SA++KKDS AVKEALDQL+EVGWAK WSSQPYVSRRTTS+RELT+LGI+NA
Sbjct  35    PGIDFTTLESAIAKKDSDAVKEALDQLTEVGWAKKWSSQPYVSRRTTSLRELTSLGIKNA  94

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGFLGV+AGQLPGDWGFFVPYLIGSISL+VLAVGSISPG
Sbjct  95    ENLAIPSVRNDAAFLFTVVGTTGFLGVIAGQLPGDWGFFVPYLIGSISLVVLAVGSISPG  154

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI GFS FFPDYQ+RIA HEAAHFLVAYLLGLPIL YSLDIGKE+VNLID++LEKL
Sbjct  155   LLQAAIGGFSLFFPDYQDRIARHEAAHFLVAYLLGLPILGYSLDIGKENVNLIDKRLEKL  214

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVVAMAGLAAEGL+YDKV+GQSADLF+LQRFINRSKP + KDQQQN
Sbjct  215   IYSGQLDAKELDRLAVVAMAGLAAEGLQYDKVIGQSADLFSLQRFINRSKPPIGKDQQQN  274

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFA SL+KNN+ ++EALI AMS KA+V
Sbjct  275   LTRWAVLFAASLIKNNRAVHEALISAMSNKATV  307



>ref|XP_008784603.1| PREDICTED: uncharacterized protein LOC103703506 isoform X1 [Phoenix 
dactylifera]
Length=324

 Score =   489 bits (1258),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 264/291 (91%), Gaps = 7/291 (2%)
 Frame = +3

Query  225   RKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYV  404
             +KWR+  +       SAAPGVDL  L++A++KKDS AVKE LDQLS++GWAK WSSQPYV
Sbjct  30    KKWRIGAS-------SAAPGVDLKALEAAIAKKDSNAVKEILDQLSQIGWAKKWSSQPYV  82

Query  405   SRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPY  584
             SRRTTS++EL TLGI+NAENL IPS+RNDAAFLFTVVGTTGFLGV+AGQLPGDWGFFVPY
Sbjct  83    SRRTTSLQELATLGIKNAENLAIPSVRNDAAFLFTVVGTTGFLGVIAGQLPGDWGFFVPY  142

Query  585   LIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYS  764
             LIGSISLIVLAVGSISPGLLQAAI GFSSFFPDYQERIA HEAAHFLVAYL+GLPIL YS
Sbjct  143   LIGSISLIVLAVGSISPGLLQAAIGGFSSFFPDYQERIARHEAAHFLVAYLIGLPILGYS  202

Query  765   LDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTL  944
             LDIGKEHVNL+DE LEKL+YSGQLD KE+DRLAVV+MAGLAAEGLKYDKVVGQSADLFTL
Sbjct  203   LDIGKEHVNLVDESLEKLVYSGQLDDKELDRLAVVSMAGLAAEGLKYDKVVGQSADLFTL  262

Query  945   QRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QRFINRSKP  SK+QQ+NLTRWAVLFAGSLLKNN   YEAL+ AMSKKASV
Sbjct  263   QRFINRSKPQTSKEQQKNLTRWAVLFAGSLLKNNAVAYEALMSAMSKKASV  313



>gb|KHN38221.1| hypothetical protein glysoja_003886 [Glycine soja]
Length=328

 Score =   488 bits (1257),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 236/273 (86%), Positives = 255/273 (93%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGVDL  L+ A+SKKDS AVKEAL+QLSEVGWAK WSSQPYVSRRTTS+RELT+LGI+N+
Sbjct  45    PGVDLNTLEFAISKKDSDAVKEALNQLSEVGWAKKWSSQPYVSRRTTSLRELTSLGIKNS  104

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGFL VLAGQLPGDWGFFVPYLIGSISL+VLAVGSISPG
Sbjct  105   ENLAIPSVRNDAAFLFTVVGTTGFLAVLAGQLPGDWGFFVPYLIGSISLVVLAVGSISPG  164

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI  FS+ FPDYQERIA HEAAHFL+AYLLGLPI DYSLDIGKEHVNLIDE+LEKL
Sbjct  165   LLQAAIGSFSTLFPDYQERIARHEAAHFLIAYLLGLPIFDYSLDIGKEHVNLIDERLEKL  224

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVV+MAGLAAEGL YDKVVGQSADLF+LQRFINR+KP LSKDQQQN
Sbjct  225   IYSGQLDAKELDRLAVVSMAGLAAEGLTYDKVVGQSADLFSLQRFINRTKPPLSKDQQQN  284

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFA SLLKNNK  +EAL+ AM+KKASV
Sbjct  285   LTRWAVLFAASLLKNNKVTHEALMAAMTKKASV  317



>ref|XP_004504022.1| PREDICTED: uncharacterized protein LOC101490185 [Cicer arietinum]
Length=337

 Score =   488 bits (1255),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 232/273 (85%), Positives = 255/273 (93%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGVDL  L SA++KKDS AVKEALDQL+E+GWAK WSSQPYVSRRTTS+RELTTLGI+NA
Sbjct  54    PGVDLNTLDSAIAKKDSNAVKEALDQLNEIGWAKKWSSQPYVSRRTTSLRELTTLGIKNA  113

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGFLG+LAGQLPGDWGFFVPYLIGSISL+VL VGS SPG
Sbjct  114   ENLAIPSVRNDAAFLFTVVGTTGFLGILAGQLPGDWGFFVPYLIGSISLVVLGVGSTSPG  173

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI  FS+ FPDYQERIA HEAAHFL+AYLLGLPIL YSLDIGKEHVNLIDE+LEKL
Sbjct  174   LLQAAISSFSTVFPDYQERIARHEAAHFLIAYLLGLPILGYSLDIGKEHVNLIDERLEKL  233

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +YSGQLDAKE+DRLAVV+MAGLAAEGL YDKV+GQSADLFTLQRFINR+KP +SKDQQQN
Sbjct  234   LYSGQLDAKELDRLAVVSMAGLAAEGLTYDKVIGQSADLFTLQRFINRTKPQISKDQQQN  293

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFA SLLKNNK ++EAL+ +M+KKASV
Sbjct  294   LTRWAVLFAASLLKNNKAIHEALMSSMAKKASV  326



>emb|CAE03618.3| OSJNBb0003B01.9 [Oryza sativa Japonica Group]
 emb|CAH67811.1| OSIGBa0138H21-OSIGBa0138E01.2 [Oryza sativa Indica Group]
 gb|EAY95738.1| hypothetical protein OsI_17606 [Oryza sativa Indica Group]
Length=325

 Score =   486 bits (1250),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 246/310 (79%), Positives = 276/310 (89%), Gaps = 7/310 (2%)
 Frame = +3

Query  168   ATQYNTLQFIPRTSTPNPRRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEA  347
             A  +N L+ I       P R+WR    ++AA+SSSAAPGVDL  LQ+A+ KKDS+ VK+A
Sbjct  12    ANPHNPLRLIAAA----PHRQWR---RVAAAASSSAAPGVDLKALQAAIDKKDSEEVKQA  64

Query  348   LDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTG  527
             +DQL E+GWAK WSSQPYVSRRTTS+RELTTLGI+NAENL IPS+RNDAAFLFTVVG+TG
Sbjct  65    MDQLKELGWAKRWSSQPYVSRRTTSLRELTTLGIKNAENLAIPSVRNDAAFLFTVVGSTG  124

Query  528   FLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANH  707
             FLGVLAGQLPGDWGFFVPYLIGSISLIVLA+GSISPGLLQAAI  FS+ FPDYQERIA H
Sbjct  125   FLGVLAGQLPGDWGFFVPYLIGSISLIVLAIGSISPGLLQAAIGAFSTVFPDYQERIARH  184

Query  708   EAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLA  887
             EAAHFLVAYL+GLPIL YSLDIGKEHVNLID++L+KLIYSGQLD KEIDRLAVV+MAGLA
Sbjct  185   EAAHFLVAYLIGLPILGYSLDIGKEHVNLIDDQLQKLIYSGQLDQKEIDRLAVVSMAGLA  244

Query  888   AEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEAL  1067
             AEGL+YDKVVGQSADLFTLQRFINR+KP L+KDQQQNLTRWAVLF+ SLLKNNK  +EAL
Sbjct  245   AEGLEYDKVVGQSADLFTLQRFINRTKPPLTKDQQQNLTRWAVLFSASLLKNNKAAHEAL  304

Query  1068  IGAMSKKASV  1097
             + AMS+KASV
Sbjct  305   MSAMSQKASV  314



>ref|XP_003525077.1| PREDICTED: uncharacterized protein LOC100807209 isoform X1 [Glycine 
max]
Length=330

 Score =   486 bits (1250),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 235/273 (86%), Positives = 254/273 (93%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGVDL  L+ A+SKKDS AVKEAL+QLSEVGWAK WSSQPYVS RTTS+RELT+LGI+N+
Sbjct  47    PGVDLNTLEFAISKKDSDAVKEALNQLSEVGWAKKWSSQPYVSCRTTSLRELTSLGIKNS  106

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGFL VLAGQLPGDWGFFVPYLIGSISL+VLAVGSISPG
Sbjct  107   ENLAIPSVRNDAAFLFTVVGTTGFLAVLAGQLPGDWGFFVPYLIGSISLVVLAVGSISPG  166

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI  FS+ FPDYQERIA HEAAHFL+AYLLGLPI DYSLDIGKEHVNLIDE+LEKL
Sbjct  167   LLQAAIGSFSTLFPDYQERIARHEAAHFLIAYLLGLPIFDYSLDIGKEHVNLIDERLEKL  226

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVV+MAGLAAEGL YDKVVGQSADLF+LQRFINR+KP LSKDQQQN
Sbjct  227   IYSGQLDAKELDRLAVVSMAGLAAEGLTYDKVVGQSADLFSLQRFINRTKPPLSKDQQQN  286

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFA SLLKNNK  +EAL+ AM+KKASV
Sbjct  287   LTRWAVLFAASLLKNNKVTHEALMAAMTKKASV  319



>gb|AFK43576.1| unknown [Lotus japonicus]
Length=330

 Score =   483 bits (1243),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 237/292 (81%), Positives = 265/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  222   RRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPY  401
             +R +++ +      +SSAAPGV+L  L+SA++KKDS AVKEALDQLSE GWAK W SQPY
Sbjct  21    QRCFKINLPKWTTRASSAAPGVELNTLESAIAKKDSNAVKEALDQLSEGGWAKKWGSQPY  80

Query  402   VSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVP  581
             VSRRTTS+RELTTLGI+NAENL IPS+RNDAAFLFTVVGTTGFLG+L GQLPGDWGFFVP
Sbjct  81    VSRRTTSLRELTTLGIKNAENLAIPSVRNDAAFLFTVVGTTGFLGILTGQLPGDWGFFVP  140

Query  582   YLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDY  761
             YLIGSISL+VLAVGSISPGLLQAAI  FS+ FPDYQERIA HEAAHFL+AYLLG+PIL Y
Sbjct  141   YLIGSISLVVLAVGSISPGLLQAAIGSFSTVFPDYQERIARHEAAHFLIAYLLGVPILGY  200

Query  762   SLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFT  941
             SLDIGKEHVNLID++LEKLIYSGQLDAKEIDRLAVV+MAGLAAEGL YDKV+GQSADLFT
Sbjct  201   SLDIGKEHVNLIDQRLEKLIYSGQLDAKEIDRLAVVSMAGLAAEGLIYDKVIGQSADLFT  260

Query  942   LQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LQRFINR+KP LSKDQQQNLTRWAV+FA SLLKNNK  +EAL+ +M+KKASV
Sbjct  261   LQRFINRTKPQLSKDQQQNLTRWAVMFAASLLKNNKESHEALMASMTKKASV  312



>gb|AFK38312.1| unknown [Lotus japonicus]
Length=330

 Score =   481 bits (1238),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 236/292 (81%), Positives = 265/292 (91%), Gaps = 0/292 (0%)
 Frame = +3

Query  222   RRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPY  401
             +R +++ +      +SSAAPGV+L  L+SA++KKDS AVKEALDQLSE GWAK W SQPY
Sbjct  21    QRCFKINLPKWTTRASSAAPGVELNILESAIAKKDSNAVKEALDQLSEGGWAKKWGSQPY  80

Query  402   VSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVP  581
             VSRRTTS+RELTTLGI+NAENL IPS+RNDAAFLFTVVGTTGFLG+L GQLPGDWGFFVP
Sbjct  81    VSRRTTSLRELTTLGIKNAENLAIPSVRNDAAFLFTVVGTTGFLGILTGQLPGDWGFFVP  140

Query  582   YLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDY  761
             YLIGSISL+VLAVGSISPGLLQAAI  FS+ FPDYQERIA HEAAHFL++YLLG+PIL Y
Sbjct  141   YLIGSISLVVLAVGSISPGLLQAAIGSFSTVFPDYQERIARHEAAHFLISYLLGVPILGY  200

Query  762   SLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFT  941
             SLDIGKEHVNLID++LEKLIYSGQLDAKEIDRLAVV+MAGLAAEGL YDKV+GQSADLFT
Sbjct  201   SLDIGKEHVNLIDQRLEKLIYSGQLDAKEIDRLAVVSMAGLAAEGLIYDKVIGQSADLFT  260

Query  942   LQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LQRFINR+KP LSKDQQQNLTRWAV+FA SLLKNNK  +EAL+ +M+KKASV
Sbjct  261   LQRFINRTKPQLSKDQQQNLTRWAVMFAASLLKNNKESHEALMASMTKKASV  312



>ref|XP_010531414.1| PREDICTED: uncharacterized protein LOC104807722 [Tarenaya hassleriana]
Length=339

 Score =   481 bits (1238),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 229/272 (84%), Positives = 253/272 (93%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             G+D T L SA++KKDS  VKEALD+LSE GWAK WSSQPY+SRRTTS+RELTTLGI+NAE
Sbjct  57    GIDFTSLDSAINKKDSDGVKEALDRLSEAGWAKKWSSQPYLSRRTTSLRELTTLGIKNAE  116

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
             NL IPS+RNDAAFLFTVVGTT FL VLAGQLPGDWGFF+PYLIGSISL+VLAVGSISPGL
Sbjct  117   NLAIPSVRNDAAFLFTVVGTTSFLAVLAGQLPGDWGFFLPYLIGSISLVVLAVGSISPGL  176

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDYQERIA+HEAAHFLVAYLLGLPIL YSLDIGKEHVNLID++LE+LI
Sbjct  177   LQAAISGFSTFFPDYQERIASHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDKRLEQLI  236

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLDAKE+DRLAV+AMAGL AEGLKYDKVVGQSADLFTLQRFINRS P LS DQQQNL
Sbjct  237   YSGQLDAKELDRLAVIAMAGLTAEGLKYDKVVGQSADLFTLQRFINRSTPKLSNDQQQNL  296

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL+AGSLLKNNK ++EAL+ AM+ K++V
Sbjct  297   TRWAVLYAGSLLKNNKAIHEALMAAMTNKSTV  328



>ref|XP_008457887.1| PREDICTED: uncharacterized protein LOC103497464 [Cucumis melo]
Length=320

 Score =   480 bits (1236),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 257/313 (82%), Positives = 276/313 (88%), Gaps = 11/313 (4%)
 Frame = +3

Query  168   ATQYN---TLQFIPRTSTPNPRRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAV  338
             AT Y+   T QF    S+  P  +WR+  +       SA+  VDLT LQSA+ KKDS AV
Sbjct  5     ATAYSAAITFQFRHSKSSTIPH-QWRIRAS-------SASSTVDLTALQSAIEKKDSNAV  56

Query  339   KEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVG  518
             KEALDQL E+GWAK WSSQPYVSRRTT++RELTTLGI+NAENL IPS+RNDAAFLFTVVG
Sbjct  57    KEALDQLRELGWAKKWSSQPYVSRRTTTLRELTTLGIKNAENLAIPSVRNDAAFLFTVVG  116

Query  519   TTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERI  698
              TGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERI
Sbjct  117   VTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERI  176

Query  699   ANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMA  878
             A HEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDE+LEKLIYSGQLD KE+DRLAVVAMA
Sbjct  177   AGHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDERLEKLIYSGQLDDKELDRLAVVAMA  236

Query  879   GLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLY  1058
             GLA+EGLKYDKVVGQSADLFTLQRFINRSKP L KDQQQNLTRWAVLF+GSLLKNNK ++
Sbjct  237   GLASEGLKYDKVVGQSADLFTLQRFINRSKPKLGKDQQQNLTRWAVLFSGSLLKNNKLIH  296

Query  1059  EALIGAMSKKASV  1097
             EALI AMS+KASV
Sbjct  297   EALIKAMSEKASV  309



>ref|XP_004976987.1| PREDICTED: uncharacterized protein LOC101752516 [Setaria italica]
Length=312

 Score =   479 bits (1234),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 239/296 (81%), Positives = 261/296 (88%), Gaps = 5/296 (2%)
 Frame = +3

Query  210   TPNPRRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWS  389
             T  PRR WR     S+A+S     GVDL  LQ+A+ KK S  VK+ALDQL E+GWAK WS
Sbjct  11    TTAPRRCWRAAAASSSAAS-----GVDLKALQAAIDKKSSDDVKQALDQLRELGWAKRWS  65

Query  390   SQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWG  569
             SQPYVSRRTTS+RELTTLGI+NAENL IPS+RNDAAFLFTVVGTTGFL VLAGQLPGDWG
Sbjct  66    SQPYVSRRTTSLRELTTLGIKNAENLAIPSVRNDAAFLFTVVGTTGFLAVLAGQLPGDWG  125

Query  570   FFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLP  749
             FFVPYLIGSISLIVLAVGS++PGLLQAAI  FS+ FPDYQERIA HEAAHFLVAYL+GLP
Sbjct  126   FFVPYLIGSISLIVLAVGSVAPGLLQAAIGAFSTVFPDYQERIARHEAAHFLVAYLIGLP  185

Query  750   ILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSA  929
             IL YSLDIGKEHVNLIDE+L+KLIYSGQLD KE+DRLAVV+MAGLAAEGL+YDKVVGQSA
Sbjct  186   ILGYSLDIGKEHVNLIDEQLQKLIYSGQLDGKELDRLAVVSMAGLAAEGLEYDKVVGQSA  245

Query  930   DLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             DLFTLQRFINR+KP LSKDQQQNLTRWAVLFA SLLKNNK  +EAL+ AMS+ ASV
Sbjct  246   DLFTLQRFINRTKPQLSKDQQQNLTRWAVLFAASLLKNNKAAHEALMSAMSQNASV  301



>ref|XP_009416874.1| PREDICTED: uncharacterized protein LOC103997398 [Musa acuminata 
subsp. malaccensis]
Length=326

 Score =   479 bits (1233),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 234/291 (80%), Positives = 263/291 (90%), Gaps = 7/291 (2%)
 Frame = +3

Query  225   RKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYV  404
             +KWR+  +       SAAPGVDL PL++A++KKDS AVKE LDQL+++GWAK WSSQPYV
Sbjct  32    KKWRIGAS-------SAAPGVDLKPLETAIAKKDSVAVKEILDQLNQIGWAKKWSSQPYV  84

Query  405   SRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPY  584
             SRR TS+RELTTLGI+NAENL IPS+RNDAAFLFTVVGTT  L V+AGQLPGDWGFFVPY
Sbjct  85    SRRMTSLRELTTLGIKNAENLAIPSVRNDAAFLFTVVGTTSLLAVIAGQLPGDWGFFVPY  144

Query  585   LIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYS  764
             LIGSISLIVLAVGSISPGLLQAAI+GFSSFFPDYQERIA HEAAHFLVAYL+GLPIL YS
Sbjct  145   LIGSISLIVLAVGSISPGLLQAAINGFSSFFPDYQERIARHEAAHFLVAYLIGLPILGYS  204

Query  765   LDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTL  944
             LDIGKEHVNL+DE+L+KL+YSGQLD KE+DRLA V+MAGLAAEGLKYDKV+GQSADLFTL
Sbjct  205   LDIGKEHVNLVDERLQKLLYSGQLDEKELDRLAAVSMAGLAAEGLKYDKVIGQSADLFTL  264

Query  945   QRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QRFINRSKP +SK+QQQNLTRWAVLFAGSLLKNN   ++AL+ AMS+KA V
Sbjct  265   QRFINRSKPRISKEQQQNLTRWAVLFAGSLLKNNAVEHQALMAAMSRKAGV  315



>ref|XP_004148439.1| PREDICTED: uncharacterized protein LOC101209062 [Cucumis sativus]
 ref|XP_004164881.1| PREDICTED: uncharacterized LOC101209062 [Cucumis sativus]
 gb|KGN62075.1| hypothetical protein Csa_2G296000 [Cucumis sativus]
Length=320

 Score =   477 bits (1228),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 275/313 (88%), Gaps = 11/313 (4%)
 Frame = +3

Query  168   ATQYN---TLQFIPRTSTPNPRRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAV  338
             AT Y+   T QF    ++  P  +WR+  +       SA+  VDLT LQSA+ KKDS AV
Sbjct  5     ATAYSAAITFQFRHSKASTIPH-QWRIRAS-------SASSTVDLTALQSAIEKKDSNAV  56

Query  339   KEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVG  518
             KEALDQL E+GWAK WSSQPYVSRRTT++RELTTLGI+NAENL IPS+RNDAAFLFTVVG
Sbjct  57    KEALDQLRELGWAKKWSSQPYVSRRTTTLRELTTLGIKNAENLAIPSVRNDAAFLFTVVG  116

Query  519   TTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERI  698
              TGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERI
Sbjct  117   VTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERI  176

Query  699   ANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMA  878
             A HEAAHFLVAYLLGLPILDYS DIGKEHVNLIDE+LEKLIYSGQLD KE+DRLAVVAMA
Sbjct  177   AGHEAAHFLVAYLLGLPILDYSTDIGKEHVNLIDERLEKLIYSGQLDDKELDRLAVVAMA  236

Query  879   GLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLY  1058
             GLA+EGLKYDKVVGQSADLFTLQRFINRSKP L KDQQQNLTRWAVLF+GSLLKNNK ++
Sbjct  237   GLASEGLKYDKVVGQSADLFTLQRFINRSKPKLGKDQQQNLTRWAVLFSGSLLKNNKLIH  296

Query  1059  EALIGAMSKKASV  1097
             EALI AMS+KASV
Sbjct  297   EALIKAMSEKASV  309



>ref|XP_002448617.1| hypothetical protein SORBIDRAFT_06g030240 [Sorghum bicolor]
 gb|EES12945.1| hypothetical protein SORBIDRAFT_06g030240 [Sorghum bicolor]
Length=315

 Score =   476 bits (1226),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/272 (85%), Positives = 251/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             GVDL  LQ+A+ KK S  VKEALDQL E+GWAK WSSQPYVSRRTTS+RELTTLGI+NAE
Sbjct  33    GVDLKGLQAAIDKKSSDDVKEALDQLRELGWAKRWSSQPYVSRRTTSLRELTTLGIKNAE  92

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
             NL IPS+RNDAAFLFTVVGTTGFL VLAGQLPGDWGFFVPYLIGSISLIVLAVGS++PGL
Sbjct  93    NLAIPSVRNDAAFLFTVVGTTGFLAVLAGQLPGDWGFFVPYLIGSISLIVLAVGSVAPGL  152

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI  FS+ FPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L+KLI
Sbjct  153   LQAAIGAFSTVFPDYQERIARHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDEQLQKLI  212

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSG+LD KE+DRLAVV+MAGLAAEGL+YDKVVGQSADLFTLQRFINR+KP LSKDQQQNL
Sbjct  213   YSGKLDGKELDRLAVVSMAGLAAEGLQYDKVVGQSADLFTLQRFINRTKPQLSKDQQQNL  272

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVLFA SLLKNNK  +EAL+ AMS+KASV
Sbjct  273   TRWAVLFAASLLKNNKAAHEALMSAMSQKASV  304



>gb|EPS69665.1| hypothetical protein M569_05099, partial [Genlisea aurea]
Length=291

 Score =   475 bits (1222),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/273 (85%), Positives = 250/273 (92%), Gaps = 0/273 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             P +D   L SA+ KKDS  V+EALD+L+EVGWAK WSSQPYVSRRTT +RELT+LGI+NA
Sbjct  9     PEIDFGSLASAIDKKDSNGVREALDRLNEVGWAKKWSSQPYVSRRTTPLRELTSLGIKNA  68

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS  NDAAFLFTVVG TGF GVLAGQLPGDWGFFVPYL+GSISLIVLAVGSISPG
Sbjct  69    ENLAIPSAGNDAAFLFTVVGITGFSGVLAGQLPGDWGFFVPYLLGSISLIVLAVGSISPG  128

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI GFSSFFPDYQERIA HEAAHFLVAYLLGLPIL+YS DIGKEHVNLID++LEKL
Sbjct  129   LLQAAISGFSSFFPDYQERIARHEAAHFLVAYLLGLPILNYSFDIGKEHVNLIDDRLEKL  188

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVVAMAGLAAEGL+YDKVVGQSADLFTLQRFINRSKP LSKDQQQN
Sbjct  189   IYSGQLDAKELDRLAVVAMAGLAAEGLRYDKVVGQSADLFTLQRFINRSKPQLSKDQQQN  248

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFAG+L+KNN+G +EAL+ AM  KASV
Sbjct  249   LTRWAVLFAGTLIKNNRGGHEALVSAMLNKASV  281



>ref|XP_003531378.1| PREDICTED: uncharacterized protein LOC100306288 isoform X1 [Glycine 
max]
 gb|KHN29110.1| hypothetical protein glysoja_008445 [Glycine soja]
Length=328

 Score =   475 bits (1222),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 229/261 (88%), Positives = 246/261 (94%), Gaps = 0/261 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGVDL  L+SA+SKKDS AVKEAL+QLSEVGWAK WSSQPYVSRRTTS+RELT+LGI+NA
Sbjct  45    PGVDLNTLESAISKKDSDAVKEALNQLSEVGWAKKWSSQPYVSRRTTSLRELTSLGIKNA  104

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISL+VLAVGSISPG
Sbjct  105   ENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLVVLAVGSISPG  164

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI  FS+ FPDYQERIA HEAAHFL+AYLLGLPI DYSLDIGKEHVNLIDE+LEKL
Sbjct  165   LLQAAIGSFSTLFPDYQERIARHEAAHFLIAYLLGLPIFDYSLDIGKEHVNLIDERLEKL  224

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVV+MAGLAAEGL YDKVVGQSADLF+LQRFINR+KP LSKDQQQN
Sbjct  225   IYSGQLDAKELDRLAVVSMAGLAAEGLTYDKVVGQSADLFSLQRFINRTKPPLSKDQQQN  284

Query  999   LTRWAVLFAGSLLKNNKGLYE  1061
             LTRWAVLFA S+LKNNK  +E
Sbjct  285   LTRWAVLFAASILKNNKVTHE  305



>ref|NP_001140871.1| hypothetical protein [Zea mays]
 gb|ACF84851.1| unknown [Zea mays]
 tpg|DAA35770.1| TPA: hypothetical protein ZEAMMB73_590939 [Zea mays]
Length=315

 Score =   474 bits (1219),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 229/272 (84%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             GVDL  LQ+A+ KK S  V++ALDQL E GWAK W SQPYVSRRTTS+RELTTLGI+NAE
Sbjct  33    GVDLKALQAAIDKKSSDDVRQALDQLRESGWAKRWGSQPYVSRRTTSLRELTTLGIKNAE  92

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
             NL IPS+RNDAAFLFTVVGTTGFL VLAGQLPGDWGFFVPYLIGSISLIVLAVGS++PGL
Sbjct  93    NLAIPSVRNDAAFLFTVVGTTGFLAVLAGQLPGDWGFFVPYLIGSISLIVLAVGSVAPGL  152

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI  FS+ FPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L+KLI
Sbjct  153   LQAAIGAFSTVFPDYQERIARHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDEQLQKLI  212

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD KE+DRLAVV+MAGLAAEGL+YDKVVGQSADLFTLQRFINR+KP LSKDQQQNL
Sbjct  213   YSGQLDGKELDRLAVVSMAGLAAEGLEYDKVVGQSADLFTLQRFINRTKPQLSKDQQQNL  272

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVLFA SLLKNNK  +EAL+ AMS+KASV
Sbjct  273   TRWAVLFAASLLKNNKAAHEALMSAMSQKASV  304



>ref|XP_007048114.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007048115.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX92271.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX92272.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=329

 Score =   473 bits (1217),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 247/294 (84%), Positives = 267/294 (91%), Gaps = 5/294 (2%)
 Frame = +3

Query  216   NPRRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQ  395
             +PRR  ++  +     SSSAAP VDL  L+SA+S+KDS AVKEALDQLSEVGWAK W SQ
Sbjct  30    SPRRDLQVRAS-----SSSAAPDVDLKTLESAISEKDSDAVKEALDQLSEVGWAKKWCSQ  84

Query  396   PYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFF  575
             PYVSRRTTS+RELT+LGI+NAE L IPS+RNDAAFLFTVVGTTGFLG+LAGQLPGDWGFF
Sbjct  85    PYVSRRTTSLRELTSLGIKNAETLAIPSVRNDAAFLFTVVGTTGFLGLLAGQLPGDWGFF  144

Query  576   VPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPIL  755
             VPYLIGSISLIVLAVGSISPGLLQAAI GFSSFFPDYQERIA HEAAHFL+AYLLGLPIL
Sbjct  145   VPYLIGSISLIVLAVGSISPGLLQAAIGGFSSFFPDYQERIARHEAAHFLIAYLLGLPIL  204

Query  756   DYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADL  935
              YSLDIGKEHVNLIDEKLEKLIYSGQLDA+ +DRLA VAMAGLAAEGLKYDKV+GQSADL
Sbjct  205   GYSLDIGKEHVNLIDEKLEKLIYSGQLDAELLDRLAAVAMAGLAAEGLKYDKVIGQSADL  264

Query  936   FTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             FTLQRFINRS P LS DQQQNLTRWAVLFAGSLLKNNK +YEAL+ AMSKK++V
Sbjct  265   FTLQRFINRSNPKLSNDQQQNLTRWAVLFAGSLLKNNKVIYEALMSAMSKKSTV  318



>gb|ACG33936.1| hypothetical protein [Zea mays]
Length=315

 Score =   472 bits (1214),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 228/272 (84%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             GVDL  LQ+A+ KK S  V++ALDQL E GWAK W SQPYVSRRTTS+RELTTLGI+NAE
Sbjct  33    GVDLKALQAAIDKKSSDDVRQALDQLRESGWAKRWGSQPYVSRRTTSLRELTTLGIKNAE  92

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
             NL IPS+RNDAAFLFTVVGTTGFL VLAGQLPGDWGFFVPYLIGSISLIVLAVGS++PGL
Sbjct  93    NLAIPSVRNDAAFLFTVVGTTGFLAVLAGQLPGDWGFFVPYLIGSISLIVLAVGSVAPGL  152

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI  FS+ FPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L+KLI
Sbjct  153   LQAAIGAFSTVFPDYQERIARHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDEQLQKLI  212

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD KE+DRLAVV+MAGLAAEGL+YDKVVGQSADLFTLQRF+NR+KP LSKDQQQNL
Sbjct  213   YSGQLDGKELDRLAVVSMAGLAAEGLEYDKVVGQSADLFTLQRFMNRTKPQLSKDQQQNL  272

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVLFA SLLKNNK  +EAL+ AMS+KASV
Sbjct  273   TRWAVLFAASLLKNNKAAHEALMSAMSQKASV  304



