BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20134_g1_i1 len=567 path=[2634:0-420 1957:421-456 3266:457-491
3300:492-566]

Length=567
                                                                      Score     E

ref|XP_009757388.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    127   2e-34   
ref|XP_006493298.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    126   7e-34   
ref|XP_002300924.2|  hypothetical protein POPTR_0002s06990g             126   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_009604188.1|  PREDICTED: cytochrome b-c1 complex subunit 6       125   2e-33   
ref|XP_009788017.1|  PREDICTED: cytochrome b-c1 complex subunit 6       124   3e-33   
gb|KHF98934.1|  Cytochrome b-c1 complex subunit 6                       126   3e-33   
sp|P48504.2|QCR6_SOLTU  RecName: Full=Cytochrome b-c1 complex sub...    124   5e-33   Solanum tuberosum [potatoes]
ref|XP_009148897.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    123   6e-33   
ref|XP_004247438.1|  PREDICTED: cytochrome b-c1 complex subunit 6       123   8e-33   
ref|XP_006359400.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    122   2e-32   
ref|XP_010260923.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    122   2e-32   
emb|CDY67213.1|  BnaA06g38290D                                          122   4e-32   
ref|XP_006359398.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    121   5e-32   
emb|CDY39613.1|  BnaC05g11420D                                          123   5e-32   
ref|XP_007221592.1|  hypothetical protein PRUPE_ppa017907mg             122   6e-32   
ref|XP_010062124.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    121   6e-32   
ref|XP_009107099.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    122   7e-32   
ref|XP_004247441.1|  PREDICTED: cytochrome b-c1 complex subunit 6       120   8e-32   
gb|KFK33331.1|  hypothetical protein AALP_AA5G000400                    122   2e-31   
ref|XP_002307493.1|  ubiquinol-cytochrome C reductase complex 7.8...    120   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010030078.1|  PREDICTED: cytochrome b-c1 complex subunit 6       119   2e-31   
ref|XP_011042844.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    119   2e-31   
ref|XP_008218833.1|  PREDICTED: cytochrome b-c1 complex subunit 6       119   2e-31   
gb|AFK37870.1|  unknown                                                 119   3e-31   
ref|XP_008456103.1|  PREDICTED: cytochrome b-c1 complex subunit 6       119   4e-31   
ref|XP_009117845.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    119   4e-31   
emb|CDY52019.1|  BnaA08g31320D                                          119   4e-31   
ref|XP_006493299.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    118   6e-31   
ref|XP_010241723.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    118   6e-31   
ref|XP_009110506.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    118   8e-31   
ref|XP_003531564.1|  PREDICTED: cytochrome b-c1 complex subunit 6       118   9e-31   
ref|NP_172964.1|  ubiquinol-cytochrome C reductase hinge protein        118   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890088.1|  predicted protein                                  117   1e-30   
gb|AES63375.2|  cytochrome B-c1 complex subunit 6                       119   1e-30   
ref|XP_006398494.1|  hypothetical protein EUTSA_v10001040mg             121   1e-30   
gb|KGN57555.1|  hypothetical protein Csa_3G212480                       119   1e-30   
emb|CDX83995.1|  BnaC08g16500D                                          117   2e-30   
gb|KDO42558.1|  hypothetical protein CISIN_1g037428mg                   120   2e-30   
ref|XP_004140689.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    117   2e-30   
ref|XP_004287060.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    116   3e-30   
emb|CDY67181.1|  BnaAnng23750D                                          117   3e-30   
ref|XP_007148445.1|  hypothetical protein PHAVU_006G209400g             116   4e-30   
ref|XP_003547586.1|  PREDICTED: cytochrome b-c1 complex subunit 6       116   4e-30   
ref|XP_003593124.1|  Cytochrome b-c1 complex subunit                    119   4e-30   
gb|KHG15128.1|  Cytochrome b-c1 complex subunit 6                       116   4e-30   
ref|XP_011044295.1|  PREDICTED: uncharacterized protein LOC105139521    119   6e-30   
ref|XP_010496855.1|  PREDICTED: cytochrome b-c1 complex subunit 6       115   6e-30   
gb|AAM63085.1|  putative ubiquinol--cytochrome-c reductase              115   8e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107100.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    115   1e-29   
ref|XP_002300923.2|  hypothetical protein POPTR_0002s06980g             119   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_004485537.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    115   1e-29   
ref|XP_004485535.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    115   1e-29   
ref|XP_006303490.1|  hypothetical protein CARUB_v10010817mg             115   1e-29   
emb|CDX81698.1|  BnaC08g39030D                                          115   1e-29   
emb|CDY40404.1|  BnaA02g27180D                                          116   2e-29   
ref|XP_008339311.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    114   2e-29   
ref|XP_002307492.1|  hypothetical protein POPTR_0005s21320g             114   3e-29   Populus trichocarpa [western balsam poplar]
gb|AFK40779.1|  unknown                                                 113   5e-29   
ref|XP_011042840.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    113   7e-29   
ref|XP_008806786.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    113   8e-29   
ref|XP_007041603.1|  Ubiquinol-cytochrome C reductase hinge protein     112   1e-28   
ref|XP_008378799.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    112   1e-28   
ref|XP_009354067.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    112   1e-28   
ref|XP_002269910.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    112   1e-28   Vitis vinifera
emb|CBI18191.3|  unnamed protein product                                113   2e-28   
emb|CDY37339.1|  BnaC02g33570D                                          112   3e-28   
ref|XP_009384206.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    112   3e-28   
ref|XP_006854530.1|  hypothetical protein AMTR_s00030p00033750          112   4e-28   
ref|XP_009388898.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    111   4e-28   
ref|XP_009384207.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    111   4e-28   
ref|XP_009343625.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    110   6e-28   
ref|XP_008339110.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    110   6e-28   
ref|XP_002450330.1|  hypothetical protein SORBIDRAFT_05g003875          110   9e-28   Sorghum bicolor [broomcorn]
ref|XP_008381816.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    110   1e-27   
ref|XP_011087825.1|  PREDICTED: cytochrome b-c1 complex subunit 6       109   2e-27   
ref|XP_004978758.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    109   2e-27   
gb|EYU35416.1|  hypothetical protein MIMGU_mgv1a024165mg                110   3e-27   
gb|ACG38059.1|  ubiquinol-cytochrome c reductase complex 7.8 kDa ...    108   4e-27   Zea mays [maize]
ref|XP_010030934.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    108   7e-27   
ref|XP_009399211.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    107   8e-27   
ref|XP_011042841.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    108   1e-26   
ref|XP_008237594.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    107   1e-26   
gb|KDO83701.1|  hypothetical protein CISIN_1g034047mg                   108   1e-26   
ref|XP_006473042.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    108   1e-26   
ref|XP_006434444.1|  hypothetical protein CICLE_v10002923mg             107   2e-26   
gb|EPS66329.1|  hypothetical protein M569_08449                         106   2e-26   
ref|XP_004308600.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    107   2e-26   
ref|XP_010680587.1|  PREDICTED: cytochrome b-c1 complex subunit 6       106   3e-26   
ref|XP_006473043.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    106   3e-26   
gb|AFW65608.1|  hypothetical protein ZEAMMB73_969846                    106   3e-26   
ref|XP_007200654.1|  hypothetical protein PRUPE_ppa014447mg             105   5e-26   
gb|EYU18522.1|  hypothetical protein MIMGU_mgv1a017873mg                105   8e-26   
ref|XP_007019478.1|  Ubiquinol-cytochrome C reductase hinge protein     105   8e-26   
ref|NP_001065827.1|  Os11g0162200                                       105   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EPS61533.1|  hypothetical protein M569_13266                         105   1e-25   
ref|NP_001154342.1|  ubiquinol-cytochrome C reductase hinge protein     107   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004298236.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    105   1e-25   
ref|XP_003578875.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    103   3e-25   
ref|NP_178219.1|  ubiquinol-cytochrome c reductase hinge protein        103   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416942.1|  hypothetical protein EUTSA_v10009667mg             104   4e-25   
ref|XP_001752758.1|  predicted protein                                  103   4e-25   
ref|XP_010237909.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    103   5e-25   
gb|ABK20928.1|  unknown                                                 103   5e-25   Picea sitchensis
gb|KFK43768.1|  hypothetical protein AALP_AA1G170400                    105   6e-25   
ref|XP_008781398.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    102   9e-25   
gb|EAY80071.1|  hypothetical protein OsI_35238                          103   9e-25   Oryza sativa Indica Group [Indian rice]
gb|AAX95093.1|  ubiquinol--cytochrome-c reductase, putative             102   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002442861.1|  hypothetical protein SORBIDRAFT_08g003963          102   1e-24   Sorghum bicolor [broomcorn]
gb|AAD39640.1|AC007591_5  Similar to gb|X79273 cytochrome c reduc...    102   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ADE75811.1|  unknown                                                 101   2e-24   
gb|ACF82301.1|  unknown                                                 101   2e-24   Zea mays [maize]
ref|XP_005848988.1|  hypothetical protein CHLNCDRAFT_35029              101   3e-24   
ref|XP_008784141.1|  PREDICTED: cytochrome b-c1 complex subunit 6...    101   3e-24   
dbj|BAJ84951.1|  predicted protein                                      101   3e-24   
ref|XP_002532440.1|  Ubiquinol-cytochrome c reductase complex 7.8...    101   6e-24   Ricinus communis
gb|EMT10803.1|  Cytochrome b-c1 complex subunit 6                       101   7e-24   
ref|XP_004977318.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  99.8    1e-23   
ref|XP_003575101.2|  PREDICTED: uncharacterized protein LOC100828312    102   1e-23   
ref|XP_002875059.1|  predicted protein                                99.4    1e-23   
gb|AFW71717.1|  hypothetical protein ZEAMMB73_660333                    101   2e-23   
ref|XP_002453955.1|  hypothetical protein SORBIDRAFT_04g022156        97.8    7e-23   Sorghum bicolor [broomcorn]
gb|AFW71718.1|  hypothetical protein ZEAMMB73_660333                  99.4    8e-23   
dbj|BAK07610.1|  predicted protein                                    97.4    9e-23   
gb|AFW65611.1|  hypothetical protein ZEAMMB73_969846                  97.4    9e-23   
gb|EAY86198.1|  hypothetical protein OsI_07574                        99.8    1e-22   Oryza sativa Indica Group [Indian rice]
gb|ACG26684.1|  hypothetical protein                                  96.7    1e-22   Zea mays [maize]
gb|EMT23173.1|  Cytochrome b-c1 complex subunit 6                     97.1    2e-22   
ref|XP_010103836.1|  Cytochrome b-c1 complex subunit 6                  100   2e-22   
gb|EMS66572.1|  Cytochrome b-c1 complex subunit 6                     96.7    2e-22   
gb|ACG25993.1|  hypothetical protein                                  96.3    3e-22   Zea mays [maize]
ref|NP_001047065.1|  Os02g0541700                                     95.5    4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952689.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  95.5    5e-22   
gb|AFW65612.1|  hypothetical protein ZEAMMB73_969846                  95.5    6e-22   
gb|AFW71716.1|  hypothetical protein ZEAMMB73_660333                  97.1    1e-21   
gb|EAZ23360.1|  hypothetical protein OsJ_07056                        97.4    1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002532437.1|  Ubiquinol-cytochrome c reductase complex 7.8...  94.7    4e-21   Ricinus communis
gb|ABA91661.2|  Ubiquinol-cytochrome c reductase complex 7.8 kDa ...  92.8    5e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005535993.1|  cytochrome c reductase hinge protein             89.7    6e-20   
tpg|DAA55604.1|  TPA: hypothetical protein ZEAMMB73_828416            89.4    2e-19   
gb|ACG44489.1|  ubiquinol-cytochrome c reductase complex 7.8 kDa ...  89.0    4e-19   Zea mays [maize]
gb|KFM27464.1|  Cytochrome b-c1 complex subunit 6                     87.4    5e-19   
ref|XP_005647640.1|  putative ubiquinol-cytochrome C reductase co...  86.7    1e-18   
ref|XP_001785618.1|  predicted protein                                85.9    2e-18   
ref|XP_005706663.1|  ubiquinol-cytochrome c reductase subunit 6       85.5    3e-18   
tpg|DAA55602.1|  TPA: hypothetical protein ZEAMMB73_828416            83.2    2e-17   
ref|XP_009608979.1|  PREDICTED: uncharacterized protein LOC104102845  83.6    3e-17   
ref|XP_002503396.1|  predicted protein                                82.4    6e-17   Micromonas commoda
ref|XP_002969341.1|  hypothetical protein SELMODRAFT_69986            80.9    1e-16   
ref|XP_003058347.1|  predicted protein                                80.9    2e-16   
ref|XP_009368542.1|  PREDICTED: uncharacterized protein LOC103958047  82.0    3e-16   
ref|XP_007513460.1|  predicted protein                                79.7    6e-16   
ref|XP_002970674.1|  hypothetical protein SELMODRAFT_69978            79.0    7e-16   
ref|XP_001697864.1|  ubiquinol:cytochrome c oxidoreductase 8 kDa ...  79.0    8e-16   Chlamydomonas reinhardtii
ref|XP_005818775.1|  hypothetical protein GUITHDRAFT_91152            77.0    5e-15   
ref|XP_002949689.1|  hypothetical protein VOLCADRAFT_80825            75.1    2e-14   
ref|XP_004341565.1|  ubiquinol:cytochrome c oxidoreductase 8 kDa ...  73.6    7e-14   
emb|CEG01357.1|  Cytochrome b-c1 complex, subunit 6                   69.3    3e-12   
ref|XP_003593125.1|  Cytochrome b-c1 complex subunit                  69.7    6e-12   
ref|XP_006405726.1|  hypothetical protein EUTSA_v10028069mg           68.6    1e-11   
ref|XP_006397227.1|  hypothetical protein EUTSA_v10029056mg           68.2    2e-11   
ref|XP_008907054.1|  hypothetical protein PPTG_13081                  65.9    4e-11   
gb|KDP43002.1|  hypothetical protein JCGZ_25188                       64.7    1e-10   
ref|XP_009825435.1|  hypothetical protein H257_03157                  63.5    3e-10   
ref|XP_008867523.1|  hypothetical protein H310_04797                  63.2    4e-10   
ref|XP_005771628.1|  hypothetical protein EMIHUDRAFT_75509            61.6    1e-09   
gb|EJK50781.1|  hypothetical protein THAOC_30120                      62.8    4e-09   
ref|XP_001419278.1|  predicted protein                                59.7    5e-09   Ostreococcus lucimarinus CCE9901
ref|XP_002293428.1|  ubiquinol cytochrome c reductase                 59.3    1e-08   Thalassiosira pseudonana CCMP1335
ref|XP_008605019.1|  hypothetical protein SDRG_01280                  58.2    2e-08   
ref|XP_002899863.1|  hypothetical protein PITG_13682                  57.4    4e-08   
ref|XP_011042843.1|  PREDICTED: uncharacterized protein LOC105138...  47.4    9e-08   
ref|XP_008819046.1|  ubiquinol-cytochrome c reductase subunit 6       56.6    1e-07   
ref|XP_003690582.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  56.2    1e-07   
ref|XP_006613401.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  56.2    2e-07   
ref|XP_001122063.2|  PREDICTED: cytochrome b-c1 complex subunit 6...  55.8    2e-07   Apis mellifera [bee]
ref|XP_001616704.1|  ubiquinol-cytochrome c reductase hinge protein   55.1    4e-07   Plasmodium vivax Sal-1
ref|XP_009619558.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  54.3    4e-07   
emb|CDJ29853.1|  ubiquinol-cytochrome c reductase hinge protein, ...  55.1    5e-07   
ref|XP_004224390.1|  ubiquinol-cytochrome c reductase hinge protein   54.7    6e-07   
ref|XP_001348422.1|  ubiquinol-cytochrome c reductase hinge prote...  54.7    6e-07   Plasmodium falciparum 3D7
ref|XP_969197.1|  PREDICTED: cytochrome b-c1 complex subunit 6, m...  53.9    1e-06   Tribolium castaneum [rust-red flour beetle]
ref|XP_004349831.1|  hypothetical protein CAOG_01311                  53.5    1e-06   
emb|CCA20655.1|  AlNc14C100G5999                                      52.8    2e-06   
ref|XP_003488270.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  53.1    2e-06   
ref|XP_009538412.1|  hypothetical protein PHYSODRAFT_319854           52.4    2e-06   
ref|XP_002260755.1|  ubiquinol-cytochrome c reductase hinge protein   52.8    3e-06   Plasmodium knowlesi strain H
ref|XP_005794133.1|  hypothetical protein EMIHUDRAFT_94940            53.1    3e-06   
ref|XP_002369881.1|  ubiquinol-cytochrome C reductase hinge prote...  52.8    3e-06   Toxoplasma gondii ME49
dbj|BAN20397.1|  unkown protein                                       52.4    3e-06   
ref|XP_676661.1|  ubiquinol-cytochrome c reductase hinge protein      52.4    3e-06   Plasmodium berghei ANKA
ref|XP_003399309.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  52.4    4e-06   
ref|XP_743273.1|  ubiquinol-cytochrome c reductase hinge protein      52.4    4e-06   Plasmodium chabaudi chabaudi
ref|XP_003880575.1|  hypothetical protein NCLIV_010110                52.4    5e-06   
ref|XP_009033735.1|  hypothetical protein AURANDRAFT_69671            51.6    5e-06   
ref|XP_001134613.1|  ubiquinol-cytochrome-c reductase hinge protein   51.6    5e-06   Dictyostelium discoideum AX4
ref|XP_002108428.1|  expressed hypothetical protein                   52.4    6e-06   Trichoplax adhaerens
ref|XP_003287985.1|  hypothetical protein DICPUDRAFT_152169           50.8    9e-06   
gb|KDR22439.1|  Cytochrome b-c1 complex subunit 6, mitochondrial      50.1    3e-05   
ref|XP_008545652.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  50.1    3e-05   
emb|CCI47288.1|  unnamed protein product                              49.7    3e-05   
ref|XP_011067618.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  49.7    3e-05   
gb|EFN77372.1|  Cytochrome b-c1 complex subunit 6, mitochondrial      49.7    4e-05   
ref|XP_004830886.1|  ubiquinol-cytochrome c reductase hinge, puta...  49.7    4e-05   
gb|ABY27174.1|  ubiquinol-cytochrome c reductase hinge protein        49.7    5e-05   Perkinsus chesapeaki
ref|XP_003746995.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  48.9    6e-05   
ref|XP_002130060.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  49.3    7e-05   Ciona intestinalis [sea vase]
ref|XP_005110018.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  48.9    1e-04   
gb|ACH45100.1|  putative ubiquinol-cytochrome c reductase hinge p...  48.1    1e-04   Taeniopygia guttata
emb|CCF72903.1|  unnamed protein product                              48.1    1e-04   
gb|EFN69930.1|  Cytochrome b-c1 complex subunit 6, mitochondrial      48.1    1e-04   
ref|XP_844648.1|  ubiquinol-cytochrome C reductase                    47.8    2e-04   Trypanosoma brucei brucei TREU927
emb|CCC47766.1|  putative ubiquinol-cytochrome c reductase            47.8    2e-04   
ref|XP_847572.1|  mitochondrial hinge protein                         47.4    2e-04   Trypanosoma brucei brucei TREU927
ref|XP_001654918.1|  hypothetical protein AaeL_AAEL010801             48.1    2e-04   Aedes aegypti
ref|XP_009315883.1|  ubiquinol-cytochrome C reductase                 47.4    2e-04   
ref|XP_002775032.1|  ubiquinol-cytochrome c reductase complex 7.8...  47.8    2e-04   Perkinsus marinus ATCC 50983
gb|ADB57071.1|  RH21839p                                              47.8    3e-04   Drosophila melanogaster
ref|XP_003700255.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  47.4    3e-04   
gb|EPY16273.1|  ubiquinol-cytochrome c reductase subunit 6            47.0    3e-04   
ref|XP_001654917.1|  hypothetical protein AaeL_AAEL010801             47.0    4e-04   Aedes aegypti
emb|CBN80231.1|  ubiquinol cytochrome c reductase subunit 6           46.6    5e-04   
ref|NP_001184190.1|  cytochrome b-c1 complex subunit 6, mitochond...  46.6    5e-04   
ref|XP_001996189.1|  GH22364                                          46.6    5e-04   Drosophila grimshawi
gb|EZA50561.1|  Cytochrome b-c1 complex subunit 6, mitochondrial      46.6    6e-04   
gb|ACH45090.1|  putative ubiquinol-cytochrome c reductase hinge p...  46.2    6e-04   Taeniopygia guttata
ref|XP_005423236.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  45.8    7e-04   
ref|XP_001632040.1|  predicted protein                                46.6    7e-04   Nematostella vectensis
ref|XP_001849620.1|  mitochondrial ubiquinol-cytochrome c reducta...  46.2    7e-04   Culex quinquefasciatus
ref|XP_002073884.1|  GK14352                                          46.2    7e-04   Drosophila willistoni
ref|XP_009261873.1|  hypothetical protein FPSE_10481                  47.0    8e-04   
ref|XP_389665.1|  hypothetical protein FG09489.1                      47.0    8e-04   Fusarium graminearum PH-1
ref|XP_003877776.1|  ubiquinol-cytochrome-c reductase-like protein    47.0    9e-04   
ref|XP_005482393.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  45.4    0.001   
ref|XP_002737367.1|  PREDICTED: cytochrome b-c1 complex subunit 6...  45.8    0.001   Saccoglossus kowalevskii