>ref|XP_011090627.1| PREDICTED: uncharacterized protein LOC105171265 isoform X2 [Sesamum 
indicum]
Length=299

 Score =   468 bits (1203),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 228/247 (92%), Positives = 237/247 (96%), Gaps = 0/247 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PG+DLT L+SA +KKDS AVKEALDQLSEVGWAK WSSQPYVSRRTTS+RELT+LGI+NA
Sbjct  44    PGIDLTTLESAFAKKDSDAVKEALDQLSEVGWAKKWSSQPYVSRRTTSLRELTSLGIKNA  103

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG
Sbjct  104   ENLAIPSTRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  163

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI GFSSFFPDYQERIA HEAAHFLVAYLLGLPIL YSLDIGKEHVNLIDE+LEKL
Sbjct  164   LLQAAIGGFSSFFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDERLEKL  223

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVVAMAGLAAEGL+YDKVVGQSADLFTLQRFINRSKP LSKDQQQN
Sbjct  224   IYSGQLDAKELDRLAVVAMAGLAAEGLQYDKVVGQSADLFTLQRFINRSKPQLSKDQQQN  283

Query  999   LTRWAVL  1019
             LTRWAVL
Sbjct  284   LTRWAVL  290



>ref|XP_006653809.1| PREDICTED: uncharacterized protein LOC102705433 [Oryza brachyantha]
Length=295

 Score =   466 bits (1200),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 224/264 (85%), Positives = 247/264 (94%), Gaps = 0/264 (0%)
 Frame = +3

Query  306   SALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIR  485
             S + +KD + VK+ALDQL E+GWAK WSSQPYVSRRTTS+RELTTLGI+NAENL IPS+R
Sbjct  21    SCVVQKDGEEVKQALDQLRELGWAKRWSSQPYVSRRTTSLRELTTLGIKNAENLAIPSVR  80

Query  486   NDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGF  665
             NDAAFLFTVVGTTGFLGV+AGQLPGDWGFFVPYLIGSISLIVLA+GSISPGLLQAAI  F
Sbjct  81    NDAAFLFTVVGTTGFLGVIAGQLPGDWGFFVPYLIGSISLIVLAIGSISPGLLQAAIGAF  140

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAK  845
             S+ FPDYQERI+ HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L+KLIYSGQLD K
Sbjct  141   STVFPDYQERISRHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDEQLQKLIYSGQLDQK  200

Query  846   EIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFA  1025
             EIDRLAVV+MAGLAAEGL+YDKVVGQSADLFTLQRFINR++PTL+KDQQQNLTRWAVLFA
Sbjct  201   EIDRLAVVSMAGLAAEGLEYDKVVGQSADLFTLQRFINRTRPTLTKDQQQNLTRWAVLFA  260

Query  1026  GSLLKNNKGLYEALIGAMSKKASV  1097
              SLLKNNK  +EAL+ AMS+KASV
Sbjct  261   ASLLKNNKVAHEALMSAMSQKASV  284



>ref|XP_003580649.1| PREDICTED: uncharacterized protein LOC100846062 [Brachypodium 
distachyon]
Length=328

 Score =   466 bits (1199),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 230/292 (79%), Positives = 257/292 (88%), Gaps = 0/292 (0%)
 Frame = +3

Query  222   RRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPY  401
              R WR+    S++S ++AA GVDL  L+SA+ KKDS   K  LD+L E+GWAK WSSQPY
Sbjct  26    HRHWRVAAASSSSSPAAAASGVDLQALRSAIDKKDSNEAKRTLDELKELGWAKRWSSQPY  85

Query  402   VSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVP  581
             +SRRTTS+RELTTLGI+NAENL IPS+RNDAAFLFTVVGTTGFL VLAGQLPGDWGFFVP
Sbjct  86    MSRRTTSLRELTTLGIKNAENLAIPSVRNDAAFLFTVVGTTGFLAVLAGQLPGDWGFFVP  145

Query  582   YLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDY  761
             YL GSISLIVLAVGS+SPGLLQ AI  FS+ FPDYQERIA HEAAHFLVAYL GLPIL Y
Sbjct  146   YLTGSISLIVLAVGSVSPGLLQVAIGSFSAVFPDYQERIARHEAAHFLVAYLTGLPILGY  205

Query  762   SLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFT  941
             SLDIGKEHVNL+DE+L+KLIYSGQLD KE+DRLAVV+MAGLAAEGL+YDKVVGQSADLFT
Sbjct  206   SLDIGKEHVNLVDEQLQKLIYSGQLDQKELDRLAVVSMAGLAAEGLEYDKVVGQSADLFT  265

Query  942   LQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LQRF+NR+KP LSKDQQQNLTRWAVL A SLLKNNK  ++AL+ AMS+KASV
Sbjct  266   LQRFLNRTKPPLSKDQQQNLTRWAVLIAASLLKNNKAAHDALVSAMSEKASV  317



>gb|EAZ32146.1| hypothetical protein OsJ_16343 [Oryza sativa Japonica Group]
Length=322

 Score =   459 bits (1182),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 220/262 (84%), Positives = 245/262 (94%), Gaps = 0/262 (0%)
 Frame = +3

Query  312   LSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRND  491
             + +KDS+ VK+A+DQL E+GWAK WSSQPYVSRRTTS+R+LTTLGI+N ENL IPS+RND
Sbjct  50    IEQKDSEEVKQAMDQLKELGWAKRWSSQPYVSRRTTSLRKLTTLGIKNPENLAIPSVRND  109

Query  492   AAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSS  671
             AAFLFTVVG+TGFLGVLAGQLPGDWGFFVPYLIGSISLIVLA+GSISPGLLQAAI  FS+
Sbjct  110   AAFLFTVVGSTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAIGSISPGLLQAAIGAFST  169

Query  672   FFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEI  851
              FPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLID++L+KLIYSGQLD KEI
Sbjct  170   VFPDYQERIARHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDDQLQKLIYSGQLDQKEI  229

Query  852   DRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGS  1031
             DRLAVV+MAGLAAEGL+YDKVVGQSADLFTLQRFINR+KP L+KDQQQNLTRWAVLF+ S
Sbjct  230   DRLAVVSMAGLAAEGLEYDKVVGQSADLFTLQRFINRTKPPLTKDQQQNLTRWAVLFSAS  289

Query  1032  LLKNNKGLYEALIGAMSKKASV  1097
             LLKNNK  +EAL+ AMS+KASV
Sbjct  290   LLKNNKAAHEALMSAMSQKASV  311



>ref|XP_006428030.1| hypothetical protein CICLE_v10026110mg [Citrus clementina]
 ref|XP_006493835.1| PREDICTED: uncharacterized protein LOC102628213 [Citrus sinensis]
 gb|ESR41270.1| hypothetical protein CICLE_v10026110mg [Citrus clementina]
 gb|KDO59919.1| hypothetical protein CISIN_1g021101mg [Citrus sinensis]
Length=317

 Score =   458 bits (1179),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 230/270 (85%), Positives = 254/270 (94%), Gaps = 0/270 (0%)
 Frame = +3

Query  288   DLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENL  467
             DL  L+SA++KKDS AVKEALDQLSEVGWAK WSSQPYVSRRTT++RELT LGI+NAENL
Sbjct  37    DLKTLESAIAKKDSNAVKEALDQLSEVGWAKRWSSQPYVSRRTTTLRELTLLGIKNAENL  96

Query  468   GIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQ  647
              IPS+RNDAAFLFTVVG TGFLGVLAGQLPGDWGFF PYLIGSISL+VLAVGS SPGLLQ
Sbjct  97    AIPSVRNDAAFLFTVVGITGFLGVLAGQLPGDWGFFTPYLIGSISLVVLAVGSTSPGLLQ  156

Query  648   AAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYS  827
             AAI GFSSFFPDYQER+A HEAAHFL+AYLLGLPIL YSLDIGKE+VNLIDE+LEKLIYS
Sbjct  157   AAIQGFSSFFPDYQERVARHEAAHFLLAYLLGLPILGYSLDIGKENVNLIDERLEKLIYS  216

Query  828   GQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTR  1007
             GQLDAKE+DRLAVVAMAGLAAEGL+YDKVVGQSADLF+LQRFINR+KP LS+DQQQNLTR
Sbjct  217   GQLDAKELDRLAVVAMAGLAAEGLQYDKVVGQSADLFSLQRFINRTKPPLSQDQQQNLTR  276

Query  1008  WAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             WAVLFA +L+KNNK ++EAL+ AMSKKA++
Sbjct  277   WAVLFAATLIKNNKAIHEALMAAMSKKATI  306



>ref|XP_002528682.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33721.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   459 bits (1180),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 220/245 (90%), Positives = 233/245 (95%), Gaps = 0/245 (0%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGVDL  LQ+A++KKDS AVKEALDQL E GWAK WSSQPYVSRRTTS+RELTTLGI+NA
Sbjct  34    PGVDLNTLQAAIAKKDSNAVKEALDQLREDGWAKNWSSQPYVSRRTTSIRELTTLGIKNA  93

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVG+TGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG
Sbjct  94    ENLAIPSVRNDAAFLFTVVGSTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  153

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI  FS+ FPDYQERIA HEAAHFL+AYLLGLPILDYSLDIGKEHVNLIDEKLEKL
Sbjct  154   LLQAAISSFSTLFPDYQERIARHEAAHFLIAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  213

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLD+KE+DRLAVVAMAGLAAEGL+YDKVVGQSADLFTLQRFINRS+P LSKDQQQN
Sbjct  214   IYSGQLDSKELDRLAVVAMAGLAAEGLQYDKVVGQSADLFTLQRFINRSRPQLSKDQQQN  273

Query  999   LTRWA  1013
             LTRWA
Sbjct  274   LTRWA  278



>ref|XP_006827099.1| hypothetical protein AMTR_s00010p00242000 [Amborella trichopoda]
 gb|ERM94336.1| hypothetical protein AMTR_s00010p00242000 [Amborella trichopoda]
Length=792

 Score =   470 bits (1209),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 231/272 (85%), Positives = 248/272 (91%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             G  L+ LQ A+  KDS AVKE LDQLS+VGWAK WSSQ YVSRRTTS+RELTTLGI+NAE
Sbjct  510   GTKLSTLQVAIEAKDSDAVKETLDQLSQVGWAKKWSSQTYVSRRTTSLRELTTLGIKNAE  569

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
             NL IPS+RND AFLFTVVGTTGFLGV+AGQLPGDWGFFVPYL+GSISLIVLAVGSISPGL
Sbjct  570   NLAIPSVRNDVAFLFTVVGTTGFLGVIAGQLPGDWGFFVPYLLGSISLIVLAVGSISPGL  629

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDYQERI  HEAAHFLV+YLLGLPIL YSLDIGKEHVNLIDE+L+K+I
Sbjct  630   LQAAIGGFSAFFPDYQERIVRHEAAHFLVSYLLGLPILGYSLDIGKEHVNLIDERLQKVI  689

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD KE+DRLAV+ MAGLAAEGLKYDKVVGQSADLFTLQRFINRSKP LSKDQQ NL
Sbjct  690   YSGQLDEKELDRLAVITMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPKLSKDQQLNL  749

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVLFAGSLLKNNK  +EAL+ AMSK ASV
Sbjct  750   TRWAVLFAGSLLKNNKDAHEALMSAMSKNASV  781



>gb|EMS46681.1| hypothetical protein TRIUR3_08218 [Triticum urartu]
Length=320

 Score =   452 bits (1163),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 215/271 (79%), Positives = 243/271 (90%), Gaps = 0/271 (0%)
 Frame = +3

Query  285   VDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAEN  464
             VDL  L SA+ KKDSQ  ++ALD+L E+GWAK WSSQPY+SRRTTS+RELT LGI+NAEN
Sbjct  39    VDLKALGSAIDKKDSQEARQALDELKELGWAKRWSSQPYMSRRTTSLRELTNLGIKNAEN  98

Query  465   LGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLL  644
             L IPS+RNDAAFLFTVVGTTGFL VLAGQLPGDWGFFVPYL GSISL+VLA+GSISPGLL
Sbjct  99    LAIPSVRNDAAFLFTVVGTTGFLAVLAGQLPGDWGFFVPYLTGSISLVVLAIGSISPGLL  158

Query  645   QAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIY  824
             Q AI  FS+ FPDYQERIA HEAAHFLVAYL GLPIL YSLDIGKEHVNL+D++L+KL+Y
Sbjct  159   QVAIGSFSAVFPDYQERIARHEAAHFLVAYLTGLPILGYSLDIGKEHVNLVDDQLQKLLY  218

Query  825   SGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLT  1004
             SGQLD KE+DRLAV++MAGLAAEGL+YDKVVGQSADLFTLQRF+NR+KP L K QQQNLT
Sbjct  219   SGQLDQKEVDRLAVISMAGLAAEGLEYDKVVGQSADLFTLQRFLNRTKPPLGKAQQQNLT  278

Query  1005  RWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             RWAVL A SLLKNNK  ++AL+ AMS+KA+V
Sbjct  279   RWAVLIAASLLKNNKAAHDALVSAMSQKATV  309



>ref|XP_009140317.1| PREDICTED: uncharacterized protein LOC103864311 [Brassica rapa]
Length=327

 Score =   452 bits (1162),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 223/272 (82%), Positives = 251/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             GVDL+ L+SA++KKDS  VKEALD+L E GWAK WSSQPY+SRRTTS+RELTTLGI+NAE
Sbjct  45    GVDLSTLESAINKKDSSGVKEALDRLGEEGWAKKWSSQPYMSRRTTSLRELTTLGIKNAE  104

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L IPS+RNDAAFLFTVVGTTGF+ VLAGQLPGDWGFFVPYL+GSISL+VLAVGS+SPGL
Sbjct  105   TLAIPSVRNDAAFLFTVVGTTGFIAVLAGQLPGDWGFFVPYLVGSISLVVLAVGSVSPGL  164

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLI
Sbjct  165   LQAAISGFSTFFPDYQERIAAHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLI  224

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P +S +QQQNL
Sbjct  225   YSGQLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKISNEQQQNL  284

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL++ SLLKNNK ++EAL+ AMS  ASV
Sbjct  285   TRWAVLYSASLLKNNKTIHEALMAAMSNNASV  316



>ref|XP_002878582.1| hypothetical protein ARALYDRAFT_900627 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54841.1| hypothetical protein ARALYDRAFT_900627 [Arabidopsis lyrata subsp. 
lyrata]
Length=333

 Score =   452 bits (1162),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 223/272 (82%), Positives = 252/272 (93%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             G DL+ L+SA++KKDS  VKEALD+LSE GWAK WSSQPY+SRRTTS+RELTTLGI+NAE
Sbjct  51    GFDLSSLESAINKKDSNGVKEALDKLSEEGWAKKWSSQPYLSRRTTSLRELTTLGIKNAE  110

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L IPS+RNDAAFLFTVVGTTGF+ VLAGQLPGDWGFFVPYL+GSISL+VLAVGS+SPGL
Sbjct  111   TLAIPSVRNDAAFLFTVVGTTGFIAVLAGQLPGDWGFFVPYLVGSISLVVLAVGSVSPGL  170

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLI
Sbjct  171   LQAAISGFSTFFPDYQERIAAHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLI  230

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSG+LD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P +S +QQQNL
Sbjct  231   YSGKLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKISNEQQQNL  290

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL++ SLLKNNK ++EAL+ AMSK ASV
Sbjct  291   TRWAVLYSASLLKNNKTIHEALMAAMSKNASV  322



>ref|NP_565523.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK59493.1| unknown protein [Arabidopsis thaliana]
 gb|AAD20413.2| expressed protein [Arabidopsis thaliana]
 gb|AAN13134.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07246.1| uncharacterized protein AT2G21960 [Arabidopsis thaliana]
Length=332

 Score =   451 bits (1160),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 222/272 (82%), Positives = 252/272 (93%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             G DL+ L+SA++KKDS  VKEALD+LSE GWAK WSSQPY+SRRTTS+RELTTLGI+NAE
Sbjct  50    GFDLSSLESAINKKDSNGVKEALDKLSEEGWAKKWSSQPYLSRRTTSLRELTTLGIKNAE  109

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L IPS+RNDAAFLFTVVG+TGF+ VLAGQLPGDWGFFVPYL+GSISL+VLAVGS+SPGL
Sbjct  110   TLAIPSVRNDAAFLFTVVGSTGFIAVLAGQLPGDWGFFVPYLVGSISLVVLAVGSVSPGL  169

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLI
Sbjct  170   LQAAISGFSTFFPDYQERIAAHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLI  229

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSG+LD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P +S +QQQNL
Sbjct  230   YSGKLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKISNEQQQNL  289

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL++ SLLKNNK ++EAL+ AMSK ASV
Sbjct  290   TRWAVLYSASLLKNNKTIHEALMAAMSKNASV  321



>gb|KFK32851.1| hypothetical protein AALP_AA6G295200 [Arabis alpina]
Length=333

 Score =   450 bits (1158),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 221/270 (82%), Positives = 250/270 (93%), Gaps = 0/270 (0%)
 Frame = +3

Query  288   DLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENL  467
             D + L+SA++KKDS  VKEALDQLSE GWAK WSSQPY+SRRTTS+RELTTLGI+NAE L
Sbjct  53    DFSTLESAINKKDSNGVKEALDQLSEQGWAKKWSSQPYLSRRTTSLRELTTLGIKNAEAL  112

Query  468   GIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQ  647
              IPS+RNDAAFLFTVVGTTGF+ V+AGQLPGDWGFFVPYL+GSISL+VLAVGS+SPGLLQ
Sbjct  113   AIPSVRNDAAFLFTVVGTTGFIAVIAGQLPGDWGFFVPYLVGSISLVVLAVGSVSPGLLQ  172

Query  648   AAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYS  827
             AAI GFS+FFPDYQERIA+HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLIYS
Sbjct  173   AAISGFSTFFPDYQERIASHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLIYS  232

Query  828   GQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTR  1007
             G+LD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P +S DQQQNLTR
Sbjct  233   GKLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKISNDQQQNLTR  292

Query  1008  WAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             WAVL++ SLLKNNK ++EAL+ AMS  ASV
Sbjct  293   WAVLYSASLLKNNKTIHEALMAAMSNNASV  322



>emb|CDY15852.1| BnaA04g12590D [Brassica napus]
Length=327

 Score =   449 bits (1156),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 222/272 (82%), Positives = 250/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             GVDL+ L+SA++KKDS  VKEALD+L E GWAK WSSQPY+SRRTTS+RELTTLGI+NAE
Sbjct  45    GVDLSTLESAINKKDSSGVKEALDRLGEEGWAKKWSSQPYMSRRTTSLRELTTLGIKNAE  104

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L IPS+RNDAAFLFTVVGTT F+ VLAGQLPGDWGFFVPYL+GSISL+VLAVGS+SPGL
Sbjct  105   TLAIPSVRNDAAFLFTVVGTTSFIAVLAGQLPGDWGFFVPYLVGSISLVVLAVGSVSPGL  164

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLI
Sbjct  165   LQAAISGFSTFFPDYQERIAAHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLI  224

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P +S +QQQNL
Sbjct  225   YSGQLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKISNEQQQNL  284

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL++ SLLKNNK ++EAL+ AMS  ASV
Sbjct  285   TRWAVLYSASLLKNNKTIHEALMAAMSNNASV  316



>dbj|BAJ96471.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88183.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   447 bits (1151),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 213/272 (78%), Positives = 241/272 (89%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             GVDL  L +A+ KKD    + ALD+L E+GWAK WSSQPY+SRRTTS+RELT LGI+NAE
Sbjct  38    GVDLKALGTAIDKKDGDEARRALDRLKELGWAKRWSSQPYMSRRTTSLRELTNLGIKNAE  97

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
             NL IPS+RNDAAFLFTVVGTTGFL VLAGQLPGDWGFFVPYL GSISL+VLA+GSISPGL
Sbjct  98    NLAIPSVRNDAAFLFTVVGTTGFLAVLAGQLPGDWGFFVPYLTGSISLVVLAIGSISPGL  157

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQ AI  FS+ FPDYQERIA HEAAHFLVAYL GLPIL YSLDIGKEHVNL+D++L+KL+
Sbjct  158   LQVAIGSFSAVFPDYQERIARHEAAHFLVAYLTGLPILGYSLDIGKEHVNLVDDQLQKLL  217

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD KE+DRLAV++MAGLAAEGL+YDKVVGQSADLFTLQRF+NR+KP L K QQQNL
Sbjct  218   YSGQLDQKEVDRLAVISMAGLAAEGLQYDKVVGQSADLFTLQRFLNRTKPPLGKAQQQNL  277

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL A SLLKNNK  ++AL+ AMS+KA+V
Sbjct  278   TRWAVLIAASLLKNNKAAHDALVAAMSQKATV  309



>ref|XP_006404650.1| hypothetical protein EUTSA_v10000230mg [Eutrema salsugineum]
 gb|ESQ46103.1| hypothetical protein EUTSA_v10000230mg [Eutrema salsugineum]
Length=338

 Score =   448 bits (1152),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 221/272 (81%), Positives = 250/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             G DL+ L+SA++KKDS  VKEALD+LSE GWAK WSSQPY+SRRTTS+RELTTLGI+NAE
Sbjct  56    GFDLSALESAINKKDSNGVKEALDRLSEEGWAKKWSSQPYLSRRTTSLRELTTLGIKNAE  115

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L IPS+RNDAAFLFTVVGTTGF+ V+AGQLPGDWGFFVPYL+GSISL+VLAVGS+SPGL
Sbjct  116   ALAIPSVRNDAAFLFTVVGTTGFIAVIAGQLPGDWGFFVPYLVGSISLVVLAVGSVSPGL  175

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLI
Sbjct  176   LQAAISGFSTFFPDYQERIARHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLI  235

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P +  +QQQNL
Sbjct  236   YSGQLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKIRNEQQQNL  295

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL++ SLLKNNK ++EAL+ AMS  ASV
Sbjct  296   TRWAVLYSASLLKNNKTIHEALMAAMSNNASV  327



>gb|AAM64802.1| unknown [Arabidopsis thaliana]
Length=332

 Score =   447 bits (1151),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 220/272 (81%), Positives = 251/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             G DL+ L+SA++KKDS  VKEALD+LSE GWAK WSSQPY+SRRTTS+RELTTLGI+NAE
Sbjct  50    GFDLSSLESAINKKDSNGVKEALDKLSEEGWAKKWSSQPYLSRRTTSLRELTTLGIKNAE  109

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L IPS+RNDAAFLFTVVG+TGF+ VLAGQLPGDWGFFVPYL+GSISL+VLA+GS+SPGL
Sbjct  110   TLAIPSVRNDAAFLFTVVGSTGFIAVLAGQLPGDWGFFVPYLVGSISLVVLAMGSVSPGL  169

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLI
Sbjct  170   LQAAISGFSTFFPDYQERIAAHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLI  229

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSG+LD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P +S +QQQNL
Sbjct  230   YSGKLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKISNEQQQNL  289

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWA L++ SLLKNNK ++EAL+ AMSK ASV
Sbjct  290   TRWAXLYSASLLKNNKTIHEALMAAMSKNASV  321



>ref|XP_010416953.1| PREDICTED: uncharacterized protein LOC104702741 [Camelina sativa]
Length=326

 Score =   446 bits (1148),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 219/272 (81%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             G D + L+SA++KKDS  VKEALD+LSE GWAK WSSQPY+SRRTTS+RELTTLGI+NAE
Sbjct  44    GFDFSTLESAINKKDSNGVKEALDKLSEQGWAKKWSSQPYLSRRTTSLRELTTLGIKNAE  103

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L IPS+RNDAAFLFTVVGTTGF+ VLAGQLPGDWGFFVPYL+GSISL+VLAVGS+SPGL
Sbjct  104   TLAIPSVRNDAAFLFTVVGTTGFIAVLAGQLPGDWGFFVPYLVGSISLVVLAVGSVSPGL  163

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDY+ERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLI
Sbjct  164   LQAAISGFSTFFPDYKERIAAHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLI  223

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P ++  QQQNL
Sbjct  224   YSGQLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKINNAQQQNL  283

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL++ SLLKNNK ++EAL+ AMS  A+V
Sbjct  284   TRWAVLYSASLLKNNKTIHEALMAAMSNNATV  315



>ref|XP_010472193.1| PREDICTED: uncharacterized protein LOC104751845 [Camelina sativa]
Length=326

 Score =   446 bits (1148),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 219/272 (81%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             G DL+ L+SA++KKDS  VKEALD+LSE GWAK WSS PY+SRRTTS+RELTTLGI+NAE
Sbjct  44    GFDLSTLESAINKKDSNGVKEALDKLSEQGWAKKWSSHPYLSRRTTSLRELTTLGIKNAE  103

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L IPS+RNDAAFLFTVVGTTGF+ VLAGQLPGDWGFFVPYL+GSISL+VLAVGS+SPGL
Sbjct  104   TLAIPSVRNDAAFLFTVVGTTGFIAVLAGQLPGDWGFFVPYLVGSISLVVLAVGSVSPGL  163

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDY+ERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLI
Sbjct  164   LQAAISGFSTFFPDYKERIAAHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLI  223

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P ++  QQQNL
Sbjct  224   YSGQLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKINNAQQQNL  283

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL++ SLLKNNK ++EAL+ AMS  A+V
Sbjct  284   TRWAVLYSASLLKNNKTIHEALMAAMSNNATV  315



>ref|XP_006296468.1| hypothetical protein CARUB_v10025652mg [Capsella rubella]
 gb|EOA29366.1| hypothetical protein CARUB_v10025652mg [Capsella rubella]
Length=327

 Score =   446 bits (1148),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/272 (81%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             G D + L+SA++KKDS  VKEALD+LSE GWAK WSSQPY+SRRTTS+RELT LGI+NAE
Sbjct  45    GFDFSTLESAINKKDSNGVKEALDKLSEEGWAKKWSSQPYLSRRTTSLRELTNLGIKNAE  104

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L IPS+RNDAAFLFTVVG+TGF+ VLAGQLPGDWGFFVPYL+GSISL+VLAVGS+SPGL
Sbjct  105   TLAIPSVRNDAAFLFTVVGSTGFIAVLAGQLPGDWGFFVPYLVGSISLVVLAVGSVSPGL  164

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLI
Sbjct  165   LQAAISGFSTFFPDYQERIAAHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLI  224

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P ++  QQQNL
Sbjct  225   YSGQLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKITNAQQQNL  284

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL++ SLLKNNK ++EAL+ AMSK A+V
Sbjct  285   TRWAVLYSASLLKNNKTIHEALMAAMSKNATV  316



>ref|XP_010429116.1| PREDICTED: uncharacterized protein LOC104713646 [Camelina sativa]
Length=326

 Score =   445 bits (1144),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 218/272 (80%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             G D + L+SA++KKDS  VKEALD+LSE GWAK WSSQPY+SRRTTS+RELTTLGI+NAE
Sbjct  44    GFDFSTLESAINKKDSNGVKEALDKLSEQGWAKKWSSQPYLSRRTTSLRELTTLGIKNAE  103

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L IPS+RNDAAFLFTVVGTTGF+ VL+GQLPGDWGFFVPYL+GSISL+VLAVGS+SPGL
Sbjct  104   TLAIPSVRNDAAFLFTVVGTTGFIAVLSGQLPGDWGFFVPYLVGSISLVVLAVGSVSPGL  163

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDY+ERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLI
Sbjct  164   LQAAISGFSTFFPDYKERIAAHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLI  223

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P ++  QQQNL
Sbjct  224   YSGQLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKINNAQQQNL  283

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL++ SLLKNNK ++EAL+ AMS  A+V
Sbjct  284   TRWAVLYSASLLKNNKTIHEALMAAMSNNATV  315



>ref|XP_010099879.1| hypothetical protein L484_020061 [Morus notabilis]
 gb|EXB80808.1| hypothetical protein L484_020061 [Morus notabilis]
Length=247

 Score =   440 bits (1131),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 214/235 (91%), Positives = 223/235 (95%), Gaps = 0/235 (0%)
 Frame = +3

Query  312   LSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRND  491
             L +KDS  VKEALDQLSEVGWAK WSSQPYVSRR TS+RELTTLGI+NAENL IPS+RND
Sbjct  9     LLQKDSTGVKEALDQLSEVGWAKKWSSQPYVSRRMTSLRELTTLGIKNAENLAIPSVRND  68

Query  492   AAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSS  671
             AAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYL GSISLIVLAVGS+SPGLLQAAIDGFSS
Sbjct  69    AAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLTGSISLIVLAVGSVSPGLLQAAIDGFSS  128

Query  672   FFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEI  851
             FFPDYQERIA HEAAHFLVAYLLGLPIL YSLDIGKEHVNLIDE+LEKLIYSGQLD KE+
Sbjct  129   FFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDERLEKLIYSGQLDTKEL  188

Query  852   DRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAV  1016
             DRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQR INRSKP +SK+QQQNLTRWAV
Sbjct  189   DRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRLINRSKPQISKEQQQNLTRWAV  243



>tpg|DAA35769.1| TPA: hypothetical protein ZEAMMB73_590939 [Zea mays]
Length=292

 Score =   433 bits (1114),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 209/245 (85%), Positives = 226/245 (92%), Gaps = 0/245 (0%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             GVDL  LQ+A+ KK S  V++ALDQL E GWAK W SQPYVSRRTTS+RELTTLGI+NAE
Sbjct  33    GVDLKALQAAIDKKSSDDVRQALDQLRESGWAKRWGSQPYVSRRTTSLRELTTLGIKNAE  92

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
             NL IPS+RNDAAFLFTVVGTTGFL VLAGQLPGDWGFFVPYLIGSISLIVLAVGS++PGL
Sbjct  93    NLAIPSVRNDAAFLFTVVGTTGFLAVLAGQLPGDWGFFVPYLIGSISLIVLAVGSVAPGL  152

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI  FS+ FPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L+KLI
Sbjct  153   LQAAIGAFSTVFPDYQERIARHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDEQLQKLI  212

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD KE+DRLAVV+MAGLAAEGL+YDKVVGQSADLFTLQRFINR+KP LSKDQQQNL
Sbjct  213   YSGQLDGKELDRLAVVSMAGLAAEGLEYDKVVGQSADLFTLQRFINRTKPQLSKDQQQNL  272

Query  1002  TRWAV  1016
             TRWAV
Sbjct  273   TRWAV  277



>ref|XP_010937046.1| PREDICTED: uncharacterized protein LOC105056527 isoform X2 [Elaeis 
guineensis]
Length=299

 Score =   432 bits (1112),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 220/291 (76%), Positives = 241/291 (83%), Gaps = 32/291 (11%)
 Frame = +3

Query  225   RKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYV  404
             +KWR+  +       SAAPGVDL  L++A++KKDS AVKE LDQLS++GWAK WSSQPYV
Sbjct  30    KKWRIGAS-------SAAPGVDLKALEAAIAKKDSNAVKEILDQLSQIGWAKKWSSQPYV  82

Query  405   SRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPY  584
             SRRT                         AAFLFTVVG TGFLGV+AGQLPGDWGFFVPY
Sbjct  83    SRRT-------------------------AAFLFTVVGVTGFLGVIAGQLPGDWGFFVPY  117

Query  585   LIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYS  764
             L+GSISLIVLA+GSISPGLLQAAI GFSSFFPDYQERIA HEAAHFLVAYL+GLPIL YS
Sbjct  118   LLGSISLIVLAIGSISPGLLQAAIGGFSSFFPDYQERIARHEAAHFLVAYLIGLPILGYS  177

Query  765   LDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTL  944
             LDIGKEHVNL+DE LEKL+YSGQLD KE+DRLAVV+MAGLAAEGLKYDKVVGQSADLFTL
Sbjct  178   LDIGKEHVNLVDESLEKLVYSGQLDDKELDRLAVVSMAGLAAEGLKYDKVVGQSADLFTL  237

Query  945   QRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QRFINRSKP +SK+QQ+NLTRWAVLFAGSLLKNN   YEAL+ AMSKKASV
Sbjct  238   QRFINRSKPQISKEQQKNLTRWAVLFAGSLLKNNAVAYEALMSAMSKKASV  288



>ref|XP_010652858.1| PREDICTED: uncharacterized protein LOC100264638 isoform X2 [Vitis 
vinifera]
Length=269

 Score =   422 bits (1085),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 206/237 (87%), Positives = 221/237 (93%), Gaps = 3/237 (1%)
 Frame = +3

Query  387   SSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDW  566
             S+ P +    TS+RELTTLG++NAENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDW
Sbjct  26    STNPCIH---TSLRELTTLGMKNAENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDW  82

Query  567   GFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGL  746
             GFFVPYLIGSISLIVLA+GSISPGLLQ AI GFSSFFPDYQERIA HEAAHFLVAYLLGL
Sbjct  83    GFFVPYLIGSISLIVLAIGSISPGLLQVAIGGFSSFFPDYQERIARHEAAHFLVAYLLGL  142

Query  747   PILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQS  926
             PIL YSLDIGKEHVNLIDE+LEKLIYSGQLD KE+DRLAVVAMAGLAAEGL+YDKVVGQS
Sbjct  143   PILGYSLDIGKEHVNLIDERLEKLIYSGQLDTKELDRLAVVAMAGLAAEGLQYDKVVGQS  202

Query  927   ADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ADLFTLQRFINRSKP LSKDQQQNLTRWAVLFAGSL+KNNK ++EAL+ AMSKK +V
Sbjct  203   ADLFTLQRFINRSKPQLSKDQQQNLTRWAVLFAGSLIKNNKAIHEALMTAMSKKGTV  259



>ref|XP_011021936.1| PREDICTED: uncharacterized protein LOC105123871 isoform X2 [Populus 
euphratica]
 ref|XP_011021937.1| PREDICTED: uncharacterized protein LOC105123871 isoform X2 [Populus 
euphratica]
Length=255

 Score =   420 bits (1079),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 205/235 (87%), Positives = 219/235 (93%), Gaps = 1/235 (0%)
 Frame = +3

Query  396   PY-VSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGF  572
             PY  S   TS+R LTTLGI+NAENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGF
Sbjct  10    PYGQSPSQTSLRVLTTLGIKNAENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGF  69

Query  573   FVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPI  752
             FVPYLIGSISL+VLAVGSISPGLLQAAI GFS+ FPDYQERIA HEAAHFL+ YL+GLPI
Sbjct  70    FVPYLIGSISLVVLAVGSISPGLLQAAISGFSAVFPDYQERIARHEAAHFLIGYLIGLPI  129

Query  753   LDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSAD  932
             LDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKE+DRLAVVAMAGLAAEGL+YDKVVGQSAD
Sbjct  130   LDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKELDRLAVVAMAGLAAEGLQYDKVVGQSAD  189

Query  933   LFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LFTLQRFINRSKP +SKDQQQNLTRWAVLF GSL+KNNK L+EAL+ AMS KA+V
Sbjct  190   LFTLQRFINRSKPQISKDQQQNLTRWAVLFGGSLIKNNKSLHEALMTAMSNKATV  244



>ref|XP_008784611.1| PREDICTED: uncharacterized protein LOC103703506 isoform X2 [Phoenix 
dactylifera]
Length=270

 Score =   416 bits (1069),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/257 (81%), Positives = 225/257 (88%), Gaps = 4/257 (2%)
 Frame = +3

Query  336   VKEALDQLSEVGWAKVWSSQPYVSRRT---TSVRELTTLGIRNAENLGIPSIRNDAAFLF  506
             V  ++   SEV   K  S+  Y+       TS++EL TLGI+NAENL IPS+RNDAAFLF
Sbjct  4     VVRSVYHFSEV-LGKCCSNTRYIYNHIYIHTSLQELATLGIKNAENLAIPSVRNDAAFLF  62

Query  507   TVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDY  686
             TVVGTTGFLGV+AGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAI GFSSFFPDY
Sbjct  63    TVVGTTGFLGVIAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIGGFSSFFPDY  122

Query  687   QERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAV  866
             QERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNL+DE LEKL+YSGQLD KE+DRLAV
Sbjct  123   QERIARHEAAHFLVAYLIGLPILGYSLDIGKEHVNLVDESLEKLVYSGQLDDKELDRLAV  182

Query  867   VAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNN  1046
             V+MAGLAAEGLKYDKVVGQSADLFTLQRFINRSKP  SK+QQ+NLTRWAVLFAGSLLKNN
Sbjct  183   VSMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPQTSKEQQKNLTRWAVLFAGSLLKNN  242

Query  1047  KGLYEALIGAMSKKASV  1097
                YEAL+ AMSKKASV
Sbjct  243   AVAYEALMSAMSKKASV  259



>ref|XP_010937047.1| PREDICTED: uncharacterized protein LOC105056527 isoform X3 [Elaeis 
guineensis]
Length=270

 Score =   416 bits (1069),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 215/227 (95%), Gaps = 0/227 (0%)
 Frame = +3

Query  417   TSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGS  596
             TS+RELTTLGI+NAENL IPS+RNDAAFLFTVVG TGFLGV+AGQLPGDWGFFVPYL+GS
Sbjct  33    TSLRELTTLGIKNAENLAIPSVRNDAAFLFTVVGVTGFLGVIAGQLPGDWGFFVPYLLGS  92

Query  597   ISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIG  776
             ISLIVLA+GSISPGLLQAAI GFSSFFPDYQERIA HEAAHFLVAYL+GLPIL YSLDIG
Sbjct  93    ISLIVLAIGSISPGLLQAAIGGFSSFFPDYQERIARHEAAHFLVAYLIGLPILGYSLDIG  152

Query  777   KEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFI  956
             KEHVNL+DE LEKL+YSGQLD KE+DRLAVV+MAGLAAEGLKYDKVVGQSADLFTLQRFI
Sbjct  153   KEHVNLVDESLEKLVYSGQLDDKELDRLAVVSMAGLAAEGLKYDKVVGQSADLFTLQRFI  212

Query  957   NRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             NRSKP +SK+QQ+NLTRWAVLFAGSLLKNN   YEAL+ AMSKKASV
Sbjct  213   NRSKPQISKEQQKNLTRWAVLFAGSLLKNNAVAYEALMSAMSKKASV  259



>ref|XP_006580305.1| PREDICTED: uncharacterized protein LOC100807209 isoform X2 [Glycine 
max]
Length=298

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 207/273 (76%), Positives = 225/273 (82%), Gaps = 32/273 (12%)
 Frame = +3

Query  279   PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
             PGVDL  L+ A+SK                                TS+RELT+LGI+N+
Sbjct  47    PGVDLNTLEFAISK--------------------------------TSLRELTSLGIKNS  74

Query  459   ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
             ENL IPS+RNDAAFLFTVVGTTGFL VLAGQLPGDWGFFVPYLIGSISL+VLAVGSISPG
Sbjct  75    ENLAIPSVRNDAAFLFTVVGTTGFLAVLAGQLPGDWGFFVPYLIGSISLVVLAVGSISPG  134

Query  639   LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
             LLQAAI  FS+ FPDYQERIA HEAAHFL+AYLLGLPI DYSLDIGKEHVNLIDE+LEKL
Sbjct  135   LLQAAIGSFSTLFPDYQERIARHEAAHFLIAYLLGLPIFDYSLDIGKEHVNLIDERLEKL  194

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             IYSGQLDAKE+DRLAVV+MAGLAAEGL YDKVVGQSADLF+LQRFINR+KP LSKDQQQN
Sbjct  195   IYSGQLDAKELDRLAVVSMAGLAAEGLTYDKVVGQSADLFSLQRFINRTKPPLSKDQQQN  254

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LTRWAVLFA SLLKNNK  +EAL+ AM+KKASV
Sbjct  255   LTRWAVLFAASLLKNNKVTHEALMAAMTKKASV  287



>emb|CDY46224.1| BnaCnng13750D [Brassica napus]
Length=306

 Score =   411 bits (1057),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 208/272 (76%), Positives = 235/272 (86%), Gaps = 18/272 (7%)
 Frame = +3

Query  282   GVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE  461
             GVDL+ L+SA++KKD                     SQPY+SRRTTS+RELTTLGI+NAE
Sbjct  42    GVDLSTLESAINKKDKM------------------DSQPYMSRRTTSLRELTTLGIKNAE  83

Query  462   NLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
              L IPS+RNDAAFLFTVVGTTGF+ VLAGQLPGDWGFFVPYL+GSISL+VLAVGS+SPGL
Sbjct  84    TLAIPSVRNDAAFLFTVVGTTGFIAVLAGQLPGDWGFFVPYLVGSISLVVLAVGSVSPGL  143

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQAAI GFS+FFPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVNLIDE+L KLI
Sbjct  144   LQAAISGFSTFFPDYQERIAAHEAAHFLVAYLIGLPILGYSLDIGKEHVNLIDERLAKLI  203

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
             YSGQLD+KE+DRLA VAMAGLAAEGLKYDKV+GQSADLF+LQRFINRS+P +S +QQQNL
Sbjct  204   YSGQLDSKELDRLAAVAMAGLAAEGLKYDKVIGQSADLFSLQRFINRSQPKISNEQQQNL  263

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             TRWAVL++ SLLKNNK ++EAL+ AMS  ASV
Sbjct  264   TRWAVLYSASLLKNNKTIHEALMAAMSNNASV  295



>ref|XP_002975329.1| hypothetical protein SELMODRAFT_103319 [Selaginella moellendorffii]
 gb|EFJ23530.1| hypothetical protein SELMODRAFT_103319 [Selaginella moellendorffii]
Length=271

 Score =   405 bits (1041),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 223/260 (86%), Gaps = 0/260 (0%)
 Frame = +3

Query  318   KKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAA  497
             +KD+ +V+ ALD+LSE GWAK W SQP VSRR T +RELT+LG++NAENL IPS+RND A
Sbjct  2     QKDADSVRLALDKLSEAGWAKQWKSQPNVSRRNTYLRELTSLGLKNAENLAIPSVRNDLA  61

Query  498   FLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFF  677
             FL TVVGTT FL V+AGQLPGDWGFFVPYL+G ISL VLA+GS +PGLLQAAI+ FSS F
Sbjct  62    FLVTVVGTTSFLAVIAGQLPGDWGFFVPYLLGGISLAVLAIGSTAPGLLQAAINSFSSVF  121

Query  678   PDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDR  857
             PDYQER+  HEAAHFL+AYL+GLP+L YSLDIGKEHVNL+DEKL+K IY G LD  E+DR
Sbjct  122   PDYQERLLRHEAAHFLIAYLVGLPVLGYSLDIGKEHVNLVDEKLQKKIYEGFLDGNELDR  181

Query  858   LAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLL  1037
             LAVV+MAGLAAE LKYDKV+GQSADLF+LQR INRSKP LS +QQQNLTRWAVL+AGSL+
Sbjct  182   LAVVSMAGLAAEALKYDKVIGQSADLFSLQRLINRSKPKLSNEQQQNLTRWAVLYAGSLI  241

Query  1038  KNNKGLYEALIGAMSKKASV  1097
             KN    +++L+ AM + ASV
Sbjct  242   KNKSKAFDSLMAAMERNASV  261



>ref|XP_002964467.1| hypothetical protein SELMODRAFT_81106 [Selaginella moellendorffii]
 gb|EFJ34800.1| hypothetical protein SELMODRAFT_81106 [Selaginella moellendorffii]
Length=271

 Score =   405 bits (1040),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 223/260 (86%), Gaps = 0/260 (0%)
 Frame = +3

Query  318   KKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAA  497
             +KD+ +V+ ALD+LSE GWAK W SQP VSRR T +RELT+LG++NAENL IPS+RND A
Sbjct  2     QKDADSVRLALDKLSEAGWAKQWKSQPNVSRRNTYLRELTSLGLKNAENLAIPSVRNDLA  61

Query  498   FLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFF  677
             FL TVVGTT FL V+AGQLPGDWGFFVPYL+G ISL VLA+GS +PGLLQAAI+ FSS F
Sbjct  62    FLVTVVGTTSFLAVIAGQLPGDWGFFVPYLLGGISLAVLAIGSTAPGLLQAAINSFSSVF  121

Query  678   PDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDR  857
             PDYQER+  HEAAHFL+AYL+GLP+L YSLDIGKEHVNL+DEKL+K IY G LD  E+DR
Sbjct  122   PDYQERLLRHEAAHFLIAYLVGLPVLGYSLDIGKEHVNLVDEKLQKKIYEGFLDGNELDR  181

Query  858   LAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLL  1037
             LAVV+MAGLAAE LKYDKV+GQSADLF+LQR INRSKP LS +QQQNLTRWAVL+AGSL+
Sbjct  182   LAVVSMAGLAAEALKYDKVIGQSADLFSLQRLINRSKPKLSNEQQQNLTRWAVLYAGSLV  241

Query  1038  KNNKGLYEALIGAMSKKASV  1097
             KN    +++L+ AM + ASV
Sbjct  242   KNKSKAFDSLMAAMERNASV  261



>gb|ACU14399.1| unknown [Glycine max]
Length=248

 Score =   363 bits (931),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = +3

Query  279  PGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNA  458
            PGVDL  L+SA+SKKDS AVKEAL+QLSEVGWAK WSSQPYVSRRTTS+RELT+LGI+NA
Sbjct  45   PGVDLNTLESAISKKDSDAVKEALNQLSEVGWAKKWSSQPYVSRRTTSLRELTSLGIKNA  104

Query  459  ENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
            ENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISL+VLAVGSISPG
Sbjct  105  ENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLVVLAVGSISPG  164

Query  639  LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
            LLQAAI  F + FPDYQERIA HEAAHFL+AYLLGLPI DYSLDIGKEHVNLIDE+LEKL
Sbjct  165  LLQAAIGSFLTLFPDYQERIARHEAAHFLIAYLLGLPIFDYSLDIGKEHVNLIDERLEKL  224

Query  819  IYSGQLDAKEIDRLAVVAMA  878
            IYSGQLDAKE+DRLAVV+M 
Sbjct  225  IYSGQLDAKELDRLAVVSMG  244



>ref|XP_006585308.1| PREDICTED: uncharacterized protein LOC100306288 isoform X2 [Glycine 
max]
Length=266

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  222  RRKWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPY  401
            +R +++ +      +SSAAPGVDL  L+SA+SKKDS AVKEAL+QLSEVGWAK WSSQPY
Sbjct  26   QRCFKINLPKWTTRASSAAPGVDLNTLESAISKKDSDAVKEALNQLSEVGWAKKWSSQPY  85

Query  402  VSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVP  581
            VSRRTTS+RELT+LGI+NAENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVP
Sbjct  86   VSRRTTSLRELTSLGIKNAENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVP  145

Query  582  YLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDY  761
            YLIGSISL+VLAVGSISPGLLQAAI  FS+ FPDYQERIA HEAAHFL+AYLLGLPI DY
Sbjct  146  YLIGSISLVVLAVGSISPGLLQAAIGSFSTLFPDYQERIARHEAAHFLIAYLLGLPIFDY  205

Query  762  SLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDR  857
            SLDIGKEHVNLIDE+LEKLIYSGQLDAKE+DR
Sbjct  206  SLDIGKEHVNLIDERLEKLIYSGQLDAKELDR  237



>ref|XP_001768660.1| predicted protein [Physcomitrella patens]
 gb|EDQ66598.1| predicted protein [Physcomitrella patens]
Length=360

 Score =   359 bits (921),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 173/266 (65%), Positives = 211/266 (79%), Gaps = 1/266 (0%)
 Frame = +3

Query  300   LQSALSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPS  479
             L++ +  K+ +AVK+ LD+L E G  K+WSS   +SRR T + ELT LGI+NAE L IPS
Sbjct  86    LEAVVVTKNGEAVKDELDKLMEQGQTKLWSSSANISRRNTFMTELTRLGIKNAEELAIPS  145

Query  480   IRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAID  659
             +RNDA FL +VVG T  + V AGQLPGDWGFFVPYL+GS+SL+VLAVGS++PGL Q  ID
Sbjct  146   VRNDAVFLASVVGVTSVIAVAAGQLPGDWGFFVPYLVGSLSLVVLAVGSVAPGLFQVVID  205

Query  660   GFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLD  839
              FSS   DY+ERI  HEAAHFL AY++GLPI+DYSLD+GKEHVNL++E  EK IY G LD
Sbjct  206   KFSSTQGDYKERILRHEAAHFLTAYMVGLPIVDYSLDLGKEHVNLLNEATEKKIYEG-LD  264

Query  840   AKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVL  1019
             +  +DRLAVV+MAGLAAEGLKYDKV+GQSADLF+LQR +NRSK  L   +QQNLTRWAV 
Sbjct  265   SNLLDRLAVVSMAGLAAEGLKYDKVMGQSADLFSLQRLLNRSKQPLKNVEQQNLTRWAVY  324

Query  1020  FAGSLLKNNKGLYEALIGAMSKKASV  1097
             +A SL+KNN   YEAL+ AM+K+ SV
Sbjct  325   YAASLIKNNAKAYEALMEAMAKQLSV  350



>ref|NP_001054033.1| Os04g0639300 [Oryza sativa Japonica Group]
 dbj|BAF15947.1| Os04g0639300, partial [Oryza sativa Japonica Group]
Length=173

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  612   LAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVN  791
             LA+GSISPGLLQAAI  FS+ FPDYQERIA HEAAHFLVAYL+GLPIL YSLDIGKEHVN
Sbjct  1     LAIGSISPGLLQAAIGAFSTVFPDYQERIARHEAAHFLVAYLIGLPILGYSLDIGKEHVN  60

Query  792   LIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKP  971
             LID++L+KLIYSGQLD KEIDRLAVV+MAGLAAEGL+YDKVVGQSADLFTLQRFINR+KP
Sbjct  61    LIDDQLQKLIYSGQLDQKEIDRLAVVSMAGLAAEGLEYDKVVGQSADLFTLQRFINRTKP  120

Query  972   TLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              L+KDQQQNLTRWAVLF+ SLLKNNK  +EAL+ AMS+KASV
Sbjct  121   PLTKDQQQNLTRWAVLFSASLLKNNKAAHEALMSAMSQKASV  162



>ref|XP_010110466.1| hypothetical protein L484_000351 [Morus notabilis]
 gb|EXC58080.1| hypothetical protein L484_000351 [Morus notabilis]
Length=172

 Score =   283 bits (724),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 149/182 (82%), Gaps = 25/182 (14%)
 Frame = +3

Query  312  LSKKDSQAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRND  491
            L +KDS  VKEALDQLSEVGWAK WSSQPYVSRR                          
Sbjct  9    LLQKDSTGVKEALDQLSEVGWAKKWSSQPYVSRRM-------------------------  43

Query  492  AAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSS  671
            AAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGS+SPGLLQAAIDGFSS
Sbjct  44   AAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSVSPGLLQAAIDGFSS  103

Query  672  FFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEI  851
            FFPDYQERIA HEAAHFLVAYLLGLPIL YSLDIGKEHVNLIDE+LEKLIYSGQLD KE+
Sbjct  104  FFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDERLEKLIYSGQLDTKEL  163

Query  852  DR  857
            DR
Sbjct  164  DR  165



>gb|EMT05966.1| hypothetical protein F775_05675 [Aegilops tauschii]
Length=186

 Score =   276 bits (706),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 159/202 (79%), Gaps = 29/202 (14%)
 Frame = +3

Query  492   AAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSS  671
             AAFLFTVVGTTGFL VLAGQLPG                 +A+GS            FS+
Sbjct  3     AAFLFTVVGTTGFLAVLAGQLPG-----------------VAIGS------------FSA  33

Query  672   FFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEI  851
              FPDYQERIA HEAAHFLVAYL GLPIL YSLDIGKEHVNL+D++L+KL+YSGQLD KE+
Sbjct  34    VFPDYQERIARHEAAHFLVAYLTGLPILGYSLDIGKEHVNLVDDQLQKLLYSGQLDQKEV  93

Query  852   DRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGS  1031
             DRLAV++MAGLAAEGL+YDKVVGQSADLFTLQRF+NR+KP L K QQQNLTRWAVL A S
Sbjct  94    DRLAVISMAGLAAEGLEYDKVVGQSADLFTLQRFLNRTKPPLGKAQQQNLTRWAVLIAAS  153

Query  1032  LLKNNKGLYEALIGAMSKKASV  1097
             LLKNNK  ++AL+ AMS+KA+V
Sbjct  154   LLKNNKAAHDALVSAMSQKATV  175



>gb|KCW54372.1| hypothetical protein EUGRSUZ_I00323 [Eucalyptus grandis]
Length=275

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 162/206 (79%), Gaps = 9/206 (4%)
 Frame = +3

Query  219  PRR-KWRLTITLsaassssaaPGVDLTPLQSALSKKDSQAVKEALDQLSEVGWAKVWSSQ  395
            PR+ +WR++ +       SAAPGVDL  L+SA++KKDS AVK+ALDQLSE+GWAK W SQ
Sbjct  46   PRQLQWRISAS-------SAAPGVDLNALESAIAKKDSDAVKDALDQLSELGWAKKWGSQ  98

Query  396  PYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFF  575
            PYVSRRTTS+RELTTLG++NAENL IPS+RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFF
Sbjct  99   PYVSRRTTSLRELTTLGMKNAENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFF  158

Query  576  VPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFL-VAYLLGLPI  752
            VPYL+GSISLIVL VGS SPGLLQAAI GFSS FPDYQERIA HEAAHFL   Y L   +
Sbjct  159  VPYLVGSISLIVLGVGSTSPGLLQAAISGFSSVFPDYQERIARHEAAHFLGTLYCLMHYV  218

Query  753  LDYSLDIGKEHVNLIDEKLEKLIYSG  830
            L   +   +        KLE   ++G
Sbjct  219  LPSWMSSWRRQNRGCPNKLEPACFTG  244



>ref|XP_001694244.1| hypothetical protein CHLREDRAFT_205570 [Chlamydomonas reinhardtii]
 gb|EDP02677.1| predicted protein [Chlamydomonas reinhardtii]
Length=346

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 182/259 (70%), Gaps = 2/259 (1%)
 Frame = +3

Query  327   SQAVKEALDQLSEVGWAKVWSS--QPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAF  500
             S  VKEA D L   G  + W S     V RR   + EL  +GI++ + + IPS+RNDAAF
Sbjct  74    SGPVKEAFDDLQGKGVLRKWGSALTDAVRRRNVFIGELRQVGIKSPDTIAIPSVRNDAAF  133

Query  501   LFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFP  680
             LF+VV TT    V AGQLPGDWGFF  YLIG I+L+VLA+GS +PGLL   ID FS  FP
Sbjct  134   LFSVVATTSVAAVAAGQLPGDWGFFSSYLIGGITLVVLAIGSTAPGLLSVVIDRFSQLFP  193

Query  681   DYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRL  860
             DY++R+  HEAAHFL+ YL+G+PI  YS+++G+EH    + K+++ I   QL  +EID L
Sbjct  194   DYKDRVLKHEAAHFLLGYLVGVPITGYSVELGREHTEFAEAKIQQRIIERQLTDEEIDSL  253

Query  861   AVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLK  1040
             A+VA+AG+AAEG +Y++V+GQ+ADL+ LQR + RSK  LS  QQQN+TRWAV  A  LL+
Sbjct  254   ALVAVAGMAAEGREYEEVMGQTADLYDLQRLLLRSKTKLSDAQQQNITRWAVWSAAGLLR  313

Query  1041  NNKGLYEALIGAMSKKASV  1097
             ++   ++ALI AM + ASV
Sbjct  314   SHAEEHKALIEAMRRGASV  332



>ref|XP_005847105.1| hypothetical protein CHLNCDRAFT_134819 [Chlorella variabilis]
 gb|EFN55003.1| hypothetical protein CHLNCDRAFT_134819 [Chlorella variabilis]
Length=873

 Score =   249 bits (636),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 177/266 (67%), Gaps = 9/266 (3%)
 Frame = +3

Query  306   SALSKKDSQAVKEALDQLSEVGWAKVWSS--QPYVSRRTTSVRELTTLGIRNAENLGIPS  479
             + L ++ S  V   +++L+  G  K W +       RR+  + EL  +G++  E +   S
Sbjct  605   ATLKQEVSGDVLATVEKLANAGALKKWGAALSDLPERRSVMLGELRLVGVKQPEKIAQLS  664

Query  480   IRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAID  659
             +RNDAAFLF+VVGTT    V+ GQLPGDWGFF  YLIG ISL+VLA+GSI+PG+L     
Sbjct  665   VRNDAAFLFSVVGTTSVAAVVLGQLPGDWGFFSSYLIGGISLVVLAIGSINPGILHVV--  722

Query  660   GFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLD  839
                  FPDY++R+  HEAAHFL  YLL +P+ +YSL +GKEH +L++ KL+K +  G L+
Sbjct  723   -----FPDYKQRVVAHEAAHFLAGYLLRVPVANYSLMLGKEHTDLVEAKLQKRLIEGSLE  777

Query  840   AKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVL  1019
               ++D+L+V+AMAG  AE +K+++V+GQ+AD F LQR ++R +P L+  QQQN TRWA  
Sbjct  778   PAQVDQLSVIAMAGATAEAMKFEEVIGQNADFFDLQRIMSRQQPKLNNTQQQNQTRWASY  837

Query  1020  FAGSLLKNNKGLYEALIGAMSKKASV  1097
              A SLL+     YEAL  AM++ A V
Sbjct  838   QAASLLRTYSKEYEALQEAMARGAGV  863



>ref|XP_002503074.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64332.1| predicted protein [Micromonas sp. RCC299]
Length=389

 Score =   236 bits (602),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 172/273 (63%), Gaps = 3/273 (1%)
 Frame = +3

Query  288   DLTPLQSALSKKDSQA-VKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAEN  464
             DL P + A + +++   V+  L+ +   G    W   P ++RR     EL  +G++N+  
Sbjct  103   DLPPSERAEAAENATGTVRSVLNGMKAAGETSRWDCYPELTRRNIFPNELNQMGVKNSSQ  162

Query  465   LGIPSIRNDAAFLFTVVGTTGFLGVLAGQ-LPGDWGFFVPYLIGSISLIVLAVGSISPGL  641
             +G P+  ND  F+  V  +T FL ++ G  LPGDWG F  YLIG ISL VLAVGS +PGL
Sbjct  163   IGQPNNTNDFNFIVGVTMSTSFLALIVGATLPGDWGAFGSYLIGGISLAVLAVGSTAPGL  222

Query  642   LQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLI  821
             LQ AID F+   P+Y+ RIA HEAAHFLV Y+LG+P+  YSL +G  H + ++ KLE+ +
Sbjct  223   LQVAIDRFARISPEYRNRIARHEAAHFLVGYMLGVPVAGYSLGLGAAHTDFLEAKLERKV  282

Query  822   YSG-QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             Y    +  K +  LA V+MAG+AAE L ++ V GQ ADL  LQR +N+++P LS   QQ 
Sbjct  283   YGKIAISEKTMLPLACVSMAGVAAEALAFEDVRGQEADLRDLQRILNKAEPKLSDQSQQQ  342

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             +TRWAV  A S+LK ++  ++AL  AM + ASV
Sbjct  343   VTRWAVWQAASMLKRHEASFDALTRAMEEGASV  375



>ref|XP_005651950.1| hypothetical protein COCSUDRAFT_52156 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27406.1| hypothetical protein COCSUDRAFT_52156 [Coccomyxa subellipsoidea 
C-169]
Length=340

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/255 (51%), Positives = 173/255 (68%), Gaps = 4/255 (2%)
 Frame = +3

Query  342   EALDQLSEVGWAKVWSS---QPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTV  512
             +A++ L E G  K W +   +PY  RR   + +L  +G+ N   +G+ SIRND AFLF+V
Sbjct  77    QAMNALKEGGVLKKWGAGLEEPY-DRRNVFLGDLKRVGVLNPSGIGVASIRNDKAFLFSV  135

Query  513   VGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQE  692
             VG T  + V AG LPGDWGFFVPYL G IS+ VLA GS +PGLLQ  ID FSS +PDY+E
Sbjct  136   VGVTSVVAVAAGFLPGDWGFFVPYLTGGISIAVLATGSTAPGLLQFFIDKFSSIYPDYRE  195

Query  693   RIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVA  872
             R+  HEAAH L  Y+ G+P+  YSL+IG+ H +  + KL++ +  G L+  EID LAVVA
Sbjct  196   RVLRHEAAHLLAGYIFGVPVTAYSLNIGQAHTDFAEAKLQRRLIEGSLEDNEIDALAVVA  255

Query  873   MAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKG  1052
             +AG AAE ++Y++V+GQ+ADL  LQR + RSK  L+  QQQN+TR A+  A SLLK  + 
Sbjct  256   LAGAAAEAMQYEEVIGQTADLVDLQRILLRSKKKLNSSQQQNMTRLAIFEACSLLKKYEK  315

Query  1053  LYEALIGAMSKKASV  1097
              Y+AL  AM   AS+
Sbjct  316   EYKALQAAMQNGASI  330



>ref|XP_007511282.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66842.1| predicted protein [Bathycoccus prasinos]
Length=316

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/260 (43%), Positives = 164/260 (63%), Gaps = 4/260 (2%)
 Frame = +3

Query  330   QAVKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAE-NLGIPSIRNDAAFLF  506
             Q VK  L+++ E      W+S   +       R  T +G+ + +  +G P+   D  F+ 
Sbjct  47    QPVKSLLNEMKENETISKWNSLGKIQSENVFPRAFTEVGLTDVDAKIGTPNNDADFNFIV  106

Query  507   TVVGTTGFLGVLAG-QLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPD  683
             TV  TT  L V+ G  LPGDWG F  YL+G +SL+VLAVGS +PGLL+  +D  S   P+
Sbjct  107   TVTVTTSLLAVIIGVTLPGDWGAFGSYLMGGVSLVVLAVGSTAPGLLKVGVDTVSRLNPE  166

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIY--SGQLDAKEIDR  857
             Y ERI  HEAAHFL+AYL G+P+  YSL + + HV L++ K+EK +   +G +  +E++ 
Sbjct  167   YMERIVKHEAAHFLIAYLSGIPVSSYSLGLMEMHVELLEAKIEKKLVGKAGVITTEEMEA  226

Query  858   LAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLL  1037
             LAVVAM+G+AAE   ++KV GQ ADLF+LQ+ +N+++P L   ++Q++TRWAV  A  ++
Sbjct  227   LAVVAMSGVAAEAKYFEKVAGQEADLFSLQKAMNKTEPKLGAQKEQSVTRWAVYKAARII  286

Query  1038  KNNKGLYEALIGAMSKKASV  1097
              +N+  YE L  AM +  SV
Sbjct  287   TDNEKSYEQLCQAMKEGKSV  306



>ref|XP_001422227.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00544.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=246

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 146/234 (62%), Gaps = 2/234 (1%)
 Frame = +3

Query  402   VSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTGFLGVLAG-QLPGDWGFFV  578
             + RR     EL  L     E +  PS  ND   + TV  +T  L  + G  LPGDWG F 
Sbjct  1     MQRRNVFPNELKRLLKCAPEQIARPSDANDFNLIVTVTLSTSLLATVVGATLPGDWGAFG  60