>ref|XP_009757388.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Nicotiana 
sylvestris]
 ref|XP_009757389.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Nicotiana 
sylvestris]
Length=69

 Score =   127 bits (320),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEEVVDQKK  E++CKPKCVRQL+EYQACAKR++GDESGHKHCTGQYFDYW CIDKCV
Sbjct  1    MSDEEVVDQKKTLEETCKPKCVRQLREYQACAKRIEGDESGHKHCTGQYFDYWQCIDKCV  60

Query  274  APKLFTKLK  248
            A KLF +LK
Sbjct  61   AVKLFDQLK  69



>ref|XP_006493298.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X1 
[Citrus sinensis]
Length=87

 Score =   126 bits (317),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  496  IRPSTSYFCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCT  317
            I+PS   F    F M+DEE+VDQKK +E++CKPKCV+ L EYQAC KR+ GDESGHKHCT
Sbjct  5    IQPSLLTFTCPSFAMADEELVDQKKYFEEACKPKCVKPLLEYQACVKRIQGDESGHKHCT  64

Query  316  GQYFDYWHCIDKCVAPKLFTKLK  248
            GQYFDYW CIDKCVA KLF KLK
Sbjct  65   GQYFDYWSCIDKCVAVKLFQKLK  87



>ref|XP_002300924.2| hypothetical protein POPTR_0002s06990g [Populus trichocarpa]
 gb|EEE80197.2| hypothetical protein POPTR_0002s06990g [Populus trichocarpa]
Length=112

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 80/111 (72%), Gaps = 10/111 (9%)
 Frame = -3

Query  550  FVLIIRSVFNNLLLRST-FIRPSTSYF-----CLSPFDM----SDEEVVDQKKLYEDSCK  401
             + ++ SV N + L S+ F     S+F     C   F +    +DEE+VDQKK  EDSCK
Sbjct  2    LIPVLESVMNLICLHSSEFYFACHSFFMSYYGCACCFHLIKFRADEELVDQKKYLEDSCK  61

Query  400  PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            PKCV+ L EY+AC KRV+GDESGHKHCTGQYFDYW+CIDKCVAPKLF+KLK
Sbjct  62   PKCVKPLLEYEACVKRVEGDESGHKHCTGQYFDYWYCIDKCVAPKLFSKLK  112



>ref|XP_009604188.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Nicotiana tomentosiformis]
 ref|XP_009604189.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Nicotiana tomentosiformis]
Length=69

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEEVVD K   E +CKPKCVRQLKEYQAC++RV+GDESGHKHCTGQYFDYW CIDKCV
Sbjct  1    MSDEEVVDPKATLEVTCKPKCVRQLKEYQACSRRVEGDESGHKHCTGQYFDYWQCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFEKLK  69



>ref|XP_009788017.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Nicotiana sylvestris]
 ref|XP_009788018.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Nicotiana sylvestris]
Length=69

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEEVVD K   E +CKPKCVRQLKEYQAC +RV+GDESGHKHCTGQYFDYW CIDKCV
Sbjct  1    MSDEEVVDPKATLEVTCKPKCVRQLKEYQACTRRVEGDESGHKHCTGQYFDYWQCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFEKLK  69



>gb|KHF98934.1| Cytochrome b-c1 complex subunit 6 [Gossypium arboreum]
Length=118

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  466  SPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCI  287
            + F M+DEE VDQKK +ED CKPKCV+QL+ Y+AC KR+ GDESG+KHCTGQYFDYW C+
Sbjct  46   TSFAMADEEPVDQKKYFEDGCKPKCVKQLRSYEACVKRIQGDESGNKHCTGQYFDYWSCV  105

Query  286  DKCVAPKLFTKLK  248
            DKCVAP LFTKLK
Sbjct  106  DKCVAPSLFTKLK  118



>sp|P48504.2|QCR6_SOLTU RecName: Full=Cytochrome b-c1 complex subunit 6; AltName: Full=CR7; 
AltName: Full=Complex III subunit 6; AltName: Full=Complex 
III subunit VI; AltName: Full=Mitochondrial hinge protein; 
AltName: Full=Ubiquinol-cytochrome c reductase complex 
7.8 kDa protein [Solanum tuberosum]
 emb|CAA55860.1| ubiquinol--cytochrome c reductase [Solanum tuberosum]
Length=69

 Score =   124 bits (310),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEEVVD K   E SCKPKCVRQLKEYQAC KRV+GDESGHKHCTGQYFDYWHCIDKCV
Sbjct  1    MSDEEVVDPKATLEVSCKPKCVRQLKEYQACTKRVEGDESGHKHCTGQYFDYWHCIDKCV  60

Query  274  APKLFTKLK  248
            A KLF  LK
Sbjct  61   AAKLFDHLK  69



>ref|XP_009148897.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Brassica rapa]
Length=69

 Score =   123 bits (309),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEEVVD KK  E+SCKPKCV+ L EYQAC KR+ GDESGHKHCTGQYFDYWHCIDKCV
Sbjct  1    MADEEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDESGHKHCTGQYFDYWHCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFAKLK  69



>ref|XP_004247438.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Solanum lycopersicum]
 ref|XP_004247439.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Solanum lycopersicum]
 ref|XP_010326584.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Solanum lycopersicum]
Length=69

 Score =   123 bits (309),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEEVVD K   E SCKPKCVRQLKEYQAC KR++GDESGHKHCTGQYFDYWHCIDKCV
Sbjct  1    MSDEEVVDPKATLEVSCKPKCVRQLKEYQACTKRIEGDESGHKHCTGQYFDYWHCIDKCV  60

Query  274  APKLFTKLK  248
            A KLF  LK
Sbjct  61   AAKLFDHLK  69



>ref|XP_006359400.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X1 
[Solanum tuberosum]
 ref|XP_006359401.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X2 
[Solanum tuberosum]
Length=69

 Score =   122 bits (306),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEEVVD K   E SCKPKCVRQLK YQACAKR++GDESGHKHCTGQYFDYWHCIDKCV
Sbjct  1    MSDEEVVDPKATLEVSCKPKCVRQLKNYQACAKRIEGDESGHKHCTGQYFDYWHCIDKCV  60

Query  274  APKLFTKLK  248
            A KLF  LK
Sbjct  61   ALKLFDHLK  69



>ref|XP_010260923.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Nelumbo nucifera]
Length=69

 Score =   122 bits (306),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQKK +E+SCKPKCV+ L EYQAC KR+ GDE+GHKHCTGQYFDYW C+DKCV
Sbjct  1    MADEEPVDQKKYFEESCKPKCVKPLLEYQACVKRIQGDETGHKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            APKLFTKLK
Sbjct  61   APKLFTKLK  69



>emb|CDY67213.1| BnaA06g38290D [Brassica napus]
Length=78

 Score =   122 bits (305),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  460  FDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDK  281
            +  +DEEVVD KK  E+SCKPKCV+ L EYQAC KR+ GDESGHKHCTGQYFDYWHCIDK
Sbjct  8    YHRADEEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDESGHKHCTGQYFDYWHCIDK  67

Query  280  CVAPKLFTKLK  248
            CVAPKLF KLK
Sbjct  68   CVAPKLFAKLK  78



>ref|XP_006359398.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X1 
[Solanum tuberosum]
 ref|XP_006359399.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X2 
[Solanum tuberosum]
Length=69

 Score =   121 bits (303),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEEVVD K+  E SCKPKCVRQLK+YQAC +R++GDESG KHCTGQYFDYW CIDKCV
Sbjct  1    MSDEEVVDPKETMEVSCKPKCVRQLKDYQACTRRIEGDESGSKHCTGQYFDYWQCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFEKLK  69



>emb|CDY39613.1| BnaC05g11420D [Brassica napus]
Length=145

 Score =   123 bits (309),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            ++DEEVVD KK  E+SCKPKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYWHCIDKCV
Sbjct  77   VADEEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWHCIDKCV  136

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  137  APKLFAKLK  145



>ref|XP_007221592.1| hypothetical protein PRUPE_ppa017907mg [Prunus persica]
 gb|EMJ22791.1| hypothetical protein PRUPE_ppa017907mg [Prunus persica]
Length=121

 Score =   122 bits (307),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  460  FDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDK  281
            F M+DEE VDQKK  E+SCKPKCV+ L EYQAC KR+ GDESGHKHCTGQYFDYW C+DK
Sbjct  51   FCMADEEPVDQKKYLEESCKPKCVKPLLEYQACVKRIQGDESGHKHCTGQYFDYWSCVDK  110

Query  280  CVAPKLFTKLK  248
            CVAPKLF KLK
Sbjct  111  CVAPKLFPKLK  121



>ref|XP_010062124.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Eucalyptus 
grandis]
 ref|XP_010062125.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Eucalyptus 
grandis]
Length=69

 Score =   121 bits (303),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQKK +EDSCKPKCV+ L EY+AC KRV GDESGHKHCTGQYFDYW C+DKCV
Sbjct  1    MADEEPVDQKKYFEDSCKPKCVKPLLEYEACMKRVQGDESGHKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFPKLK  69



>ref|XP_009107099.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X1 
[Brassica rapa]
Length=101

 Score =   122 bits (305),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  469  LSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHC  290
            LS F M+D EVVD KK  E+SCKPKCV+ L EYQAC KRV GDESGHKHCTGQYFDYW C
Sbjct  28   LSNFTMADVEVVDPKKCLEESCKPKCVKPLLEYQACVKRVQGDESGHKHCTGQYFDYWQC  87

Query  289  IDKCVAPKLFTKLK  248
            +DKCV PKLF +LK
Sbjct  88   VDKCVGPKLFAELK  101



>ref|XP_004247441.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Solanum lycopersicum]
 ref|XP_010326585.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Solanum lycopersicum]
Length=69

 Score =   120 bits (302),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEEVVD K   E SCKPKCVRQLK+YQAC +R++GDESG KHCTGQYFDYW CIDKCV
Sbjct  1    MSDEEVVDPKATMEVSCKPKCVRQLKDYQACTRRIEGDESGSKHCTGQYFDYWQCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFEKLK  69



>gb|KFK33331.1| hypothetical protein AALP_AA5G000400 [Arabis alpina]
Length=162

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  469  LSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHC  290
            LS F M+DEE VDQKK  E+SCKPKCV+ L +YQAC KR+  DESG KHCTGQYFDYWHC
Sbjct  89   LSNFAMADEEAVDQKKCLEESCKPKCVKPLLDYQACVKRIQDDESGQKHCTGQYFDYWHC  148

Query  289  IDKCVAPKLFTKLK  248
            +DKCV PKLF KLK
Sbjct  149  VDKCVGPKLFAKLK  162



>ref|XP_002307493.1| ubiquinol-cytochrome C reductase complex 7.8 kDa family protein 
[Populus trichocarpa]
 gb|EEE94489.1| ubiquinol-cytochrome C reductase complex 7.8 kDa family protein 
[Populus trichocarpa]
Length=69

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VD KK  E++CKPKCVR L EYQAC KR+ GDESGHKHCTGQYFDYW C+DKCV
Sbjct  1    MADEEPVDPKKYLEEACKPKCVRPLLEYQACVKRIQGDESGHKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            APKLFTKLK
Sbjct  61   APKLFTKLK  69



>ref|XP_010030078.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Eucalyptus grandis]
 gb|KCW57039.1| hypothetical protein EUGRSUZ_I02701 [Eucalyptus grandis]
 gb|KCW57040.1| hypothetical protein EUGRSUZ_I02701 [Eucalyptus grandis]
Length=69

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQKK  E+ CKPKCV+ L EY+AC KR++GDESGHKHCTGQYFDYWHCIDKCV
Sbjct  1    MADEEPVDQKKYLEELCKPKCVKPLLEYKACVKRIEGDESGHKHCTGQYFDYWHCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFEKLK  69



>ref|XP_011042844.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X3 
[Populus euphratica]
Length=69

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+VDQKK  EDSC+PKCV+ L EY+AC KRV+GD+SGHKHCTGQYFDYW CIDKCV
Sbjct  1    MADEELVDQKKYLEDSCRPKCVKPLLEYEACVKRVEGDDSGHKHCTGQYFDYWFCIDKCV  60

Query  274  APKLFTKL  251
            APKLF+KL
Sbjct  61   APKLFSKL  68



>ref|XP_008218833.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Prunus mume]
 ref|XP_008218834.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Prunus mume]
 ref|XP_008218835.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Prunus mume]
Length=69

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQKK  E+SCKPKCV+ L EYQAC KR+ GDESGHKHCTGQYFDYW C+DKCV
Sbjct  1    MADEEPVDQKKYLEESCKPKCVKPLLEYQACVKRIQGDESGHKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFPKLK  69



>gb|AFK37870.1| unknown [Medicago truncatula]
Length=69

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VD KKL E+SCKPKCVR L EYQAC KR+ GD+SG KHCTGQYFDYW+C+DKCV
Sbjct  1    MADEEPVDPKKLLEESCKPKCVRPLLEYQACIKRIQGDDSGQKHCTGQYFDYWYCVDKCV  60

Query  274  APKLFTKLK  248
            APKLFTKLK
Sbjct  61   APKLFTKLK  69



>ref|XP_008456103.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Cucumis melo]
 ref|XP_008456104.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Cucumis melo]
Length=69

 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQK+  E++CKPKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYW CIDKCV
Sbjct  1    MADEEPVDQKRYLEEACKPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWSCIDKCV  60

Query  274  APKLFTKLK  248
            APKLFTKLK
Sbjct  61   APKLFTKLK  69



>ref|XP_009117845.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Brassica rapa]
Length=69

 Score =   119 bits (297),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+++EVVD KK  E+SCKPKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYWHCIDKCV
Sbjct  1    MAEDEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWHCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFAKLK  69



>emb|CDY52019.1| BnaA08g31320D [Brassica napus]
Length=91

 Score =   119 bits (299),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+EVVD KK  E+SC PKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYW CIDKCV
Sbjct  23   MADDEVVDPKKYLEESCNPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWQCIDKCV  82

Query  274  APKLFTKLK  248
            APKLFTKLK
Sbjct  83   APKLFTKLK  91



>ref|XP_006493299.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X2 
[Citrus sinensis]
 ref|XP_006493300.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X3 
[Citrus sinensis]
Length=69

 Score =   118 bits (296),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+VDQKK +E++CKPKCV+ L EYQAC KR+ GDESGHKHCTGQYFDYW CIDKCV
Sbjct  1    MADEELVDQKKYFEEACKPKCVKPLLEYQACVKRIQGDESGHKHCTGQYFDYWSCIDKCV  60

Query  274  APKLFTKLK  248
            A KLF KLK
Sbjct  61   AVKLFQKLK  69



>ref|XP_010241723.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Nelumbo nucifera]
Length=69

 Score =   118 bits (296),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE++DQKK  E+SCKPKCV+ L EYQAC KR+ GDE+GHKHCTGQYFDYW C+DKCV
Sbjct  1    MADEELIDQKKYLEESCKPKCVKSLLEYQACVKRIQGDETGHKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            A KLF KLK
Sbjct  61   ASKLFVKLK  69



>ref|XP_009110506.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Brassica rapa]
Length=69

 Score =   118 bits (295),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+EVVD KK  E+SC PKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYW CIDKCV
Sbjct  1    MADDEVVDPKKYLEESCNPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWQCIDKCV  60

Query  274  APKLFTKLK  248
            APKLFTKLK
Sbjct  61   APKLFTKLK  69



>ref|XP_003531564.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Glycine max]
 gb|ACU14641.1| unknown [Glycine max]
 gb|KHN26719.1| Cytochrome b-c1 complex subunit 6 [Glycine soja]
Length=69

 Score =   118 bits (295),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQK+  E+SCKPKCV+ L EYQAC KR+ GDESG KHCTGQYFDYW CIDKCV
Sbjct  1    MADEEPVDQKRYLEESCKPKCVKPLLEYQACIKRIHGDESGQKHCTGQYFDYWSCIDKCV  60

Query  274  APKLFTKLK  248
            APKLFTKLK
Sbjct  61   APKLFTKLK  69



>ref|NP_172964.1| ubiquinol-cytochrome C reductase hinge protein [Arabidopsis thaliana]
 dbj|BAE98555.1| ubiquinol-cytochrome-c reductase like protein [Arabidopsis thaliana]
 gb|ABI49495.1| At1g15120 [Arabidopsis thaliana]
 dbj|BAH57081.1| AT1G15120 [Arabidopsis thaliana]
 gb|AEE29267.1| ubiquinol-cytochrome C reductase hinge protein [Arabidopsis thaliana]
Length=69

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+EVVD KK  E+SCKPKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYW CIDKCV
Sbjct  1    MADDEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWQCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFAKLK  69



>ref|XP_002890088.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66347.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=69

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +D+EVVD KK  E+SCKPKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYWHCIDKCVA
Sbjct  2    ADDEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWHCIDKCVA  61

Query  271  PKLFTKLK  248
            PKLF KLK
Sbjct  62   PKLFAKLK  69



>gb|AES63375.2| cytochrome B-c1 complex subunit 6 [Medicago truncatula]
Length=122

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +DEE VD KKL E+SCKPKCVR L EYQAC KR+ GD+SG KHCTGQYFDYW+C+DKCVA
Sbjct  55   ADEEPVDPKKLLEESCKPKCVRPLLEYQACIKRIQGDDSGQKHCTGQYFDYWYCVDKCVA  114

Query  271  PKLFTKLK  248
            PKLFTKLK
Sbjct  115  PKLFTKLK  122



>ref|XP_006398494.1| hypothetical protein EUTSA_v10001040mg [Eutrema salsugineum]
 gb|ESQ39947.1| hypothetical protein EUTSA_v10001040mg [Eutrema salsugineum]
Length=183

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  469  LSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHC  290
            +S F M D EVVD KK  E+SCKPKCV+ L EYQAC KR+  DESGHKHCTGQYFDYWHC
Sbjct  110  ISNFTMEDVEVVDPKKCLEESCKPKCVKPLLEYQACVKRIQDDESGHKHCTGQYFDYWHC  169

Query  289  IDKCVAPKLFTKLK  248
            +DKCV PKLF KLK
Sbjct  170  VDKCVGPKLFEKLK  183



>gb|KGN57555.1| hypothetical protein Csa_3G212480 [Cucumis sativus]
Length=128

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            ++DEE VDQK+  E++CKPKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYW CIDKCV
Sbjct  60   LADEEPVDQKRYLEEACKPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWSCIDKCV  119