Query  579   PYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILD  758
              YLIG ISL VLAVGS +PGLL+ A D  +   P+Y+ RIA HEA HFLV Y LG+P+  
Sbjct  61    AYLIGGISLAVLAVGSTAPGLLRVATDRLARVNPEYRRRIARHEAGHFLVGYALGVPVGS  120

Query  759   YSLDIGKEHVNLIDEKLEKLIYSG-QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADL  935
             Y L I + HVN ++ KLE+ I+ G +L   E+  LAVV+M+G+AAE +++D+V+GQSADL
Sbjct  121   YDLGIDQSHVNFMESKLERKIFQGAKLSESEMLPLAVVSMSGVAAEAMEFDEVMGQSADL  180

Query  936   FTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             + LQR +NR  P LS   QQ LTRWAV  A S+LK NK  ++ L   M   ASV
Sbjct  181   YDLQRILNRVDPKLSDASQQELTRWAVFQAASILKTNKSAWDTLTEKMLDGASV  234



>ref|XP_003084143.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL58559.1| unnamed product [Ostreococcus tauri]
Length=340

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 157/257 (61%), Gaps = 5/257 (2%)
 Frame = +3

Query  336   VKEALDQLSEVGWAKVWSSQ-PYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTV  512
             V+ AL+ + E  W  +W+S      RR     EL  +     E +  PS  ND   + TV
Sbjct  74    VRGALNAMREDSW--LWNSALKNPQRRNVFPNELKRVLKAAPEQIAKPSDANDLKLIVTV  131

Query  513   VGTTGFLGVLAGQ-LPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQ  689
               T     V+ G  LPGD G F  YL+G I ++VLAVGS +PGLL+ A D  +   P+Y+
Sbjct  132   TLTCSLAAVVVGATLPGDIGAFGAYLLGGIPIVVLAVGSTAPGLLRVATDRLARVDPEYR  191

Query  690   ERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSG-QLDAKEIDRLAV  866
              RIA HEA HFLV Y  G+P+  Y+L I + HVN ++ KLE+ I+ G +L + E+  LAV
Sbjct  192   RRIARHEAGHFLVGYACGVPVGSYNLGIDESHVNFMESKLERKIFQGAKLSSSEVLPLAV  251

Query  867   VAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNN  1046
             ++MAG+AAE +++++V+GQSADLF LQR +NR  P L+   QQ +TRWAV  A ++L  N
Sbjct  252   ISMAGVAAEAMEFEEVMGQSADLFDLQRILNRVDPKLNDASQQEITRWAVFQAATILSEN  311

Query  1047  KGLYEALIGAMSKKASV  1097
             +  ++AL   M + ASV
Sbjct  312   RAAFDALTEKMQEGASV  328



>ref|XP_002952946.1| hypothetical protein VOLCADRAFT_105755 [Volvox carteri f. nagariensis]
 gb|EFJ45868.1| hypothetical protein VOLCADRAFT_105755 [Volvox carteri f. nagariensis]
Length=321

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 157/266 (59%), Gaps = 43/266 (16%)
 Frame = +3

Query  306   SALSKKDSQAVKEALDQLSEVGWAKVWSS--QPYVSRRTTSVRELTTLGIRNAENLGIPS  479
             +A+  + S  V ++ +QL   G A  W S     + RR   V EL  +GI+N + + +PS
Sbjct  72    AAMRVEFSGPVLDSYEQLRTAGVAAKWGSAVSDALRRRNVFVGELRQVGIKNPDKIAVPS  131

Query  480   IRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAID  659
             +RNDAAFLF+VV +T  L VLAGQLPGDWGFF  YLIGSI+L+VLAVGS +PGLL   ID
Sbjct  132   VRNDAAFLFSVVASTSILAVLAGQLPGDWGFFSSYLIGSITLVVLAVGSTAPGLLAVVID  191

Query  660   GFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLD  839
              FS  FPDY+ERI                               L DE            
Sbjct  192   KFSQIFPDYKERIIER---------------------------TLTDE------------  212

Query  840   AKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVL  1019
               EID LA+VA+AG+AAEG +YD+V+GQ+ADL  LQR + RS+  LS  QQQN+TRWAV 
Sbjct  213   --EIDNLALVAVAGIAAEGREYDEVMGQTADLTDLQRLLLRSRTRLSDSQQQNVTRWAVW  270

Query  1020  FAGSLLKNNKGLYEALIGAMSKKASV  1097
              A  LL+ N   ++AL+ AM + ASV
Sbjct  271   AAAGLLRTNAAEHKALVEAMRRGASV  296



>ref|XP_003061089.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54739.1| predicted protein [Micromonas pusilla CCMP1545]
Length=387

 Score =   177 bits (448),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 133/231 (58%), Gaps = 6/231 (3%)
 Frame = +3

Query  336   VKEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVV  515
             V + L  +   G    W   P + RR     EL  +GI +AE +  PS  ND  F+  V 
Sbjct  144   VSKTLCAMKANGDTTRWDCYPELQRRNVFPNELRQVGIEDAEGIAKPSNTNDFNFIVAVT  203

Query  516   GTTGFLGVLAGQ-LPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQE  692
              +T FL ++ G  LPGDWG F  YL+G ISL VLAVGS +PGLL   ID F+   P Y+ 
Sbjct  204   LSTSFLALVIGVVLPGDWGAFGSYLVGGISLAVLAVGSTAPGLLAVGIDQFARVDPKYRN  263

Query  693   RIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQ--LDAKEIDRLAV  866
             RIA HEAAHFLV Y+LG+P+  YSL +GK HV+ ++ KLE+ I+     +  K +  LA 
Sbjct  264   RIARHEAAHFLVGYMLGVPVAGYSLGLGKTHVDFLEAKLERKIFGPDFAISDKTLLPLAC  323

Query  867   VAMAGLAAEGLKY-DKVVGQSADLFTLQRFINRS--KPTLSKDQQQNLTRW  1010
             V MAG+AAE + +   V GQ  DL  LQR +N++  K   S+   +  T W
Sbjct  324   VCMAGVAAEAMAFPGDVRGQDGDLVDLQRILNKAENKARSSRAGPRAFTHW  374



>dbj|BAD36132.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD36428.1| unknown protein [Oryza sativa Japonica Group]
Length=198

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 93/129 (72%), Gaps = 23/129 (18%)
 Frame = +3

Query  339  KEALDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVG  518
            + ++DQL E+GWAK WSSQPYVS RTTS++ELT LGI++ ENL IPS+RND         
Sbjct  61   EPSMDQLKELGWAKRWSSQPYVSCRTTSLQELTRLGIKHVENLVIPSVRND---------  111

Query  519  TTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERI  698
                          DWGF VPYLIGSISLIVLA+GSISPGLLQAAI  F + FPDYQ+R+
Sbjct  112  --------------DWGFLVPYLIGSISLIVLAIGSISPGLLQAAIGAFLTVFPDYQDRV  157

Query  699  ANHEAAHFL  725
            A HEAAHFL
Sbjct  158  ARHEAAHFL  166



>dbj|BAJ85983.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87324.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=116

 Score =   154 bits (388),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 78/115 (68%), Positives = 91/115 (79%), Gaps = 7/115 (6%)
 Frame = +3

Query  639  LLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKL  818
            LLQ AI  FS+ FP        HEAAHFLVAYL GLPI   SLDIGK+HVNL+D+ L+K+
Sbjct  8    LLQVAIGSFSAVFP-------RHEAAHFLVAYLTGLPISGCSLDIGKQHVNLVDDHLQKM  60

Query  819  IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSK  983
            +YSGQLD KE+DRLAV++MAG AA GL+YDKVVGQSA LFTLQRF+NR+K  L K
Sbjct  61   LYSGQLDQKEVDRLAVISMAGQAAVGLEYDKVVGQSAVLFTLQRFLNRTKTPLGK  115



>gb|ABB47725.1| hypothetical protein LOC_Os10g30980 [Oryza sativa Japonica Group]
 gb|EAZ16251.1| hypothetical protein OsJ_31708 [Oryza sativa Japonica Group]
Length=109

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 69/97 (71%), Gaps = 15/97 (15%)
 Frame = +3

Query  348  LDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDAAFLFTVVGTTG  527
            +DQL E+GWAK WSSQPYVS  TTS++ELTTLGI++ ENL IPS+RND            
Sbjct  1    MDQLKELGWAKRWSSQPYVSCCTTSLQELTTLGIKHVENLAIPSVRND------------  48

Query  528  FLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPG  638
               V   +L  DWG  VPYLIGSISLIVLA+GSISPG
Sbjct  49   ---VRPAKLKNDWGLLVPYLIGSISLIVLAIGSISPG  82



>gb|EJK71112.1| hypothetical protein THAOC_07480 [Thalassiosira oceanica]
Length=401

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 139/292 (48%), Gaps = 48/292 (16%)
 Frame = +3

Query  324   DSQAVKEALDQLSEVGWAKVWSSQPYVSRR--TTSVRELTTL---------------GIR  452
             D+ +  E LD L + G   +W S     RR  T+S   ++ L               G  
Sbjct  113   DAASQSEKLDGLVDSGDLSLWKS---AVRRGPTSSTSNMSLLVPFPVTLETLERRSDGKV  169

Query  453   NAENLGIPSIRNDAAF-------LFTVVGTTGFLGVLA-GQLPGDWGFFVPYLIGSISLI  608
               E+LGI     D  F       +  V+G+T  +G+L+   LP + G  V YL   I + 
Sbjct  170   TGESLGIGG-EGDVKFEEFQDLTVAVVLGST-LMGILSLAVLPENIGATVTYLFALIPVG  227

Query  609   VLAVGSISPGLLQAAIDGFSSFFPDYQ---ERIANHEAAHFLVAYLLGLPILDYSL--DI  773
              + +GS SPG++ AAI G      D +   ERI  HEA HFL  +L GLPI  Y++  D 
Sbjct  228   FIGIGSTSPGIIAAAIKGSRGDSEDAEQQRERICRHEAGHFLCGWLCGLPIKSYNVNDDT  287

Query  774   GKEHVNLIDEKLEKLIYSG----QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFT  941
             G   V           ++G    +L  +EI  L+VVAM+G  AE L +D   G   DL  
Sbjct  288   GVACVEF---------HTGGAGQELSDEEIASLSVVAMSGSVAEILNFDVAKGGENDLLE  338

Query  942   LQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             LQ    +SK  +   +QQ+LTRW  L + +LLK+N   YE L+ A  ++ S+
Sbjct  339   LQNCFRKSKEFIGAAKQQDLTRWGALTSYNLLKSNAQKYEKLVDAFKQRKSL  390



>ref|XP_002184911.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43647.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=207

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = +3

Query  552   LPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDY---QERIANHEAAHF  722
             LP + G  + Y+   + ++ L+VGS +PG +  AI        D    QERI  HEAAHF
Sbjct  21    LPPNIGATLCYVFALLPILFLSVGSSAPGYIANAISSVRGDVDDGVTPQERICRHEAAHF  80

Query  723   LVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLK  902
                Y  GLPI  YS++ G         K+E  + + QL A E+  L+V A++GL AE   
Sbjct  81    CCGYWCGLPIKGYSVENGIA-------KVEFGVNTQQLTATEVAALSVTALSGLVAEAQT  133

Query  903   YDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMS  1082
             + K VG  +DL TL+    +S   +    QQ+LTRW  L A  LLK +   YE ++ A +
Sbjct  134   FGKAVGAESDLLTLEMVFRQSADFIGAAAQQDLTRWGALNAALLLKEHNAKYEQVVQAFA  193

Query  1083  KKASV  1097
              + SV
Sbjct  194   SQQSV  198



>ref|XP_002294037.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED88392.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=207

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 109/200 (55%), Gaps = 8/200 (4%)
 Frame = +3

Query  510   VVGTTGFLGVLA-GQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAID---GFSSFF  677
             V+G+TG LG+ +   LP + G  V YL+  + +  + VGS++PG++   I    G S   
Sbjct  1     VLGSTG-LGIASLALLPENIGATVCYLVALVPIAFIGVGSVAPGIIAGVITSARGKSEDE  59

Query  678   PDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDR  857
                +ER+  HEA HFL  YL GLP+ +Y + +    V  ++   +     G+L   ++  
Sbjct  60    ERRRERVCRHEAGHFLCGYLCGLPVKNYEI-VDSTGVACVEFHTDG--NGGELTEDDVAA  116

Query  858   LAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLL  1037
             L+VVAM+G  AE + YDK  G   DL  LQ    +SK  +   +QQ+LTRW  L +  LL
Sbjct  117   LSVVAMSGSVAEIIAYDKATGGENDLIELQNCFRKSKEFIGAARQQDLTRWGALTSYELL  176

Query  1038  KNNKGLYEALIGAMSKKASV  1097
             + N  +YE L+ A  +K S+
Sbjct  177   RKNSEVYEKLVKAFGEKKSL  196



>ref|XP_005825652.1| hypothetical protein GUITHDRAFT_46078, partial [Guillardia theta 
CCMP2712]
 gb|EKX38672.1| hypothetical protein GUITHDRAFT_46078, partial [Guillardia theta 
CCMP2712]
Length=172

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 91/164 (55%), Gaps = 8/164 (5%)
 Frame = +3

Query  612   LAVGSISPGLLQAA-IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGK-EH  785
             L +G   PGLLQ   I    +   +Y+ER+  HEA HFLV Y LGLPI  YS D      
Sbjct  6     LGMGLSVPGLLQLVLIQIRRAASQEYRERLLWHEAGHFLVGYCLGLPIAAYSADDPILNA  65

Query  786   VNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRS  965
             V   D + + + +      + +D L  V+ AG+ AE +++   +G  AD   LQ F+ RS
Sbjct  66    VQFFDSEEDSISH------EFLDVLCAVSTAGVVAEAIRFGDAIGGYADFSQLQSFLYRS  119

Query  966   KPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             +P L+  +QQ   RW  + A ++LKN +   +ALI AMS+K+S+
Sbjct  120   RPRLNDREQQERVRWGCVAAFTILKNREESLKALIEAMSRKSSI  163



>ref|WP_017309004.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=231

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 89/157 (57%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  ++F P+++ERI +HEA HFLVAYLLG+P++ Y+L           G+  V+  D +
Sbjct  60    LDWVAAFSPEHRERIIHHEAGHFLVAYLLGIPVIGYTLSAWEAWKQKQPGQGGVSFDDAE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G L A+ +DR   V MAG+ AE L Y+   G + D   L   +     + S  
Sbjct  120   LASQLERGSLSAQMVDRYCTVWMAGITAETLVYENAEGGADDKSKLAGVLKSLGFSASAC  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QQ+   R+ VL A +LL+ N   Y+AL+ AM +KA+V
Sbjct  180   QQKQ--RFCVLQAKTLLQENWSAYQALVDAMRQKATV  214



>ref|WP_015083577.1| hypothetical protein [Anabaena sp. 90]
 ref|YP_007001081.1| hypothetical protein ANA_C20593 [Anabaena sp. 90]
 gb|AFW97024.1| hypothetical protein ANA_C20593 [Anabaena sp. 90]
Length=237

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 90/157 (57%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P+Y+ERI +HEA HFLVAYLLG+P+  Y+L           G+  + L D +
Sbjct  60    LDLMARFSPEYKERILHHEAGHFLVAYLLGIPVTSYTLSAWEAWKKGQPGQGGITLEDSE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   I +GQ+ A+ +DR   + MAG+AAE L +    G + D   L  F+     + +  
Sbjct  120   LTAQIETGQITAQMLDRYCTIWMAGIAAETLVFKSAEGGNDDKIKLNEFLQVIGFSETGY  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QQ+   R+ +L + +L++ N   Y+AL+ AM K+AS+
Sbjct  180   QQKQ--RFHLLQSKNLIQENWDSYQALVTAMRKRASI  214



>ref|WP_026735371.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=225

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 89/158 (56%), Gaps = 13/158 (8%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P+++ERI +HEA HFLVAYLLG+P++ Y+L           G+  V+  DE+
Sbjct  60    LDWIAGFSPEHRERIIHHEAGHFLVAYLLGIPVVGYTLSAWEAWRQKQPGQGGVSFDDEE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINR-SKPTLSK  983
             L   +  G L A+ +DR   V MAG+ AE L Y+   G + D   L   +        + 
Sbjct  120   LASQLEKGTLSAQMLDRYCTVWMAGITAETLVYENAEGGADDQTKLAGVLKSLGFSAFAC  179

Query  984   DQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             DQ+Q   R+  L A +LL+ N  +Y+AL+ AM ++A+V
Sbjct  180   DQKQ---RFCALQAKTLLQENWSVYQALVDAMRQRATV  214



>ref|WP_019492843.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=225

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 91/160 (57%), Gaps = 17/160 (11%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEK  806
             +D  +SF P ++ERIA+HEA HFLVA  LG+P++ Y+L+          G   V+  D  
Sbjct  60    LDWIASFSPAHRERIAHHEAGHFLVATKLGIPVVSYTLNAWSALKQGQAGLGGVSFDDAN  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSAD---LFTLQRFINRSKPTL  977
             LE  +   Q+ A+ +DR   V MAG+AAE L Y+   G + D   L  L + +  S+ T 
Sbjct  120   LESELGQRQISAQTLDRYCTVWMAGIAAETLVYNNAEGGADDKTKLVALLKSLGFSESTF  179

Query  978   SKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++ Q     R+ +L A SLL+ N   Y+AL+ AM ++ASV
Sbjct  180   NQKQ-----RFCMLQAKSLLQENWSAYKALVNAMKQRASV  214



>ref|WP_017739677.1| hypothetical protein [Scytonema hofmanni]
Length=230

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 89/157 (57%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  +SF P+++ERI +HEA HFLVAYLLG+P++ Y+L           G+  V+  DEK
Sbjct  60    LDWMASFSPEHRERILHHEAGHFLVAYLLGIPVVGYTLSAWEAVKQKQPGQGGVSFDDEK  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G++ A+ +DR     MAG+AAE L Y+   G + D   L   +      LS +
Sbjct  120   LASQLEQGKITAQMLDRYCTTWMAGIAAETLVYNDTEGGADDKSKLAGVLK--SVGLSPN  177

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             Q     R+ +L A +LL+ +   Y+AL+  M ++ASV
Sbjct  178   QYHLKQRFCLLQAKTLLQEHWSAYQALVDVMRQRASV  214



>ref|WP_016866588.1| hypothetical protein [Fischerella muscicola]
Length=225

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 88/157 (56%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P ++ERI +HEA HFLVAYLLG+P++ Y+L           G+  V+  D +
Sbjct  60    LDWIAGFSPKHRERIIHHEAGHFLVAYLLGIPVIGYTLSAWEAWKQKQPGQGGVSFDDAE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G L A+ +DR   V MAG+ AE L Y+   G + D   L   +     ++S  
Sbjct  120   LASQLEQGTLSAQMLDRYCTVWMAGITAETLVYENAEGGADDKSKLAGVLRSLGFSVSAC  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             +Q+   R+ VL A +LL+ N   Y+AL+ AM +KA+V
Sbjct  180   EQKQ--RFCVLQAKTLLQENWSAYQALVDAMRQKATV  214



>ref|WP_017320959.1| hypothetical protein [cyanobacterium PCC 7702]
Length=228

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 87/157 (55%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P+++ER+ +HEA HFLVAYL  +PI+ YSL           G+  V+  D+K
Sbjct  60    LDWIAGFSPEHRERVLHHEAGHFLVAYLFDIPIIGYSLSAWEAWKQKQSGQGGVSFNDQK  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G + A+ +DR   V MAG+AAE L Y  V G S D   L   +     + S  
Sbjct  120   LALQLEQGTISAQMLDRYCTVWMAGIAAEALVYKNVEGGSDDKSKLATVLTSMGFSPSAC  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             +Q+   R+  L A +LL+ N   Y+AL+ AM ++ASV
Sbjct  180   EQKQ--RFFALQAKTLLQKNWSAYQALVSAMRQRASV  214



>ref|WP_016862568.1| hypothetical protein [Fischerella muscicola]
Length=225

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 88/157 (56%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  ++F P+++ERI +HEA HFLVAYLLG+PI+ Y+L           G+  V+  D +
Sbjct  60    LDWVAAFSPEHRERIIHHEAGHFLVAYLLGIPIIGYTLSAWEAWKQKQPGQGGVSFDDAE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G L A+ +DR   V MAG+ AE L Y+   G + D   L   +     + S  
Sbjct  120   LASQLERGSLSAQMVDRYCTVWMAGITAETLVYENAEGGADDKSKLAGVLKSLGFSASAC  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             +Q+   R+  L A +LL+ N   Y+AL+ AM +KA+V
Sbjct  180   EQKQ--RFCALQAKTLLQENWSAYQALVDAMRQKATV  214



>ref|WP_015152849.1| hypothetical protein [Chroococcidiopsis thermalis]
 ref|YP_007090167.1| hypothetical protein Chro_0752 [Chroococcidiopsis thermalis PCC 
7203]
 gb|AFY86298.1| hypothetical protein Chro_0752 [Chroococcidiopsis thermalis PCC 
7203]
Length=236

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 95/189 (50%), Gaps = 16/189 (8%)
 Frame = +3

Query  573   FVPYLIGSISLIVLAVGSISPGLLQA-----AIDGFSSFFPDYQERIANHEAAHFLVAYL  737
             F P +    +  +LA+ ++     Q       +D  +SF P +++RI  HEA HFLVA+L
Sbjct  28    FSPTIPALATFSILAIATLDSFSFQGKGGNLVLDWLASFSPQHRDRIVRHEAGHFLVAHL  87

Query  738   LGLPILDYSLDI---------GKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAA  890
             L +PI  Y+L           G   V+  D +L   +  G L A+ +DR   V MAGLAA
Sbjct  88    LNIPITGYTLSAWEALKQKQPGLGGVSFEDRELAAQLDRGMLTAQMLDRYCTVWMAGLAA  147

Query  891   EGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALI  1070
             E L Y    G + D   L   +     T +  +Q+   RWAVL A +LL+ N   YEAL+
Sbjct  148   EDLVYSNTEGGADDRQKLGMVLTPLGYTANAVEQKQ--RWAVLQARTLLQTNWSAYEALV  205

Query  1071  GAMSKKASV  1097
             G M ++A V
Sbjct  206   GMMQQRAGV  214



>ref|WP_017314331.1| hypothetical protein [Mastigocladopsis repens]
Length=229

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 89/157 (57%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P+++ERI +HEA HFLVAYLLG+P+++Y+L           G+  V+  D K
Sbjct  60    LDWIAGFSPEHRERIIHHEAGHFLVAYLLGIPVINYTLSAWEALKQRQPGQGGVSFDDGK  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G++ A+ +DR   V MAG+AAE L Y    G + D   L   +     + S  
Sbjct  120   LASQLEQGRISAQMLDRYCTVWMAGIAAETLVYKNSEGGADDKTKLSIVLTNLGFSASTC  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             +Q+   R+  L A +LL+ N   Y+AL+ +M ++A+V
Sbjct  180   EQKQ--RFCTLQAKTLLQENWSAYQALVNSMRQRATV  214



>ref|XP_005706363.1| hypothetical protein isoform 2 [Galdieria sulphuraria]
 gb|EME29843.1| hypothetical protein isoform 2 [Galdieria sulphuraria]
Length=400

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 95/173 (55%), Gaps = 12/173 (7%)
 Frame = +3

Query  606   IVLAVGSISPGL-LQAAI--DGFSSFFPDYQERIANHEAAHFLVAYLLGLPIL-------  755
             I L VG +   + LQ AI  + + + FP Y++++  HEA HFLV+YLLG P+        
Sbjct  212   ISLLVGFLCDQIALQGAIFEELYKNLFPIYKKKVLKHEAGHFLVSYLLGCPVRGIVLSAW  271

Query  756   -DYSLDI-GKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSA  929
                SL I G+      D KLE  + +G L    IDR ++V MAG+AAE L+Y +  G  +
Sbjct  272   ESLSLGIPGQAGTLFFDRKLESELSTGFLTDATIDRYSIVLMAGIAAEALEYGQAEGGQS  331

Query  930   DLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKK  1088
             D   L R +    P  SK++  N  RWAVL A  ++K  K  Y+AL+ A+S K
Sbjct  332   DEAALLRVLTCLNPPWSKERVFNQARWAVLQAILIIKKQKKAYDALVHALSSK  384



>ref|WP_027846109.1| hypothetical protein [Mastigocoleus testarum]
Length=222

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 91/157 (58%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEK  806
             +D  + F P Y+ERI +HEA HFLVA LLG+ +  Y+L          +G+  V+  DE+
Sbjct  60    LDSIARFSPKYRERIVHHEAGHFLVASLLGVAVTGYTLSAWEALQQNQLGQGGVSFDDEE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L + + +G + A+ +DR   V MAG+AAE L YD+V G + D   L   +N    + + +
Sbjct  120   LAQQVEAGHISAQMLDRYCTVLMAGIAAEKLVYDEVEGGADDKSKLNAILNSLGFSPNNN  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             +Q+   R+  L A +L+++N   Y+ L+ AM ++ SV
Sbjct  180   KQK--LRFYTLQAKTLIQDNLSNYQNLVDAMHQRKSV  214



>ref|WP_026723708.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=225

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 87/157 (55%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P+++ERI +HEA HFLVAYLLG+P++ Y+L           G+  V+  D +
Sbjct  60    LDWVAGFSPEHRERIIHHEAGHFLVAYLLGIPVIGYTLSAWEAWKQKQPGQGGVSFDDTE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G L A+ +DR   V MAG+ AE L Y+   G + D   L   +     + S  
Sbjct  120   LAAQLERGSLSAQMVDRYCTVWMAGITAETLVYENAEGGADDKSKLAGVLQSLGFSASTC  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             +Q+   R+  L A +LL+ N   Y+AL+ AM +KA+V
Sbjct  180   EQKQ--RFCALQAKTLLQENWSAYQALVDAMRQKATV  214



>ref|WP_015151609.1| hypothetical protein [Oscillatoria acuminata]
 ref|YP_007088919.1| hypothetical protein Oscil6304_5515 [Oscillatoria acuminata PCC 
6304]
 gb|AFY84999.1| hypothetical protein Oscil6304_5515 [Oscillatoria acuminata PCC 
6304]
Length=230

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 90/157 (57%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEH---------VNLIDEK  806
             +D F+   PD++ R+  HEA HFLVAYLL +PI  Y+L+  +           V   D++
Sbjct  60    VDVFAGMSPDHRSRVLRHEAGHFLVAYLLEIPITGYALNAWEAFKQGQSAGGGVQFDDQE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G L A+  DR  +V MAG+AAE L Y++  G + D   L+  + +++ + +  
Sbjct  120   LLAELQQGSLSAQLFDRYCIVWMAGIAAETLTYERAEGGAEDRTKLKAILAQNRKSATDA  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             Q +   RWA+L A +L+++N   Y++L+ AM ++ +V
Sbjct  180   QLKE--RWAILQAKTLIESNLDAYQSLVTAMEQRLAV  214



>ref|WP_008310822.1| hypothetical protein [Leptolyngbya sp. PCC 6406]
Length=240

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 88/158 (56%), Gaps = 13/158 (8%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             I   S F P  ++RIA+HEAAHFLVA+LL +PI DYSL+          G+  V      
Sbjct  69    IGSLSRFSPQQRQRIAHHEAAHFLVAHLLDIPIQDYSLNAWEAWRKGLPGQGGVRFDTTD  128

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRF-INRSKPTLSK  983
             LE  +  G++ A+ ++R A V MAG+AAE   Y + +G   D    Q+F I   +   S 
Sbjct  129   LEAPLAQGKISAQMVNRYATVWMAGIAAEQWIYGEALGGQDD---QQKFAILWQQLGRSS  185

Query  984   DQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              ++Q   RWA L A ++L++++  Y AL+ AM+   SV
Sbjct  186   QERQTQQRWAALQARTMLEHHQDAYRALVAAMTAGESV  223



>ref|WP_039715373.1| ATP-dependent Zn protease [Scytonema millei]
 gb|KIF17817.1| ATP-dependent Zn protease [Scytonema millei VB511283]
Length=231

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 93/189 (49%), Gaps = 16/189 (8%)
 Frame = +3

Query  573   FVPYLIGSISLIVLAVGSISPGLLQAA-----IDGFSSFFPDYQERIANHEAAHFLVAYL  737
             F P +    +  VLAV ++     Q       +D  +SF P +++RI  HEA HFLVA+L
Sbjct  28    FSPVIPALATFSVLAVATLDSFSFQGKGGNLILDWLASFSPQHRDRIVRHEAGHFLVAHL  87

Query  738   LGLPILDYSLDI---------GKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAA  890
             L +PI  Y+L           G   V+  D +L   +  G L A+ +DR   V MAGLAA
Sbjct  88    LNIPITGYTLSAWEALKQKQPGLGGVSFEDRELAAQLDRGTLTAQMLDRYCTVWMAGLAA  147

Query  891   EGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALI  1070
             E L Y    G + D       +     T    +Q+   RWAVL A +LL+ N   YEAL+
Sbjct  148   EDLVYSNTEGGADDRQKFGMILTPLGYTARAVEQKQ--RWAVLQAKTLLEANWSAYEALV  205

Query  1071  GAMSKKASV  1097
             G M ++A V
Sbjct  206   GMMQQRAGV  214



>ref|WP_035150144.1| ATP-dependent Zn protease [Calothrix sp. 336/3]
 gb|KFB82135.1| hypothetical protein IJ00_03815 [Calothrix sp. 336/3]
Length=224

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 87/159 (55%), Gaps = 15/159 (9%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEK  806
             +D  + F  +++ERI  HEA HFLVA+LLG+P+  Y+L           G+  VN  DE+
Sbjct  60    LDWLAGFSVEHRERILRHEAGHFLVAHLLGIPVAGYTLSAWEAWRQGQTGQGGVNFADEE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRS--KPTLS  980
             L   + +G++ A+ +DR   V MAG+AAE L Y    G + D   L   +      P  S
Sbjct  120   LISQLQTGKITAQMLDRYCTVWMAGIAAETLVYQNSEGGADDRSKLGEILASVGFAPNAS  179

Query  981   KDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               +Q    R+ +L A +LL+ N   YEAL+ AM ++A+V
Sbjct  180   AQKQ----RFCLLQAKTLLEENWTTYEALVNAMGQRATV  214



>ref|WP_017662825.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=227

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 84/157 (54%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D   +   D ++RI  HEA HFLVAYLL +PI DY+L+          G   V   D  
Sbjct  60    LDWLGNTSSDRRDRIVRHEAGHFLVAYLLDIPIADYTLNAWDAVKRGYRGYGGVQFDDRH  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L + +  G L A+ +DR A V MAG+AAE L  D  +G   D   L++   + +P ++  
Sbjct  120   LLEQLQQGTLSARTLDRYAKVWMAGIAAEQLHNDTEIGGDGDRLQLRQIFKQLRPAITDI  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              Q+   RWA+  A +L+  ++  Y AL+ AM++  SV
Sbjct  180   VQRE--RWAIFQAKTLISTHQDAYNALVEAMTEGRSV  214



>ref|WP_039738878.1| ATP-dependent Zn protease [Hassallia byssoidea]
 gb|KIF36664.1| ATP-dependent Zn protease [Hassallia byssoidea VB512170]
Length=231

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 88/158 (56%), Gaps = 13/158 (8%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P++++RI +HEA HFL AYLLG+PI  Y+L           G+  V   D +
Sbjct  60    LDWIAGFSPEHRDRIVHHEAGHFLTAYLLGIPISGYTLTAWEALKQGQPGQGGVAFDDAE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSK-  983
             L   +  G++ A+ +DR   V MAG+AAE L +D   G S D   L   +     + S  
Sbjct  120   LASQLEQGKITAQMLDRYCTVWMAGIAAEALVFDNAEGGSDDKSKLAGVLTSLGFSASAY  179

Query  984   DQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             DQ+Q   R+ +L A +LL+ N   Y+AL+ AM K+ASV
Sbjct  180   DQKQ---RFCLLQAKNLLQENWSSYQALVDAMRKRASV  214



>ref|WP_009455405.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC18058.1| hypothetical protein FJSC11DRAFT_1120 [Fischerella sp. JSC-11]
Length=225

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 87/157 (55%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P ++ERI +HEA HFLVAYLLG+P++ Y+L           G+  V+  D +
Sbjct  60    LDWVAGFSPKHRERIIHHEAGHFLVAYLLGIPVIGYTLSAWEAWKQKQPGQGGVSFDDAE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G+L A+ +DR   V MAG+ AE L Y+   G + D   L   +     + S  
Sbjct  120   LASQLEWGKLTAQMLDRYCTVWMAGITAETLVYENAEGGADDKSKLAGVLKSLGFSASAC  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             +Q+   R+  L A +LL+ N   Y+AL+ AM +KA+V
Sbjct  180   EQKQ--RFCALQAKTLLQENWSAYQALVDAMRQKATV  214



>ref|WP_009557215.1| ATP-dependent Zn protease [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ68450.1| ATP-dependent Zn protease [Oscillatoriales cyanobacterium JSC-12]
Length=229

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 87/157 (55%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEK  806
             +D  + F  D+++R+  HEA HFLVA+ L +P+  Y+L+          G+  V    ++
Sbjct  60    LDRLAGFSADHRDRVVRHEAGHFLVAHQLNIPVTGYTLNAWESFRRGQAGQGGVQFNTQE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L+  +  G L A  +DR   + MAG AAE L Y  V G + D   L+  ++R + + +  
Sbjct  120   LDAELQQGTLSAHLLDRYCTIWMAGAAAEHLTYGNVQGGTDDFQKLRLILSRLQFSPAAI  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QQ+   RWA L A +LL+ +   YE+LI AM ++ASV
Sbjct  180   QQKE--RWAALQAKTLLQEHWETYESLIAAMQRRASV  214



>ref|XP_005837211.1| hypothetical protein GUITHDRAFT_151256 [Guillardia theta CCMP2712]
 gb|EKX50231.1| hypothetical protein GUITHDRAFT_151256 [Guillardia theta CCMP2712]
Length=411

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/276 (28%), Positives = 124/276 (45%), Gaps = 27/276 (10%)
 Frame = +3

Query  336   VKEALDQLSEVGWAKVWSSQPYVSRRTTSVREL-----------TTLGIRNAENLGIPSI  482
             V +  ++L   G  K W+S P V  R  S  EL           T LGI     +    +
Sbjct  131   VYDTFERLKSQGVLKKWNSMP-VKSRAVSQNELKRMLKTELDLDTVLGISGG--VQTEDL  187

Query  483   RNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDG  662
             +      F      G LG   G   G + +++ +L  SI L+++ VGS++P L+   I G
Sbjct  188   KKLTVGAFASSAIIGVLGTAIGGETGGFVYWLTFLGASIPLVLVGVGSVAPSLIGGVISG  247

Query  663   FSSFFP--DYQERIANHEAAHFLVAYLLGLPILDYSLD-------IGKEHVNLIDEKLEK  815
                 F   +  ER   HEAAH L  Y+ GLPI  Y ++         +   N+ D  +E 
Sbjct  248   LQWQFDKTNTMERRIRHEAAHILAGYMCGLPIEGYEVEPMPMCKFYDRREGNIDD--VEA  305

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQ--  989
                +   + +E+D+LAVV ++G+  E   Y++  G   DL  LQ    R++    ++   
Sbjct  306   WKKARPFNEEEVDKLAVVCLSGVMGELSLYERAAGGQQDLEQLQEVYFRAESEKLRNNRV  365

Query  990   QQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++  TRW  + A +LL+ N   +  L   + K AS+
Sbjct  366   REETTRWGAMKARTLLEENNDSFMRLCKQLEKGASI  401



>ref|WP_023065940.1| hypothetical protein [Lyngbya aestuarii]
 gb|ERT07784.1| hypothetical protein M595_2155 [Lyngbya aestuarii BL J]
Length=229

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 95/187 (51%), Gaps = 16/187 (9%)
 Frame = +3

Query  579   PYLIGSISLIVLAVGSISPGLLQAA-----IDGFSSFFPDYQERIANHEAAHFLVAYLLG  743
             P +   ++  +L +G+I    LQ       I+G     P+ ++RI  HEA HFLVAYL+ 
Sbjct  30    PLIPAGLAFSLLVLGTIDTFALQGQGSMILIEGIEGISPEKRDRILRHEAGHFLVAYLMN  89

Query  744   LPILDYSLD---------IGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEG  896
             +PI  Y+L+          G+  V   D++L   +  GQL A+ ID+   V MAG+AAE 
Sbjct  90    IPISGYALNTLEAFKQGQTGQGGVRFNDQELWIQLQKGQLSAQRIDQYCTVWMAGVAAEI  149

Query  897   LKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGA  1076
             L Y+   G   D   ++    + K  LS    +   RWA L A +L++ N+  Y AL+ A
Sbjct  150   LAYENAQGGLEDRGKIRAVWTQLKRPLSDANLKE--RWATLQAQTLIEQNQSAYTALVEA  207

Query  1077  MSKKASV  1097
             M ++  V
Sbjct  208   MEQRICV  214



>ref|WP_015207050.1| hypothetical protein [Cylindrospermum stagnale]
 ref|YP_007146474.1| hypothetical protein Cylst_1510 [Cylindrospermum stagnale PCC 
7417]
 gb|AFZ23794.1| hypothetical protein Cylst_1510 [Cylindrospermum stagnale PCC 
7417]
Length=242

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 89/157 (57%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  SSF  +Y++RI +HEA HFL+A+LLG+P   Y+L           G+  V   DE+
Sbjct  60    LDWISSFSKEYRDRILHHEAGHFLIAHLLGIPATGYTLSAWEAWKQGQPGQGGVTFEDEQ  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   + +G++  + +DR   V MAG+AAE + ++   G + DL  L+  +     T S  
Sbjct  120   LASQLAAGKIGVQMLDRYCTVWMAGIAAETVVFNSAEGGTDDLGKLKGVLTTLGFTESIC  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QQ+   R+  L A +LL+ N   Y+AL+ AM ++ASV
Sbjct  180   QQKQ--RFYALQAKNLLEENWSSYQALVKAMEQRASV  214



>ref|WP_015190980.1| hypothetical protein [Gloeocapsa sp. PCC 7428]
 ref|YP_007130273.1| hypothetical protein Glo7428_4680 [Gloeocapsa sp. PCC 7428]
 gb|AFZ33113.1| hypothetical protein Glo7428_4680 [Gloeocapsa sp. PCC 7428]
Length=232

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 87/160 (54%), Gaps = 17/160 (11%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D F+SF P +++RI  HEA HFLVA+LLG+P+  Y+L           G+  V+  D +
Sbjct  60    LDWFASFSPQHRDRIVRHEAGHFLVAHLLGIPVTGYALSAWEALKQKQPGQGGVSFDDTE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSAD---LFTLQRFINRSKPTL  977
             +   +  G +  + +DR   + MAG+AAE L YD+  G + D   L T+   +  S  ++
Sbjct  120   VASQLAQGTISTQLLDRYCTIWMAGVAAETLVYDRAEGGADDRQHLHTVLSSLGFSAASV  179

Query  978   SKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
                Q     R+  L A +LL+ N   YEALI AM ++A V
Sbjct  180   ELKQ-----RFCSLQARNLLQQNWAAYEALINAMRQRADV  214



>ref|WP_037224627.1| ATP-dependent Zn protease [Richelia intracellularis]
 emb|CDN17160.1| FIG00875011: hypothetical protein [Richelia intracellularis]
Length=228

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 95/181 (52%), Gaps = 18/181 (10%)
 Frame = +3

Query  600   SLIVLAVGSISPGLLQA-----AIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYS  764
             +L VL+V SI   +  +      +DG ++F P ++ERI +HEA HFLVAYLLG  +L+Y+
Sbjct  37    TLTVLSVASIDSFICHSQGSKLVLDGIANFSPKHRERIIHHEAGHFLVAYLLGFQVLNYT  96

Query  765   L---------DIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVV  917
             L         + G+  V + D +L   +    LD    DR   + MAG+ AE L +  V+
Sbjct  97    LTAWEAWRQKEPGQGGVTVDDRQLFNELDERTLDTHIFDRYCTICMAGIVAEKLVFQDVM  156

Query  918   GQSADLFTLQRFINRSK-PTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKAS  1094
             G   D   L + +  S  P  +  Q+Q   R+  L A +LL+ N   Y+ L+ AM K+ S
Sbjct  157   GGLDDRQKLAKVLQVSGFPESAYLQKQ---RFHSLQAQNLLQENWSAYQGLVDAMGKRLS  213

Query  1095  V  1097
             V
Sbjct  214   V  214



>ref|WP_009784766.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW36553.1| hypothetical protein L8106_28286 [Lyngbya sp. PCC 8106]
Length=229

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 97/187 (52%), Gaps = 16/187 (9%)
 Frame = +3

Query  579   PYLIGSISLIVLAVGSISPGLLQAA-----IDGFSSFFPDYQERIANHEAAHFLVAYLLG  743
             P +   ++  +L +G+I    LQ       I+G     P+ ++RI  HEA HFLVAYL+ 
Sbjct  30    PLIPAGLAFSLLVLGTIDTFALQGQGSMILIEGIEGISPEKRDRILRHEAGHFLVAYLMN  89

Query  744   LPILDYSLD---------IGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEG  896
             +PI  Y+L+          G+  V   D++L   + +GQL A+ ID+   V MAG+AAE 
Sbjct  90    IPISGYALNTLEAFKQGQTGQGGVRFNDQELWIQLQTGQLSAQRIDQYCTVWMAGVAAEI  149

Query  897   LKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGA  1076
             L Y+   G   D   ++    + K  LS+   +   R A L A +L++ N+  Y AL+ A
Sbjct  150   LAYENAQGGQEDRGKIRAVWTQLKRPLSEANLKE--RLATLQAQTLIEQNQSAYAALVEA  207

Query  1077  MSKKASV  1097
             M ++ SV
Sbjct  208   MKQRISV  214



>ref|WP_029632698.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=230

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 88/158 (56%), Gaps = 13/158 (8%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P++++RI +HEA HFL AYLLG+P+  Y+L           G+  V   D +
Sbjct  60    LDWIAGFSPEHRDRIVHHEAGHFLTAYLLGIPVSGYTLTAWEALKLGQPGQGGVAFDDAE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSK-  983
             L   +  G++ A+ +DR   V MAG+AAE L +D   G S D   L   +     + S  
Sbjct  120   LALQLEQGKITAQMLDRYCTVWMAGIAAEALVFDNTEGGSDDKNKLAGVLKSLGFSASTY  179

Query  984   DQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             DQ+Q   R+ +L A +LL+ N   Y+AL+ AM ++ASV
Sbjct  180   DQKQ---RFCLLQAKNLLQENWSSYKALVEAMRQRASV  214



>ref|WP_011317110.1| hypothetical protein [Anabaena variabilis]
 ref|YP_320743.1| hypothetical protein Ava_0222 [Anabaena variabilis ATCC 29413]
 gb|ABA19848.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=231

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 90/160 (56%), Gaps = 17/160 (11%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P +++RI +HEA HFLVAYLLG+P+  Y+L           G+  V   D +
Sbjct  60    LDWIAGFSPQHRDRIIHHEAGHFLVAYLLGVPVTGYTLSAWEAWRQGQPGQGGVTFDDVE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSAD---LFTLQRFINRSKPTL  977
             L   +  G++  + ++R   + MAG+AAE L +++  G + D   L T+ + +  S+   
Sbjct  120   LVSQVEQGKISNQALERYCTICMAGIAAETLVFERAEGGTDDKSKLATIFKVLGFSESVC  179

Query  978   SKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              + Q     R+ VL A +LL+NN   Y+AL+ A+ +K+++
Sbjct  180   QQKQ-----RFHVLQAKTLLQNNWASYQALVQAIRQKSTI  214



>ref|XP_008447098.1| PREDICTED: uncharacterized protein LOC103489633 isoform X2 [Cucumis 
melo]
Length=260

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 76/154 (49%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEK  815
              SS++P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+  
Sbjct  93    ISSYWPPYRRRILVHEAGHLLTAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMAS  152

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  Q  
Sbjct  153   NLAEGRLDGTSFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICILLQPPLSVAQMS  212

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RWAVL + +LLK +K  ++  + AM   +S+
Sbjct  213   NQARWAVLQSYNLLKWHKHAHQVAVKAMESGSSL  246



>ref|WP_012407348.1| hypothetical protein [Nostoc punctiforme]
 ref|YP_001864266.1| hypothetical protein Npun_F0560 [Nostoc punctiforme PCC 73102]
 gb|ACC79323.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=225

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 87/157 (55%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F  ++++RI +HEA HFLVAYLLG+P+  Y+L           G+  V+  D +
Sbjct  60    LDWIAGFSSEHRDRIVHHEAGHFLVAYLLGIPVTGYTLSAWEAWKQGQPGQGGVSFDDGE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G++ A+ +DR   V MAG+AAE L +D   G S D   L   +     + S  
Sbjct  120   LASQLEVGKISAQMLDRYCTVWMAGIAAETLVFDNAEGGSDDKSKLIGVLTVLGFSESVY  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QQ+   R+  L A +LL+ N   YEAL+ AM ++ASV
Sbjct  180   QQK--LRFHALQAKTLLQENWSSYEALVNAMRQRASV  214



>ref|WP_023076788.1| atp-dependent zn protease [Leptolyngbya sp. Heron Island J]
 gb|ESA32195.1| atp-dependent zn protease [Leptolyngbya sp. Heron Island J]
Length=230

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 82/160 (51%), Gaps = 17/160 (11%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             ID  S   P+Y +RI  HEA HFL AYLLG+PI DY+L           G   V    + 
Sbjct  60    IDWISQRSPEYCDRIVRHEAGHFLTAYLLGIPIADYTLTAWEALHSGVDGNGGVIFKTDD  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSAD---LFTLQRFINRSKPTL  977
             +++ + +G++  +EIDR   V MAG+AAE + Y    G   D   L  L R INR    +
Sbjct  120   IDRAVAAGKISQQEIDRYCTVWMAGIAAEEITYGSAEGGHDDRLKLNLLWRQINRPLAEV  179

Query  978   SKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
                Q     RW++L A +L++     Y  LI AM+++  V
Sbjct  180   PLKQ-----RWSMLQAKTLIEKEADAYGVLIDAMAERRPV  214



>ref|WP_010996570.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_486454.1| hypothetical protein alr2414 [Nostoc sp. PCC 7120]
 dbj|BAB74113.1| alr2414 [Nostoc sp. PCC 7120]
Length=228

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 89/160 (56%), Gaps = 17/160 (11%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P +++RI +HEA HFLVAYLLG+P+  Y+L           G+  V   D +
Sbjct  60    LDWIAGFSPQHRDRIIHHEAGHFLVAYLLGVPVTGYTLSAWEAWRQGLPGQGGVTFDDVE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSAD---LFTLQRFINRSKPTL  977
             L   +  G++  + ++R   + MAG+AAE L +++  G   D   L T+ + +  S+   
Sbjct  120   LMSQVQQGKISNQVLERYCTICMAGIAAETLVFERAEGGIDDKSKLATIFKVLGFSESVC  179

Query  978   SKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              + Q     R+ VL A +LL+NN   YEAL+ A+ +K+++
Sbjct  180   QQKQ-----RFHVLQAKTLLQNNWASYEALVQAIRQKSAI  214



>ref|XP_009768417.1| PREDICTED: uncharacterized protein LOC104219423 [Nicotiana sylvestris]
Length=392

 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 77/154 (50%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              SSF+P Y+ RI  HEA H LVAYL+G PI    LD          G+      DEKL+ 
Sbjct  224   ISSFWPPYKRRICVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKLQN  283

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G+L +   DR  +V  AG+AAE L Y +  G   D    +      +P LS  Q  
Sbjct  284   ELAEGRLSSTAFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRSICILLEPPLSVAQMS  343

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW+VL + +LLK +K  + A + A+    S+
Sbjct  344   NQARWSVLQSYNLLKWHKQAHRAAVKAIESGCSL  377



>ref|WP_016874006.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=232

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 85/157 (54%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P ++ERI +HEA HFLVAYLL +P++ Y+L           G+  V+  D++
Sbjct  60    LDWIAGFSPAHRERIIHHEAGHFLVAYLLDIPVIGYTLSAWEAWKQKQPGQGGVSFDDQE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G +  + +DR   V MAG+AAE L Y    G + D   L   +     + S  
Sbjct  120   LASQLERGTISTQMLDRYCTVWMAGIAAETLVYKNAEGGADDKSKLAGVLGSMGCSASVC  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             +Q+   R+  L A +LL+ N   Y+AL+ AM ++ASV
Sbjct  180   EQKQ--RFFALQAKTLLQENWLAYQALVNAMRQRASV  214



>ref|WP_038099010.1| ATP-dependent Zn protease [Tolypothrix bouteillei]
 gb|KIE08236.1| ATP-dependent Zn protease [Tolypothrix bouteillei VB521301]
Length=235

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 87/157 (55%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  +SF P+++ERI +HEA HFLVAYLLG+P++ Y+L           G+  V+  D +
Sbjct  60    LDWMASFSPEHRERILHHEAGHFLVAYLLGIPVVGYTLSAWEAIKQKQPGQGGVSFDDGE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G++ A+ +DR     MAG+AAE L Y+   G + D   L   +     + S  
Sbjct  120   LASQLEQGKITAQMLDRYCTTWMAGIAAETLVYNNTEGGADDKSKLAGVLKSLGFSGSNT  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               +   R+ +L A +LL+ +   Y+AL+  M ++ASV
Sbjct  180   NLKQ--RFCLLQAKTLLEEHWAAYQALVDVMRQRASV  214



>ref|XP_006346027.1| PREDICTED: uncharacterized protein LOC102605389 [Solanum tuberosum]
Length=364

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 76/154 (49%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEK  815
              SSF+P Y+ RI  HEA H LVAYL+G PI    LD          G+      DEKLE 
Sbjct  196   ISSFWPPYKRRICVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKLEN  255

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  GQL     DR  +V  AG+AAE L Y +  G   D    +      +P LS  Q  
Sbjct  256   ELAEGQLSGTTFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRSISILLEPPLSVAQMS  315

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW++L + +LLK +K  + A + A+    S+
Sbjct  316   NQARWSLLQSYNLLKWHKHAHRAAVKAIENGCSL  349



>ref|XP_004243971.1| PREDICTED: uncharacterized protein LOC101254711 [Solanum lycopersicum]
Length=358

 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 76/154 (49%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEK  815
              SSF+P Y+ RI  HEA H LVAYL+G PI    LD          G+      DEKLE 
Sbjct  190   ISSFWPPYKRRICVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKLEN  249

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  GQL     DR  +V  AG+AAE L Y +  G   D    +      +P LS  Q  
Sbjct  250   ELAVGQLSGTTFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRSISILLEPPLSMAQMS  309

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW++L + +LLK +K  + A + A+    S+
Sbjct  310   NQARWSLLQSYNLLKWHKHAHRAAVKAIENGCSL  343



>ref|WP_036002232.1| ATP-dependent Zn protease [Leptolyngbya sp. JSC-1]
Length=237

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 70/213 (33%), Positives = 108/213 (51%), Gaps = 22/213 (10%)
 Frame = +3

Query  501   LFTVVGTTGFLGVLAGQLPGDWGFFVPYLI--GSISLIVLAVGSISPGLLQAAIDGFSSF  674
             +FT+V  T  LG L    P     FVP ++  G +S+  L   S    +    +D F+SF
Sbjct  13    IFTLV-MTSLLGPLLHLSP-----FVPAVVTFGILSVATLDTLSWRGQVGNLVVDWFASF  66

Query  675   FPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKLIYS  827
               +++ R+  HEA HFL A+LL +P+  Y+L           G+  V+   E LE  +  
Sbjct  67    SAEHRARVVQHEAGHFLAAHLLEIPVTGYTLSAWESFRQGQPGRGGVSFALEPLEFQLQQ  126

Query  828   G---QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             G   QL  + +DR   V MAG+AAE L Y    G   D   L+   ++ K   S+   + 
Sbjct  127   GQSTQLSTQLLDRFCTVWMAGIAAEQLTYGNAEGGGDDRLKLRLLWSQLKRPDSEGALKE  186

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RWA+L A +LL++N+  Y+AL+ AM+++  V
Sbjct  187   --RWALLQAKTLLESNRVAYDALVTAMAQRVPV  217



>ref|WP_027255391.1| hypothetical protein [Planktothrix agardhii]
Length=226

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 95/187 (51%), Gaps = 16/187 (9%)
 Frame = +3

Query  579   PYLIGSISLIVLAVGSISPGLLQAA-----IDGFSSFFPDYQERIANHEAAHFLVAYLLG  743
             P++   I+  +L V ++     Q       IDG +      QERI +HEA HFLVAYL+ 
Sbjct  30    PFIPAGITFFLLGVATLDVFQFQGQGASLLIDGLAGTSASTQERILHHEAGHFLVAYLME  89

Query  744   LPILDYSLD---------IGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEG  896
             +PI  Y+L+           +  V   D+ L + +  GQ+ A+ +DR   V MAG+AAE 
Sbjct  90    IPIQGYALNGWEAFKQGFKAQGGVQFADQLLWEQLQQGQISAQVLDRYCAVWMAGIAAET  149

Query  897   LKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGA  1076
             L + K  G   D   +     + +  LS+ + +   RWA+L A +L++ +K  Y  L+ A
Sbjct  150   LIFKKAEGGREDRNKIIAIWTQLQRPLSEAKIKE--RWAILQAKTLIETHKVAYLGLVEA  207

Query  1077  MSKKASV  1097
             M  +ASV
Sbjct  208   MRNRASV  214



>ref|WP_015138693.1| hypothetical protein [Nostoc sp. PCC 7524]
 ref|YP_007075848.1| hypothetical protein Nos7524_2409 [Nostoc sp. PCC 7524]
 gb|AFY48251.1| hypothetical protein Nos7524_2409 [Nostoc sp. PCC 7524]
Length=230

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 87/157 (55%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P +++RI +HEA HFLVA+LLG+P+  Y+L           G+  V+  DE+
Sbjct  60    LDWIAGFSPQHRDRIIHHEAGHFLVAHLLGIPVTGYTLSAWEAWKQGQPGQGGVSFDDEE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G+L  + ++R   V MAG+AAE L + +  G   D   L   +     + S  
Sbjct  120   LASQLQQGKLSTQMLERYCTVWMAGIAAENLVFTQAEGGFDDQSKLAAVLKTVGFSESAY  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QQ+   R+ VL A +LL+ N   Y+AL+ AM ++A++
Sbjct  180   QQKQ--RFHVLQAKTLLQENWSSYQALVVAMRQRATI  214



>ref|WP_039726475.1| ATP-dependent Zn protease [Lyngbya confervoides]
 gb|KIF14684.1| ATP-dependent Zn protease [Aphanocapsa montana BDHKU210001]
 gb|KIF39608.1| ATP-dependent Zn protease [Lyngbya confervoides BDU141951]
Length=234

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 81/160 (51%), Gaps = 17/160 (11%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             I+G +    D +ERI +HEA HFL+AYLL +P+ DY+L           G   V      
Sbjct  60    INGLNRLSGDERERIIHHEAGHFLIAYLLNIPVTDYTLSAWDAWKKGLPGLGGVQFDTSD  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSAD---LFTLQRFINRSKPTL  977
             LE  + +GQL A+ ++R   V MAG+AAE L Y +  G   D      L + + R  P  
Sbjct  120   LEATLKTGQLPAQTLNRYCTVWMAGIAAEQLVYGQAQGGQDDRQKFSILWQQLQRPIP--  177

Query  978   SKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
                + Q   RWA L A +LL+ ++  Y AL+ AMS    V
Sbjct  178   ---EGQMRQRWAALQAKTLLEKHQDAYTALVAAMSADTPV  214



>ref|WP_028083464.1| hypothetical protein [Dolichospermum circinale]
Length=226

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 86/157 (55%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P+Y+ERI +HEA HFLVA+LL +PI  Y+L           G+  V++ D +
Sbjct  60    LDFLARFSPEYKERILHHEAGHFLVAHLLEIPITGYTLSAWEAWKQGQPGQGGVSIDDRE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   I  G++  + ++R   + MAG+AAE L +D   G + D   L +F+       S+D
Sbjct  120   LTTQIEKGEISTQILERYCTILMAGIAAETLIFDAPQGGNDDKIKLMQFLQVLG--FSED  177

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               Q   R+ +L + +L++ N   Y+AL+ AM K   V
Sbjct  178   IYQQKQRFHLLQSKNLIQENWESYQALVSAMKKGVDV  214



>ref|XP_006858219.1| hypothetical protein AMTR_s00062p00186450 [Amborella trichopoda]
 gb|ERN19686.1| hypothetical protein AMTR_s00062p00186450 [Amborella trichopoda]
Length=335

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 74/153 (48%), Gaps = 9/153 (6%)
 Frame = +3

Query  648   AAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLID  800
               I   S  +P Y+ R+  HEA H L+AYL+G PI    LD          G+      D
Sbjct  162   CCIAQISFLWPPYRRRVLVHEAGHLLIAYLMGCPIRGVILDPLVAVQMGIQGQAGTQFWD  221

Query  801   EKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLS  980
             EKLEK +  G+L +   DR  +V  AG+AAE L Y +  G   D    +      +P LS
Sbjct  222   EKLEKELADGRLSSTAFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICVLLQPPLS  281

Query  981   KDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               Q  N  RWAV  +  LLK +KG + A + A+
Sbjct  282   TSQMSNQARWAVQQSYKLLKMHKGAHRAAVKAI  314



>gb|KDP25068.1| hypothetical protein JCGZ_22603 [Jatropha curcas]
Length=404

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H LVAYL+G PI    LD          G+      DEK+ K 
Sbjct  237   SSYWPPYKRRILVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNKE  296

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  GQL     DR  +V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  297   LAEGQLSGGTFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLQPPLSVAQMSN  356

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+VL A +LLK  K  + A + A+   +S+
Sbjct  357   QARWSVLQAYNLLKWQKHAHRAAVKALESGSSL  389



>ref|WP_011613756.1| hypothetical protein [Trichodesmium erythraeum]
 ref|YP_723906.1| hypothetical protein Tery_4446 [Trichodesmium erythraeum IMS101]
 gb|ABG53433.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
Length=229

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 84/147 (57%), Gaps = 14/147 (10%)
 Frame = +3

Query  687   QERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKLIYSGQLD  839
             ++RI  HEA HFLVAYLL +PI  Y+L+           +  V   D+KL   +YSG + 
Sbjct  71    RDRIICHEAGHFLVAYLLEIPISGYALNAWEAFRQGQSSQGGVRFDDQKLAAQLYSGVIS  130

Query  840   AKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINR-SKPTLSKDQQQNLTRWAV  1016
             ++ +DR   V MAG+AAE L Y    G + D   +   + +  +P  SK +Q     WA 
Sbjct  131   SQLVDRYCTVWMAGIAAENLVYGNAEGGAEDRTKITAILRQLKRPGESKLKQS----WAS  186

Query  1017  LFAGSLLKNNKGLYEALIGAMSKKASV  1097
             L A +LL+N++  Y+AL+ AM++++SV
Sbjct  187   LQARNLLENHQSAYKALVKAMTERSSV  213



>emb|CBI24181.3| unnamed protein product [Vitis vinifera]
Length=388

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L AYL+G PI    LD          G+      DEKLEK 
Sbjct  221   SSYWPPYRRRILVHEAGHLLTAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKLEKE  280

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+L     DR  +V  AG+AAE L Y +  G   D    +      +P L+  Q  N
Sbjct  281   LAEGRLSGTTFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICVLLRPPLTIGQMSN  340

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+VL + +LLK +K  + A + A+    S+
Sbjct  341   QARWSVLQSYNLLKWHKHAHRAAVKALESGGSL  373



>ref|XP_007022576.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007022577.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY14101.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY14102.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=402

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 77/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y++RI  HEA H LVAYL+G P+    LD          G+      D+K+   
Sbjct  235   SSYWPPYRQRILVHEAGHLLVAYLMGCPLRGVILDPIVAMQMGIQGQAGTQFWDDKMNNE  294

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  GQL A   DR  +V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  295   MAEGQLSASTFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICVLLQPPLSVAQMSN  354

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+VL + +LLK ++  + A + AM    S+
Sbjct  355   QARWSVLQSYNLLKWHRHAHRAAVKAMESGGSL  387



>ref|WP_015171342.1| hypothetical protein [Geitlerinema sp. PCC 7407]
 ref|YP_007108827.1| hypothetical protein GEI7407_1281 [Geitlerinema sp. PCC 7407]
 gb|AFY65775.1| hypothetical protein GEI7407_1281 [Geitlerinema sp. PCC 7407]
Length=231

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 83/157 (53%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             ID  SSF   +++R+ +HEA HFL AY+LG+P+  Y+L+           +  V      
Sbjct  60    IDWLSSFSQAHRDRVLHHEAGHFLAAYILGIPVTSYALNAWEAFRQGQPAQGGVQFDLGP  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             LE  +  G + +  IDR   V MAG AAE L Y  V G + D    Q+   + + +  + 
Sbjct  120   LEGELQQGLISSVSIDRYCTVWMAGAAAEKLVYGNVEGGADDRAKFQQLWAQMRRSPEEG  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              Q+   RW+ L A +LL+ +   YEAL+ AM ++ASV
Sbjct  180   SQK--VRWSDLRARTLLETHWEAYEALVAAMKQRASV  214



>ref|XP_010669996.1| PREDICTED: uncharacterized protein LOC104887105 [Beta vulgaris 
subsp. vulgaris]
Length=399

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 78/153 (51%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L AYL+G PI    LD          G+      DE LEK 
Sbjct  232   SSYWPPYKRRILVHEAGHLLTAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDENLEKE  291

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+L +   DR  +V  AG+AAE L Y +  G   D    +      +P L+  Q  N
Sbjct  292   LAGGRLSSTAFDRYCIVLFAGIAAEALVYGEAEGGENDENLFRGICVLLQPPLNVPQMSN  351

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RWAVL + +LLK +K  ++A + A+   +S+
Sbjct  352   QARWAVLQSYNLLKWHKQAHKAAVKALESGSSL  384



>ref|XP_002263645.3| PREDICTED: uncharacterized protein LOC100261626 [Vitis vinifera]
 ref|XP_010645134.1| PREDICTED: uncharacterized protein LOC100261626 [Vitis vinifera]
Length=378

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L AYL+G PI    LD          G+      DEKLEK 
Sbjct  211   SSYWPPYRRRILVHEAGHLLTAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKLEKE  270

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+L     DR  +V  AG+AAE L Y +  G   D    +      +P L+  Q  N
Sbjct  271   LAEGRLSGTTFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICVLLRPPLTIGQMSN  330

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+VL + +LLK +K  + A + A+    S+
Sbjct  331   QARWSVLQSYNLLKWHKHAHRAAVKALESGGSL  363