Query  274  APKLFTKLK  248
            APKL TKLK
Sbjct  120  APKLLTKLK  128



>emb|CDX83995.1| BnaC08g16500D [Brassica napus]
Length=82

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            ++D+EVVD KK  E+SC PKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYW CIDKCV
Sbjct  14   LADDEVVDPKKYLEESCNPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWQCIDKCV  73

Query  274  APKLFTKLK  248
            APKLFTKLK
Sbjct  74   APKLFTKLK  82



>gb|KDO42558.1| hypothetical protein CISIN_1g037428mg [Citrus sinensis]
Length=158

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = -3

Query  484  TSYFCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYF  305
             S+  L P + +DEE+VDQKK +E++CKPKCV+ L EYQAC KR+ GDESGHKHCTGQYF
Sbjct  81   VSFKVLCP-ERADEELVDQKKYFEEACKPKCVKPLLEYQACVKRIQGDESGHKHCTGQYF  139

Query  304  DYWHCIDKCVAPKLFTKLK  248
            DYW CIDKCVA KLF KLK
Sbjct  140  DYWSCIDKCVAVKLFQKLK  158



>ref|XP_004140689.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Cucumis sativus]
 ref|XP_004171340.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Cucumis sativus]
Length=69

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQK+  E++CKPKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYW CIDKCV
Sbjct  1    MADEEPVDQKRYLEEACKPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWSCIDKCV  60

Query  274  APKLFTKLK  248
            APKL TKLK
Sbjct  61   APKLLTKLK  69



>ref|XP_004287060.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Fragaria vesca 
subsp. vesca]
Length=69

 Score =   116 bits (291),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQKK  EDSCKPKCV+    YQ C KR+ GDESGHKHCTGQYFDYW C+DKCV
Sbjct  1    MADEEPVDQKKYLEDSCKPKCVKPFLHYQDCVKRIQGDESGHKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            APKLFTKLK
Sbjct  61   APKLFTKLK  69



>emb|CDY67181.1| BnaAnng23750D [Brassica napus]
Length=97

 Score =   117 bits (293),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +++EVVD KK  E+SCKPKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYWHCIDKCVA
Sbjct  30   AEDEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWHCIDKCVA  89

Query  271  PKLFTKLK  248
            PKLF KLK
Sbjct  90   PKLFAKLK  97



>ref|XP_007148445.1| hypothetical protein PHAVU_006G209400g [Phaseolus vulgaris]
 gb|ESW20439.1| hypothetical protein PHAVU_006G209400g [Phaseolus vulgaris]
Length=69

 Score =   116 bits (291),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQK+  EDSCKPKCV+ L EYQAC KR+ GDESG KHCTGQYFDYW CIDKCV
Sbjct  1    MADEEPVDQKRYLEDSCKPKCVKPLLEYQACIKRIHGDESGQKHCTGQYFDYWFCIDKCV  60

Query  274  APKLFTKLK  248
            AP+LF KLK
Sbjct  61   APRLFNKLK  69



>ref|XP_003547586.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Glycine max]
 gb|ACU15586.1| unknown [Glycine max]
 gb|KHN33494.1| Cytochrome b-c1 complex subunit 6 [Glycine soja]
Length=69

 Score =   116 bits (291),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQK+  E+SCKPKCV+ L EYQAC KR+ GD+SG KHCTGQYFDYW CIDKCV
Sbjct  1    MADEEPVDQKRYLEESCKPKCVKPLLEYQACIKRIHGDDSGQKHCTGQYFDYWSCIDKCV  60

Query  274  APKLFTKLK  248
            APKLFTKLK
Sbjct  61   APKLFTKLK  69



>ref|XP_003593124.1| Cytochrome b-c1 complex subunit [Medicago truncatula]
Length=154

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +DEE VD KKL E+SCKPKCVR L EYQAC KR+ GD+SG KHCTGQYFDYW+C+DKCVA
Sbjct  87   ADEEPVDPKKLLEESCKPKCVRPLLEYQACIKRIQGDDSGQKHCTGQYFDYWYCVDKCVA  146

Query  271  PKLFTKLK  248
            PKLFTKLK
Sbjct  147  PKLFTKLK  154



>gb|KHG15128.1| Cytochrome b-c1 complex subunit 6 [Gossypium arboreum]
Length=69

 Score =   116 bits (291),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQKK  E+ CKPKCV+QL+ Y+AC KR++GDESGHKHCTGQYFDYW CIDKCV
Sbjct  1    MADEEPVDQKKYLEEGCKPKCVKQLRAYEACVKRIEGDESGHKHCTGQYFDYWACIDKCV  60

Query  274  APKLFTKLK  248
            A  LF+KLK
Sbjct  61   AQTLFSKLK  69



>ref|XP_011044295.1| PREDICTED: uncharacterized protein LOC105139521 [Populus euphratica]
Length=169

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 71/102 (70%), Gaps = 6/102 (6%)
 Frame = -3

Query  541  IIRSVFNNLLLRSTFIRPSTSYFCLSP----FDMSDEEVVDQKKLYEDSCKPKCVRQLKE  374
            I R +   +  R+  I P  S   L P       +DEE+VDQKK  EDSCKPKCV+ L E
Sbjct  70   IRRGIIFKIEQRT--ITPPISVISLPPPLTVTKRADEELVDQKKYLEDSCKPKCVKPLLE  127

Query  373  YQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            Y+AC KRV+GDESG KHCTGQYFDYW CIDKCVAPKL +KLK
Sbjct  128  YEACVKRVEGDESGQKHCTGQYFDYWFCIDKCVAPKLLSKLK  169


 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKC  278
            +DEE VD KK  E++CKPKCVR L EYQAC KR+ GDESGHKHCTGQYFDYW C+DKC
Sbjct  9    ADEEPVDPKKYLEEACKPKCVRPLLEYQACVKRIQGDESGHKHCTGQYFDYWSCVDKC  66



>ref|XP_010496855.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Camelina sativa]
Length=69

 Score =   115 bits (289),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+EVVD KK  E+SCKPKCV+ L EYQAC KR+ GD+SGH HCTGQYFDY+HCIDKCV
Sbjct  1    MADDEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDDSGHMHCTGQYFDYYHCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFAKLK  69



>gb|AAM63085.1| putative ubiquinol--cytochrome-c reductase [Arabidopsis thaliana]
Length=69

 Score =   115 bits (289),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+EVVD KK  E+SCKPKCV+ L EYQAC KR+  D+SGHKHCTGQYFDYW CIDKCV
Sbjct  1    MADDEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQSDDSGHKHCTGQYFDYWQCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFAKLK  69



>ref|XP_009107100.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X2 
[Brassica rapa]
Length=69

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D EVVD KK  E+SCKPKCV+ L EYQAC KRV GDESGHKHCTGQYFDYW C+DKCV
Sbjct  1    MADVEVVDPKKCLEESCKPKCVKPLLEYQACVKRVQGDESGHKHCTGQYFDYWQCVDKCV  60

Query  274  APKLFTKLK  248
             PKLF +LK
Sbjct  61   GPKLFAELK  69



>ref|XP_002300923.2| hypothetical protein POPTR_0002s06980g [Populus trichocarpa]
 gb|EEE80196.2| hypothetical protein POPTR_0002s06980g [Populus trichocarpa]
Length=210

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +DEE VD KK  E+SCKPKCVR L EYQAC KR+ GDE+GHKHCTGQYFDYW C+DKCVA
Sbjct  143  ADEEPVDPKKYLEESCKPKCVRPLLEYQACVKRIQGDETGHKHCTGQYFDYWSCVDKCVA  202

Query  271  PKLFTKLK  248
             KLF+KLK
Sbjct  203  LKLFSKLK  210



>ref|XP_004485537.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Cicer arietinum]
Length=69

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQK+  EDSCKPKCV+ L EYQAC KR+ GDE+G KHCTGQYFDYW CIDKCV
Sbjct  1    MADEEPVDQKRYLEDSCKPKCVKPLLEYQACVKRIQGDETGQKHCTGQYFDYWACIDKCV  60

Query  274  APKLFTKLK  248
            A KLF+KLK
Sbjct  61   ATKLFSKLK  69



>ref|XP_004485535.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Cicer arietinum]
Length=69

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQK+  E+SCKPKCV+ L EYQAC KR+ GD+SG KHCTGQYFDYW+C+DKCV
Sbjct  1    MADEEPVDQKRYLEESCKPKCVKPLLEYQACVKRIHGDDSGQKHCTGQYFDYWYCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFVKLK  69



>ref|XP_006303490.1| hypothetical protein CARUB_v10010817mg [Capsella rubella]
 gb|EOA36388.1| hypothetical protein CARUB_v10010817mg [Capsella rubella]
Length=69

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+EVVD KK  E+SCKPKCV+ L EYQAC KR+ GD+SGHKHCTGQYFD+W CIDKCV
Sbjct  1    MADDEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDFWFCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KL+
Sbjct  61   APKLFAKLR  69



>emb|CDX81698.1| BnaC08g39030D [Brassica napus]
Length=95

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +++EVVD KK  E+SCKPKCV+ L EYQAC KR+  D+SGHKHCTGQYFDYWHCIDKCVA
Sbjct  28   AEDEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQSDDSGHKHCTGQYFDYWHCIDKCVA  87

Query  271  PKLFTKLK  248
            PKLF KLK
Sbjct  88   PKLFAKLK  95



>emb|CDY40404.1| BnaA02g27180D [Brassica napus]
Length=115

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            ++D EVVD KK  E+SCKPKCV+ L EYQAC KRV GDESGHKHCTGQYFDYW C+DKCV
Sbjct  47   LADVEVVDPKKCLEESCKPKCVKPLLEYQACVKRVQGDESGHKHCTGQYFDYWQCVDKCV  106

Query  274  APKLFTKLK  248
             PKLF +LK
Sbjct  107  GPKLFAELK  115



>ref|XP_008339311.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Malus domestica]
Length=69

 Score =   114 bits (286),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQK   E+ CKPKCV+ L EYQAC KR+ GDE+GHKHCTGQYFD+W CIDKCV
Sbjct  1    MADEEPVDQKNYLEEXCKPKCVKPLLEYQACVKRIQGDETGHKHCTGQYFDFWSCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFQKLK  69



>ref|XP_002307492.1| hypothetical protein POPTR_0005s21320g [Populus trichocarpa]
 gb|EEE94488.1| hypothetical protein POPTR_0005s21320g [Populus trichocarpa]
Length=69

 Score =   114 bits (285),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+VDQKK  EDSCKPKCV+ L EY+AC KRV+GD++  KHCTGQYFDYW CIDKCV
Sbjct  1    MADEELVDQKKYLEDSCKPKCVKPLLEYEACVKRVEGDDTSQKHCTGQYFDYWFCIDKCV  60

Query  274  APKLFTKLK  248
            APKL +KLK
Sbjct  61   APKLLSKLK  69



>gb|AFK40779.1| unknown [Lotus japonicus]
Length=69

 Score =   113 bits (283),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VD K   E+SCKPKCV+ L EYQAC KR+ GDE+G KHCTGQYFDYW C+DKCV
Sbjct  1    MADEEPVDPKGYLEESCKPKCVKPLLEYQACVKRIHGDETGQKHCTGQYFDYWACVDKCV  60

Query  274  APKLFTKLK  248
            APKLFTKLK
Sbjct  61   APKLFTKLK  69



>ref|XP_011042840.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Populus euphratica]
Length=69

 Score =   113 bits (282),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VD KK  E+SCKPKCV+ L EYQAC KR+ GDE+GHKHCTGQYFDYW C+DKCV
Sbjct  1    MADEEPVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDETGHKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            A KLF+KLK
Sbjct  61   ALKLFSKLK  69



>ref|XP_008806786.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Phoenix dactylifera]
 ref|XP_008806787.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Phoenix dactylifera]
Length=69

 Score =   113 bits (282),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE +DQKK  E+SCKPKCVR L+ YQAC +R+ GDE GHKHCTGQYFDYW CID CV
Sbjct  1    MADEEPIDQKKYLEESCKPKCVRPLRAYQACIERIKGDEMGHKHCTGQYFDYWSCIDNCV  60

Query  274  APKLFTKLK  248
            APKL  +LK
Sbjct  61   APKLLGRLK  69



>ref|XP_007041603.1| Ubiquinol-cytochrome C reductase hinge protein [Theobroma cacao]
 gb|EOX97434.1| Ubiquinol-cytochrome C reductase hinge protein [Theobroma cacao]
Length=69

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DE+ VDQKK  E++CKPKCV+ L  YQ C KR+ GDESGHKHCTGQYFDYW C+DKCV
Sbjct  1    MADEDPVDQKKYLEEACKPKCVKPLLAYQECVKRIQGDESGHKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF++LK
Sbjct  61   APKLFSELK  69



>ref|XP_008378799.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Malus domestica]
 ref|XP_008378801.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Malus domestica]
 ref|XP_008347880.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Malus domestica]
 ref|XP_008347881.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Malus domestica]
Length=69

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQKK  E+SCKPKCV+   EYQAC KR+  D+SGHKHCTGQYFD+W CIDKCV
Sbjct  1    MADEEPVDQKKYLEESCKPKCVKPFLEYQACVKRIQDDDSGHKHCTGQYFDFWSCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFPKLK  69



>ref|XP_009354067.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Pyrus x bretschneideri]
Length=69

 Score =   112 bits (280),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VDQKK  E+ CKPKCV+ L EYQAC KR+  DE+GHKHCTGQYFD+W CIDKCV
Sbjct  1    MADEEPVDQKKYLEELCKPKCVKPLLEYQACVKRIQDDETGHKHCTGQYFDFWSCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFQKLK  69



>ref|XP_002269910.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Vitis vinifera]
 ref|XP_010665122.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Vitis vinifera]
Length=69

 Score =   112 bits (280),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VD KK  E+SCKPKCVR L+ Y+AC  RV  DE+GHKHCTGQYFDYW C+DKCV
Sbjct  1    MADEEPVDPKKYLEESCKPKCVRYLRAYEACENRVKEDETGHKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            AP+LFTKLK
Sbjct  61   APRLFTKLK  69



>emb|CBI18191.3| unnamed protein product [Vitis vinifera]
Length=110

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -3

Query  463  PFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCID  284
            P   +DEE VD KK  E+SCKPKCVR L+ Y+AC  RV  DE+GHKHCTGQYFDYW C+D
Sbjct  39   PGVRADEEPVDPKKYLEESCKPKCVRYLRAYEACENRVKEDETGHKHCTGQYFDYWSCVD  98

Query  283  KCVAPKLFTKLK  248
            KCVAP+LFTKLK
Sbjct  99   KCVAPRLFTKLK  110



>emb|CDY37339.1| BnaC02g33570D [Brassica napus]
Length=83

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  481  SYFCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFD  302
            + +C S    +D EVVD KK  E+SCKPKCV+ L EYQAC KRV GDESGHKHCTGQYFD
Sbjct  5    TIWCDSDDYRADVEVVDPKKCLEESCKPKCVKPLLEYQACVKRVQGDESGHKHCTGQYFD  64

Query  301  YWHCIDKCVAPKLFTKLK  248
            YW C+DKCV PKLF +LK
Sbjct  65   YWQCVDKCVGPKLFAELK  82



>ref|XP_009384206.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=82

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VD K+  ED+CKPKCVR L+ YQAC KR+ GDE+GHKHCTGQYFDYW CID+CV
Sbjct  14   MADEEPVDPKQYLEDTCKPKCVRPLRAYQACVKRIKGDETGHKHCTGQYFDYWKCIDECV  73

Query  274  APKLFTKLK  248
            A KLF KLK
Sbjct  74   ALKLFDKLK  82



>ref|XP_006854530.1| hypothetical protein AMTR_s00030p00033750 [Amborella trichopoda]
 gb|ERN15997.1| hypothetical protein AMTR_s00030p00033750 [Amborella trichopoda]
Length=86

 Score =   112 bits (279),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +DEE+VD K+  E+SCKPKCV+ L EYQAC KR+ GDE+GHKHCTGQYFDYW C+DKCVA
Sbjct  19   ADEELVDPKQYLEESCKPKCVKPLLEYQACVKRIQGDETGHKHCTGQYFDYWSCVDKCVA  78

Query  271  PKLFTKLK  248
             KLF+KLK
Sbjct  79   SKLFSKLK  86



>ref|XP_009388898.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Musa acuminata 
subsp. malaccensis]
Length=69

 Score =   111 bits (277),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+ D KK  EDSCKPKC R L  YQAC +R+ GDESGHKHCTGQYFDY+ C+D CV
Sbjct  1    MADEELADPKKYLEDSCKPKCARPLHAYQACVRRIKGDESGHKHCTGQYFDYFSCVDNCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFPKLK  69



>ref|XP_009384207.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009384208.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009384209.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=69

 Score =   111 bits (277),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VD K+  ED+CKPKCVR L+ YQAC KR+ GDE+GHKHCTGQYFDYW CID+CV
Sbjct  1    MADEEPVDPKQYLEDTCKPKCVRPLRAYQACVKRIKGDETGHKHCTGQYFDYWKCIDECV  60

Query  274  APKLFTKLK  248
            A KLF KLK
Sbjct  61   ALKLFDKLK  69



>ref|XP_009343625.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Pyrus x bretschneideri]
 ref|XP_009343626.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Pyrus x bretschneideri]
Length=69

 Score =   110 bits (276),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+VDQKK  E+SC+PKCV+ L EYQAC KRV+GD+ G KHCTGQYFDY  C+DKCV
Sbjct  1    MADEELVDQKKYLEESCRPKCVKPLIEYQACVKRVEGDDGGDKHCTGQYFDYISCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFQKLK  69



>ref|XP_008339110.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Malus domestica]
 ref|XP_009368503.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Pyrus x bretschneideri]
Length=69

 Score =   110 bits (276),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+E+VDQKK  E+SC+PKCV+ L EYQAC KRV+GD++G+KHCTGQYFDY  C+DKCV
Sbjct  1    MADDELVDQKKYLEESCQPKCVKPLIEYQACVKRVEGDDTGNKHCTGQYFDYISCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFQKLK  69



>ref|XP_002450330.1| hypothetical protein SORBIDRAFT_05g003875 [Sorghum bicolor]
 gb|EES09318.1| hypothetical protein SORBIDRAFT_05g003875 [Sorghum bicolor]
Length=68

 Score =   110 bits (275),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
             DEE+VDQKK  E+ CKP+CV+ L EY+ C KRV+ DE+GHKHCTGQYFDYW CIDKCVA
Sbjct  1    EDEELVDQKKYLEERCKPQCVKSLYEYEKCVKRVESDETGHKHCTGQYFDYWSCIDKCVA  60

Query  271  PKLFTKLK  248
            PKLF KLK
Sbjct  61   PKLFKKLK  68



>ref|XP_008381816.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Malus domestica]
Length=69

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+VDQKK  E+SC+PKCV+ L EYQAC KRV+GD  G KHCTGQYFDY  C+DKCV
Sbjct  1    MADEELVDQKKYLEESCQPKCVKPLIEYQACVKRVEGDNGGDKHCTGQYFDYISCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFQKLK  69



>ref|XP_011087825.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Sesamum indicum]
Length=69

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+E VD KK  ED CK  C R LKEYQACAKR+ GDESGHKHCTGQYFDYW C+DKCV
Sbjct  1    MADDEPVDPKKELEDRCKAPCTRPLKEYQACAKRIQGDESGHKHCTGQYFDYWRCVDKCV  60

Query  274  APKLFTKLK  248
            A KLF+ LK
Sbjct  61   ATKLFSYLK  69



>ref|XP_004978758.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Setaria italica]
Length=69

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M DEE+VDQKK  E+ CKP+CV+ L EY+ C KRV+ D++GHKHCTGQYFDYW CIDKCV
Sbjct  1    MEDEELVDQKKYLEERCKPQCVKSLYEYEKCVKRVENDDTGHKHCTGQYFDYWACIDKCV  60

Query  274  APKLFTKLK  248
            APKL  KLK
Sbjct  61   APKLLKKLK  69



>gb|EYU35416.1| hypothetical protein MIMGU_mgv1a024165mg, partial [Erythranthe 
guttata]
Length=112

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 67/101 (66%), Gaps = 4/101 (4%)
 Frame = -3

Query  550  FVLIIRSVFNNLLLRSTFIRPSTSYFCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEY  371
            F+L I ++     L  +    S SY       M+D+E VD K+  ED CK  C R LKEY
Sbjct  16   FLLTISTLTPPQTLIPSGCFRSISYV----LTMADDEPVDPKRELEDRCKAPCTRPLKEY  71

Query  370  QACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            +ACAKR+DGD+SGHKHCTGQYFDYW C+DKC A KLF+ LK
Sbjct  72   KACAKRIDGDDSGHKHCTGQYFDYWRCVDKCAASKLFSHLK  112



>gb|ACG38059.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein [Zea 
mays]
 gb|AFW65613.1| ubiquinol-cytochrome c reductase complex protein [Zea mays]
Length=69

 Score =   108 bits (270),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M DEE+VDQKK  E+ CKP+CV+ L EY+ C KRV+ D++GHKHCTGQYFDYW CIDKCV
Sbjct  1    MEDEELVDQKKYLEERCKPQCVKSLYEYEKCVKRVENDDTGHKHCTGQYFDYWSCIDKCV  60

Query  274  APKLFTKLK  248
            A KLF KLK
Sbjct  61   ASKLFKKLK  69



>ref|XP_010030934.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Eucalyptus 
grandis]
Length=71

 Score =   108 bits (269),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +DEE+VD KK  E  CKPKCV+ L EY+AC KRV+GDESGHKHCTGQYFDY HCID CVA
Sbjct  4    ADEELVDMKKYLEGLCKPKCVKPLLEYKACVKRVEGDESGHKHCTGQYFDYRHCIDNCVA  63

Query  271  PKLFTKLK  248
             KLF KLK
Sbjct  64   TKLFEKLK  71



>ref|XP_009399211.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Musa acuminata 
subsp. malaccensis]
Length=69

 Score =   107 bits (268),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VD K+  E++CKPKCVR L+ YQAC +R+ GDE+GHKHCTGQYFDYW C+D CV
Sbjct  1    MADEEPVDPKQYLEETCKPKCVRPLRAYQACVERIKGDETGHKHCTGQYFDYWKCVDDCV  60

Query  274  APKLFTKLK  248
            A KLF KLK
Sbjct  61   ALKLFVKLK  69



>ref|XP_011042841.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X1 
[Populus euphratica]
Length=92

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 62/91 (68%), Gaps = 23/91 (25%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQ-----------------------ACAKRVDG  344
            M+DEE+VDQKK  EDSC+PKCV+ L EY+                       AC KRV+G
Sbjct  1    MADEELVDQKKYLEDSCRPKCVKPLLEYEELKEMTLLIVLCGTSSVWGREMSACVKRVEG  60

Query  343  DESGHKHCTGQYFDYWHCIDKCVAPKLFTKL  251
            D+SGHKHCTGQYFDYW CIDKCVAPKLF+KL
Sbjct  61   DDSGHKHCTGQYFDYWFCIDKCVAPKLFSKL  91



>ref|XP_008237594.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Prunus mume]
Length=69

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+VDQKK  E+SC+PKCV+ L EYQAC KRV+ D +G KHCTGQYFDY  C+DKCV
Sbjct  1    MADEELVDQKKYLEESCQPKCVKPLIEYQACVKRVEADNNGEKHCTGQYFDYISCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF  LK
Sbjct  61   APKLFGALK  69



>gb|KDO83701.1| hypothetical protein CISIN_1g034047mg [Citrus sinensis]
Length=105

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+ D KK  E++CKPKCV+ L EY+AC KR++ D++G KHCTGQYFDY  C+DKCV
Sbjct  37   MADEEIADPKKYLEEACKPKCVKSLIEYEACIKRIEADDTGSKHCTGQYFDYLSCVDKCV  96

Query  274  APKLFTKLK  248
            APKLFT+LK
Sbjct  97   APKLFTQLK  105



>ref|XP_006473042.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X1 
[Citrus sinensis]
Length=105

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+ D KK  E++CKPKCV+ L EY+AC KR++ D++G KHCTGQYFDY  C+DKCV
Sbjct  37   MADEEIADPKKYLEEACKPKCVKSLIEYEACIKRIEADDTGSKHCTGQYFDYLSCVDKCV  96

Query  274  APKLFTKLK  248
            APKLFT+LK
Sbjct  97   APKLFTQLK  105



>ref|XP_006434444.1| hypothetical protein CICLE_v10002923mg [Citrus clementina]
 gb|ESR47684.1| hypothetical protein CICLE_v10002923mg [Citrus clementina]
Length=105

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = -3

Query  532  SVFNNLLLRSTFIRPSTSYFCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKR  353
            SV   +   ST    S   F ++   M+DEE+ D KK  E++CKPKCV+ L EY+AC KR
Sbjct  11   SVIGLVQETSTCALNSIQLFHIAFNPMADEEIADPKKYLEEACKPKCVKSLIEYEACVKR  70

Query  352  VDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            ++ D++G KHCTGQYFDY  C+DKCVAPKLF +LK
Sbjct  71   IEADDTGSKHCTGQYFDYLSCVDKCVAPKLFIQLK  105



>gb|EPS66329.1| hypothetical protein M569_08449, partial [Genlisea aurea]
Length=68

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +D+E  D KK  ED CK  C R LKEYQACAKR+ GDESGHKHCTGQYFDYW C+DKCVA
Sbjct  1    ADDEAADPKKELEDRCKAPCTRPLKEYQACAKRIQGDESGHKHCTGQYFDYWRCVDKCVA  60

Query  271  PKLFTKLK  248
             KLF+ LK
Sbjct  61   TKLFSYLK  68



>ref|XP_004308600.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Fragaria vesca 
subsp. vesca]
Length=83

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  445  EEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPK  266
            +E VDQKK  EDSC+PKCV+ L EYQAC KR++GD+SG+KHCTGQYFDY  C+DKCVAPK
Sbjct  18   DEDVDQKKYLEDSCQPKCVKPLIEYQACVKRIEGDDSGYKHCTGQYFDYISCVDKCVAPK  77

Query  265  LFTKLK  248
            LF KLK
Sbjct  78   LFGKLK  83



>ref|XP_010680587.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Beta vulgaris subsp. 
vulgaris]
Length=70

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDS-CKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKC  278
            M+DEE VD K+  E+S CKPKCV+ L +YQAC KR+  DESGHKHCTGQYFDYW CIDKC
Sbjct  1    MADEEPVDPKREIEESICKPKCVKPLLDYQACIKRIKDDESGHKHCTGQYFDYWSCIDKC  60

Query  277  VAPKLFTKLK  248
            VAP+LF KLK
Sbjct  61   VAPRLFAKLK  70



>ref|XP_006473043.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X2 
[Citrus sinensis]
 ref|XP_006473044.1| PREDICTED: cytochrome b-c1 complex subunit 6-like isoform X3 
[Citrus sinensis]
Length=69

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+ D KK  E++CKPKCV+ L EY+AC KR++ D++G KHCTGQYFDY  C+DKCV
Sbjct  1    MADEEIADPKKYLEEACKPKCVKSLIEYEACIKRIEADDTGSKHCTGQYFDYLSCVDKCV  60

Query  274  APKLFTKLK  248
            APKLFT+LK
Sbjct  61   APKLFTQLK  69



>gb|AFW65608.1| hypothetical protein ZEAMMB73_969846 [Zea mays]
 gb|AFW65609.1| hypothetical protein ZEAMMB73_969846 [Zea mays]
Length=71

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
             DEE+VDQKK  E+ CKP+CV+ L EY+ C KRV+ D++GHKHCTGQYFDYW CIDKCVA
Sbjct  4    EDEELVDQKKYLEERCKPQCVKSLYEYEKCVKRVENDDTGHKHCTGQYFDYWSCIDKCVA  63

Query  271  PKLFTKLK  248
             KLF KLK
Sbjct  64   SKLFKKLK  71



>ref|XP_007200654.1| hypothetical protein PRUPE_ppa014447mg [Prunus persica]
 gb|EMJ01853.1| hypothetical protein PRUPE_ppa014447mg [Prunus persica]
Length=69

 Score =   105 bits (263),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+VDQKK  E+SC+PKCV+ L EYQAC KRV+ D +G KHCTGQYFDY  C+DKCV
Sbjct  1    MADEELVDQKKYLEESCQPKCVKPLIEYQACVKRVEADNNGEKHCTGQYFDYISCVDKCV  60

Query  274  APKLFTKLK  248
            AP LF  LK
Sbjct  61   APMLFGALK  69



>gb|EYU18522.1| hypothetical protein MIMGU_mgv1a017873mg, partial [Erythranthe 
guttata]
Length=68

 Score =   105 bits (262),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            SDEE VD K+  ED CK  C R LKEYQACAKR+  DESGHKHCTGQYFDYW C+DKCVA
Sbjct  1    SDEEPVDPKRELEDRCKAPCTRPLKEYQACAKRIKDDESGHKHCTGQYFDYWRCVDKCVA  60

Query  271  PKLFTKLK  248
             KLF  LK
Sbjct  61   TKLFAHLK  68



>ref|XP_007019478.1| Ubiquinol-cytochrome C reductase hinge protein [Theobroma cacao]
 gb|EOY16703.1| Ubiquinol-cytochrome C reductase hinge protein [Theobroma cacao]
Length=69

 Score =   105 bits (262),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE  DQKK  ED CK +C + + +Y  CAKRV GDESG KHCTGQYFDYW C+DKCV
Sbjct  1    MADEEPTDQKKYLEDICKSQCAKPMHDYGECAKRVSGDESGSKHCTGQYFDYWTCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFAKLK  69



>ref|NP_001065827.1| Os11g0162200 [Oryza sativa Japonica Group]
 dbj|BAF27672.1| Os11g0162200 [Oryza sativa Japonica Group]
Length=69

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VD KK  E+ CKP+CV+ L EY+ C KRV+ D++GHKHCTGQYFDYW CIDKCV
Sbjct  1    MADEEPVDPKKYLEERCKPQCVKPLYEYEKCVKRVEKDDTGHKHCTGQYFDYWSCIDKCV  60

Query  274  APKLFTKLK  248
            APKL  KLK
Sbjct  61   APKLLEKLK  69



>gb|EPS61533.1| hypothetical protein M569_13266, partial [Genlisea aurea]
Length=67

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAP  269
            DEE VD K   ED CK  C R LKEYQAC+KR++GD+SGHKHCTGQYFDYW C+DKCVA 
Sbjct  1    DEEAVDPKNELEDRCKAPCTRPLKEYQACSKRIEGDDSGHKHCTGQYFDYWRCVDKCVAT  60

Query  268  KLFTKLK  248
            KLF+ LK
Sbjct  61   KLFSFLK  67



>ref|NP_001154342.1| ubiquinol-cytochrome C reductase hinge protein [Arabidopsis thaliana]
 gb|AEE29268.1| ubiquinol-cytochrome C reductase hinge protein [Arabidopsis thaliana]
Length=166

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 63/91 (69%), Gaps = 7/91 (8%)
 Frame = -3

Query  529  VFNNLL--LRSTFIRP----STSYFCLS-PFDMSDEEVVDQKKLYEDSCKPKCVRQLKEY  371
            VFN LL  L   F       S S F     F+M+D+EVVD KK  E+SCKPKCV+ L EY
Sbjct  36   VFNGLLKVLLPCFFESRSPLSISVFSFQLTFNMADDEVVDPKKYLEESCKPKCVKPLLEY  95

Query  370  QACAKRVDGDESGHKHCTGQYFDYWHCIDKC  278
            QAC KR+ GD+SGHKHCTGQYFDYW CIDKC
Sbjct  96   QACVKRIQGDDSGHKHCTGQYFDYWQCIDKC  126



>ref|XP_004298236.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Fragaria vesca 
subsp. vesca]
Length=81

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+E VDQKK  E+ CKPKCV+   +YQAC +R+ GD SGH HCTGQYFD+W C+DKCV
Sbjct  13   MADKEHVDQKKYLEEFCKPKCVKPFLQYQACLQRIQGDASGHMHCTGQYFDHWSCVDKCV  72

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  73   APKLFEKLK  81



>ref|XP_003578875.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Brachypodium 
distachyon]
Length=69

 Score =   103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+E VDQK   E+ CKP+CV+ L EY+ C KRV+ DESG KHCTGQ+FDYW C+DKCV
Sbjct  1    MADDEPVDQKNYLEERCKPQCVKPLYEYERCVKRVENDESGQKHCTGQFFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF +LK
Sbjct  61   APKLFEQLK  69



>ref|NP_178219.1| ubiquinol-cytochrome c reductase hinge protein [Arabidopsis thaliana]
 ref|NP_001189492.1| ubiquinol-cytochrome c reductase hinge protein [Arabidopsis thaliana]
 gb|AAK25930.1|AF360220_1 putative ubiquinol-cytochrome c reductase [Arabidopsis thaliana]
 gb|AAF18657.1| putative ubiquinol-cytochrome c reductase [Arabidopsis thaliana]
 gb|AAK64121.1| putative ubiquinol-cytochrome c reductase [Arabidopsis thaliana]
 gb|AEC05397.1| ubiquinol-cytochrome c reductase hinge protein [Arabidopsis thaliana]
 gb|AEC05398.1| ubiquinol-cytochrome c reductase hinge protein [Arabidopsis thaliana]
Length=62

 Score =   103 bits (257),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M +E+VVDQK+ +E+SCKPKCV+ L EYQAC KR+  DESGHKHCTGQYFDYWHC+DKCV
Sbjct  1    MPEEDVVDQKRYFEESCKPKCVKPLLEYQACVKRIQDDESGHKHCTGQYFDYWHCVDKCV  60

Query  274  A  272
            +
Sbjct  61   S  61



>ref|XP_006416942.1| hypothetical protein EUTSA_v10009667mg, partial [Eutrema salsugineum]
 gb|ESQ35295.1| hypothetical protein EUTSA_v10009667mg, partial [Eutrema salsugineum]
Length=109

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+EVVD KK  E+SCKPKCV+ L  YQAC KR+ GD+SGHKHCTGQYFDYWHCIDKCV
Sbjct  22   MADDEVVDPKKYLEESCKPKCVKPLLSYQACVKRIQGDDSGHKHCTGQYFDYWHCIDKCV  81

Query  274  A  272
            +
Sbjct  82   S  82



>ref|XP_001752758.1| predicted protein [Physcomitrella patens]
 gb|EDQ82262.1| predicted protein [Physcomitrella patens]
Length=67

 Score =   103 bits (256),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAP  269
            +EEVVD K   E+SCKPKCV+QL   QAC KRV+ DE G KHCTGQYFDYW CIDKC AP
Sbjct  1    EEEVVDPKAEIEESCKPKCVKQLLALQACEKRVEEDEEGQKHCTGQYFDYWGCIDKCTAP  60

Query  268  KLFTKLK  248
            KLF KLK
Sbjct  61   KLFRKLK  67



>ref|XP_010237909.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Brachypodium 
distachyon]
Length=69

 Score =   103 bits (256),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VD KK  E+ CKP+CV+ L EY+ C KRV+ D++GHKHCTGQYFDY  CIDKCV
Sbjct  1    MADEEPVDPKKYLEERCKPQCVKPLYEYERCVKRVESDDTGHKHCTGQYFDYLSCIDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFEKLK  69



>gb|ABK20928.1| unknown [Picea sitchensis]
 gb|ABK20959.1| unknown [Picea sitchensis]
 gb|ABK21392.1| unknown [Picea sitchensis]
 gb|ABK23840.1| unknown [Picea sitchensis]
 gb|ABK25640.1| unknown [Picea sitchensis]
 gb|ABR16300.1| unknown [Picea sitchensis]
Length=69

 Score =   103 bits (256),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEE VD K   E+SCKPKCV+ L +YQAC KR++ DE+GHKHCTGQYFDYW C+D C 
Sbjct  1    MSDEEPVDPKHEIEESCKPKCVKPLLQYQACVKRIEEDETGHKHCTGQYFDYWRCVDTCA  60

Query  274  APKLFTKLK  248
            A K+F KLK
Sbjct  61   AHKIFEKLK  69



>gb|KFK43768.1| hypothetical protein AALP_AA1G170400 [Arabis alpina]
Length=132

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 55/69 (80%), Gaps = 6/69 (9%)
 Frame = -3

Query  460  FDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQ------ACAKRVDGDESGHKHCTGQYFDY  299
            F M+DEEVVD KK  E+SCKPKCV+ L EYQ      AC KR+ GD+SGHKHCTGQYFDY
Sbjct  6    FSMADEEVVDPKKYLEESCKPKCVKPLLEYQSCCDSQACVKRIQGDDSGHKHCTGQYFDY  65

Query  298  WHCIDKCVA  272
            WHCIDKCV+
Sbjct  66   WHCIDKCVS  74



>ref|XP_008781398.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Phoenix dactylifera]
Length=69

 Score =   102 bits (255),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D+E+VD KK  E+ C+P+CV+ L EY+ C KR+  DE+GHKHCTGQYFDYW CIDKCV
Sbjct  1    MADDELVDPKKYLEERCQPRCVKALYEYRECVKRIKDDETGHKHCTGQYFDYWKCIDKCV  60

Query  274  APKLFTKLK  248
            A KLF KLK
Sbjct  61   AEKLFDKLK  69



>gb|EAY80071.1| hypothetical protein OsI_35238 [Oryza sativa Indica Group]
 gb|EEE51704.1| hypothetical protein OsJ_33084 [Oryza sativa Japonica Group]
Length=88

 Score =   103 bits (256),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +DEE VD KK  E+ CKP+CV+ L EY+ C KRV+ D++GHKHCTGQYFDYW CIDKCVA
Sbjct  21   ADEEPVDPKKYLEERCKPQCVKPLYEYEKCVKRVEKDDTGHKHCTGQYFDYWSCIDKCVA  80

Query  271  PKLFTKLK  248
            PKL  KLK
Sbjct  81   PKLLEKLK  88



>gb|AAX95093.1| ubiquinol--cytochrome-c reductase, putative [Oryza sativa Japonica 
Group]
Length=96

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
             +DEE VD KK  E+ CKP+CV+ L EY+ C KRV+ D++GHKHCTGQYFDYW CIDKCV
Sbjct  28   WADEEPVDPKKYLEERCKPQCVKPLYEYEKCVKRVEKDDTGHKHCTGQYFDYWSCIDKCV  87

Query  274  APKLFTKLK  248
            APKL  KLK
Sbjct  88   APKLLEKLK  96



>ref|XP_002442861.1| hypothetical protein SORBIDRAFT_08g003963 [Sorghum bicolor]
 gb|EES16699.1| hypothetical protein SORBIDRAFT_08g003963 [Sorghum bicolor]
Length=69

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D E VDQK   E+ CKP+CV+ L +Y+ C KRV+ D SG KHCTGQYFDYW C+DKCV
Sbjct  1    MADAEPVDQKNYLEERCKPQCVKSLYDYERCVKRVENDGSGQKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFDKLK  69



>gb|AAD39640.1|AC007591_5 Similar to gb|X79273 cytochrome c reductase hinge protein subunit 
from Solanum tuberosum. ESTs gb|T45282 and gb|T21596 come 
from this gene [Arabidopsis thaliana]
Length=101

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +D+EVVD KK  E+SCKPKCV+ L EYQAC KR+ GD+SGHKHCTGQYFDYW CIDKCV+
Sbjct  15   ADDEVVDPKKYLEESCKPKCVKPLLEYQACVKRIQGDDSGHKHCTGQYFDYWQCIDKCVS  74