>ref|WP_006455994.1| hypothetical protein [Synechococcus sp. PCC 7335]
 gb|EDX86231.1| hypothetical protein S7335_3934 [Synechococcus sp. PCC 7335]
Length=243

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 86/157 (55%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             ID  S    +Y++RI +HEA HFLVA+LL +P+  Y+L           G   V L    
Sbjct  60    IDLISRQSSEYRQRILHHEAGHFLVAHLLDIPVQSYTLSAWEATKAGVPGLGGVVLDTAA  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             +E  + +G + A++++R  ++ MAG+AAE   Y    G   D   L+    +++ T S  
Sbjct  120   IENDLATGTISAQQVNRYCILWMAGIAAETQIYGSAEGGEDDQTKLRLLWKQTQRTASAA  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             + Q   RWA+L A +LL+  K  Y+AL+ AMSK +SV
Sbjct  180   ETQ--IRWALLQAQTLLEKQKQAYDALVEAMSKGSSV  214



>ref|WP_015203927.1| hypothetical protein [Crinalium epipsammum]
 ref|YP_007143329.1| hypothetical protein Cri9333_2980 [Crinalium epipsammum PCC 9333]
 gb|AFZ13819.1| hypothetical protein Cri9333_2980 [Crinalium epipsammum PCC 9333]
Length=224

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 86/157 (55%), Gaps = 16/157 (10%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +DGF+ F P+Y++RI  HEA HFLVAYLLG+PI  Y+L           G+  V+   ++
Sbjct  60    LDGFARFSPEYRDRIIKHEAGHFLVAYLLGIPITGYTLSAWEAFQKGQPGQGGVSFAPQE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
                  ++    A  I R   V MAG+AAE L Y    G   D   LQ  ++    ++++ 
Sbjct  120   -----FTSPQAAIIIQRYCTVWMAGIAAENLVYGNAEGGGEDRQKLQEVLSGMGRSVNEC  174

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              Q  L R+ +L A ++++ +  +YE+++ AM ++ SV
Sbjct  175   LQ--LERFCILQAKTMIQEHLKVYESIVAAMQQRKSV  209



>ref|XP_009590707.1| PREDICTED: uncharacterized protein LOC104087850 [Nicotiana tomentosiformis]
Length=392

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 76/154 (49%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              SSF+P Y+ RI  HEA H LVAYL+G PI    LD          G+      DEKL+ 
Sbjct  224   ISSFWPPYKRRICVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKLQN  283

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G+L +   DR  +V  AG+AAE L Y +  G   D    +      +P LS  Q  
Sbjct  284   ELAEGRLSSTAFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRSICILLEPPLSVAQMS  343

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW+VL + +LLK +   + A + A+    S+
Sbjct  344   NQARWSVLQSYNLLKWHTHAHRAAVKAIESGCSL  377



>gb|KEI68740.1| hypothetical protein A19Y_4027 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=227

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 93/181 (51%), Gaps = 14/181 (8%)
 Frame = +3

Query  582   YLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDY  761
             +L+G  +L V         LL   IDG +      QERI +HEA HFLVAYL+ +PI  Y
Sbjct  40    FLLGVATLDVFQFQGQGASLL---IDGLAGTSASTQERILHHEAGHFLVAYLMEIPIQGY  96

Query  762   SLD---------IGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKV  914
             +L+           +  V   D+ L + +  GQ+ A+ +DR   V MAG+AAE L + K 
Sbjct  97    ALNGWEAFKQGFKAQGGVQFADQLLWEQLQQGQISAQVLDRYCAVWMAGIAAETLIFKKA  156

Query  915   VGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKAS  1094
              G   D   +     + +  LS+ + +   RWA+L A +L++ +K  Y  L+ AM  +AS
Sbjct  157   EGGREDRNKIIAIWTQLQRPLSEAKIKE--RWAILQAKTLIETHKVAYLGLVEAMRNRAS  214

Query  1095  V  1097
             V
Sbjct  215   V  215



>ref|XP_009039752.1| hypothetical protein AURANDRAFT_72206 [Aureococcus anophagefferens]
 gb|EGB05621.1| hypothetical protein AURANDRAFT_72206 [Aureococcus anophagefferens]
Length=1061

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 111/249 (45%), Gaps = 24/249 (10%)
 Frame = +3

Query  348   LDQLSEVGWAKVWSSQPYVSRRT---TSVRELTTLGIRNAENL-GIPSIRND-----AAF  500
             L  L   G A  W+S+  V+      T  R     GI  A++L     + ND      AF
Sbjct  797   LGSLKADGKAPAWASRELVAAGAEVPTEARVRAATGINGAKDLLAQEEVGNDELLQITAF  856

Query  501   LFTVVGTTGFLGVLAGQL-PGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFSSFF  677
             +F    T+  L V +G L  G+ G    Y+   + +I L VGS SPG++ A         
Sbjct  857   VFV---TSAILAVGSGALIGGNLGAAFTYIFAVLPIIFLGVGSSSPGVILAVYGATKQAK  913

Query  678   PDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQLDAKEIDR  857
              +   R   HEAAH +  Y LGLP+  Y+           D+ +E     G     + +R
Sbjct  914   ENTAPRRRRHEAAHLVAGYALGLPVAAYA-----------DDAVEFYDGPGPKSRDDAER  962

Query  858   LAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLL  1037
             LA VA+AG  AE   + +  G   D   LQR  +R +P L+  +QQ  TR  VL A S+L
Sbjct  963   LACVALAGAVAECDAFGEAKGAQDDFANLQRLFDRVEPRLTPAEQQAATRRGVLNAYSVL  1022

Query  1038  KNNKGLYEA  1064
               ++   +A
Sbjct  1023  FGSRARRDA  1031



>ref|XP_008447096.1| PREDICTED: uncharacterized protein LOC103489633 isoform X1 [Cucumis 
melo]
 ref|XP_008447097.1| PREDICTED: uncharacterized protein LOC103489633 isoform X1 [Cucumis 
melo]
Length=403

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+   
Sbjct  237   SSYWPPYRRRILVHEAGHLLTAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMASN  296

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  297   LAEGRLDGTSFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICILLQPPLSVAQMSN  356

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RWAVL + +LLK +K  ++  + AM   +S+
Sbjct  357   QARWAVLQSYNLLKWHKHAHQVAVKAMESGSSL  389



>ref|XP_004139896.1| PREDICTED: uncharacterized protein LOC101213430 [Cucumis sativus]
 ref|XP_004159181.1| PREDICTED: uncharacterized LOC101213430 [Cucumis sativus]
 gb|KGN44287.1| hypothetical protein Csa_7G239000 [Cucumis sativus]
Length=403

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+   
Sbjct  237   SSYWPPYRRRILVHEAGHLLTAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMASN  296

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  297   LAEGRLDGTSFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICVLLQPPLSVAQMSN  356

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RWAVL + +LLK +K  ++  + AM   +S+
Sbjct  357   QARWAVLQSYNLLKWHKHAHQVAVKAMESGSSL  389



>ref|XP_010060860.1| PREDICTED: uncharacterized protein LOC104448685 [Eucalyptus grandis]
 gb|KCW67741.1| hypothetical protein EUGRSUZ_F01475 [Eucalyptus grandis]
Length=389

 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK++K 
Sbjct  222   SSYWPPYRRRILVHEAGHLLTAYLMGCPIRGVILDPIIAMQMGIQGQAGTQFWDEKMDKE  281

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+L +   DR ++V  AG+AAE L Y    G   D    +      +P LS  Q  N
Sbjct  282   LAEGRLSSTAFDRYSMVLFAGIAAEALIYGDAEGGENDENMFRSLCVLLEPPLSVAQMSN  341

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               RWAVL + +LLK +K  + A + A+
Sbjct  342   QARWAVLQSYNLLKWHKQAHRAAVNAL  368



>ref|WP_038331353.1| ATP-dependent Zn protease, partial [filamentous cyanobacterium 
ESFC-1]
Length=222

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 88/163 (54%), Gaps = 23/163 (14%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVN---  791
             +DG S F  +Y++R+  HEA HFLVAY L +PI DY+L+           IG   V+   
Sbjct  60    LDGVSRFSGEYRDRVVRHEAGHFLVAYHLDIPIKDYTLNAWEALKQGQNGIGGAIVDTEA  119

Query  792   LIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINR-SK  968
             L+ EKL      G+L  + IDRL+ V MAG+AAE L Y +  G   D   L   ++   +
Sbjct  120   LLPEKLP----PGELK-QLIDRLSAVWMAGIAAETLSYGEAQGGRDDREKLAATLDYFGR  174

Query  969   PTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             P      +Q   RW  L A +LLK ++  YEAL+ AM  +ASV
Sbjct  175   PESETPLKQ---RWGELQATTLLKEHQDAYEALVNAMETQASV  214



>ref|WP_006518853.1| hypothetical protein [Leptolyngbya sp. PCC 7375]
 gb|EKU97680.1| hypothetical protein Lepto7375DRAFT_6912 [Leptolyngbya sp. PCC 
7375]
Length=230

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 82/160 (51%), Gaps = 17/160 (11%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  S   P+Y +RI  HEA HFL AYLLG+PI  Y+L           G   V    + 
Sbjct  60    VDWLSQRSPEYCDRIVRHEAGHFLTAYLLGIPIAAYTLTAWETLRSGVDGSGGVIFKTDG  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSAD---LFTLQRFINRSKPTL  977
             +++ + +G++  +EIDR   V MAG+AAE + Y    G   D   L  L R INR    +
Sbjct  120   IDRAVENGKISQQEIDRYCTVWMAGIAAEEIVYGIAQGGRDDRLKLNLLWRQINRPLAEV  179

Query  978   SKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
                Q     RW++L A +L++     Y ALI AM+++  V
Sbjct  180   PLKQ-----RWSMLQAKTLIEKESDAYGALIDAMAERRPV  214



>ref|WP_006633839.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK86847.1| hypothetical protein MicvaDRAFT_3632 [Microcoleus vaginatus FGP-2]
Length=225

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 82/147 (56%), Gaps = 13/147 (9%)
 Frame = +3

Query  687   QERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKLIYSGQLD  839
             ++RI +HEA HFLVA+LLG+P+  Y+L+           +  V   DE+L   + SG L 
Sbjct  71    RDRILHHEAGHFLVAHLLGIPVTSYALNAWEAFKQGQTAQGGVRFEDEQLASQLQSGTLS  130

Query  840   AKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINR-SKPTLSKDQQQNLTRWAV  1016
             A+ +D+   V MAG+ AE   Y    G + D   +   + +  +P+     +QN   W +
Sbjct  131   AQLLDQYCTVWMAGIVAEKFVYGSAQGGAEDRTKISAILTQLRRPSSEIQLKQN---WGL  187

Query  1017  LFAGSLLKNNKGLYEALIGAMSKKASV  1097
             L A +L++N+K  YEAL+ AM ++A+V
Sbjct  188   LRAKNLIENHKSAYEALVAAMEERATV  214



>ref|NP_001046019.2| Os02g0169000 [Oryza sativa Japonica Group]
 dbj|BAF07933.2| Os02g0169000, partial [Oryza sativa Japonica Group]
Length=387

 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 74/154 (48%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              S F+P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+EK
Sbjct  219   ISCFWPPYKRRILVHEAGHLLTAYLMGCPIRGVILDPFVALRMGIQGQAGTQFWDEKMEK  278

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G L +   DR  ++  AG+AAE L Y +  G   D    +       P LS  Q  
Sbjct  279   ELAEGHLSSTAFDRYCMILFAGIAAEALVYGEAEGGENDENLFRSLCILLDPPLSVAQMA  338

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW+V+ + +LLK +K  + A + A+    S+
Sbjct  339   NRARWSVMQSYNLLKWHKKAHRAAVKALESGHSL  372



>ref|WP_016951904.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=223

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 87/157 (55%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P+Y+ERI +HEA HFLVA LL +P+  Y+L           G+  + L D +
Sbjct  60    LDWLARFSPEYKERILHHEAGHFLVANLLEIPVTGYTLSAWEAWKQGQPGQGGITLEDGE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   I  GQ+ A+ +DR   + MAG+AAE L ++   G + D   L   +     + +  
Sbjct  120   LTAQIEKGQITAQMLDRYCTIWMAGIAAETLVFNSAEGGNDDKTKLIEVLQVLGFSEAGY  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QQ+   R+ +L + +L++ N   Y+AL+ AM ++A+V
Sbjct  180   QQKQ--RFHLLQSKNLIQENWDSYQALVAAMKRRATV  214



>ref|WP_015115582.1| hypothetical protein [Nostoc sp. PCC 7107]
 ref|YP_007052543.1| hypothetical protein Nos7107_4875 [Nostoc sp. PCC 7107]
 gb|AFY45393.1| hypothetical protein Nos7107_4875 [Nostoc sp. PCC 7107]
Length=228

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 83/157 (53%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F  ++++RI  HEA HFL A LLG+P+  Y+L           G+  V   D +
Sbjct  60    VDWIAGFSSEHRDRIIRHEAGHFLAASLLGIPVTGYTLSAWEAWRKGQPGQGGVAFNDVE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G + A+ +DR   + MAGLAAE L +D+  G   D   L   +     + S  
Sbjct  120   LAAQLEKGTISAQMLDRYCTMWMAGLAAEALVFDRAEGGGDDKAKLAGVLKIVGFSESAF  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QQ+   R+ VL A +LL+ N   YEAL+ AM ++ASV
Sbjct  180   QQKQ--RFHVLQAKTLLEENWSSYEALVQAMQQRASV  214



>dbj|BAD25720.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG95159.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72573.1| hypothetical protein OsI_06014 [Oryza sativa Indica Group]
 gb|EEE56392.1| hypothetical protein OsJ_05542 [Oryza sativa Japonica Group]
Length=374

 Score = 89.0 bits (219),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 74/154 (48%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              S F+P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+EK
Sbjct  206   ISCFWPPYKRRILVHEAGHLLTAYLMGCPIRGVILDPFVALRMGIQGQAGTQFWDEKMEK  265

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G L +   DR  ++  AG+AAE L Y +  G   D    +       P LS  Q  
Sbjct  266   ELAEGHLSSTAFDRYCMILFAGIAAEALVYGEAEGGENDENLFRSLCILLDPPLSVAQMA  325

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW+V+ + +LLK +K  + A + A+    S+
Sbjct  326   NRARWSVMQSYNLLKWHKKAHRAAVKALESGHSL  359



>ref|WP_039200564.1| ATP-dependent Zn protease [Aphanizomenon flos-aquae]
 gb|KHG42407.1| ATP-dependent Zn protease [Aphanizomenon flos-aquae 2012/KM/D3]
Length=237

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 89/160 (56%), Gaps = 17/160 (11%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P+Y+ERI +HEA HFLVA+LL +P+  Y+L           G+  + L D +
Sbjct  60    LDFVARFSPEYKERILHHEAGHFLVAHLLEIPVTGYTLSAWEAWKKGQPGQGGITLEDSE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSAD---LFTLQRFINRSKPTL  977
             L   I +G++ A+ +DR   + MAG+AAE L ++   G + D   L  + R I  S+   
Sbjct  120   LTAQIENGKISAQMLDRYCTIWMAGIAAETLFFNSSEGGNDDKSKLTEVLRVIGFSEAGY  179

Query  978   SKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              + Q     R+ +L + +L++ N   Y+AL+ AM ++ SV
Sbjct  180   QQKQ-----RFHLLQSKTLIQENWESYQALVAAMRERVSV  214



>ref|XP_003570102.1| PREDICTED: uncharacterized protein LOC100846921 [Brachypodium 
distachyon]
Length=386

 Score = 89.0 bits (219),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 74/153 (48%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             S F+P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+EK 
Sbjct  219   SCFWPPYKRRILVHEAGHLLTAYLMGCPIRGVILDPFVALRMGIQGQAGTQFWDEKMEKE  278

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G L +   DR  ++  AG+AAE L Y +  G   D    +       P LS  Q  N
Sbjct  279   LGEGHLSSTAFDRYCMILFAGIAAEALVYGEAEGGENDENLFRSLCILLNPPLSIAQMAN  338

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+V+ + +LLK +K  + A + A+    S+
Sbjct  339   RARWSVMQSYNLLKWHKKAHRAAVKALESGHSL  371



>ref|WP_008179856.1| hypothetical protein [Moorea producens]
 gb|EGJ34600.1| hypothetical protein LYNGBM3L_13750 [Moorea producens 3L]
Length=222

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 88/178 (49%), Gaps = 11/178 (6%)
 Frame = +3

Query  591   GSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD  770
             G +SL+ L   S     L   +D  +S  P+++ RI  HEA HFLVAYLLG+PI  Y+L 
Sbjct  39    GVLSLVTLDGFSFQGKGLTLLLDVLASTNPEHRGRIIRHEAGHFLVAYLLGIPITGYTLS  98

Query  771   ---------IGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQ  923
                      +G   V+   E L    Y+ +     +DR   V MAG+AAE + Y+ V G 
Sbjct  99    AWEALKEGQLGNGGVSFDTEALSAKAYNLREMRLTLDRFCTVWMAGIAAETIVYENVEGG  158

Query  924   SADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             + D   L+  +       S  +     RWA   A S++  +   YEAL+ AM K+ASV
Sbjct  159   AEDCEKLRDALE--GLGFSGSEYSVKARWAERQATSMITEHWESYEALVAAMEKRASV  214



>ref|XP_005706362.1| hypothetical protein isoform 1 [Galdieria sulphuraria]
 gb|EME29842.1| hypothetical protein isoform 1 [Galdieria sulphuraria]
Length=377

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 84/156 (54%), Gaps = 12/156 (8%)
 Frame = +3

Query  606   IVLAVGSISPGL-LQAAI--DGFSSFFPDYQERIANHEAAHFLVAYLLGLPIL-------  755
             I L VG +   + LQ AI  + + + FP Y++++  HEA HFLV+YLLG P+        
Sbjct  193   ISLLVGFLCDQIALQGAIFEELYKNLFPIYKKKVLKHEAGHFLVSYLLGCPVRGIVLSAW  252

Query  756   -DYSLDI-GKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSA  929
                SL I G+      D KLE  + +G L    IDR ++V MAG+AAE L+Y +  G  +
Sbjct  253   ESLSLGIPGQAGTLFFDRKLESELSTGFLTDATIDRYSIVLMAGIAAEALEYGQAEGGQS  312

Query  930   DLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLL  1037
             D   L R +    P  SK++  N  RWAVL  G+ L
Sbjct  313   DEAALLRVLTCLNPPWSKERVFNQARWAVLQKGNRL  348



>ref|XP_010462482.1| PREDICTED: uncharacterized protein LOC104743061 isoform X1 [Camelina 
sativa]
Length=182

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEK  815
              S ++P ++ RI  HEA H LVAYL+G PI    LD          G+      D+K+E 
Sbjct  14    ISCYWPPHKRRIIVHEAGHLLVAYLMGCPIRGVILDPIVAMRMGVQGQAGTQFWDQKMES  73

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  
Sbjct  74    EIAEGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMS  133

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAM  1079
             N  RW+VL + +L+K +K  + A + A+
Sbjct  134   NQARWSVLQSYNLIKWHKAAHRAAVEAL  161



>gb|AFK46324.1| unknown [Medicago truncatula]
 gb|AES66340.2| plant/F14G9-20 protein [Medicago truncatula]
Length=392

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 77/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L+AYL+G PI    LD          G+      DEK+   
Sbjct  225   SSYWPPYRRRILIHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKVASD  284

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  +  N
Sbjct  285   LAEGRLDGSAFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRSVCLLLEPPLSVAEMSN  344

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+VL + +LLK +K  ++A + A+    S+
Sbjct  345   QARWSVLQSYNLLKWHKAAHQAAVKALESGGSL  377



>ref|XP_004951774.1| PREDICTED: uncharacterized protein LOC101758555 [Setaria italica]
Length=396

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SSF+P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+EK 
Sbjct  229   SSFWPPYKRRILVHEAGHLLTAYLMGCPIRGVILDPFVALRMGIQGQAGTQFWDEKMEKE  288

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G L +   DR +++  AG+AAE L Y +  G   D    +       P  S  Q  N
Sbjct  289   LADGHLSSTAFDRYSMILFAGIAAEALVYGEAEGGENDENLFRSLCLLLNPPPSVAQMAN  348

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+V+ + +LLK +K  + A++ A+    S+
Sbjct  349   RARWSVMQSYNLLKWHKKAHRAVVKALEDGHSL  381



>emb|CDP13573.1| unnamed protein product [Coffea canephora]
Length=400

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 75/154 (49%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              SS++P Y+ RI  HEA H LVAYL+G PI    LD          G+      DE+L+ 
Sbjct  231   ISSYWPPYKRRILVHEAGHLLVAYLMGCPIRGVILDPIVAMQSGIQGQAGTQFWDERLQN  290

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G+L     DR  +V  AG+AAE L Y +  G   D    +       P LS  Q  
Sbjct  291   ELAEGRLSGSSFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICVLLDPPLSVAQMS  350

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW+VL + +LL+ +K  + A I A+    S+
Sbjct  351   NQARWSVLQSYNLLRWHKHAHRAAIRALETGCSL  384



>ref|XP_003596089.1| hypothetical protein MTR_2g066060 [Medicago truncatula]
Length=390

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 77/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L+AYL+G PI    LD          G+      DEK+   
Sbjct  223   SSYWPPYRRRILIHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKVASD  282

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  +  N
Sbjct  283   LAEGRLDGSAFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRSVCLLLEPPLSVAEMSN  342

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+VL + +LLK +K  ++A + A+    S+
Sbjct  343   QARWSVLQSYNLLKWHKAAHQAAVKALESGGSL  375



>ref|WP_026795707.1| MULTISPECIES: hypothetical protein [Planktothrix]
Length=226

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 95/187 (51%), Gaps = 16/187 (9%)
 Frame = +3

Query  579   PYLIGSISLIVLAVGSISPGLLQAA-----IDGFSSFFPDYQERIANHEAAHFLVAYLLG  743
             P++   I+  +L V ++     Q       IDG +      +ERI +HEA HFLVA+L+ 
Sbjct  30    PFIPAGITFFLLGVATLDVFQFQGQGASLLIDGLAGTSASTRERILHHEAGHFLVAHLME  89

Query  744   LPILDYSLD---------IGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEG  896
             +PI  Y+L+           +  V   D+ L + +  GQ+ A+ +DR   V MAG+AAE 
Sbjct  90    IPIQGYALNGWEAFKQGFKAQGGVQFADQLLWEQLQQGQISAQVLDRYCAVWMAGIAAET  149

Query  897   LKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGA  1076
             L + K  G   D   +     + +  LS+ + +   RWA+L A +L++ +K  Y  L+ A
Sbjct  150   LIFKKAEGGREDRNKIIAIWTQLQRPLSEAKIKE--RWAILQAKTLIETHKVAYLGLVEA  207

Query  1077  MSKKASV  1097
             M  +ASV
Sbjct  208   MRNRASV  214



>ref|XP_011095720.1| PREDICTED: uncharacterized protein LOC105175093 [Sesamum indicum]
Length=391

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H LVAYL+G PI    LD          G+      DEKL+  
Sbjct  224   SSYWPPYKRRILVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKLQSE  283

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G++     DR  +V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  284   LAEGRVSGTAFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICVLLEPPLSTVQMSN  343

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+VL + +LLK +K  + A + A+    S+
Sbjct  344   QARWSVLQSYNLLKWHKHAHRAAVKALEGGGSL  376



>ref|WP_015175065.1| hypothetical protein [Oscillatoria nigro-viridis]
 ref|YP_007114157.1| hypothetical protein Osc7112_1194 [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ05741.1| hypothetical protein Osc7112_1194 [Oscillatoria nigro-viridis 
PCC 7112]
Length=235

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 84/158 (53%), Gaps = 13/158 (8%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEK  806
             +D       + ++RI +HEA HFLVAYLLG+P+  Y+L+           +  V   DE+
Sbjct  60    LDWLGGTSKEKRDRILHHEAGHFLVAYLLGIPVTSYALNAWEAFKQGQTAQGGVRFEDEQ  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINR-SKPTLSK  983
             L   + +G L A+ +D+   V MAG+ AE   Y    G + D   +   + +  +P+   
Sbjct  120   LASQLQNGTLSAQLLDQYCTVWMAGIVAEKFVYGSAEGGAEDRTKISAILTQLRRPSSEI  179

Query  984   DQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               +QN   W +L A +LL+++K  YEAL+ AM  +A+V
Sbjct  180   QLKQN---WGLLRAKNLLESHKSAYEALVAAMENRATV  214



>ref|WP_017718959.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=231

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 86/158 (54%), Gaps = 14/158 (9%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D      P+ +ER+  HEA HFLVA+LLG+ +  Y+L+           +  V   DE+
Sbjct  59    MDWLEGASPERRERVLRHEAGHFLVAHLLGISVTGYALNAWEAFRQGQSAQGGVRFEDEE  118

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   + SG L ++ ++R   V MAG+AAE   Y +  G + D   L+  + +    L + 
Sbjct  119   LAGQLQSGVLSSQMLERYCTVWMAGIAAENFVYGRAGGGTEDRQKLRAVLAQ----LRRP  174

Query  987   QQQNLT-RWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             +Q  L  RWA L A +L+++++  YEAL+ AM+++  V
Sbjct  175   EQAPLKERWACLQARTLIESHQPAYEALVAAMAQRLPV  212



>ref|XP_010260608.1| PREDICTED: uncharacterized protein LOC104599679 [Nelumbo nucifera]
Length=399

 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/212 (33%), Positives = 93/212 (44%), Gaps = 33/212 (16%)
 Frame = +3

Query  555   PGDWG------FFVPYLIGSISLIVLAVGSISPGLLQAAIDGF----------------S  668
             P  WG      F +   +G IS ++     I P L  AAI G                 S
Sbjct  175   PKKWGLSGSSSFVLVVFLGGISYLLSQGIDIRPNL--AAILGLAMLDSIFLGGCCLAQIS  232

Query  669   SFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKLI  821
             S++P Y+ RI  HEA H L AYLLG PI    LD          G+      DEKLE  +
Sbjct  233   SYWPPYRRRILVHEAGHLLTAYLLGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKLENEL  292

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
               G+L     DR  +V  AG+AAE L Y +  G   D    +      +P LS  +  N 
Sbjct  293   AEGRLSTAAFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLQPPLSIAEMSNQ  352

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              RW+VL + +LLK +K  + A + A+    S+
Sbjct  353   ARWSVLQSYNLLKWHKHAHRAAVKALESGGSL  384



>ref|WP_027248908.1| hypothetical protein [Planktothrix agardhii]
Length=226

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 95/187 (51%), Gaps = 16/187 (9%)
 Frame = +3

Query  579   PYLIGSISLIVLAVGSISPGLLQAA-----IDGFSSFFPDYQERIANHEAAHFLVAYLLG  743
             P++   I+  +L V ++     Q       IDG +      +ERI +HEA HFLVA+L+ 
Sbjct  30    PFIPAGITFFLLGVATLDVFQFQGQGASLLIDGLAGTSASTRERILHHEAGHFLVAHLME  89

Query  744   LPILDYSLD---------IGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEG  896
             +PI  Y+L+           +  V   D+ L + +  GQ+ A+ +DR   V MAG+AAE 
Sbjct  90    IPIQGYALNGWEAFKQGFKAQGGVQFADQLLWEQLQQGQISAQVLDRYCAVWMAGIAAET  149

Query  897   LKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGA  1076
             L + K  G   D   +     + +  LS+ + +   RWA+L A +L++ +K  Y  L+ A
Sbjct  150   LIFKKAEGGREDRDKIIAIWTQLQRPLSEAKIKE--RWAILQAKTLIETHKVAYLGLVEA  207

Query  1077  MSKKASV  1097
             M  +ASV
Sbjct  208   MRNRASV  214



>ref|XP_004488764.1| PREDICTED: uncharacterized protein LOC101507232 isoform X1 [Cicer 
arietinum]
 ref|XP_004488765.1| PREDICTED: uncharacterized protein LOC101507232 isoform X2 [Cicer 
arietinum]
Length=394

 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L+AYL+G PI    LD          G+      DEK+   
Sbjct  227   SSYWPPYKRRILIHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKVASD  286

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  +  N
Sbjct  287   LAEGRLDGSAFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRSICLLLEPPLSVAEMSN  346

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+V+ + +LLK +K  + A + A+    S+
Sbjct  347   QARWSVMQSYNLLKWHKAAHRAAVKALESGGSL  379



>ref|XP_002453366.1| hypothetical protein SORBIDRAFT_04g004670 [Sorghum bicolor]
 gb|EES06342.1| hypothetical protein SORBIDRAFT_04g004670 [Sorghum bicolor]
Length=408

 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 73/153 (48%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             S F+P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+EK 
Sbjct  237   SCFWPPYKRRILVHEAGHLLTAYLMGCPIRGVILDPFVALRMGIQGQAGTQFWDEKMEKE  296

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G L +   DR  ++  AG AAE L Y +  G   D    +       P LS  Q  N
Sbjct  297   LAEGHLSSTAFDRYCMILFAGTAAEALVYGEAEGGENDENLFRSLCILLNPPLSVAQMAN  356

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+V+ + +LLK +K  + A + A+    S+
Sbjct  357   RARWSVMQSYNLLKWHKKAHRAAVKALEDGHSL  389



>gb|EYU27567.1| hypothetical protein MIMGU_mgv1a008097mg [Erythranthe guttata]
Length=385

 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 75/153 (49%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H LVAYL+G PI    LD          G+      DEKL+  
Sbjct  220   SSYWPPYKRRILVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKLQNE  279

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G++     DR  +V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  280   LAEGRVSGTAFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMSN  339

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+VL + +LLK  K  + A + A+    S+
Sbjct  340   QARWSVLQSYNLLKWQKHAHRAAVKALENGGSL  372



>ref|WP_027404622.1| hypothetical protein [Aphanizomenon flos-aquae]
Length=237

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 88/157 (56%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P+Y+ERI +HEA HFLVA+LL +P+  Y+L           G+  + L D +
Sbjct  60    LDLVARFSPEYKERILHHEAGHFLVAHLLEIPVTGYTLSAWEAWKKGQPGQGGITLEDSE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   I +G++ A+ +DR   + MAG+AAE L ++   G + D   L   +     + +  
Sbjct  120   LTAQIENGKISAQMLDRYCTIWMAGIAAETLVFNSSEGGNDDKSKLTEILQVIGFSEAGY  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QQ+   R+ +L + +L++ N   Y+AL+ AM ++ SV
Sbjct  180   QQKQ--RFHLLQSKTLIQENWESYQALVVAMRERVSV  214



>ref|XP_008798243.1| PREDICTED: uncharacterized protein LOC103713192 [Phoenix dactylifera]
Length=402

 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 75/152 (49%), Gaps = 9/152 (6%)
 Frame = +3

Query  669   SFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKLI  821
              F+P Y+ R+  HEA H LVAYL+G PI    LD          G+      DEKLE  +
Sbjct  236   CFWPPYKRRVLVHEAGHLLVAYLMGCPIRGVILDPFVALQMGIQGQAGTQFWDEKLENEL  295

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
               G+L +   DR  +V  AG+AAE L Y +  G   D    +      +P L+  Q  N 
Sbjct  296   TEGRLSSTAFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSVCVLLQPPLNIAQMSNR  355

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              RW+V+ + +LLK +K  + A + A+    S+
Sbjct  356   ARWSVMQSYNLLKWHKHAHRAAVKALENGHSL  387



>gb|EEE69777.1| hypothetical protein OsJ_29493 [Oryza sativa Japonica Group]
Length=94