>gb|ADE75811.1| unknown [Picea sitchensis]
Length=69

 Score =   101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSD E VD K   E+SCK  CV+ L +YQAC KRV+ DE+GHKHCTGQYFDYW C+D C 
Sbjct  1    MSDTEPVDPKACIEESCKSNCVKPLFQYQACVKRVESDETGHKHCTGQYFDYWACVDNCA  60

Query  274  APKLFTKLK  248
            APK+F+ LK
Sbjct  61   APKVFSNLK  69



>gb|ACF82301.1| unknown [Zea mays]
 gb|ACG30040.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein [Zea 
mays]
 gb|ACG43132.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein [Zea 
mays]
 gb|ACG48621.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein [Zea 
mays]
 tpg|DAA55603.1| TPA: hypothetical protein ZEAMMB73_828416 [Zea mays]
Length=69

 Score =   101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D E VDQK   E+ CKP+CV+ L +Y+ C KRV+ D SG KHCTGQYFDYW C+DKCV
Sbjct  1    MADAEPVDQKNYLEERCKPQCVKTLYDYEKCVKRVESDGSGQKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFDKLK  69



>ref|XP_005848988.1| hypothetical protein CHLNCDRAFT_35029 [Chlorella variabilis]
 gb|EFN56886.1| hypothetical protein CHLNCDRAFT_35029 [Chlorella variabilis]
Length=69

 Score =   101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M++EEVV+ +   E+SCKP+CV+   EYQACA+RV+ DESG  HCTGQYFDYWHC+DKC 
Sbjct  1    MAEEEVVNPQIEVEESCKPQCVKAWLEYQACAERVEKDESGEAHCTGQYFDYWHCVDKCA  60

Query  274  APKLFTKLK  248
            A  LF KLK
Sbjct  61   AKPLFAKLK  69



>ref|XP_008784141.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Phoenix dactylifera]
Length=69

 Score =   101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+VD KK  E+ C+P+CV+ L EY+ C KR+  DE+GHKHCTGQYFDYW C+D+C 
Sbjct  1    MADEELVDPKKYLEERCQPRCVKALYEYRECVKRIQDDETGHKHCTGQYFDYWKCVDQCA  60

Query  274  APKLFTKLK  248
            A KLF KLK
Sbjct  61   AEKLFDKLK  69



>dbj|BAJ84951.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87835.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07413.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=69

 Score =   101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D E VD K   E+ CKP+CV+ L +Y+ C KRV+ DE+G KHCTGQ+FDYW C+DKCV
Sbjct  1    MADNEPVDPKNFLEERCKPQCVKSLYDYERCVKRVENDETGQKHCTGQFFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            APKLF KLK
Sbjct  61   APKLFEKLK  69



>ref|XP_002532440.1| Ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative 
[Ricinus communis]
 gb|EEF29955.1| Ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative 
[Ricinus communis]
Length=110

 Score =   101 bits (252),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +DEE VDQKK  E+SCKPKCV+ L EY+AC KR+ GDE+GHKHCTGQYFDYW C+DKCV+
Sbjct  36   ADEEPVDQKKYLEESCKPKCVKPLLEYEACVKRIRGDETGHKHCTGQYFDYWSCVDKCVS  95

Query  271  PKLFTKLK*R  242
             K F   + R
Sbjct  96   -KYFMAFRLR  104



>gb|EMT10803.1| Cytochrome b-c1 complex subunit 6 [Aegilops tauschii]
Length=111

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 64/103 (62%), Gaps = 3/103 (3%)
 Frame = -3

Query  556  PRFVLIIRSVFNNLLLRSTFIRPSTSYFCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLK  377
            PR +    S+ ++ +L    +  S S +C      +DEEV D K L ED  K KCV Q  
Sbjct  12   PRHLQDSPSLASDTILNWEELTSSLSLYCTGG---ADEEVSDPKALLEDRTKAKCVYQWY  68

Query  376  EYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            EYQ C KR++GDE+G KHCTGQYFDYW CIDK VA KLF  LK
Sbjct  69   EYQKCVKRIEGDETGQKHCTGQYFDYWKCIDKHVAEKLFDSLK  111



>ref|XP_004977318.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Setaria italica]
Length=69

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D E VDQK   E+ CKP CV+ L EY+ C KRV+ D SG KHCTGQYFDYW C+DKCV
Sbjct  1    MADAEPVDQKNKLEERCKPLCVKSLYEYERCVKRVENDGSGQKHCTGQYFDYWSCVDKCV  60

Query  274  APKLFTKLK  248
            APKL  KLK
Sbjct  61   APKLLDKLK  69



>ref|XP_003575101.2| PREDICTED: uncharacterized protein LOC100828312 [Brachypodium 
distachyon]
Length=166

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 55/83 (66%), Gaps = 3/83 (4%)
 Frame = -3

Query  487  STSYFCLSP---FDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCT  317
             +  F  SP    DMSDEEV D K L ED  K KCV Q  EYQ C KR++ DE+G KHCT
Sbjct  84   GSGIFLGSPRSVADMSDEEVSDPKALLEDRSKAKCVSQWYEYQKCVKRIEDDETGQKHCT  143

Query  316  GQYFDYWHCIDKCVAPKLFTKLK  248
            GQYFDYW CIDK VA KLF  LK
Sbjct  144  GQYFDYWKCIDKNVAEKLFDSLK  166



>ref|XP_002875059.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51318.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=67

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            ++EE VDQK+ +E+SCKPKCV+ L EYQAC KR+  DESGHKHCTGQYFDYWHC+DKCV
Sbjct  2    AEEEDVDQKRYFEESCKPKCVKPLLEYQACVKRIQDDESGHKHCTGQYFDYWHCVDKCV  60



>gb|AFW71717.1| hypothetical protein ZEAMMB73_660333, partial [Zea mays]
Length=138

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = -3

Query  517  LLLRSTFIRPSTSYFCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDE  338
            +L+   +IR    +  L    M+DEEV D K L ED  K KCV Q  +YQ C KR++ DE
Sbjct  49   VLVSFRWIRALHLFAALRQSPMADEEVTDPKALLEDRSKAKCVSQWYDYQKCVKRIEDDE  108

Query  337  SGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            +GHKHCTGQYFDYW C+DK VA KLF  LK
Sbjct  109  TGHKHCTGQYFDYWKCVDKNVAEKLFEMLK  138



>ref|XP_002453955.1| hypothetical protein SORBIDRAFT_04g022156 [Sorghum bicolor]
 gb|EES06931.1| hypothetical protein SORBIDRAFT_04g022156 [Sorghum bicolor]
Length=69

 Score = 97.8 bits (242),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEEV D K L E+  K KCV Q  EYQ C KR++ DE+GHKHCTGQYFDYW C+DK V
Sbjct  1    MADEEVTDPKALLEERSKAKCVSQWYEYQKCVKRIENDETGHKHCTGQYFDYWKCVDKNV  60

Query  274  APKLFTKLK  248
            A KLF  LK
Sbjct  61   AEKLFEMLK  69



>gb|AFW71718.1| hypothetical protein ZEAMMB73_660333, partial [Zea mays]
Length=135

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEEV D K L ED  K KCV Q  +YQ C KR++ DE+GHKHCTGQYFDYW C+DK V
Sbjct  67   MADEEVTDPKALLEDRSKAKCVSQWYDYQKCVKRIEDDETGHKHCTGQYFDYWKCVDKNV  126

Query  274  APKLFTKLK  248
            A KLF  LK
Sbjct  127  AEKLFEMLK  135



>dbj|BAK07610.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04889.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=69

 Score = 97.4 bits (241),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEEV D K L ED  KPKCV    EYQ C KR++GDE+G KHCTGQYFDYW CIDK V
Sbjct  1    MADEEVSDPKALLEDRTKPKCVYLWYEYQKCVKRIEGDETGQKHCTGQYFDYWKCIDKHV  60

Query  274  APKLFTKLK  248
            A KLF  LK
Sbjct  61   AEKLFDSLK  69



>gb|AFW65611.1| hypothetical protein ZEAMMB73_969846 [Zea mays]
Length=66

 Score = 97.4 bits (241),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M DEE+VDQKK  E+ CKP+CV+ L EY+ C KRV+ D++GHKHCTGQYFDYW CIDKCV
Sbjct  1    MEDEELVDQKKYLEERCKPQCVKSLYEYEKCVKRVENDDTGHKHCTGQYFDYWSCIDKCV  60

Query  274  A  272
            +
Sbjct  61   S  61



>gb|EAY86198.1| hypothetical protein OsI_07574 [Oryza sativa Indica Group]
Length=167

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -3

Query  505  STFIRPSTSYFCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHK  326
            S+F+    S    +   MSDEEV D K L ED  K KCV Q  EYQ C KR++ DE+G K
Sbjct  82   SSFVEVVASPRRAAVASMSDEEVSDPKALLEDRSKAKCVYQWYEYQKCVKRIEDDETGQK  141

Query  325  HCTGQYFDYWHCIDKCVAPKLFTKLK  248
            HCTGQYFDYW C+DK VA KLF  LK
Sbjct  142  HCTGQYFDYWKCVDKNVAEKLFDSLK  167



>gb|ACG26684.1| hypothetical protein [Zea mays]
 gb|ACG32770.1| hypothetical protein [Zea mays]
 gb|ACG46781.1| hypothetical protein [Zea mays]
 gb|AFW71719.1| hypothetical protein ZEAMMB73_660333 [Zea mays]
Length=69

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEEV D K L ED  K KCV Q  +YQ C KR++ DE+GHKHCTGQYFDYW C+DK V
Sbjct  1    MADEEVTDPKALLEDRSKAKCVSQWYDYQKCVKRIEDDETGHKHCTGQYFDYWKCVDKNV  60

Query  274  APKLFTKLK  248
            A KLF  LK
Sbjct  61   AEKLFEMLK  69



>gb|EMT23173.1| Cytochrome b-c1 complex subunit 6 [Aegilops tauschii]
Length=80

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAP  269
            D E VD K   E+ CKP+CV+ L +Y+ C KRV+ DE+G KHCTGQ+FDYW C+DKCVAP
Sbjct  14   DNEPVDPKNYLEERCKPQCVKSLYDYERCVKRVENDETGQKHCTGQFFDYWSCVDKCVAP  73

Query  268  KLFTKLK  248
            KLF KLK
Sbjct  74   KLFEKLK  80



>ref|XP_010103836.1| Cytochrome b-c1 complex subunit 6 [Morus notabilis]
 gb|EXB97277.1| Cytochrome b-c1 complex subunit 6 [Morus notabilis]
Length=211

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            ++D+E VD KK  E++CKPKCV+ L EYQAC KR+ GDE+GHKHCTGQYFDYW C+DKC 
Sbjct  57   LADDEPVDPKKYLEEACKPKCVKPLLEYQACVKRIQGDETGHKHCTGQYFDYWACVDKCF  116

Query  274  APKLF  260
               +F
Sbjct  117  EETVF  121



>gb|EMS66572.1| Cytochrome b-c1 complex subunit 6 [Triticum urartu]
Length=80

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAP  269
            D E +D K   E+ CKP+CV+ L +Y+ C KRV+ DE+G KHCTGQ+FDYW C+DKCVAP
Sbjct  14   DNEPIDPKNYLEERCKPQCVKSLYDYERCVKRVENDETGQKHCTGQFFDYWSCVDKCVAP  73

Query  268  KLFTKLK  248
            KLF KLK
Sbjct  74   KLFEKLK  80



>gb|ACG25993.1| hypothetical protein [Zea mays]
 gb|ACG40023.1| hypothetical protein [Zea mays]
 gb|ACG44118.1| hypothetical protein [Zea mays]
 gb|AFW62563.1| hypothetical protein ZEAMMB73_329023 [Zea mays]
 gb|AFW62564.1| hypothetical protein ZEAMMB73_329023 [Zea mays]
Length=69

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEEV D K   E+  K KCV Q  EYQ C KR++ DE+GHKHCTGQYFDYW C+DK V
Sbjct  1    MADEEVTDPKAFLEERSKAKCVSQWYEYQKCVKRIENDETGHKHCTGQYFDYWKCVDKNV  60

Query  274  APKLFTKLK  248
            A KLF  LK
Sbjct  61   AEKLFEMLK  69



>ref|NP_001047065.1| Os02g0541700 [Oryza sativa Japonica Group]
 dbj|BAD28073.1| putative ubiquinol-cytochrome C reductase complex 7.8 kDa protein 
[Oryza sativa Japonica Group]
 dbj|BAD28224.1| putative ubiquinol-cytochrome C reductase complex 7.8 kDa protein 
[Oryza sativa Japonica Group]
 dbj|BAF08979.1| Os02g0541700 [Oryza sativa Japonica Group]
Length=69

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEEV D K L ED  K KCV Q  EYQ C KR++ DE+G KHCTGQYFDYW C+DK V
Sbjct  1    MSDEEVSDPKALLEDRSKAKCVYQWYEYQKCVKRIEDDETGQKHCTGQYFDYWKCVDKNV  60

Query  274  APKLFTKLK  248
            A KLF  LK
Sbjct  61   AEKLFDSLK  69



>ref|XP_004952689.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Setaria italica]
Length=69

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEEV D K L ED  K KCV Q  EYQ C KR++ DE+G KHCTGQYFDYW C+DK V
Sbjct  1    MADEEVSDPKALLEDRTKAKCVSQWYEYQKCVKRIENDETGQKHCTGQYFDYWKCVDKNV  60

Query  274  APKLFTKLK  248
            A KLF  LK
Sbjct  61   AEKLFELLK  69



>gb|AFW65612.1| hypothetical protein ZEAMMB73_969846 [Zea mays]
Length=79

 Score = 95.5 bits (236),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M DEE+VDQKK  E+ CKP+CV+ L EY+ C KRV+ D++GHKHCTGQYFDYW CIDKC 
Sbjct  1    MEDEELVDQKKYLEERCKPQCVKSLYEYEKCVKRVENDDTGHKHCTGQYFDYWSCIDKCH  60

Query  274  APKL  263
               L
Sbjct  61   QSSL  64



>gb|AFW71716.1| hypothetical protein ZEAMMB73_660333, partial [Zea mays]
Length=157

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            +DEEV D K L ED  K KCV Q  +YQ C KR++ DE+GHKHCTGQYFDYW C+DK VA
Sbjct  90   ADEEVTDPKALLEDRSKAKCVSQWYDYQKCVKRIEDDETGHKHCTGQYFDYWKCVDKNVA  149

Query  271  PKLFTKLK  248
             KLF  LK
Sbjct  150  EKLFEMLK  157



>gb|EAZ23360.1| hypothetical protein OsJ_07056 [Oryza sativa Japonica Group]
Length=170

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEEV D K L ED  K KCV Q  EYQ C KR++ DE+G KHCTGQYFDYW C+DK V
Sbjct  102  MSDEEVSDPKALLEDRSKAKCVYQWYEYQKCVKRIEDDETGQKHCTGQYFDYWKCVDKNV  161

Query  274  APKLFTKLK  248
            A KLF  LK
Sbjct  162  AEKLFDSLK  170



>ref|XP_002532437.1| Ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative 
[Ricinus communis]
 gb|EEF29952.1| Ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative 
[Ricinus communis]
Length=128

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE+VDQK+  EDSCKPKCV+ L EY+AC KR +G++ G KHCTGQYFDY  C+D+C+
Sbjct  20   MADEELVDQKRYLEDSCKPKCVKPLIEYEACIKRTEGEDPGQKHCTGQYFDYLSCVDRCL  79

Query  274  APKLFTKLK*RACIASR  224
               L  +L    C A R
Sbjct  80   V-DLGHRLTLACCRAGR  95



>gb|ABA91661.2| Ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative, 
expressed [Oryza sativa Japonica Group]
Length=76

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+DEE VD KK  E+ CKP+CV+ L EY+ C KRV+ D++GHKHCTGQYFDYW CIDKCV
Sbjct  1    MADEEPVDPKKYLEERCKPQCVKPLYEYEKCVKRVEKDDTGHKHCTGQYFDYWSCIDKCV  60

Query  274  A  272
            +
Sbjct  61   S  61



>ref|XP_005535993.1| cytochrome c reductase hinge protein [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM79707.1| cytochrome c reductase hinge protein [Cyanidioschyzon merolae 
strain 10D]
Length=67

 Score = 89.7 bits (221),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -3

Query  442  EVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKL  263
            E VD K   E+SC+P+C+RQL EY+ C KR++ D +G  HCTGQY D+W CID CVA KL
Sbjct  3    ETVDPKVEIEESCRPQCIRQLIEYEDCTKRIENDPAGEAHCTGQYLDFWRCIDLCVASKL  62

Query  262  FTKLK  248
            F +LK
Sbjct  63   FVRLK  67



>tpg|DAA55604.1| TPA: hypothetical protein ZEAMMB73_828416 [Zea mays]
Length=100

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D E VDQK   E+ CKP+CV+ L +Y+ C KRV+ D SG KHCTGQYFDYW C+DKCV
Sbjct  1    MADAEPVDQKNYLEERCKPQCVKTLYDYEKCVKRVESDGSGQKHCTGQYFDYWSCVDKCV  60

Query  274  A  272
            +
Sbjct  61   S  61



>gb|ACG44489.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein [Zea 
mays]
Length=102

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+D E VDQK   E+ CKP+CV+ L +Y+ C KRV+ D SG KHCTGQYFDYW C+DKCV
Sbjct  1    MADAEPVDQKNYLEERCKPQCVKTLYDYEKCVKRVESDGSGQKHCTGQYFDYWSCVDKCV  60

Query  274  A  272
            +
Sbjct  61   S  61



>gb|KFM27464.1| Cytochrome b-c1 complex subunit 6 [Auxenochlorella protothecoides]
Length=68

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDE VV  K   E+ CKP+C + L EY+AC +RV  D +G  HCTGQYFDYW C+DKCV
Sbjct  1    MSDE-VVCPKPEEEERCKPRCTKYLLEYEACGERVKNDTTGEAHCTGQYFDYWRCVDKCV  59

Query  274  APKLFTKLK  248
            A +LF KLK
Sbjct  60   AARLFDKLK  68



>ref|XP_005647640.1| putative ubiquinol-cytochrome C reductase complex 7.8 kDa protein 
[Coccomyxa subellipsoidea C-169]
 gb|EIE23096.1| putative ubiquinol-cytochrome C reductase complex 7.8 kDa protein 
[Coccomyxa subellipsoidea C-169]
Length=67

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 2/69 (3%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSD++ V  K   E++CKP+C++QL +YQ C KR++G    H  CTGQYFDYWHC+D C 
Sbjct  1    MSDDDPVCPKPAIEEACKPECIKQLLKYQQCVKRIEGKPEAH--CTGQYFDYWHCVDHCT  58

Query  274  APKLFTKLK  248
            AP+LF+ LK
Sbjct  59   APRLFSVLK  67



>ref|XP_001785618.1| predicted protein [Physcomitrella patens]
 gb|EDQ49565.1| predicted protein [Physcomitrella patens]
Length=57

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  442  EVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            E +D K   EDSCKP+CV+QL  Y+AC KR++ DE+G KHCTGQYFDYW CID+CV+
Sbjct  1    EAMDPKPEIEDSCKPRCVKQLISYEACVKRIEEDENGQKHCTGQYFDYWGCIDQCVS  57



>ref|XP_005706663.1| ubiquinol-cytochrome c reductase subunit 6 [Galdieria sulphuraria]
 gb|EME30143.1| ubiquinol-cytochrome c reductase subunit 6 [Galdieria sulphuraria]
Length=69

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MS+EE VD+K   E+SC+P C  +  EY+AC KR++ D +G  HCTGQY D+W C+D C 
Sbjct  1    MSEEEPVDKKPEIEESCQPHCSHEWAEYRACVKRIENDTTGEAHCTGQYLDFWRCVDHCA  60