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  348  LDQLSEVGWAKVWSSQPYVSRRTTSVRELTTLGIRNAENLGIPSIRNDA  494
            +DQL E+GWAK WSSQPYVS RTTS++ELT LGI++ ENL IPS+RNDA
Sbjct  1    MDQLKELGWAKRWSSQPYVSCRTTSLQELTRLGIKHVENLVIPSVRNDA  49



>emb|CDY10505.1| BnaC03g71090D [Brassica napus]
Length=382

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              S F+P ++ R+  HEA H LVAYL+G PI    LD          G+      D+K+E 
Sbjct  214   ISCFWPPHKRRVIVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGVQGQAGTQFWDQKMES  273

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  
Sbjct  274   EIAEGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMS  333

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAM  1079
             N  RW+VL + +LLK +K  + A + A+
Sbjct  334   NQARWSVLQSYNLLKWHKAAHRAAVEAL  361



>gb|ACF87710.1| unknown [Zea mays]
Length=277

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 73/153 (48%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             S F+P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+EK 
Sbjct  109   SCFWPPYKRRILVHEAGHLLTAYLMGCPIRGVILDPFVALRMGIQGQAGTQFWDEKMEKE  168

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G L +   DR  ++  AG+AAE L Y +  G   D    +       P  +  Q  N
Sbjct  169   LAEGHLSSTAFDRYCMIMFAGIAAEALVYGEAEGGENDENLFRSLCILLNPPPAVAQMAN  228

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+V+ + +LLK +K  + A + A+    S+
Sbjct  229   RARWSVMQSYNLLKWHKKAHRAAVKALEDGHSL  261



>gb|AAK32818.1|AF361805_1 At1g56180/F14G9_20 [Arabidopsis thaliana]
Length=389

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKL  818
             S ++P ++ RI  HEA H LVAYL+G PI    LD          G+      D+K+E  
Sbjct  222   SCYWPPHKRRIVVHEAGHLLVAYLMGCPIRGVILDPVVAMQMGVQGQAGTQFWDQKMESE  281

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  282   IAEGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMSN  341

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               RW+VL + +LLK +K  + A + A+
Sbjct  342   QARWSVLQSYNLLKWHKAAHRAAVEAL  368



>ref|XP_001762437.1| predicted protein [Physcomitrella patens]
 gb|EDQ72904.1| predicted protein [Physcomitrella patens]
Length=288

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 95/202 (47%), Gaps = 15/202 (7%)
 Frame = +3

Query  525   GFLGVLAGQLPGDWGFFVPYLIGSISLIVLAVGSISPGLLQAAIDGFS------SFFPDY  686
             G  G  A QL   +  F   +  +I +  LAV  +   LL +   G +      S +P Y
Sbjct  67    GLTGASAFQLAAGFALFSFLVNNNIDIRPLAVIIVGLSLLDSIYLGGAAQAQVLSLWPGY  126

Query  687   QERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKLIYSGQLD  839
             + R+  HEA H LVAYLLG P+    LD          G+      DE L +     +L 
Sbjct  127   KRRMLVHEAGHVLVAYLLGCPVRGVVLDAQEAFKSGISGQAGTQFWDESLARESEQNRLT  186

Query  840   AKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVL  1019
                +DR  +V  AG+AAEGL Y +  G  +D    +  I+  +P     +  N  RW+VL
Sbjct  187   EASLDRYCIVLFAGIAAEGLVYGEAEGGESDENLYKGIISGLRPPWGPGRMSNHARWSVL  246

Query  1020  FAGSLLKNNKGLYEALIGAMSK  1085
              A ++LK ++ ++EA++  + +
Sbjct  247   QAFNMLKEHRKVHEAVVQELER  268



>ref|NP_564711.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG50923.1|AC069159_24 hypothetical protein [Arabidopsis thaliana]
 gb|AAN46768.1| At1g56180/F14G9_20 [Arabidopsis thaliana]
 gb|AEE33355.1| uncharacterized protein AT1G56180 [Arabidopsis thaliana]
Length=389

 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKL  818
             S ++P ++ RI  HEA H LVAYL+G PI    LD          G+      D+K+E  
Sbjct  222   SCYWPPHKRRIVVHEAGHLLVAYLMGCPIRGVILDPVVAMQMGVQGQAGTQFWDQKMESE  281

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  282   IAEGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMSN  341

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               RW+VL + +LLK +K  + A + A+
Sbjct  342   QARWSVLQSYNLLKWHKAAHRAAVEAL  368



>ref|WP_015145177.1| hypothetical protein [Pleurocapsa minor]
 ref|YP_007082435.1| hypothetical protein Ple7327_3688 [Pleurocapsa sp. PCC 7327]
 gb|AFY78878.1| hypothetical protein Ple7327_3688 [Pleurocapsa sp. PCC 7327]
Length=224

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 86/160 (54%), Gaps = 20/160 (13%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIYSGQ  833
             +D FSS  P  ++R+ +HEA HFLVAY LG+P++ Y+L    E        L  +++   
Sbjct  60    LDLFSS--PQQRQRVVHHEAGHFLVAYFLGIPVVGYTLS-AWEAFKEGQPGLGGVVFDTN  116

Query  834   L-----DAKE----IDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQ---RFINRSKPTL  977
             L     D +E    ++R   V MAG+AAE + Y  V G  +D   L+   RF+   +   
Sbjct  117   LLEKSADLREAPIILERFCTVWMAGIAAETIVYGNVEGGESDRENLREVLRFVGLPESVY  176

Query  978   SKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              + +     RWA L A SLL+ ++  YEAL+ AM K+ASV
Sbjct  177   PQKE-----RWAYLQAKSLLEKHQKSYEALVQAMEKRASV  211



>ref|XP_005831184.1| hypothetical protein GUITHDRAFT_87555, partial [Guillardia theta 
CCMP2712]
 gb|EKX44204.1| hypothetical protein GUITHDRAFT_87555, partial [Guillardia theta 
CCMP2712]
Length=361

 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 77/155 (50%), Gaps = 9/155 (6%)
 Frame = +3

Query  660   GFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLE  812
              +   FP Y+E++  HEA HFL+AYLLG PI  + L           G+      D  L 
Sbjct  62    AYRFLFPKYKEKVIKHEAGHFLLAYLLGCPIQGFFLSAWDATRAGIRGQAGTVFFDNDLS  121

Query  813   KLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQ  992
               + + ++    IDR  +V M G+AAE + Y++  G ++D   L  F+    P     Q 
Sbjct  122   TQLNANRVTRTAIDRYTIVLMGGIAAEAMNYEQAEGGASDESALVSFLVGLLPPWQPQQV  181

Query  993   QNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              N  RWAV  A  LL+ ++  Y++L  AM++  S+
Sbjct  182   LNQARWAVTEAILLLREHRAAYDSLCDAMARGESL  216



>gb|AAF02831.1|AC009894_2 Hypothetical protein [Arabidopsis thaliana]
Length=368

 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKL  818
             S ++P ++ RI  HEA H LVAYL+G PI    LD          G+      D+K+E  
Sbjct  201   SCYWPPHKRRIVVHEAGHLLVAYLMGCPIRGVILDPVVAMQMGVQGQAGTQFWDQKMESE  260

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  261   IAEGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMSN  320

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               RW+VL + +LLK +K  + A + A+
Sbjct  321   QARWSVLQSYNLLKWHKAAHRAAVEAL  347



>ref|XP_009106798.1| PREDICTED: uncharacterized protein LOC103832531 isoform X2 [Brassica 
rapa]
 emb|CDY42409.1| BnaA08g00050D [Brassica napus]
Length=378

 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              S F+P ++ R+  HEA H LVAYL+G PI    LD          G+      D+K+E 
Sbjct  210   ISCFWPPHKRRVIVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGVQGQAGTQFWDQKMES  269

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  
Sbjct  270   EIAEGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMS  329

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAM  1079
             N  RW+VL + +LLK +K  + A + A+
Sbjct  330   NQARWSVLQSYNLLKWHKAAHRAAVEAL  357



>ref|XP_010557268.1| PREDICTED: uncharacterized protein LOC104826324 [Tarenaya hassleriana]
Length=383

 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 76/149 (51%), Gaps = 9/149 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKL  818
             SS++P ++ RI  HEA H LVAYLLG PI    LD          G+      D+K+E  
Sbjct  216   SSYWPPHKRRIIVHEAGHLLVAYLLGCPIRGVILDPFVAMQMGIQGQAGTQFWDQKMESE  275

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  276   IAVGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLQPPLSVAQMSN  335

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSK  1085
               RW+VL + +LLK +K  + A + A+ +
Sbjct  336   QARWSVLQSYNLLKWHKKAHRAAVEALQE  364



>ref|XP_003546818.1| PREDICTED: uncharacterized protein LOC100800880 [Glycine max]
Length=386

 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 74/153 (48%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+   
Sbjct  219   SSYWPPYRRRILVHEAGHLLTAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKVAND  278

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+LD    DR  +V  AG+AAE L Y +  G   D    +       P LS  +  N
Sbjct  279   LAEGRLDGTAFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRGICLLLDPPLSTAEMSN  338

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RWAVL + +LLK ++  + A + A+    S+
Sbjct  339   QARWAVLQSYNLLKWHRAAHRAAVKALESGDSL  371



>ref|WP_026099936.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=226

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 86/157 (55%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F  ++++RI +HEA HFL AYLL +PI  Y+L           G+  V   D++
Sbjct  60    LDWIAGFSGEHRDRIVHHEAGHFLTAYLLDIPISGYTLSAWEAWKQGQPGQGGVAFNDDQ  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   + +G++ A+ +DR   V MAG+AAE L ++   G + D   L   +     + S  
Sbjct  120   LASQLEAGKISAQILDRYCTVWMAGIAAETLVFNNTEGGADDQNKLVGVLANLGFSPSAC  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QQ+   R+  L A +LL+ N   Y+AL+ AM ++ASV
Sbjct  180   QQKQ--RFHALQAKTLLQENWSSYQALVKAMRERASV  214



>ref|XP_002894564.1| hypothetical protein ARALYDRAFT_474687 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70823.1| hypothetical protein ARALYDRAFT_474687 [Arabidopsis lyrata subsp. 
lyrata]
Length=385

 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKL  818
             S ++P ++ RI  HEA H LVAYL+G PI    LD          G+      D+K+E  
Sbjct  222   SCYWPPHKRRIVVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGVQGQAGTQFWDQKMESE  281

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  282   IAEGRLSGSSFDRYSMVLFAGIAAEALIYGEAEGGENDENLFRSISVLLEPPLSVAQMSN  341

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               RW+VL + +LLK +K  + A + A+
Sbjct  342   QARWSVLQSYNLLKWHKAAHRAAVEAL  368



>ref|NP_001130100.1| uncharacterized protein LOC100191193 [Zea mays]
 gb|ACF78227.1| unknown [Zea mays]
 gb|ACF84930.1| unknown [Zea mays]
 gb|AFW70279.1| hypothetical protein ZEAMMB73_631346 [Zea mays]
Length=388

 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 73/153 (48%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             S F+P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+EK 
Sbjct  220   SCFWPPYKRRILVHEAGHLLTAYLMGCPIRGVILDPFVALRMGIQGQAGTQFWDEKMEKE  279

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G L +   DR  ++  AG+AAE L Y +  G   D    +       P  +  Q  N
Sbjct  280   LAEGHLSSTAFDRYCMIMFAGIAAEALVYGEAEGGENDENLFRSLCILLNPPPAVAQMAN  339

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+V+ + +LLK +K  + A + A+    S+
Sbjct  340   RARWSVMQSYNLLKWHKKAHRAAVKALEDGHSL  372



>gb|KHG21681.1| ATP-dependent zinc metalloprotease FtsH 3 [Gossypium arboreum]
Length=400

 Score = 86.3 bits (212),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 72/153 (47%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ R+  HEA H LVAYL+G PI    LD          G+      DE +   
Sbjct  233   SSYWPPYRRRVLVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDENMNNE  292

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  GQL     DR  +V  AG AAE L Y    G   D    +      +P LS  Q  N
Sbjct  293   MAEGQLSGSTFDRYCMVLFAGTAAEALVYGDAEGGENDENLFRSISVLLQPPLSVAQMSN  352

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+VL + +LLK ++  + A   AM   AS+
Sbjct  353   QARWSVLQSYNLLKWHRHAHRAAFKAMENGASL  385



>gb|ACG47252.1| hypothetical protein [Zea mays]
Length=388

 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 73/154 (47%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              S F+P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+EK
Sbjct  219   ISCFWPPYKRRILVHEAGHLLTAYLMGCPIRGVILDPFVALRMGIQGQAGTQFWDEKMEK  278

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G L +   DR  ++  AG+AAE L Y +  G   D    +       P  +  Q  
Sbjct  279   ELAEGHLSSTAFDRYCMIMFAGIAAEALVYGEAEGGENDENLFRSLCILLNPPPAVAQMA  338

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW+V+ + +LLK +K  + A + A+    S+
Sbjct  339   NRARWSVMQSYNLLKWHKKAHRAAVKALEDGHSL  372



>ref|XP_011013836.1| PREDICTED: uncharacterized protein LOC105117773 [Populus euphratica]
Length=386

 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 77/159 (48%), Gaps = 9/159 (6%)
 Frame = +3

Query  648   AAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLID  800
             A +   SS++P  + RI  HEA H LVAYL+G P+    LD          G+      D
Sbjct  214   ACLAQISSYWPPNKRRILVHEAGHLLVAYLMGCPVRGVILDPIVAMQMGTQGQAGTQFWD  273

Query  801   EKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLS  980
             EKL K +  G+L     DR  +V  AG+AAE L Y +  G   D    +      +P LS
Sbjct  274   EKLSKELAEGKLSGTSFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSTCVLLQPPLS  333

Query  981   KDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               Q  N  RW+VL + +LLK ++  + A + A+    S+
Sbjct  334   VAQMSNQARWSVLQSFNLLKWHRDAHRAAVKALESGGSL  372



>gb|KDO61590.1| hypothetical protein CISIN_1g016454mg [Citrus sinensis]
 gb|KDO61591.1| hypothetical protein CISIN_1g016454mg [Citrus sinensis]
 gb|KDO61592.1| hypothetical protein CISIN_1g016454mg [Citrus sinensis]
Length=389

 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L+AYL+G PI    LD          G+      DEK+   
Sbjct  222   SSYWPPYKRRILVHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNE  281

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  282   LAEGRLSGTAFDRYSMVLFAGIAAEALIYGEAEGGENDENLFRSICVLLQPPLSMAQMSN  341

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RWAVL + +LLK +K  +   + A+   +S+
Sbjct  342   QARWAVLQSYNLLKWHKHAHLEAVKALESGSSL  374



>ref|XP_006393500.1| hypothetical protein EUTSA_v10011505mg [Eutrema salsugineum]
 gb|ESQ30786.1| hypothetical protein EUTSA_v10011505mg [Eutrema salsugineum]
Length=427

 Score = 86.3 bits (212),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              S ++P ++ RI  HEA H LVAYL+G PI    LD          G+      D+K+E 
Sbjct  259   ISCYWPPHKRRIIVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGVQGQAGTQFWDQKMEN  318

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  
Sbjct  319   EIAEGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMS  378

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAM  1079
             N  RW+VL + +LLK +K  + A + A+
Sbjct  379   NQARWSVLQSYNLLKWHKAAHRAAVEAL  406



>ref|XP_006422252.1| hypothetical protein CICLE_v10005140mg [Citrus clementina]
 ref|XP_006422254.1| hypothetical protein CICLE_v10005140mg [Citrus clementina]
 ref|XP_006493781.1| PREDICTED: uncharacterized protein LOC102609738 isoform X1 [Citrus 
sinensis]
 ref|XP_006493782.1| PREDICTED: uncharacterized protein LOC102609738 isoform X2 [Citrus 
sinensis]
 ref|XP_006493783.1| PREDICTED: uncharacterized protein LOC102609738 isoform X3 [Citrus 
sinensis]
 ref|XP_006493784.1| PREDICTED: uncharacterized protein LOC102609738 isoform X4 [Citrus 
sinensis]
 ref|XP_006493785.1| PREDICTED: uncharacterized protein LOC102609738 isoform X5 [Citrus 
sinensis]
 ref|XP_006493786.1| PREDICTED: uncharacterized protein LOC102609738 isoform X6 [Citrus 
sinensis]
 ref|XP_006493787.1| PREDICTED: uncharacterized protein LOC102609738 isoform X7 [Citrus 
sinensis]
 gb|ESR35492.1| hypothetical protein CICLE_v10005140mg [Citrus clementina]
 gb|ESR35494.1| hypothetical protein CICLE_v10005140mg [Citrus clementina]
Length=389

 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P Y+ RI  HEA H L+AYL+G PI    LD          G+      DEK+   
Sbjct  222   SSYWPPYKRRILVHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNE  281

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  282   LAEGRLSGTAFDRYSMVLFAGIAAEALIYGEAEGGENDENLFRSICVLLQPPLSMAQMSN  341

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RWAVL + +LLK +K  +   + A+   +S+
Sbjct  342   QARWAVLQSYNLLKWHKHAHLEAVKALESGSSL  374



>ref|XP_006393498.1| hypothetical protein EUTSA_v10011505mg [Eutrema salsugineum]
 gb|ESQ30784.1| hypothetical protein EUTSA_v10011505mg [Eutrema salsugineum]
Length=417

 Score = 85.9 bits (211),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 74/148 (50%), Gaps = 9/148 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEK  815
              S ++P ++ RI  HEA H LVAYL+G PI    LD          G+      D+K+E 
Sbjct  249   ISCYWPPHKRRIIVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGVQGQAGTQFWDQKMEN  308

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  
Sbjct  309   EIAEGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMS  368

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAM  1079
             N  RW+VL + +LLK +K  + A + A+
Sbjct  369   NQARWSVLQSYNLLKWHKAAHRAAVEAL  396



>ref|WP_012268290.1| hypothetical protein [Microcystis aeruginosa]
 ref|YP_001661179.1| hypothetical protein MAE_61650 [Microcystis aeruginosa NIES-843]
 dbj|BAG05987.1| hypothetical protein MAE_61650 [Microcystis aeruginosa NIES-843]
Length=224

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 83/149 (56%), Gaps = 15/149 (10%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVNLIDEKLEKLIYSG  830
             +++R+  HEA HFL AY+LG+PI  YSL            +G    +L D  LE+ + + 
Sbjct  68    HRQRVIYHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFDLAD--LEQKVKNF  125

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
                   ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +   +S++      RW
Sbjct  126   TDFPAFLERISTVWMAGIAAETLVYGKAAGGESDRFYLQSALKLAG--VSENNYAQKERW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++L A +LL+  +  Y+AL+ AM K+ASV
Sbjct  184   SLLQAKTLLEKQQTAYQALVIAMEKRASV  212



>ref|WP_002759281.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH96950.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
Length=224

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 83/149 (56%), Gaps = 15/149 (10%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVNLIDEKLEKLIYSG  830
             +++R+ +HEA HFL AY+LG+PI  YSL            +G     L D  LE+ + + 
Sbjct  68    HRQRVIHHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFELAD--LEQKVKNF  125

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
                   ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +   +S++      RW
Sbjct  126   TDFPAFLERISTVWMAGIAAETLVYGKAEGGESDRFYLQSALKLAG--VSENNYAQKERW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++L A +LL+  +  Y+AL+ AM K+ASV
Sbjct  184   SLLQAKTLLEKQQTAYQALVIAMEKRASV  212



>dbj|GAL92028.1| hypothetical protein N44_00316 [Microcystis aeruginosa NIES-44]
Length=224

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 83/149 (56%), Gaps = 15/149 (10%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVNLIDEKLEKLIYSG  830
             +++R+ +HEA HFL AY+LG+PI  YSL            +G    +L D  LE+ + + 
Sbjct  68    HRQRVIHHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFDLAD--LEQKVKNF  125

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
                   ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +    +   Q+   RW
Sbjct  126   TDFPAFLERISTVWMAGIAAETLVYGKAAGGESDRFYLQSALKLAGVPENNYAQKE--RW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++L A +LL+  +  Y+AL+ AM K+ASV
Sbjct  184   SLLQAKTLLEKQQTAYQALVIAMEKRASV  212



>ref|XP_002513354.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48757.1| conserved hypothetical protein [Ricinus communis]
Length=410

 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKL  818
             SS++P ++ RI  HEA H LVAYL+G PI    LD          G+      DEKL   
Sbjct  226   SSYWPPFKRRILVHEAGHLLVAYLMGCPIRGVILDPIVMMQMGIQGQAGTQFWDEKLSNE  285

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+L     DR  +V  AG+AAE L Y +  G   D    +      +P LS +Q  N
Sbjct  286   LADGRLSGTTFDRYCMVLFAGIAAETLVYGEAEGGENDENLFRSISVLLQPPLSVNQMSN  345

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+VL + +LLK  +  + A + A+   +S+
Sbjct  346   QARWSVLQSYNLLKWQRHAHRAAVKALESGSSL  378



>ref|XP_008372153.1| PREDICTED: uncharacterized protein LOC103435538, partial [Malus 
domestica]
Length=329

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 76/154 (49%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              SS++P  + RI  HEA H L+AYL+G PI    LD          G+      DEK+  
Sbjct  153   LSSYWPPNRRRILIHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMAN  212

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  +  
Sbjct  213   DLAEGRLDGTAFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRGICVLLEPPLSVPEMS  272

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW++L A ++LK +K  + A + A+  ++ +
Sbjct  273   NQARWSLLQAYNMLKWHKNAHRAAVKALESRSGL  306



>ref|WP_015120691.1| hypothetical protein [Rivularia sp. PCC 7116]
 ref|YP_007057679.1| hypothetical protein Riv7116_4718 [Rivularia sp. PCC 7116]
 gb|AFY57132.1| hypothetical protein Riv7116_4718 [Rivularia sp. PCC 7116]
Length=230

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 84/157 (54%), Gaps = 14/157 (9%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             I GFSS   +Y+ERI +HEA HFLVA++LG+P+  Y+L           G   V   D +
Sbjct  63    ISGFSS---EYRERILHHEAGHFLVAHVLGVPVTGYTLSAWEAFKQKQKGLAGVTFGDVE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L      G +  + ++R   + MAG+AAE L YD   G + D   L+  +     + S  
Sbjct  120   LLSQFEKGAITTRILERYYTIWMAGIAAEKLVYDDASGGADDQNKLKGVLKSLGCSDSFC  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              Q+   R+++L A +LL+NN   Y+ L+  M K+A+V
Sbjct  180   NQKQ--RFSILQAKTLLENNWSAYQTLVDTMRKRATV  214



>dbj|BAJ87062.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=384

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 71/147 (48%), Gaps = 9/147 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             S F+P Y+ R+  HEA H L AYL+G PI    LD          G+      D K+EK 
Sbjct  217   SCFWPPYKRRVLVHEAGHLLTAYLMGCPIRGVILDPFVALRMGIQGQAGTQFWDAKMEKE  276

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G L +   DR  ++  AG+AAE L Y +  G   D    +       P LS  Q  N
Sbjct  277   LGEGHLSSTAFDRYCMILFAGIAAEALVYGEAEGGENDENLFRSLCVLLDPPLSVAQMAN  336

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               RW+V+ + +LLK +K  + A + A+
Sbjct  337   RARWSVMQSYNLLKWHKKAHRAAVKAL  363



>ref|WP_015127389.1| hypothetical protein [Calothrix sp. PCC 7507]
 ref|YP_007064401.1| hypothetical protein Cal7507_1091 [Calothrix sp. PCC 7507]
 gb|AFY31567.1| hypothetical protein Cal7507_1091 [Calothrix sp. PCC 7507]
Length=226

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 83/157 (53%), Gaps = 11/157 (7%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F  ++++RI +HEA HFL+AYL  +PI  Y+L           G+  V   D++
Sbjct  60    LDWIAGFSQEHRDRIIHHEAGHFLIAYLFEIPISGYTLSAWEAWKQGQPGQGGVTFNDDQ  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             L   +  G++ A+ +DR   + MAG+AAE L ++   G + D   L   +       S  
Sbjct  120   LASQLQVGKISAQMLDRYCTIWMAGIAAETLVFNNTEGGADDQNKLAGVLTNLGFAASVR  179

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             QQ+   R+  L A +LL+ N   YEAL+ AM + ASV
Sbjct  180   QQKQ--RFYALQAKTLLQENWPSYEALVKAMRQGASV  214



>ref|XP_007148977.1| hypothetical protein PHAVU_005G030300g [Phaseolus vulgaris]
 gb|ESW20971.1| hypothetical protein PHAVU_005G030300g [Phaseolus vulgaris]
Length=388

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 74/153 (48%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P ++ RI  HEA H L AYL+G PI    LD          G+      DEK+   
Sbjct  221   SSYWPPFRRRILVHEAGHLLTAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKVANN  280

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+LD    DR  +V  AG+AAE L Y +  G   D    +       P LS  +  N
Sbjct  281   LAEGRLDGTTFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRGICLLLDPPLSTAEMSN  340

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW+VL + +LLK ++  + A I A+    S+
Sbjct  341   QARWSVLQSYNLLKWHRAAHRAAIKALESGGSM  373



>gb|ACG45567.1| hypothetical protein [Zea mays]
Length=363

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 69/144 (48%), Gaps = 9/144 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             S F+P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+EK 
Sbjct  220   SCFWPPYKRRILVHEAGHLLTAYLMGCPIRGVILDPFVALRMGIQGQAGTQFWDEKMEKE  279

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G L +   DR  ++  AG+AAE L Y +  G   D    +       P  +  Q  N
Sbjct  280   LAEGHLSSTAFDRYCMIMFAGIAAEALVYGEAEGGENDENLFRSLCILLNPPPAVAQMAN  339

Query  999   LTRWAVLFAGSLLKNNKGLYEALI  1070
               RW+V+ + +LLK +K  + A +
Sbjct  340   RARWSVMQSYNLLKWHKKAHRAAV  363



>ref|XP_010941658.1| PREDICTED: uncharacterized protein LOC105059869 isoform X2 [Elaeis 
guineensis]
Length=381

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 74/152 (49%), Gaps = 9/152 (6%)
 Frame = +3

Query  669   SFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKLI  821
              F+P Y+ R+  HEA H LVAYL+G PI    LD          G+      DE LE  +
Sbjct  215   CFWPPYKRRVLVHEAGHLLVAYLMGCPIRGVILDPFVALHMGIQGQAGTQFWDENLENEL  274

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
               G+L +   DR  +V  AG+AAE L Y +  G   D    +      +P L+  Q  N 
Sbjct  275   TEGRLSSTAFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSVCVLLQPPLNIAQMSNR  334

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              RW+V+ + +LLK +K  + A + A+    S+
Sbjct  335   ARWSVMQSYNLLKWHKHAHRAAVRALESGHSL  366



>ref|XP_010501263.1| PREDICTED: uncharacterized protein LOC104778504 [Camelina sativa]
Length=385

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKL  818
             S ++P ++ RI  HEA H LVAYL+G PI    LD          G+      D+K+E  
Sbjct  218   SCYWPPHKRRIIVHEAGHLLVAYLMGCPIRGVILDPIVAMRMGVQGQAGTQFWDQKMESE  277

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  278   IAEGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMSN  337

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               RW+VL + +L+K +K  + A + A+
Sbjct  338   QARWSVLQSYNLIKWHKAAHRAAVEAL  364



>ref|WP_002766973.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI01601.1| Similar to tr|Q8YUD8|Q8YUD8 [Microcystis aeruginosa PCC 9443]
 emb|CCI20248.1| Similar to tr|Q8YUD8|Q8YUD8 [Microcystis aeruginosa PCC 9807]
Length=224

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 82/149 (55%), Gaps = 15/149 (10%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVNLIDEKLEKLIYSG  830
             +++R+ +HEA HFL AY+LG+PI  YSL            +G     L D  LE+ + + 
Sbjct  68    HRQRVIHHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFELAD--LEQKVKNF  125

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
                   ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +    +   Q+   RW
Sbjct  126   TDFPAFLERISTVWMAGIAAETLVYGKAAGGESDRFYLQSALKLAGVPENNYAQKE--RW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++L A +LL+  +  Y+AL+ AM K+ASV
Sbjct  184   SLLQAKTLLEKQQTAYQALVIAMEKRASV  212



>emb|CBJ28498.1| conserved unknown protein [Ectocarpus siliculosus]
Length=665

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 117/253 (46%), Gaps = 28/253 (11%)
 Frame = +3

Query  384   WSSQPYVSRRTTSVRELTTLGIRNAENL--GIPSIRNDAAFLFTVVGTTG---FLGVLAG  548
             +S  P    R  S  +L +L     +NL  G P+     ++L   VG  G     G+L G
Sbjct  193   FSKGPSSQSRDVSAEKLLSLSGVEKQNLAPGRPT----GSWLAAGVGVFGAEYLAGILMG  248

Query  549   QLPGDWGFFVPYLIGSI-SLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFL  725
               P      +P+ +G I +  +L  G++S  L +  +       P Y+ERI  HEA HFL
Sbjct  249   LDP--LQTVIPWTLGLIFADRLLLNGALSESLTRLIV-------PAYRERIIRHEAGHFL  299

Query  726   VAYLLGLPILDYSLD--------IGKEHVNLI-DEKLEKLIYSGQLDAKEIDRLAVVAMA  878
             VAYLLG P+    LD         G +   +  D  L K +  G+L    IDR ++V M 
Sbjct  300   VAYLLGCPVQACLLDPFVLGSGLTGAQGGTVFADPVLSKQMADGKLTKSSIDRFSIVLMG  359

Query  879   GLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLY  1058
             G+AAE + Y    G SAD   +   ++   P   ++Q ++   WA   A  L++ +K  Y
Sbjct  360   GIAAEAINYGNSEGGSADEGVMIGILSTIAPPFDREQIKSQALWAATQAVLLIQEHKEAY  419

Query  1059  EALIGAMSKKASV  1097
             E L+ A+   A +
Sbjct  420   EVLVNALESGAEL  432



>ref|XP_006305012.1| hypothetical protein CARUB_v10009377mg [Capsella rubella]
 gb|EOA37910.1| hypothetical protein CARUB_v10009377mg [Capsella rubella]
Length=393

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 73/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             S ++P ++ RI  HEA H L+AYL+G PI    LD          G       D+K+E  
Sbjct  226   SCYWPPHKRRIIVHEAGHLLIAYLMGCPIRGVILDPIVAMQMGVQGHAGTQFWDQKMEGE  285

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  286   IAEGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISLLLEPPLSMAQMSN  345

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               RW+VL + +LLK +K  + A + A+
Sbjct  346   QARWSVLQSYNLLKWHKAAHRAAVEAL  372



>ref|XP_008372156.1| PREDICTED: uncharacterized protein LOC103435541 [Malus domestica]
Length=410

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 76/154 (49%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              SS++P  + RI  HEA H L+AYL+G PI    LD          G+      DEK+  
Sbjct  234   LSSYWPPNRRRILIHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMAN  293

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  +  
Sbjct  294   DLAEGRLDGTAFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRGICVLLEPPLSVPEMS  353

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW++L A ++LK +K  + A + A+  ++ +
Sbjct  354   NQARWSLLQAYNMLKWHKNAHRAAVKALESRSGL  387



>ref|XP_010941655.1| PREDICTED: uncharacterized protein LOC105059869 isoform X1 [Elaeis 
guineensis]
 ref|XP_010941656.1| PREDICTED: uncharacterized protein LOC105059869 isoform X1 [Elaeis 
guineensis]
 ref|XP_010941657.1| PREDICTED: uncharacterized protein LOC105059869 isoform X1 [Elaeis 
guineensis]
Length=401