Query  274  APKLFTKLK  248
            A K+F  LK
Sbjct  61   AKKIFQTLK  69



>tpg|DAA55602.1| TPA: hypothetical protein ZEAMMB73_828416 [Zea mays]
Length=66

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDK  281
            M+D E VDQK   E+ CKP+CV+ L +Y+ C KRV+ D SG KHCTGQYFDYW C+DK
Sbjct  1    MADAEPVDQKNYLEERCKPQCVKTLYDYEKCVKRVESDGSGQKHCTGQYFDYWSCVDK  58



>ref|XP_009608979.1| PREDICTED: uncharacterized protein LOC104102845 [Nicotiana tomentosiformis]
Length=101

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  370  QACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            QACAKR++GDESGHKHCTGQYFDYW CIDKCVA KLF +LK
Sbjct  61   QACAKRIEGDESGHKHCTGQYFDYWQCIDKCVAVKLFDQLK  101



>ref|XP_002503396.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64654.1| predicted protein [Micromonas sp. RCC299]
Length=78

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
             DE+ VD +   E++CKPKC + ++ Y+AC  R++ D +G  HCTGQYFD W C+D CVA
Sbjct  11   DDEDPVDHRPDLEEACKPKCQKFIEAYEACQTRIEKDATGEAHCTGQYFDMWGCVDHCVA  70

Query  271  PKLFTKLK  248
            PKLF   K
Sbjct  71   PKLFKDTK  78



>ref|XP_002969341.1| hypothetical protein SELMODRAFT_69986, partial [Selaginella moellendorffii]
 gb|EFJ29429.1| hypothetical protein SELMODRAFT_69986, partial [Selaginella moellendorffii]
Length=58

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  445  EEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            EE+ D K   E+ C+P+CV+Q   YQAC KR++ D++G KHCTGQY D+WHCIDKCV+
Sbjct  1    EELQDPKLELEEMCRPRCVKQFLAYQACCKRIEDDDTGSKHCTGQYLDFWHCIDKCVS  58



>ref|XP_003058347.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH56802.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=67

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAP  269
            DE+ VD +   E++CKPKC + +  Y AC +RV  D +G  HCTGQYFD W C+DKCVAP
Sbjct  1    DEDPVDIRPELEEACKPKCAKFVAAYDACVERVAKDTTGEAHCTGQYFDLWGCVDKCVAP  60

Query  268  KLFTKLK  248
             LF   K
Sbjct  61   TLFKHTK  67



>ref|XP_009368542.1| PREDICTED: uncharacterized protein LOC103958047 [Pyrus x bretschneideri]
Length=155

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 3/71 (4%)
 Frame = -3

Query  517  LLLRSTFIRPSTSYFCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDE  338
            LLLRS  +R ++S F    F   D+E+VDQKK  E+SC+PKCV+ L EYQAC KRV+GD+
Sbjct  85   LLLRSN-LRWNSSPF--PRFRRVDDELVDQKKYLEESCQPKCVKPLIEYQACVKRVEGDD  141

Query  337  SGHKHCTGQYF  305
            +G+ HCTGQYF
Sbjct  142  TGNNHCTGQYF  152



>ref|XP_007513460.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15985.1| predicted protein [Bathycoccus prasinos]
Length=79

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 2/67 (3%)
 Frame = -3

Query  457  DMSD-EEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDK  281
            D+ D ++ VD K   ED CKPKC   LK Y+ACA+R++GDE+G KHCTGQYFD+W C+D 
Sbjct  9    DIGDVDDPVDPKLQIEDLCKPKCDAFLKAYEACAERIEGDETGEKHCTGQYFDFWSCVDH  68

Query  280  C-VAPKL  263
            C V P +
Sbjct  69   CAVGPTM  75



>ref|XP_002970674.1| hypothetical protein SELMODRAFT_69978, partial [Selaginella moellendorffii]
 gb|EFJ28000.1| hypothetical protein SELMODRAFT_69978, partial [Selaginella moellendorffii]
Length=58

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  445  EEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
            EE+ D K   E+ C+P+CV+Q   YQAC KR++ D++G KHCTGQY D+W+CIDKCV+
Sbjct  1    EELQDPKLELEEMCRPRCVKQFLAYQACCKRIEDDDTGSKHCTGQYLDFWNCIDKCVS  58



>ref|XP_001697864.1| ubiquinol:cytochrome c oxidoreductase 8 kDa subunit [Chlamydomonas 
reinhardtii]
 gb|EDO99747.1| ubiquinol:cytochrome c oxidoreductase 8 kDa subunit [Chlamydomonas 
reinhardtii]
Length=69

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  433  DQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTK  254
            D K   E+ CKP CV++   Y+ACA+R+  D +G  HC+GQYFD+W C+D C APK+F  
Sbjct  8    DPKPQIEEDCKPHCVKEWAAYKACAERIKDDTTGQAHCSGQYFDFWKCVDHCAAPKIFAH  67

Query  253  LK  248
            LK
Sbjct  68   LK  69



>ref|XP_005818775.1| hypothetical protein GUITHDRAFT_91152 [Guillardia theta CCMP2712]
 gb|EKX31795.1| hypothetical protein GUITHDRAFT_91152 [Guillardia theta CCMP2712]
Length=74

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 49/77 (64%), Gaps = 11/77 (14%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVD--------GDESGHKHCTGQYFDY  299
            MSD   VD +   E+SCK  C + LKE +AC +RV+        GDE    HCTGQYFD+
Sbjct  1    MSDP--VDPRPAIEESCKGHCQKYLKELEACTERVNKIIAEAKPGDEV-QAHCTGQYFDF  57

Query  298  WHCIDKCVAPKLFTKLK  248
            WHCID C APKLF KLK
Sbjct  58   WHCIDHCAAPKLFAKLK  74



>ref|XP_002949689.1| hypothetical protein VOLCADRAFT_80825 [Volvox carteri f. nagariensis]
 gb|EFJ49241.1| hypothetical protein VOLCADRAFT_80825 [Volvox carteri f. nagariensis]
Length=69

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  433  DQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTK  254
            D K   E+ CK  CV++   Y+ACA+R+  D +G  HC+GQYFD+W C+D C APK+F  
Sbjct  8    DPKPKIEEDCKVHCVKEWAAYKACAERIKSDTTGQAHCSGQYFDFWKCVDHCAAPKIFAV  67

Query  253  LK  248
            LK
Sbjct  68   LK  69



>ref|XP_004341565.1| ubiquinol:cytochrome c oxidoreductase 8 kDa subunit [Acanthamoeba 
castellanii str. Neff]
 gb|ELR19479.1| ubiquinol:cytochrome c oxidoreductase 8 kDa subunit [Acanthamoeba 
castellanii str. Neff]
Length=70

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -3

Query  427  KKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            KK  E+   PKC+++  EY AC +R+ GD +G   C+GQYF+YWHC+D  VA  LF +LK
Sbjct  11   KKSLEEKAHPKCLKKWAEYDACGQRIKGDTTGEAQCSGQYFEYWHCVDALVANDLFKRLK  70



>emb|CEG01357.1| Cytochrome b-c1 complex, subunit 6 [Ostreococcus tauri]
Length=71

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = -3

Query  454  MSDEEV--VDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDK  281
            M DEE   VD K   E +C PKC   ++ Y+ACA R++ DE+G  HCTGQYFD + C+D+
Sbjct  1    MEDEEEDPVDHKLEVETACAPKCEAFVRAYEACATRIESDETGEAHCTGQYFDMYKCVDE  60

Query  280  CVAPKLFTK  254
            C   ++  +
Sbjct  61   CAKKEIMER  69



>ref|XP_003593125.1| Cytochrome b-c1 complex subunit [Medicago truncatula]
Length=127

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  352  VDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            + GD+SG KHCTGQYFDYW+C+DKCVAPKLF KLK
Sbjct  93   IHGDDSGQKHCTGQYFDYWYCVDKCVAPKLFPKLK  127


 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACA  359
            +DEE VDQK+ +EDSCKPKCVR L EY+ CA
Sbjct  3    ADEEPVDQKRFFEDSCKPKCVRPLIEYKDCA  33



>ref|XP_006405726.1| hypothetical protein EUTSA_v10028069mg, partial [Eutrema salsugineum]
 gb|ESQ47179.1| hypothetical protein EUTSA_v10028069mg, partial [Eutrema salsugineum]
Length=118

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -3

Query  475  FCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYF  305
            F +SP+     EVVD KK  E+SCKPKCV+ L EYQ C KR+  DESGHKHC G   
Sbjct  57   FPISPY----AEVVDPKKCLEESCKPKCVKPLLEYQVCVKRIQDDESGHKHCAGSIL  109



>ref|XP_006397227.1| hypothetical protein EUTSA_v10029056mg [Eutrema salsugineum]
 gb|ESQ38680.1| hypothetical protein EUTSA_v10029056mg [Eutrema salsugineum]
Length=136

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -3

Query  475  FCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYF  305
            F +SP+     EVVD KK  E+SCKPKCV+ L EYQ C KR+  DESGHKHC G   
Sbjct  75   FPISPY----AEVVDPKKCLEESCKPKCVKPLLEYQVCVKRIQDDESGHKHCAGSIL  127



>ref|XP_008907054.1| hypothetical protein PPTG_13081 [Phytophthora parasitica INRA-310]
 gb|ETI44232.1| hypothetical protein F443_11079 [Phytophthora parasitica P1569]
 gb|ETK84210.1| hypothetical protein L915_10801 [Phytophthora parasitica]
 gb|ETL37680.1| hypothetical protein L916_10692 [Phytophthora parasitica]
 gb|ETL90834.1| hypothetical protein L917_10591 [Phytophthora parasitica]
 gb|ETM44089.1| hypothetical protein L914_10641 [Phytophthora parasitica]
 gb|ETN07769.1| hypothetical protein PPTG_13081 [Phytophthora parasitica INRA-310]
 gb|ETO72883.1| hypothetical protein F444_11154 [Phytophthora parasitica P1976]
 gb|ETP14056.1| hypothetical protein F441_10992 [Phytophthora parasitica CJ01A1]
 gb|ETP42106.1| hypothetical protein F442_10981 [Phytophthora parasitica P10297]
Length=67

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEE VD       +C+PKC +    YQAC  RV     G   C GQYFD+ HCIDKC 
Sbjct  1    MSDEEPVDVMPAIRKACEPKCEQSFNAYQACLDRVKAKGVGS--CDGQYFDFLHCIDKCS  58

Query  274  APKLFTKLK  248
             P++   LK
Sbjct  59   VPQIMKHLK  67



>gb|KDP43002.1| hypothetical protein JCGZ_25188 [Jatropha curcas]
Length=63

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  370  QACAKRVDGDESGHKHCTGQYFDYWHCIDKC  278
            +AC KR+ GDESGHKHCTGQYFDYW C+DKC
Sbjct  3    EACVKRIRGDESGHKHCTGQYFDYWSCVDKC  33



>ref|XP_009825435.1| hypothetical protein H257_03157 [Aphanomyces astaci]
 gb|ETV85417.1| hypothetical protein H257_03157 [Aphanomyces astaci]
Length=67

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+ E+ VD       +C+PKCV   K Y+AC  R+     G   C GQYFDY  CIDKC 
Sbjct  1    MAGEDPVDVMPEIRKACEPKCVESFKLYRACVDRITA--KGDGACDGQYFDYLKCIDKCS  58

Query  274  APKLFTKLK  248
             P+LF  LK
Sbjct  59   VPQLFKHLK  67



>ref|XP_008867523.1| hypothetical protein H310_04797 [Aphanomyces invadans]
 gb|ETW03294.1| hypothetical protein H310_04797 [Aphanomyces invadans]
Length=67

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+ E+ VD       +C+PKCV   K Y+AC  R+     G   C GQYFDY  CIDKC 
Sbjct  1    MAGEDPVDVMPEIRKACEPKCVESFKVYRACVDRITA--KGEGACDGQYFDYLKCIDKCS  58

Query  274  APKLFTKLK  248
             P++F  LK
Sbjct  59   VPQIFKHLK  67



>ref|XP_005771628.1| hypothetical protein EMIHUDRAFT_75509 [Emiliania huxleyi CCMP1516]
 ref|XP_005780527.1| hypothetical protein EMIHUDRAFT_73196 [Emiliania huxleyi CCMP1516]
 gb|EOD19199.1| hypothetical protein EMIHUDRAFT_75509 [Emiliania huxleyi CCMP1516]
 gb|EOD28098.1| hypothetical protein EMIHUDRAFT_73196 [Emiliania huxleyi CCMP1516]
Length=69

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = -3

Query  442  EVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKL  263
            EVVD K L E  C+  C + L+ YQACA R+   E     C+G Y DY HC+D CV+  L
Sbjct  8    EVVDPKDLLEKGCEASCGKALETYQACAARI---EEKAGECSGWYGDYVHCVDSCVSKTL  64

Query  262  FTKL  251
            F KL
Sbjct  65   FKKL  68



>gb|EJK50781.1| hypothetical protein THAOC_30120 [Thalassiosira oceanica]
Length=217

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 2/82 (2%)
 Frame = -3

Query  493  RPSTSYFCLSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTG  314
            RP+  +        S+EEVVD     + SC+  C  + K Y+AC  R+   + G   C G
Sbjct  138  RPTKPHVAPRLAQGSEEEVVDHLPALKKSCESHCPGEKKAYEACTGRIA--KLGEGDCEG  195

Query  313  QYFDYWHCIDKCVAPKLFTKLK  248
             YFD  HC+D CVAPK F  LK
Sbjct  196  WYFDLLHCVDHCVAPKAFKPLK  217



>ref|XP_001419278.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97571.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=52

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  400  PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTK  254
            PKC + +K Y+ACA+R+ GDE+G  HCTGQYFD + C+D+C   ++  +
Sbjct  2    PKCEKFVKLYEACAERIKGDETGEAHCTGQYFDMYKCVDECAKDEVMRR  50



>ref|XP_002293428.1| ubiquinol cytochrome c reductase [Thalassiosira pseudonana CCMP1335]
 gb|EED89164.1| ubiquinol cytochrome c reductase, partial [Thalassiosira pseudonana 
CCMP1335]
Length=78

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
             S+EEVVD     + SC   C  Q KEY AC  R+   + G   C   YFD  HC+D CV
Sbjct  12   QSEEEVVDHLPQLKASCAKHCPAQKKEYDACVNRIT--KLGEGDCEAWYFDLLHCVDHCV  69

Query  274  APKLFTKLK  248
            AP+ F KLK
Sbjct  70   APQAFKKLK  78



>ref|XP_008605019.1| hypothetical protein SDRG_01280 [Saprolegnia diclina VS20]
 gb|EQC41305.1| hypothetical protein SDRG_01280 [Saprolegnia diclina VS20]
 gb|KDO34959.1| hypothetical protein SPRG_01021 [Saprolegnia parasitica CBS 223.65]
Length=65

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 4/69 (6%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M+ E+ VD        C+ KC   +KEY AC  RV    +G   C GQYFD   C+DKC 
Sbjct  1    MAGEDPVDIYPEIRKGCESKCAPVVKEYNACLDRV----AGKGGCDGQYFDLLKCVDKCA  56

Query  274  APKLFTKLK  248
            AP++F  LK
Sbjct  57   APQIFKHLK  65



>ref|XP_002899863.1| hypothetical protein PITG_13682 [Phytophthora infestans T30-4]
 gb|EEY60917.1| hypothetical protein PITG_13682 [Phytophthora infestans T30-4]
Length=58

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 2/54 (4%)
 Frame = -3

Query  409  SCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            +C+PKC +    YQAC  RV     G   C GQYFDY HCIDKC  P++   LK
Sbjct  7    ACEPKCEQSFNAYQACLDRVKAKGVGA--CDGQYFDYLHCIDKCSVPQIMKHLK  58



>ref|XP_011042843.1| PREDICTED: uncharacterized protein LOC105138462 isoform X2 [Populus 
euphratica]
Length=77

 Score = 47.4 bits (111),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQ  368
            M+DEE+VDQKK  EDSC+PKCV+ L EY+
Sbjct  1    MADEELVDQKKYLEDSCRPKCVKPLLEYE  29


 Score = 35.4 bits (80),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  366  HVLKELMAMKVGTSIALANISTIGTALTNVLLRSY  262
            HVL+EL  M V T+I   +  TIG+ L N L RSY
Sbjct  40   HVLRELKEMTVATNIVQGSTLTIGSVLINALHRSY  74



>ref|XP_008819046.1| ubiquinol-cytochrome c reductase subunit 6 [Plasmodium inui San 
Antonio 1]
 gb|EUD64371.1| ubiquinol-cytochrome c reductase subunit 6 [Plasmodium inui San 
Antonio 1]
Length=88

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
              E  VD + + E  C+ KCVR + EYQ+C  RV        +C GQ+ + + CID CVA
Sbjct  21   ESERTVDPRIMLEKKCEAKCVRPVHEYQSCVSRVQAKPEMKGNCLGQHEEMYMCIDHCVA  80

Query  271  PKLFTKL  251
              LF  L
Sbjct  81   KDLFNYL  87



>ref|XP_003690582.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like 
[Apis florea]
Length=87

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 37/70 (53%), Gaps = 2/70 (3%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCK--PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKC  278
             DEE+VD +KL  + C   PKC     +   C  RV+  +   + C  +  DY  CID C
Sbjct  18   EDEEIVDPQKLLREKCSRLPKCSAMQDKLNTCNDRVNSRKQTEETCMEELIDYVECIDHC  77

Query  277  VAPKLFTKLK  248
            VA  LFTKLK
Sbjct  78   VAKTLFTKLK  87



>ref|XP_006613401.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like 
[Apis dorsata]
Length=87

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 37/70 (53%), Gaps = 2/70 (3%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCK--PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKC  278
             DEE+VD +KL  + C   PKC     +   C  RV+  +   + C  +  DY  CID C
Sbjct  18   EDEEIVDPQKLLREKCSKLPKCSAMQDKLNTCNDRVNSRKETEETCMEELIDYVECIDHC  77

Query  277  VAPKLFTKLK  248
            VA  LFTKLK
Sbjct  78   VAKTLFTKLK  87



>ref|XP_001122063.2| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like 
[Apis mellifera]
Length=87

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (53%), Gaps = 2/70 (3%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCK--PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKC  278
             DEE+VD +KL  + C   PKC     +   C  RV+  +   + C  +  DY  C+D C
Sbjct  18   EDEEIVDPQKLLREKCSRLPKCSAMQDKLNTCNDRVNSRKQTEETCMEELIDYVECVDHC  77

Query  277  VAPKLFTKLK  248
            VA  LFTKLK
Sbjct  78   VAKTLFTKLK  87



>ref|XP_001616704.1| ubiquinol-cytochrome c reductase hinge protein [Plasmodium vivax 
Sal-1]
 gb|EDL46977.1| ubiquinol-cytochrome c reductase hinge protein, putative [Plasmodium 
vivax]
Length=88

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = -3

Query  445  EEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPK  266
            E  VD +   E  C+ KCVR + EYQ+C  RV        +C GQ+ + + CID CVA  
Sbjct  23   ERTVDPRIELEKKCQAKCVRPVNEYQSCVSRVQAKPEMKGNCLGQHEEMYMCIDHCVAKD  82

Query  265  LFTKL  251
            LF  L
Sbjct  83   LFNYL  87



>ref|XP_009619558.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009619559.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009619560.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Nicotiana 
tomentosiformis]
Length=51

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQA  365
            MSDEEVVDQKK  E++CKPKCVRQL+EYQ 
Sbjct  1    MSDEEVVDQKKTLEETCKPKCVRQLREYQG  30



>emb|CDJ29853.1| ubiquinol-cytochrome c reductase hinge protein, putative [Eimeria 
mitis]
Length=89

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = -3

Query  469  LSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHC  290
            + P D S E +VD KK    +C  KC R + EY AC  R+     G  +C GQ+ +   C
Sbjct  17   IPPKDPS-ERLVDPKKKLAPACTTKCSRWVHEYSACCDRLKARTDGRGNCAGQFEELQTC  75

Query  289  IDKCVAPKLFTKLK  248
            +D+CVA  LF  LK
Sbjct  76   VDRCVAKDLFKYLK  89



>ref|XP_004224390.1| ubiquinol-cytochrome c reductase hinge protein [Plasmodium cynomolgi 
strain B]
 dbj|GAB68443.1| ubiquinol-cytochrome c reductase hinge protein [Plasmodium cynomolgi 
strain B]
Length=88

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 35/67 (52%), Gaps = 0/67 (0%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVA  272
              E  VD +   E  C+ KCVR + EYQ+C  RV        +C GQ+ + + CID CVA
Sbjct  21   ESERTVDPRIELEKKCQAKCVRPVHEYQSCVSRVQAKPEMKGNCLGQHEEMYMCIDHCVA  80

Query  271  PKLFTKL  251
              LF  L
Sbjct  81   KDLFNYL  87



>ref|XP_001348422.1| ubiquinol-cytochrome c reductase hinge protein, putative [Plasmodium 
falciparum 3D7]
 gb|AAN36861.1|AE014820_11 ubiquinol-cytochrome c reductase hinge protein, putative [Plasmodium 
falciparum 3D7]
 gb|ETW16346.1| hypothetical protein PFFVO_04884 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
 gb|ETW34056.1| hypothetical protein PFTANZ_05221 [Plasmodium falciparum Tanzania 
(2000708)]
 gb|ETW46799.1| hypothetical protein PFMALIP_05080 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW53903.1| hypothetical protein PFUGPA_03776 [Plasmodium falciparum Palo 
Alto/Uganda]
 gb|ETW58208.1| hypothetical protein PFMC_05312 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR63547.1| hypothetical protein PFBG_05295 [Plasmodium falciparum 7G8]
 gb|EUT78761.1| hypothetical protein PFAG_05338 [Plasmodium falciparum Santa 
Lucia]
 gb|EWC73975.1| hypothetical protein C923_05358 [Plasmodium falciparum UGT5.1]
 emb|CDO66736.1| ubiquinol-cytochrome c reductase hinge protein, putative [Plasmodium 
reichenowi]
Length=88

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 40/81 (49%), Gaps = 3/81 (4%)
 Frame = -3

Query  484  TSYFCLSP-FDMSDEE--VVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTG  314
            T +F   P F   DE+   VD +   E  C  KCVR + EYQ C  RV        +C G
Sbjct  7    TEFFVRYPKFKERDEKDRTVDPRIELEKKCAVKCVRPVNEYQNCVSRVRARTDNKGNCLG  66

Query  313  QYFDYWHCIDKCVAPKLFTKL  251
            QY + + CID CVA  LF  L
Sbjct  67   QYEELYICIDHCVAKDLFNYL  87



>ref|XP_969197.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial [Tribolium 
castaneum]
 gb|EFA05661.1| hypothetical protein TcasGA2_TC014895 [Tribolium castaneum]
Length=88

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = -3

Query  457  DMSDEEVVDQKKLYEDSCKP--KCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCID  284
            D  DEE+VD +++  D C     C +  ++YQAC  RV+      ++C+ + FD+ H +D
Sbjct  17   DEEDEELVDPQQVLRDKCNETEHCQKLHEKYQACNDRVNSRSKTTENCSEELFDWLHAVD  76

Query  283  KCVAPKLFTKLK  248
             CV   LF+KLK
Sbjct  77   HCVTKDLFSKLK  88



>ref|XP_004349831.1| hypothetical protein CAOG_01311 [Capsaspora owczarzaki ATCC 30864]
 gb|EFW43267.1| hypothetical protein CAOG_01311 [Capsaspora owczarzaki ATCC 30864]
Length=95

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -3

Query  394  CVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            C    KE + C +RV+G+    + C  + FD+WHC+D C A +LF KLK
Sbjct  47   CAHARKELEECTQRVEGNPDTKETCAQELFDFWHCVDHCAANQLFAKLK  95



>emb|CCA20655.1| AlNc14C100G5999 [Albugo laibachii Nc14]
Length=67

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M D++ VD   L  + CKPKCV+  +  + C +RV   ESG   C G Y DY  CID   
Sbjct  1    MPDQDPVDMMVLIREECKPKCVKAKEILETCYERVRQKESG--DCDGYYLDYLSCIDYHS  58

Query  274  APKLFTKLK  248
            AP++   LK
Sbjct  59   APRIMKHLK  67



>ref|XP_003488270.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like 
[Bombus impatiens]
Length=87

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSC--KPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            +EE++D +K+  + C  +PKC    ++   C +RV+   +  + C  +  DY  C+D CV
Sbjct  19   EEELIDPQKILRERCSRQPKCTSLQEKLDTCNQRVNSRSNTEETCMEELIDYVECVDHCV  78

Query  274  APKLFTKLK  248
            A  LF+KLK
Sbjct  79   AKTLFSKLK  87



>ref|XP_009538412.1| hypothetical protein PHYSODRAFT_319854 [Phytophthora sojae]
 gb|EGZ06515.1| hypothetical protein PHYSODRAFT_319854 [Phytophthora sojae]
Length=58

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 2/54 (4%)
 Frame = -3

Query  409  SCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            +C+PKC +    Y+AC  RV     G   C GQYFD+ HCID+C  P++   LK
Sbjct  7    ACEPKCEQSYSAYRACLDRVKAKGVGS--CDGQYFDFLHCIDQCSVPQIMKHLK  58



>ref|XP_002260755.1| ubiquinol-cytochrome c reductase hinge protein [Plasmodium knowlesi 
strain H]
 emb|CAQ42727.1| ubiquinol-cytochrome c reductase hinge protein,putative [Plasmodium 
knowlesi strain H]
Length=88

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 40/81 (49%), Gaps = 3/81 (4%)
 Frame = -3

Query  484  TSYFCLSPFDMSDEE---VVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTG  314
            T +F   P     EE    VD +   E  C+ KCVR + EYQ+C  RV        +C G
Sbjct  7    TEFFVRFPKFKEREESQRTVDPRIELEKKCQAKCVRPVHEYQSCVSRVQAKPEMKGNCLG  66

Query  313  QYFDYWHCIDKCVAPKLFTKL  251
            Q+ + + CID CVA  LF  L
Sbjct  67   QHEEMYICIDHCVAKDLFNYL  87



>ref|XP_005794133.1| hypothetical protein EMIHUDRAFT_94940 [Emiliania huxleyi CCMP1516]
 gb|EOD41704.1| hypothetical protein EMIHUDRAFT_94940 [Emiliania huxleyi CCMP1516]
Length=108

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
 Frame = -3

Query  394  CVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            C   L EY+AC  R++   SG   C GQY D+ HC+D C A  LF+KLK
Sbjct  62   CATMLVEYEACQARIEAKGSGS--CEGQYGDWVHCVDACAAKSLFSKLK  108



>ref|XP_002369881.1| ubiquinol-cytochrome C reductase hinge protein, putative [Toxoplasma 
gondii ME49]
 ref|XP_008888847.1| ubiquinol-cytochrome c reductase hinge protein, putative [Hammondia 
hammondi]
 gb|EPR58114.1| putative ubiquinol-cytochrome c reductase hinge protein [Toxoplasma 
gondii GT1]
 gb|EPT31562.1| ubiquinol-cytochrome c reductase hinge protein, putative [Toxoplasma 
gondii ME49]
 gb|ESS29825.1| putative ubiquinol-cytochrome c reductase hinge protein [Toxoplasma 
gondii VEG]
 gb|KEP60547.1| ubiquinol-cytochrome c reductase hinge protein, putative [Hammondia 
hammondi]
 gb|KFG32578.1| putative ubiquinol-cytochrome c reductase hinge protein [Toxoplasma 
gondii GAB2-2007-GAL-DOM2]
 gb|KFG43865.1| putative ubiquinol-cytochrome c reductase hinge protein [Toxoplasma 
gondii p89]
 gb|KFG58750.1| putative ubiquinol-cytochrome c reductase hinge protein [Toxoplasma 
gondii RUB]
 gb|KFH03913.1| putative ubiquinol-cytochrome c reductase hinge protein [Toxoplasma 
gondii VAND]
 gb|KFH11251.1| putative ubiquinol-cytochrome c reductase hinge protein [Toxoplasma 
gondii MAS]
Length=89

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = -3

Query  445  EEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPK  266
            E +VD ++  E  C  +C   + EY AC KRV        +C+GQY +   CID+CVA  
Sbjct  24   ERLVDPRQKLEPGCTARCSLWVNEYDACTKRVRARTDNKGNCSGQYEELHVCIDRCVAKD  83

Query  265  LFTKLK  248
            +F  LK
Sbjct  84   IFKYLK  89



>dbj|BAN20397.1| unkown protein [Riptortus pedestris]
Length=87

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAP  269
            DEE+VD + + ++ C  KC     +   C +RV       + C  + FD+ HC+D CVA 
Sbjct  21   DEELVDPQVVLKEQCGDKCTNYKAKLDECYERVSSRSQTTETCAEELFDFIHCVDHCVAK  80

Query  268  KLFTKLK  248
             LF+KLK
Sbjct  81   DLFSKLK  87



>ref|XP_676661.1| ubiquinol-cytochrome c reductase hinge protein, [Plasmodium berghei 
strain ANKA]
 ref|XP_728451.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein [Plasmodium 
yoelii yoelii 17XNL]
 gb|EAA20016.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein [Plasmodium 
yoelii yoelii]
 emb|CAH97923.1| ubiquinol-cytochrome c reductase hinge protein, putative [Plasmodium 
berghei]
 gb|ETB59678.1| hypothetical protein YYC_03106 [Plasmodium yoelii 17X]
 gb|EUD73846.1| ubiquinol-cytochrome c reductase subunit 6 [Plasmodium vinckei 
petteri]
 emb|CDU21248.1| ubiquinol-cytochrome c reductase hinge protein, putative [Plasmodium 
berghei ANKA]
 emb|CDU85030.1| ubiquinol-cytochrome c reductase hinge protein, putative [Plasmodium 
yoelii]
 emb|CDZ16797.1| ubiquinol-cytochrome c reductase hinge protein, putative [Plasmodium 
yoelii]
Length=88

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = -3

Query  487  STSYFCLSP-FDMSDEE--VVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCT  317
            +T +F   P F   DE+    D +   E  C+ KCVR + EY+ C  RV        +C 
Sbjct  6    NTEFFVRYPKFKERDEKDRTTDPRIELEKKCEVKCVRPVNEYKNCVTRVKARTDNKGNCL  65

Query  316  GQYFDYWHCIDKCVAPKLFTKL  251
            GQY + + CID CVA  LF  L
Sbjct  66   GQYEELYICIDHCVAKDLFNYL  87



>ref|XP_003399309.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like 
[Bombus terrestris]
Length=87

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSC--KPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            +EE++D +K+  + C  +PKC    ++   C +RV+   +  + C  +  DY  C+D CV
Sbjct  19   EEELIDPQKILRERCSRQPKCTSLQEKLDICNQRVNSRSNTEETCMEELIDYVECVDHCV  78

Query  274  APKLFTKLK  248
            A  LF+KLK
Sbjct  79   AKTLFSKLK  87



>ref|XP_743273.1| ubiquinol-cytochrome c reductase hinge protein, [Plasmodium chabaudi 
chabaudi]
 emb|CAH81864.1| ubiquinol-cytochrome c reductase hinge protein, putative [Plasmodium 
chabaudi chabaudi]
 emb|CDU21661.1| ubiquinol-cytochrome c reductase hinge protein, putative [Plasmodium 
chabaudi chabaudi]
Length=88

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = -3

Query  487  STSYFCLSP-FDMSDEE--VVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCT  317
            +T +F   P F   DE+    D +   E  C+ KCVR + EY+ C  RV        +C 
Sbjct  6    NTEFFVRYPKFKERDEKDRTTDPRIELEKKCEVKCVRPVNEYKNCVTRVKARTDNKGNCL  65

Query  316  GQYFDYWHCIDKCVAPKLFTKL  251
            GQY + + CID CVA  LF  L
Sbjct  66   GQYEELYICIDHCVAKDLFNYL  87



>ref|XP_003880575.1| hypothetical protein NCLIV_010110 [Neospora caninum Liverpool]
 emb|CBZ50542.1| hypothetical protein NCLIV_010110 [Neospora caninum Liverpool]
Length=89

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = -3

Query  445  EEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPK  266
            E +VD ++  E  C  +C   + EY AC KRV        +C+GQY +   CID+CVA  
Sbjct  24   ERLVDPRQKLEPGCTAQCSLWVNEYDACTKRVRARTDNKGNCSGQYEELHVCIDRCVAKD  83

Query  265  LFTKLK  248
            +F  LK
Sbjct  84   IFKYLK  89



>ref|XP_009033735.1| hypothetical protein AURANDRAFT_69671 [Aureococcus anophagefferens]
 gb|EGB11359.1| hypothetical protein AURANDRAFT_69671 [Aureococcus anophagefferens]
Length=67

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 35/69 (51%), Gaps = 2/69 (3%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            MSDEE V        +C+PKC    K Y +C  R++    G   C   YFD+  C+DKC 
Sbjct  1    MSDEEPVCPLPAMRKACEPKCTDAYKAYLSCVDRIEA--KGGGDCEPYYFDWLKCLDKCA  58

Query  274  APKLFTKLK  248
             P +  KLK
Sbjct  59   MPHIMQKLK  67



>ref|XP_001134613.1| ubiquinol-cytochrome-c reductase hinge protein [Dictyostelium 
discoideum AX4]
 sp|Q1ZXP3.1|QCR6_DICDI RecName: Full=Probable cytochrome b-c1 complex subunit 6; AltName: 
Full=Ubiquinol-cytochrome c reductase complex subunit 
6 [Dictyostelium discoideum]
 gb|EAS66929.1| ubiquinol-cytochrome-c reductase hinge protein [Dictyostelium 
discoideum AX4]
Length=69

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 1/57 (2%)
 Frame = -3

Query  415  EDSCKPKCVRQLKEYQACAKRVDGDESGHK-HCTGQYFDYWHCIDKCVAPKLFTKLK  248
            ++ C   C +    YQAC+ RV   E   K +C GQ+ ++  CIDKCV PKLF +LK
Sbjct  13   QEGCASGCEKSWSAYQACSGRVAKLEHDEKANCLGQFLEHVQCIDKCVGPKLFAQLK  69



>ref|XP_002108428.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV29226.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=116

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = -3

Query  436  VDQKKLYEDSC--KPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKL  263
            +D K +  + C   PKC      Y+ C  RV+   +  + CT + FD+ HC DKCVA  L
Sbjct  52   IDPKPILFEECGESPKCAPLKSVYETCNDRVNSRSNTEETCTQELFDFMHCADKCVAKTL  111

Query  262  FTKLK  248
            F++LK
Sbjct  112  FSRLK  116



>ref|XP_003287985.1| hypothetical protein DICPUDRAFT_152169 [Dictyostelium purpureum]
 gb|EGC35506.1| hypothetical protein DICPUDRAFT_152169 [Dictyostelium purpureum]
Length=71

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 5/59 (8%)
 Frame = -3

Query  415  EDSCKPKCVRQLKEYQACAKRVD---GDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            + SC+  C +    Y+ C+ RV+    DE  +  C GQ+ ++  CIDKCVAPKLF +LK
Sbjct  15   QKSCESNCTKTWTAYENCSGRVEKLVDDEKAN--CLGQFLEHIQCIDKCVAPKLFAQLK  71



>gb|KDR22439.1| Cytochrome b-c1 complex subunit 6, mitochondrial [Zootermopsis 
nevadensis]
Length=87

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSCK--PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            +E++VD ++   + C    KC    ++Y AC  RV+  +   + C+ + FDY HC+D CV
Sbjct  19   EEDLVDPQQTLREECHKLTKCTELQEKYTACNDRVNSRKKTSEICSEELFDYLHCVDACV  78

Query  274  APKLFTKLK  248
            +  LF+ LK
Sbjct  79   SKTLFSHLK  87



>ref|XP_008545652.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial [Microplitis 
demolitor]
Length=89

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 40/72 (56%), Gaps = 2/72 (3%)
 Frame = -3

Query  457  DMSDEEVVDQKKLYEDSC--KPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCID  284
            D  D E+VD +K+  + C  +PKCV+  +    C  RV+  +   + C  +  DY +C+D
Sbjct  18   DDEDAELVDPQKVLREKCSQEPKCVKFQERLTTCNNRVNSRKKTEETCLEELIDYVNCVD  77

Query  283  KCVAPKLFTKLK  248
             C +  LF+KLK
Sbjct  78   HCASHDLFSKLK  89



>emb|CCI47288.1| unnamed protein product [Albugo candida]
Length=67

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 37/69 (54%), Gaps = 2/69 (3%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            M  ++ VD   L  + CKPKC +  + Y+ C +RV   +SG   C G Y DY  CID   
Sbjct  1    MPKQDPVDVMVLIREECKPKCSKAKEVYECCLERVQQKQSG--DCDGYYLDYLSCIDHHS  58

Query  274  APKLFTKLK  248
            AP++   LK
Sbjct  59   APRIMKHLK  67



>ref|XP_011067618.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial [Acromyrmex 
echinatior]
 gb|EGI57306.1| Cytochrome b-c1 complex subunit 6, mitochondrial [Acromyrmex 
echinatior]
Length=89

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 36/70 (51%), Gaps = 2/70 (3%)
 Frame = -3

Query  451  SDEEVVDQKKLYEDSCK--PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKC  278
             +EE+VD + +  + C   PKCV   ++   C  RV+      + C  +  DY  C+D C
Sbjct  20   EEEELVDPQTVLREECSQLPKCVNFKEKLDTCNNRVNSRSHTEETCVEEILDYVQCVDHC  79

Query  277  VAPKLFTKLK  248
            VA  LF KLK
Sbjct  80   VAKTLFNKLK  89



>gb|EFN77372.1| Cytochrome b-c1 complex subunit 6, mitochondrial [Harpegnathos 
saltator]
Length=90

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 43/76 (57%), Gaps = 2/76 (3%)
 Frame = -3

Query  469  LSPFDMSDEEVVDQKKLYEDSC--KPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYW  296
            ++  + +++E+VDQ+++  D C  + KC    ++   C  RV+   +  + C  +  DY 
Sbjct  15   VNAEEEAEQELVDQQQVLRDKCSKEAKCHSLQEKLNTCNDRVNSRSNTEETCLEELIDYV  74

Query  295  HCIDKCVAPKLFTKLK  248
             C+D CVA  LF+KLK
Sbjct  75   ECVDHCVAKTLFSKLK  90



>ref|XP_004830886.1| ubiquinol-cytochrome c reductase hinge, putative [Babesia equi]
 gb|AFZ81220.1| ubiquinol-cytochrome c reductase hinge, putative [Babesia equi 
strain WA]
Length=96

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 41/81 (51%), Gaps = 8/81 (10%)
 Frame = -3

Query  469  LSPFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVD-------GDESGHKHCTGQ  311
            + P    D ++  + KL E +C  KC +  K Y  C +RV        G  SG  HC GQ
Sbjct  17   IPPTSEEDAQIDPRVKL-EPACNEKCKKYTKLYDECVERVTEYNKHNAGSLSGPGHCLGQ  75

Query  310  YFDYWHCIDKCVAPKLFTKLK  248
            ++D   C+DKC+A  LF  LK
Sbjct  76   HYDVVECVDKCLAKDLFRHLK  96



>gb|ABY27174.1| ubiquinol-cytochrome c reductase hinge protein [Perkinsus chesapeaki]
Length=93

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 35/72 (49%), Gaps = 0/72 (0%)
 Frame = -3

Query  463  PFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCID  284
            P    D E VD +      C  +C   L EY AC +R+     G  +C GQY ++  C D
Sbjct  22   PRKNEDGEFVDPRTDMLPKCAAECSEWLTEYNACVQRIKMRTDGRGNCQGQYEEFGMCQD  81