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 74/152 (49%), Gaps = 9/152 (6%)
 Frame = +3

Query  669   SFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKLI  821
              F+P Y+ R+  HEA H LVAYL+G PI    LD          G+      DE LE  +
Sbjct  235   CFWPPYKRRVLVHEAGHLLVAYLMGCPIRGVILDPFVALHMGIQGQAGTQFWDENLENEL  294

Query  822   YSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
               G+L +   DR  +V  AG+AAE L Y +  G   D    +      +P L+  Q  N 
Sbjct  295   TEGRLSSTAFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSVCVLLQPPLNIAQMSNR  354

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              RW+V+ + +LLK +K  + A + A+    S+
Sbjct  355   ARWSVMQSYNLLKWHKHAHRAAVRALESGHSL  386



>ref|WP_016514760.1| hypothetical protein [Microcystis aeruginosa]
 gb|EPF24076.1| hypothetical protein MAESPC_00791 [Microcystis aeruginosa SPC777]
Length=224

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 83/149 (56%), Gaps = 15/149 (10%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVNLIDEKLEKLIYSG  830
             +++R+ +HEA HFL AY+LG+PI  YSL            +G    +L D  LE+ + + 
Sbjct  68    HRQRVIHHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFDLAD--LEQKVKNF  125

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
                   ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +    +   Q+   RW
Sbjct  126   TDFPAFLERISTVWMAGIAAETLVYGKAEGGESDRFYLQSALKLAGVPENNYAQKE--RW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++L A +LL+  +  Y+AL+ AM K+ASV
Sbjct  184   SLLQAKTLLEKQQTAYQALVIAMEKRASV  212



>gb|KFK35531.1| hypothetical protein AALP_AA4G002700 [Arabis alpina]
Length=378

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             S ++P ++ RI  HEA H LVAYL+G PI    LD          G+      D+K+E  
Sbjct  211   SCYWPPHKRRIIVHEAGHLLVAYLMGCPIRGVILDPVVAMQMGVQGQAGTQFWDQKMESE  270

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             I  G+L     DR ++V  AG+AAE L Y +  G   D    +      +P LS  Q  N
Sbjct  271   IAEGRLSGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLQPPLSVAQMSN  330

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               RW++L + +LLK +K  + A + A+
Sbjct  331   QARWSLLQSYNLLKWHKAAHRAAVEAL  357



>ref|WP_015133963.1| M41 family peptidase [Leptolyngbya sp. PCC 7376]
 ref|YP_007071030.1| M41 family peptidase [Leptolyngbya sp. PCC 7376]
 gb|AFY38196.1| M41 family peptidase [Leptolyngbya sp. PCC 7376]
Length=230

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 99/186 (53%), Gaps = 16/186 (9%)
 Frame = +3

Query  579   PYLIGSISLIVLAVGSISPGLLQA--AIDGFSSFFPDYQ-ERIANHEAAHFLVAYLLGLP  749
             P++   I++ ++ + S+    LQ   A+     F P+ + +R+  HEA HFL  YLLG+P
Sbjct  30    PFVPAGITIFIMGIASVDTFQLQGRGAMLFLDLFTPEEERKRVIQHEAGHFLAGYLLGIP  89

Query  750   ILDYSL---------DIGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLK  902
             I  YSL           G   VN   E +E+ +   Q     ++R++   MAG+AAE L 
Sbjct  90    ITGYSLTPWEAIKNTQGGLGGVNFDLEAVEESLQKSQHINLLVERISTTLMAGIAAEKLV  149

Query  903   YDKVVGQSADLFTLQRFINRSK-PTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAM  1079
             YD+  G   D   L++ + ++  P++  +Q++   +WA L A +LL+ NK  Y+ L+ AM
Sbjct  150   YDQDKGGFEDRRQLKKMLLKAGLPSVVYEQKE---KWATLQATNLLERNKAGYDNLVKAM  206

Query  1080  SKKASV  1097
             + + S+
Sbjct  207   AARKSL  212



>ref|WP_008207088.1| hypothetical protein [Microcystis sp. T1-4]
 emb|CCI34549.1| conserved hypothetical protein [Microcystis sp. T1-4]
Length=224

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 82/149 (55%), Gaps = 15/149 (10%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVNLIDEKLEKLIYSG  830
             +++R+  HEA HFL AY+LG+PI  YSL            +G    +L D  LE+ + + 
Sbjct  68    HRQRVIYHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFDLAD--LEQKVKNF  125

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
                   ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +    +   Q+   RW
Sbjct  126   TDFPAFLERISTVWMAGIAAETLVYGKAAGGESDRFYLQSALKLAGVPENNYAQKE--RW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++L A +LL+  +  Y+AL+ AM K+ASV
Sbjct  184   SLLQAKTLLEKQQTAYQALVIAMEKRASV  212



>ref|XP_006646935.1| PREDICTED: uncharacterized protein LOC102702250, partial [Oryza 
brachyantha]
Length=348

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 65/135 (48%), Gaps = 9/135 (7%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              S F+P Y+ RI  HEA H L AYL+G PI    LD          G+      DEK+EK
Sbjct  180   ISCFWPPYKRRILVHEAGHLLTAYLMGCPIRGVILDPFVALRMGIQGQAGTQFWDEKMEK  239

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G+L     DR  ++  AG+AAE L Y +  G   D    +       P LS  Q  
Sbjct  240   ELADGRLSITAFDRYCMILFAGIAAEALVYGEAEGGENDENLFRSLCILLDPPLSVAQMA  299

Query  996   NLTRWAVLFAGSLLK  1040
             N  RW+V+ + +LLK
Sbjct  300   NRARWSVMQSYNLLK  314



>ref|XP_002316146.2| hypothetical protein POPTR_0010s17850g [Populus trichocarpa]
 gb|EEF02317.2| hypothetical protein POPTR_0010s17850g [Populus trichocarpa]
Length=386

 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 76/159 (48%), Gaps = 9/159 (6%)
 Frame = +3

Query  648   AAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLID  800
             A +   SS++P  + RI  HEA H LVAYL+G P+    LD          G+      D
Sbjct  214   ACLAQISSYWPPNKRRILVHEAGHLLVAYLMGCPVRGVILDPMVAMQMGTQGQAGTQFWD  273

Query  801   EKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLS  980
             EKL   +  G+L     DR  +V  AG+AAE L Y +  G   D    +      +P LS
Sbjct  274   EKLSNELAEGKLSGTSFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSTCVLLQPPLS  333

Query  981   KDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               Q  N  RW+VL + +LLK ++  + A + A+    S+
Sbjct  334   VAQMSNQARWSVLQSFNLLKWHRDAHRAAVKALESGGSL  372



>ref|WP_002797278.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI25161.1| Similar to tr|Q8YUD8|Q8YUD8 [Microcystis aeruginosa PCC 9809]
Length=224

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 82/149 (55%), Gaps = 15/149 (10%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVNLIDEKLEKLIYSG  830
             +++R+ +HEA HFL AY+LG+PI  YSL            +G     L D  LE+ + + 
Sbjct  68    HRQRVIHHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFELAD--LEQKVKNF  125

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
                   ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +    +   Q+   RW
Sbjct  126   TDFPAFLERISTVWMAGIAAETLVYGKAEGGESDRFYLQSALKLAGVPENNYAQKE--RW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++L A +LL+  +  Y+AL+ AM K+ASV
Sbjct  184   SLLQAKTLLEKQQTAYQALVIAMEKRASV  212



>ref|XP_005845454.1| hypothetical protein CHLNCDRAFT_25833, partial [Chlorella variabilis]
 gb|EFN53352.1| hypothetical protein CHLNCDRAFT_25833, partial [Chlorella variabilis]
Length=260

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 80/149 (54%), Gaps = 13/149 (9%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----IGKEHVNL------IDEKLEKLIYSG  830
             Y  R+A HEA HFLVAYLLGL    Y+L      + K  +N+       D   +  + +G
Sbjct  97    YGRRVALHEAGHFLVAYLLGLLPRGYTLSSLDLFLKKRQLNVQAGCQFCDSAFQAEVATG  156

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
             +L +  +D  A VA+AG+A E L++ +  G   D+  L R +   + T +K   Q   RW
Sbjct  157   RLSSSSLDTYACVALAGVATEWLRFGRAEGGLEDVRQLDRLLQALRFTQAKADSQ--VRW  214

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             AVL   +LL+ ++ +++AL  AM +  SV
Sbjct  215   AVLNVVTLLRRHERVHDALAAAMQRGGSV  243



>ref|XP_004308253.1| PREDICTED: uncharacterized protein LOC101300106 [Fragaria vesca 
subsp. vesca]
Length=398

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 76/154 (49%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEK  815
              SS++P  + RI  HEA H L AYL+G PI    LD          G+      DEK+  
Sbjct  225   ISSYWPPNRRRILIHEAGHLLTAYLMGCPIRGVILDPIVAVQMGIQGQAGTQFWDEKMAS  284

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  +  
Sbjct  285   DLAEGRLDGSAFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRGVCLLLQPPLSVAEMS  344

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW++L + +LLK +K  + A + A+  ++S+
Sbjct  345   NQARWSLLQSYNLLKWHKSAHRAAVKALESRSSL  378



>ref|WP_004157250.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO87505.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS48430.1| hypothetical protein C789_1823 [Microcystis aeruginosa DIANCHI905]
Length=224

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 82/149 (55%), Gaps = 15/149 (10%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVNLIDEKLEKLIYSG  830
             +++R+ +HEA HFL AY+LG+PI  YSL            +G    +L D  LE+ + + 
Sbjct  68    HRQRVIHHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFDLAD--LEQKVKNF  125

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
                   ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +    +   Q+   RW
Sbjct  126   TDFPAFLERISTVWMAGIAAETLVYGKAAGGESDRFYLQSALKLAGVPENNYAQKE--RW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++L A +LL+  +  Y+AL+ AM K+ SV
Sbjct  184   SLLQAKTLLEKQQTAYQALVIAMEKRTSV  212



>ref|WP_015956166.1| hypothetical protein [Cyanothece sp. PCC 7424]
 ref|YP_002379449.1| hypothetical protein PCC7424_4211 [Cyanothece sp. PCC 7424]
 gb|ACK72581.1| conserved hypothetical protein [Cyanothece sp. PCC 7424]
Length=223

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 83/150 (55%), Gaps = 15/150 (10%)
 Frame = +3

Query  681   DYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEKLEKLIY-SGQLDAKE---  848
              +++RI +HEA HFLVAYLLG+P+  Y+L    E V      L  +I+ S  L  K    
Sbjct  67    QHRQRIIHHEAGHFLVAYLLGIPVTGYTLS-AWEAVQQKQSGLGGVIFDSTALTEKTLTP  125

Query  849   ------IDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSK-PTLSKDQQQNLTR  1007
                   I+R   V MAG+AAE L Y +  G   D F ++  +  +  P  + +Q++   R
Sbjct  126   TEMPLMIERFCTVWMAGIAAETLIYGESQGGEEDRFQVRSALKLAGLPQFNYEQKE---R  182

Query  1008  WAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             WA+L A +LL+ ++  YEAL+ AM ++ SV
Sbjct  183   WALLQAKNLLEKHQSSYEALVKAMEQRVSV  212



>ref|WP_006102119.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX74276.1| hypothetical protein MC7420_3800 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=228

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 82/152 (54%), Gaps = 19/152 (13%)
 Frame = +3

Query  681   DYQERIANHEAAHFLVAYLLGLPILDYSLDI------GKEHVNLIDEKLEKL----IYSG  830
             DY++RI +HEA HFLVAYLLG+PI  Y+L        G+  +  +    ++L    +  G
Sbjct  70    DYRDRILHHEAGHFLVAYLLGIPIAGYTLTAWEALKQGQPGLGGVQFDTQQLSPNPLAIG  129

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQ---RFINRSKPTLSKDQQQNL  1001
             ++    +DR   V MAG+AAE L Y +  G   D   L+   R   R     +  Q    
Sbjct  130   EMRLT-LDRFCTVWMAGIAAETLVYGEAEGGIDDCQKLKEALRLFERPVGEFTTKQ----  184

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              RWA+L A ++L++N   YEALI AM+++ SV
Sbjct  185   -RWAMLQAQTMLQDNWEAYEALIKAMAERTSV  215



>ref|WP_002782267.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI12043.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9806]
Length=224

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 82/147 (56%), Gaps = 11/147 (7%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLDI------GKEHVNLID---EKLEKLIYSGQL  836
             +++R+  HEA HFL AY+LG+PI  YSL        G+E V  +      LE+ + +   
Sbjct  68    HRQRVIYHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFDIADLEQKVKNFTD  127

Query  837   DAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAV  1016
                 ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +    +   Q+   RW++
Sbjct  128   FPAFLERISTVWMAGIAAETLVYGKAAGGESDRFYLQSALKLAGVPENNYAQKE--RWSL  185

Query  1017  LFAGSLLKNNKGLYEALIGAMSKKASV  1097
             L A +LL+  +  Y+AL+ AM K+ASV
Sbjct  186   LQAKTLLEKQQTAYQALVIAMEKRASV  212



>ref|WP_002791119.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI28861.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808]
Length=224

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 82/149 (55%), Gaps = 15/149 (10%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVNLIDEKLEKLIYSG  830
             +++R+  HEA HFL AY+LG+PI  YSL            +G    +L D  LE+ + + 
Sbjct  68    HRQRVIYHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFDLAD--LEQKVKNF  125

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
                   ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +    +   Q+   RW
Sbjct  126   TDFPAFLERISTVWMAGIAAETLVYGKAEGGESDRFYLQSALKLAGVPENNYAQKE--RW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++L A +LL+  +  Y+AL+ AM K+ASV
Sbjct  184   SLLQAKTLLEKQQTAYQALVIAMEKRASV  212



>ref|WP_015196605.1| hypothetical protein [Calothrix parietina]
 ref|YP_007135923.1| hypothetical protein Cal6303_0886 [Calothrix sp. PCC 6303]
 gb|AFY99950.1| hypothetical protein Cal6303_0886 [Calothrix sp. PCC 6303]
Length=230

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 84/160 (53%), Gaps = 17/160 (11%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D  + F P ++ERI +HEA HFLVA+ L +PI  Y+L           G+  V+  D +
Sbjct  60    LDWIAGFSPAHRERIIHHEAGHFLVAHQLEIPISGYTLTAWEAIKQKQPGQGGVSFDDAE  119

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSAD---LFTLQRFINRSKPTL  977
             L   +  GQ+ A+ +DR   V MAG+AAE + Y+   G + D   L  + + +  S+ T 
Sbjct  120   LTSQLQKGQITAQMLDRYCTVWMAGIAAETIVYNNSEGGADDRNKLAGVLKGLGFSEATF  179

Query  978   SKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
                Q     R+  L A +LL+ N   Y+AL+ AM ++  V
Sbjct  180   DHKQ-----RFCALQAKTLLEENWQAYQALVEAMRQRVPV  214



>ref|XP_008226132.1| PREDICTED: uncharacterized protein LOC103325727 [Prunus mume]
Length=402

 Score = 83.2 bits (204),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 73/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P  + RI  HEA H L+AYL+G PI    LD          G+      DEK+   
Sbjct  235   SSYWPPNRRRILIHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMAND  294

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  +  N
Sbjct  295   LAEGRLDGSAFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICVLLQPPLSVAEMSN  354

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               RW++L + +LLK +K  + A + A+
Sbjct  355   QARWSLLQSYNLLKWHKNAHRAAVEAL  381



>ref|XP_007212262.1| hypothetical protein PRUPE_ppa006642mg [Prunus persica]
 gb|EMJ13461.1| hypothetical protein PRUPE_ppa006642mg [Prunus persica]
Length=402

 Score = 83.2 bits (204),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 73/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEKL  818
             SS++P  + RI  HEA H L+AYL+G PI    LD          G+      DEK+   
Sbjct  235   SSYWPPNRRRILIHEAGHLLIAYLMGCPIRGVILDPVVAMQMGIQGQAGTQFWDEKMAND  294

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  +  N
Sbjct  295   LAEGRLDGSAFDRYCMVLFAGIAAEALVYGEAEGGENDENLFRSICVLLQPPLSVAEMSN  354

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAM  1079
               RW++L + +LLK +K  + A + A+
Sbjct  355   QARWSLLQSYNLLKWHKNAHRAAVEAL  381



>ref|XP_010093312.1| hypothetical protein L484_006771 [Morus notabilis]
 gb|EXB53851.1| hypothetical protein L484_006771 [Morus notabilis]
Length=393

 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 76/153 (50%), Gaps = 9/153 (6%)
 Frame = +3

Query  666   SSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKL  818
             SS++P  + RI  HEA H L AYL+G PI    +D          G+      DEK+   
Sbjct  223   SSYWPPNRRRILVHEAGHLLTAYLMGCPIRGVIIDPIVAVQMGIQGQAGTQFWDEKISND  282

Query  819   IYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQN  998
             +  G+LD    DR  +V  +G+AAE L Y +  G   D    ++     +P LS  +  N
Sbjct  283   LAEGRLDGIAFDRYCMVLFSGIAAEALIYGEAEGGENDENLFRKTCALLRPPLSIAEMSN  342

Query  999   LTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               RW++L + +LLK +K  + A + A+  + S+
Sbjct  343   QARWSLLQSYNLLKWHKNAHRAAVKALESRCSL  375



>ref|WP_026785972.1| hypothetical protein [Planktothrix rubescens]
Length=226

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 92/181 (51%), Gaps = 14/181 (8%)
 Frame = +3

Query  582   YLIGSISLIVLAVGSISPGLLQAAIDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDY  761
             +L+G  +L V         LL   IDG +      +ERI +HEA HFLVA+L+ +PI  Y
Sbjct  39    FLLGVATLDVFQFQGQGASLL---IDGLAGTSASTRERILHHEAGHFLVAHLMEIPIQGY  95

Query  762   SLD---------IGKEHVNLIDEKLEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKV  914
             +L+           +  V   D+ L + +  GQ+ +  +DR   V MAG+AAE L + K 
Sbjct  96    ALNGWEAFKQGFKAQGGVQFADQLLWEQLQQGQISSLILDRYCAVWMAGIAAETLIFKKA  155

Query  915   VGQSADLFTLQRFINRSKPTLSKDQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKAS  1094
              G   D   +     + +  LS+ + +   RWA+L A +L++ +K  Y  L+ AM  +AS
Sbjct  156   EGGREDRDKIIAIWTQLQRPLSEAKIKE--RWAILQAKTLIETHKVAYLGLVEAMRNRAS  213

Query  1095  V  1097
             V
Sbjct  214   V  214



>ref|WP_002737425.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI09732.1| Similar to tr|Q8YUD8|Q8YUD8 [Microcystis aeruginosa PCC 7941]
 gb|ELP54752.1| hypothetical protein O53_3577 [Microcystis aeruginosa TAIHU98]
Length=224

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 82/149 (55%), Gaps = 15/149 (10%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVNLIDEKLEKLIYSG  830
             +++R+ +HEA HFL AY+LG+PI  YSL            +G    +L D  LE+ + + 
Sbjct  68    HRQRVIHHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFDLAD--LEQKVKNF  125

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
                   ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +    +   Q+   RW
Sbjct  126   TDFPAFLERISTVWMAGIAAETLVYGKAEGGESDRFYLQSALKLAGVPENNYAQKE--RW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++L A +LL+  +  Y+AL+ AM K+ SV
Sbjct  184   SLLQAKTLLEKQQTAYQALVIAMEKRTSV  212



>ref|WP_002801455.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI39058.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701]
Length=224

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 81/150 (54%), Gaps = 17/150 (11%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLDI------GKEHVNLIDEKLEKLIYSGQLDAK  845
             +++R+  HEA HFL AY+LG+PI  YSL        G+E V  +  +L  L   GQ    
Sbjct  68    HRQRVIYHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFELADL---GQKVKN  124

Query  846   EID------RLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTR  1007
               D      R++ V MAG+AAE L Y K  G  +D F LQ  +  +    +   Q+   R
Sbjct  125   FTDFPAFLERISTVWMAGIAAETLVYGKAEGGESDRFYLQSALKLAGVPENNYAQKE--R  182

Query  1008  WAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             W++L A +LL+  +  Y+AL+ AM K+ASV
Sbjct  183   WSLLQAKTLLEKQQTAYQALVIAMEKRASV  212



>ref|WP_012160852.1| hypothetical protein [Acaryochloris marina]
 ref|YP_001514552.1| hypothetical protein AM1_0152 [Acaryochloris marina MBIC11017]
 gb|ABW25238.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
Length=221

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 81/152 (53%), Gaps = 9/152 (6%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSL---DIGKEHVNLIDEKLEKLIY  824
             +DGF+   P Y++R+ +HEA HFL AYLL LPI  Y+L   +  ++        +E  + 
Sbjct  60    LDGFARLSPQYRQRVIHHEAGHFLTAYLLDLPITGYTLTAWEAQQQGGGQGGVCIETPVD  119

Query  825   SGQLDA-KEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
               + +A ++++R   V MAG  AE   Y +  G   DL  L+R +NR    +   ++Q  
Sbjct  120   FSETNALEQVERYCTVWMAGGVAETFIYSEAEGGKDDLRQLRRTLNRLHMNVKVHERQAG  179

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              R     A  ++++N   YEAL+ AM+ + SV
Sbjct  180   NR-----ARQMIRSNWDAYEALVQAMTDRKSV  206



>ref|WP_006510695.1| hypothetical protein [Xenococcus sp. PCC 7305]
 gb|ELS02221.1| hypothetical protein Xen7305DRAFT_00019340 [Xenococcus sp. PCC 
7305]
Length=223

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 80/149 (54%), Gaps = 13/149 (9%)
 Frame = +3

Query  681   DYQERIANHEAAHFLVAYLLGLPILDYSLD----IGKEHVNLIDEKLE-KLIYSGQLDAK  845
             + ++R+ +HEA HFL AY LG+PI +YSL       K H        E     S  +D K
Sbjct  67    EQRQRVIHHEAGHFLTAYFLGIPITEYSLTAWEAFRKGHYGQGGVVFEPNSAISKTVDKK  126

Query  846   E----IDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSK-PTLSKDQQQNLTRW  1010
             +    +DRL  V MAG+AAE L YD+  G   D   LQ  +N +  P     Q++   RW
Sbjct  127   DLPLTLDRLCTVWMAGIAAEKLVYDEAEGGQEDCQQLQIALNMAGFPNTIYSQKE---RW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
               L A SLL+ +K  ++AL+ AM+++ SV
Sbjct  184   GQLQATSLLERHKRAFDALVIAMAERKSV  212



>gb|EPS65428.1| hypothetical protein M569_09348, partial [Genlisea aurea]
Length=336

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 73/154 (47%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEK  815
              SS++P Y+ RI  HEA H +VAYL+G PI    LD          G+      DE L+ 
Sbjct  171   ISSYWPPYKRRILVHEAGHLIVAYLMGCPIRGVILDPFIAMQMGIKGQAGTQFWDENLQN  230

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G++     DR  +V   G+AAE L Y +  G   D    +       P LS  Q  
Sbjct  231   ELAEGRVSGTAFDRYCMVLFGGIAAEALVYGEAEGGENDENLFRSICLLLDPPLSTAQMS  290

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW+VL A +LLK ++  + A + A+    ++
Sbjct  291   NQARWSVLQAYNLLKWHERAHGAAVKALENGGNL  324



>ref|WP_010474621.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=221

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 79/152 (52%), Gaps = 9/152 (6%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDIGKEHVNLIDEK---LEKLIY  824
             +DGF+   P Y++R+ +HEA HFL AYLL LPI  Y+L   +       +    +E  + 
Sbjct  60    LDGFARLSPQYRQRVIHHEAGHFLTAYLLDLPITGYTLTAWEAQQQGGGQGGICIETPVD  119

Query  825   SGQLDA-KEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNL  1001
               +  A ++++R   V MAG  AE   Y +  G   DL  L+R +NR    +   ++Q  
Sbjct  120   FSETSALEQVERYCTVWMAGGVAETFIYSEAEGGKDDLRQLRRTLNRLHMNVKVHERQAG  179

Query  1002  TRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              R     A  L+++N   YEAL+ AM+ + SV
Sbjct  180   NR-----ARQLIRSNWDAYEALVQAMTDRKSV  206



>ref|WP_002754791.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH93178.1| Similar to tr|Q8YUD8|Q8YUD8 [Microcystis aeruginosa PCC 9432]
Length=224

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 81/149 (54%), Gaps = 15/149 (10%)
 Frame = +3

Query  684   YQERIANHEAAHFLVAYLLGLPILDYSLD-----------IGKEHVNLIDEKLEKLIYSG  830
             +++R+  HEA HFL AY+LG+PI  YSL            +G    +L D  LE+ + + 
Sbjct  68    HRQRVIYHEAGHFLTAYILGIPIASYSLTAWEAFRQGQEGVGGVQFDLAD--LEQKVKNF  125

Query  831   QLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQNLTRW  1010
                   ++R++ V MAG+AAE L Y K  G  +D F LQ  +  +    +   Q+   RW
Sbjct  126   TDFPAFLERISTVWMAGIAAETLVYGKAEGGESDRFYLQSALKLAGVPENNYAQKE--RW  183

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             ++L A +LL+  +  Y+AL+ AM K+ SV
Sbjct  184   SLLQAKTLLEKQQTAYQALVIAMEKRTSV  212



>ref|XP_010462483.1| PREDICTED: uncharacterized protein LOC104743061 isoform X2 [Camelina 
sativa]
Length=180

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 73/148 (49%), Gaps = 11/148 (7%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEK  815
              S ++P ++ RI  HEA H LVAYL+G PI    LD          G+      D+K+E 
Sbjct  14    ISCYWPPHKRRIIVHEAGHLLVAYLMGCPIRGVILDPIVAMRMGVQGQAGTQFWDQKMES  73

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              I  G+L     D  ++V  AG+AAE L Y +  G   D    +      +P LS  Q  
Sbjct  74    EIAEGRLSGSSFD--SMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMS  131

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAM  1079
             N  RW+VL + +L+K +K  + A + A+
Sbjct  132   NQARWSVLQSYNLIKWHKAAHRAAVEAL  159



>ref|WP_015194303.1| hypothetical protein [Stanieria cyanosphaera]
 ref|YP_007133604.1| hypothetical protein Sta7437_3127 [Stanieria cyanosphaera PCC 
7437]
 gb|AFZ36638.1| hypothetical protein Sta7437_3127 [Stanieria cyanosphaera PCC 
7437]
Length=223

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 83/158 (53%), Gaps = 15/158 (9%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D FS+  P  ++R+ +HEA HFL AY LG+P+  YSL           G+  V    ++
Sbjct  60    LDVFST--PQQRQRVIHHEAGHFLTAYFLGIPVTGYSLTAWEALKQGQPGRGGVAFNTQE  117

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSK-PTLSK  983
             L     + +     +DR   V MAG+AAE L Y    G   D   L+  ++ +  P +  
Sbjct  118   LTTKPINFEEMRLTLDRFCTVWMAGIAAEKLVYGNAEGGQEDCEQLRLALSLAGLPEIGY  177

Query  984   DQQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
              Q+Q   RWA + A S+++ ++  Y+AL+ AM ++ASV
Sbjct  178   AQKQ---RWAQIQATSIIERHQNAYQALVTAMEQRASV  212



>ref|XP_008356157.1| PREDICTED: uncharacterized protein LOC103419845 [Malus domestica]
Length=323

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 74/154 (48%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              SS++P  + RI  HEA H L+ YL+G PI    L           G+      DEK+  
Sbjct  155   LSSYWPPNRRRILIHEAGHLLIXYLMGCPIRGVILXPIVAMQMGIQGQAGTQFWDEKMAN  214

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  +  
Sbjct  215   DLAEGRLDGTAFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRGICVLLEPPLSVPEMS  274

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW++L A ++LK +K  + A + A+  ++ +
Sbjct  275   NQARWSLLQAYNMLKWHKNAHRAAVKALESRSGL  308



>ref|WP_007354337.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN55114.1| conserved exported hypothetical protein [ [[Oscillatoria] sp. 
PCC 6506]
Length=225

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 80/149 (54%), Gaps = 13/149 (9%)
 Frame = +3

Query  681   DYQERIANHEAAHFLVAYLLGLPILDYSLD---------IGKEHVNLIDEKLEKLIYSGQ  833
             D ++RI  HEA HFLVAYLL +P+  Y+L+           +  V   D++L   +  G 
Sbjct  69    DRRDRILRHEAGHFLVAYLLEIPVSGYALNAWEAFKQGQTAQGGVRFEDQELASQMQKGA  128

Query  834   LDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINR-SKPTLSKDQQQNLTRW  1010
                + +DR   V MAG+AAE L Y    G + D   ++  +++  +P     Q++N    
Sbjct  129   FSVQLLDRYCTVWMAGIAAENLVYGNAEGGAEDRNKIRLILSQLRRPASEFKQKENR---  185

Query  1011  AVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             A+L A +L++N+K  YEAL+ AM K+  V
Sbjct  186   ALLQARNLIENHKLAYEALVEAMKKREPV  214



>ref|WP_015226966.1| hypothetical protein [Halothece sp. PCC 7418]
 ref|YP_007169307.1| hypothetical protein PCC7418_2964 [Halothece sp. PCC 7418]
 gb|AFZ45093.1| hypothetical protein PCC7418_2964 [Halothece sp. PCC 7418]
Length=226

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 77/157 (49%), Gaps = 13/157 (8%)
 Frame = +3

Query  654   IDGFSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEK  806
             +D FS+   + +ER+  HEA HFL AY LG+PI  YSL           G+  V      
Sbjct  60    VDLFST--AEQRERVLYHEAGHFLTAYFLGIPIQGYSLTAWEAFRRQQPGQGGVQFDTTA  117

Query  807   LEKLIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKD  986
             LE++          +DR   V  AG+AAE L+Y K  G   D   LQ  +N       ++
Sbjct  118   LEQVGTQPNQVNLMLDRACTVWCAGIAAEILQYGKAEGGGDDRAQLQSVLNDFG--YPQN  175

Query  987   QQQNLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             Q+Q    WA L A SL++ N   Y AL+  M ++ASV
Sbjct  176   QRQQKEEWAKLQAKSLIERNIEAYHALVKVMRQRASV  212



>ref|XP_008364245.1| PREDICTED: uncharacterized protein LOC103427939 [Malus domestica]
Length=402

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 74/154 (48%), Gaps = 9/154 (6%)
 Frame = +3

Query  663   FSSFFPDYQERIANHEAAHFLVAYLLGLPILDYSLDI---------GKEHVNLIDEKLEK  815
              SS++P  + RI  HEA H L+ YL+G PI    L           G+      DEK+  
Sbjct  234   LSSYWPPNRRRILIHEAGHLLIXYLMGCPIRGVILXPIVAMQMGIQGQAGTQFWDEKMAN  293

Query  816   LIYSGQLDAKEIDRLAVVAMAGLAAEGLKYDKVVGQSADLFTLQRFINRSKPTLSKDQQQ  995
              +  G+LD    DR  +V  AG+AAE L Y +  G   D    +      +P LS  +  
Sbjct  294   DLAEGRLDGTAFDRYCMVLFAGIAAEALIYGEAEGGENDENLFRGICVLLEPPLSVPEMS  353

Query  996   NLTRWAVLFAGSLLKNNKGLYEALIGAMSKKASV  1097
             N  RW++L A ++LK +K  + A + A+  ++ +
Sbjct  354   NQARWSLLQAYNMLKWHKNAHRAAVKALESRSGL  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3721193409042