Query  283  KCVAPKLFTKLK  248
             C+A +LF  LK
Sbjct  82   HCIAHELFHYLK  93



>ref|XP_003746995.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like 
[Metaseiulus occidentalis]
Length=81

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 5/79 (6%)
 Frame = -3

Query  469  LSPF---DMSDEEVVDQKKLYEDSCK--PKCVRQLKEYQACAKRVDGDESGHKHCTGQYF  305
            LSP    ++ ++E+VD +    + C+  PKC    +++ AC  RV   +   + C+ +  
Sbjct  3    LSPVKAQEVEEQELVDPQTTLREKCREEPKCAAFKEKWDACETRVRSRKKTAETCSEELI  62

Query  304  DYWHCIDKCVAPKLFTKLK  248
            D+  C+D CVAP+LF  LK
Sbjct  63   DFIQCVDHCVAPELFKHLK  81



>ref|XP_002130060.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like 
isoform X2 [Ciona intestinalis]
Length=104

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = -3

Query  439  VVDQKKLYEDSC--KPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPK  266
            +VD      ++C   P C    +E   C +RV    +  +HCT + FD+ HC DKCV+  
Sbjct  39   LVDPMDAVRETCGGAPACKNYREELDVCTERVSSRSNTEEHCTQELFDFLHCSDKCVSQT  98

Query  265  LFTKLK  248
            LF +LK
Sbjct  99   LFKQLK  104



>ref|XP_005110018.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like 
[Aplysia californica]
Length=126

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = -3

Query  439  VVDQKKLYEDSCKPK--CVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPK  266
            ++D +   ++SC  K  CV   ++   C  RV+G     + CT +  D+ HC+D CVA  
Sbjct  61   LIDPQDTLKESCSEKRECVTLKEKLDECNARVEGRSKTSETCTEEIIDFMHCVDHCVAKS  120

Query  265  LFTKLK  248
            LFTKLK
Sbjct  121  LFTKLK  126



>gb|ACH45100.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
Length=79

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -3

Query  400  PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
             KCV+  +  + C +RV       + CT + FD+ H  D+CVA KLF+KLK
Sbjct  29   EKCVKARERLELCNERVSSRSESEEQCTEELFDFLHARDRCVAHKLFSKLK  79



>emb|CCF72903.1| unnamed protein product [Babesia microti strain RI]
Length=96

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 41/79 (52%), Gaps = 8/79 (10%)
 Frame = -3

Query  463  PFDMSDEEVVDQKKLYEDSCKPKCVRQLKEY-------QACAKRVDGDESGHKHCTGQYF  305
            P +  D ++  + KL E  C  KC + +K Y       Q+CA+RV      H  C GQ++
Sbjct  19   PLNDQDAQIDPKNKL-EPKCLEKCSKYVKLYDVNSTFIQSCAERVIAHPEQHLQCLGQHY  77

Query  304  DYWHCIDKCVAPKLFTKLK  248
            D  +C+D CVA  LF  LK
Sbjct  78   DIRYCVDNCVAKDLFRFLK  96



>gb|EFN69930.1| Cytochrome b-c1 complex subunit 6, mitochondrial [Camponotus 
floridanus]
Length=88

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 39/79 (49%), Gaps = 2/79 (3%)
 Frame = -3

Query  478  YFCLSPFDMSDEEVVDQKKLYEDSC--KPKCVRQLKEYQACAKRVDGDESGHKHCTGQYF  305
            Y  +   D  +EE+VD +K+  + C  + KC    K+   C  RV+      + C  +  
Sbjct  10   YLPIVKADDGEEELVDPQKVLREQCSQEEKCSNLQKKLTTCNDRVNSRSHTEETCLEELI  69

Query  304  DYWHCIDKCVAPKLFTKLK  248
            DY  C+D C A  LF+KLK
Sbjct  70   DYVQCVDHCAAKTLFSKLK  88



>ref|XP_844648.1| ubiquinol-cytochrome C reductase [Trypanosoma brucei brucei TREU927]
 gb|AAX80545.1| ubiquinol-cytochrome C reductase, putative [Trypanosoma brucei]
 gb|AAZ11089.1| ubiquinol-cytochrome C reductase, putative [Trypanosoma brucei 
brucei TREU927]
 emb|CBH10821.1| ubiquinol-cytochrome c reductase, putative [Trypanosoma brucei 
gambiense DAL972]
Length=71

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 37/70 (53%), Gaps = 2/70 (3%)
 Frame = -3

Query  454  MSDEEVVDQK-KLYEDSCKPKCVRQLKEYQACAKRV-DGDESGHKHCTGQYFDYWHCIDK  281
            M+DEE  D K  L +D     C  ++  Y AC +R+ D       HC  QYFD  HC+D 
Sbjct  1    MADEEPRDIKLDLEKDCLANNCQHKVLAYNACLERIKDIPSEKEPHCYHQYFDIVHCVDV  60

Query  280  CVAPKLFTKL  251
            CV PKL+  L
Sbjct  61   CVDPKLWPTL  70



>emb|CCC47766.1| putative ubiquinol-cytochrome c reductase [Trypanosoma vivax 
Y486]
Length=71

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPK-CVRQLKEYQACAKRVDGDESGHK-HCTGQYFDYWHCIDK  281
            M+DEE  D K   E  C  + C  ++  YQ C +R+       + HC  QYFD  HC+D 
Sbjct  1    MADEEPCDIKLDLEKECLAQSCQHKVAAYQECLERIKQVPPDREPHCYHQYFDIIHCVDV  60

Query  280  CVAPKLFTKLK  248
            CV PKL+  LK
Sbjct  61   CVDPKLWPTLK  71



>ref|XP_847572.1| mitochondrial hinge protein [Trypanosoma brucei brucei TREU927]
 gb|AAX69224.1| mitochondrial hinge protein, putative [Trypanosoma brucei]
 gb|AAZ13506.1| mitochondrial hinge protein, putative [Trypanosoma brucei brucei 
TREU927]
Length=71

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 37/70 (53%), Gaps = 2/70 (3%)
 Frame = -3

Query  454  MSDEEVVDQK-KLYEDSCKPKCVRQLKEYQACAKRV-DGDESGHKHCTGQYFDYWHCIDK  281
            M+DEE  D K  L +D     C  ++  Y AC +R+ D       HC  QYFD  HC+D 
Sbjct  1    MADEEPRDIKLDLEKDCLANNCQHKVLAYSACLERIKDIPSEKEPHCYHQYFDIVHCVDV  60

Query  280  CVAPKLFTKL  251
            CV PKL+  L
Sbjct  61   CVDPKLWPTL  70



>ref|XP_001654918.1| hypothetical protein AaeL_AAEL010801 [Aedes aegypti]
 gb|EJY57884.1| AAEL010801-PB [Aedes aegypti]
Length=107

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSCKPKCVR-QLKE-YQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            +EEVVD + +  + C       QL E YQAC  RV+   +  + C  + FDY H +D CV
Sbjct  39   EEEVVDPQVVLREKCAEHGTAPQLWEKYQACNDRVNSRSNTTETCVEELFDYLHELDHCV  98

Query  274  APKLFTKLK  248
               LF+KLK
Sbjct  99   TKTLFSKLK  107



>ref|XP_009315883.1| ubiquinol-cytochrome C reductase [Trypanosoma grayi]
 gb|KEG05887.1| ubiquinol-cytochrome C reductase [Trypanosoma grayi]
Length=71

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSCKPK-CVRQLKEYQACAKRVDGDESGHK-HCTGQYFDYWHCIDK  281
            MSDEE  D K   E  C  K C  ++  Y  C +R+    S  + HC  QYF   HC+D+
Sbjct  1    MSDEEPQDIKLELEKKCLAKDCSHKVVAYNECLERIKSIPSEKEPHCYHQYFGIVHCVDE  60

Query  280  CVAPKLFTKLK  248
            CV PKL+  LK
Sbjct  61   CVDPKLWPTLK  71



>ref|XP_002775032.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative 
[Perkinsus marinus ATCC 50983]
 ref|XP_002776275.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative 
[Perkinsus marinus ATCC 50983]
 ref|XP_002777816.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative 
[Perkinsus marinus ATCC 50983]
 gb|EER06848.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative 
[Perkinsus marinus ATCC 50983]
 gb|EER08091.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative 
[Perkinsus marinus ATCC 50983]
 gb|EER09611.1| ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative 
[Perkinsus marinus ATCC 50983]
Length=93

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 35/72 (49%), Gaps = 0/72 (0%)
 Frame = -3

Query  463  PFDMSDEEVVDQKKLYEDSCKPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCID  284
            P    D + VD +      C  +C   L EY AC +R+     G  +C GQY ++  C D
Sbjct  22   PRKNEDGDYVDPRTDMLPKCAAECSEWLTEYNACVQRIKMRTDGRGNCQGQYEEFAMCQD  81

Query  283  KCVAPKLFTKLK  248
             C+A +LF  LK
Sbjct  82   HCIAHELFHYLK  93



>gb|ADB57071.1| RH21839p [Drosophila melanogaster]
Length=105

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 3/93 (3%)
 Frame = -3

Query  517  LLLRSTFIRPSTSYFCLSPFDMSDEE-VVDQKKLYEDSCKPKC-VRQL-KEYQACAKRVD  347
            ++ + + I    ++F L      DEE +VD + +  + C+ K  +  L  +YQ C  RV+
Sbjct  13   VIFQKSLIMAFRNWFSLPAVRADDEEDLVDPQAVLREKCQAKGHIESLYNKYQECNDRVN  72

Query  346  GDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            G     + C  + FDY   +D CV+  LFTKLK
Sbjct  73   GRSKTTETCIEELFDYVAELDHCVSHSLFTKLK  105



>ref|XP_003700255.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like 
[Megachile rotundata]
Length=89

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (53%), Gaps = 2/72 (3%)
 Frame = -3

Query  457  DMSDEEVVDQKKLYEDSC--KPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCID  284
            D  + E+VD +K   + C  + KCV+  +    C  RV+      ++C  +  DY  C+D
Sbjct  18   DDDEGELVDHQKRLREKCSQQAKCVKMQERLTTCNDRVNSASETEENCLEELIDYVECVD  77

Query  283  KCVAPKLFTKLK  248
             CV+ KLF+ LK
Sbjct  78   HCVSEKLFSLLK  89



>gb|EPY16273.1| ubiquinol-cytochrome c reductase subunit 6 [Strigomonas culicis]
Length=70

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = -3

Query  445  EEVVDQKKLYEDSCKPK-CVRQLKEYQACAKRVDG-DESGHKHCTGQYFDYWHCIDKCVA  272
            E+ VD K   E +C  K C +++  Y+AC +R+   D +   HC  QYF   HC+D C  
Sbjct  3    EDPVDIKLDIEKACLAKECAKKVTAYEACLERIKTVDPALEPHCYHQYFAIVHCVDVCTD  62

Query  271  PKLFTKLK  248
            PKL+  LK
Sbjct  63   PKLWPTLK  70



>ref|XP_001654917.1| hypothetical protein AaeL_AAEL010801 [Aedes aegypti]
 gb|ABF18309.1| mitochondrial ubiquinol-cytochrome c reductase hinge protein 
[Aedes aegypti]
 gb|EAT37180.1| AAEL010801-PA [Aedes aegypti]
Length=86

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSCKPKCVR-QLKE-YQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            +EEVVD + +  + C       QL E YQAC  RV+   +  + C  + FDY H +D CV
Sbjct  18   EEEVVDPQVVLREKCAEHGTAPQLWEKYQACNDRVNSRSNTTETCVEELFDYLHELDHCV  77

Query  274  APKLFTKLK  248
               LF+KLK
Sbjct  78   TKTLFSKLK  86



>emb|CBN80231.1| ubiquinol cytochrome c reductase subunit 6 [Ectocarpus siliculosus]
Length=69

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 34/71 (48%), Gaps = 4/71 (6%)
 Frame = -3

Query  454  MSDEEVVDQKKLYEDSC--KPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDK  281
            M D+E VD       +C     C   + EY+AC +RV     G   C   +FDY  C+DK
Sbjct  1    MDDDEPVDPLTGIRATCGETTACSATMSEYKACVERVT--SKGFGTCEPWFFDYISCVDK  58

Query  280  CVAPKLFTKLK  248
            C APK+    K
Sbjct  59   CAAPKIMKATK  69



>ref|NP_001184190.1| cytochrome b-c1 complex subunit 6, mitochondrial [Taeniopygia 
guttata]
 ref|NP_001232864.1| ubiquinol-cytochrome c reductase hinge protein-like [Taeniopygia 
guttata]
 gb|ACH45088.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45089.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45093.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45094.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45095.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45098.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45099.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45101.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45102.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45103.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45104.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45107.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45109.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45110.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45112.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45113.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
Length=79

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -3

Query  400  PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
             KCV+  +  + C +RV       + CT + FD+ H  D CVA KLF+KLK
Sbjct  29   EKCVKARERLELCNERVSSRSESEEQCTEELFDFLHARDHCVAHKLFSKLK  79



>ref|XP_001996189.1| GH22364 [Drosophila grimshawi]
 gb|EDV98550.1| GH22364 [Drosophila grimshawi]
Length=86

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 2/72 (3%)
 Frame = -3

Query  457  DMSDEEVVDQKKLYEDSCKPKC-VRQL-KEYQACAKRVDGDESGHKHCTGQYFDYWHCID  284
            D  +E++VD +    D C+ K  +  L  +YQ C  RV+G     ++C  + FDY   +D
Sbjct  15   DEEEEDLVDPQTALRDKCQTKGNIESLYNKYQECNDRVNGRSKTTENCMEELFDYVAELD  74

Query  283  KCVAPKLFTKLK  248
             CVA  LF+KLK
Sbjct  75   HCVAHSLFSKLK  86



>gb|EZA50561.1| Cytochrome b-c1 complex subunit 6, mitochondrial [Cerapachys 
biroi]
Length=90

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (53%), Gaps = 2/72 (3%)
 Frame = -3

Query  457  DMSDEEVVDQKKLYEDSC--KPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCID  284
            +  +EE+VD +K+  + C  + KC    ++   C  RV+      + C  +  DY  C+D
Sbjct  19   EAEEEELVDPQKVLREECSKETKCANFQQKLMTCNDRVNSRTKTEETCLEELIDYVGCVD  78

Query  283  KCVAPKLFTKLK  248
             CVA  LF+KLK
Sbjct  79   HCVAKTLFSKLK  90



>gb|ACH45090.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45091.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45092.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45097.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45105.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45106.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
 gb|ACH45108.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
2 [Taeniopygia guttata]
 gb|ACH45111.1| putative ubiquinol-cytochrome c reductase hinge protein variant 
1 [Taeniopygia guttata]
Length=79

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -3

Query  400  PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
             KCV+  +  + C +RV       + CT + FD+ H  D CVA KLF+KLK
Sbjct  29   EKCVKARERLELCNERVSSRSDSEEQCTEELFDFLHARDHCVAHKLFSKLK  79



>ref|XP_005423236.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like, 
partial [Geospiza fortis]
Length=67

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -3

Query  397  KCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
            KCV+  +  + C +RV       + CT + FD+ H  D CVA KLF+KLK
Sbjct  18   KCVKARERLEQCNERVSSRSQTEEQCTEELFDFLHARDHCVAHKLFSKLK  67



>ref|XP_001632040.1| predicted protein [Nematostella vectensis]
 gb|EDO39977.1| predicted protein [Nematostella vectensis]
Length=104

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 35/67 (52%), Gaps = 2/67 (3%)
 Frame = -3

Query  442  EVVDQKKLYEDSC--KPKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAP  269
            ++VD      +SC  KP+C +   E   C +RV+   S  + C  +  D+ HC D CV+ 
Sbjct  38   DLVDPMDAIRESCEEKPECSKLKLELSNCEERVNSKSSTTETCAQELLDFMHCRDHCVSK  97

Query  268  KLFTKLK  248
             LF KLK
Sbjct  98   SLFNKLK  104



>ref|XP_001849620.1| mitochondrial ubiquinol-cytochrome c reductase hinge protein 
[Culex quinquefasciatus]
 gb|EDS30578.1| mitochondrial ubiquinol-cytochrome c reductase hinge protein 
[Culex quinquefasciatus]
Length=85

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 36/69 (52%), Gaps = 2/69 (3%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSCKP--KCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            +E++VD + +  + C       R  ++YQAC  RV       + C  + FDY H +D CV
Sbjct  17   EEDIVDPQTVLREKCAEHGSAPRLFEKYQACNDRVHSKSQTTETCVEELFDYLHELDHCV  76

Query  274  APKLFTKLK  248
               LF+KLK
Sbjct  77   NKTLFSKLK  85



>ref|XP_002073884.1| GK14352 [Drosophila willistoni]
 gb|EDW84870.1| GK14352 [Drosophila willistoni]
Length=86

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = -3

Query  448  DEEVVDQKKLYEDSCKPKC-VRQL-KEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCV  275
            +EE+VD +    +SC+ K  +  L  +YQ C  RV+G     + C  + FDY   +D CV
Sbjct  18   EEELVDPQTALRESCQTKGHIESLYNKYQECNDRVNGRSKTTETCVEELFDYVAELDHCV  77

Query  274  APKLFTKLK  248
            A  LF KLK
Sbjct  78   AHSLFAKLK  86



>ref|XP_009261873.1| hypothetical protein FPSE_10481 [Fusarium pseudograminearum CS3096]
 gb|EKJ69317.1| hypothetical protein FPSE_10481 [Fusarium pseudograminearum CS3096]
Length=133

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (54%), Gaps = 5/69 (7%)
 Frame = -3

Query  439  VVDQKKLYEDSCK--PKCVRQLKEYQACAKRVDGDES---GHKHCTGQYFDYWHCIDKCV  275
            +VDQK+  E+ CK  P+C      +  C +RV   ES     + C  ++F   HC   C 
Sbjct  65   LVDQKETLEEECKNAPQCAPAKHHFDECVERVQQQESEGGAKEDCVEEFFHLAHCATACA  124

Query  274  APKLFTKLK  248
            APKL+++LK
Sbjct  125  APKLWSQLK  133



>ref|XP_389665.1| hypothetical protein FG09489.1 [Fusarium graminearum PH-1]
 gb|ESU16082.1| hypothetical protein FGSG_09489 [Fusarium graminearum PH-1]
 gb|EYB31132.1| hypothetical protein FG05_09489 [Fusarium graminearum]
 emb|CEF85473.1| unnamed protein product [Fusarium graminearum]
Length=134

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (54%), Gaps = 5/69 (7%)
 Frame = -3

Query  439  VVDQKKLYEDSCK--PKCVRQLKEYQACAKRVDGDES---GHKHCTGQYFDYWHCIDKCV  275
            +VDQK+  E+ CK  P+C      +  C +RV   ES     + C  ++F   HC   C 
Sbjct  66   LVDQKETLEEECKNAPQCAPAKHHFDECVERVQQQESEGGAKEDCVEEFFHLAHCATACA  125

Query  274  APKLFTKLK  248
            APKL+++LK
Sbjct  126  APKLWSQLK  134



>ref|XP_003877776.1| ubiquinol-cytochrome-c reductase-like protein [Leishmania mexicana 
MHOM/GT/2001/U1103]
 emb|CBZ29316.1| ubiquinol-cytochrome-c reductase-like protein [Leishmania mexicana 
MHOM/GT/2001/U1103]
Length=135

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 45/91 (49%), Gaps = 6/91 (7%)
 Frame = -3

Query  514  LLRSTFIRPSTSYFCLSPFDMSDEEVVDQKKLYEDSC-KPKCVRQLKEYQACAKRVDG-D  341
            L+R  F + ++ + C  P   SD   VD K   E  C   +C +++  Y AC +R+    
Sbjct  49   LIRPIFQKSASLFDC--PAMASDP--VDIKLDLEKECLANECAKKVVAYNACLERIKTVS  104

Query  340  ESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
                 HC  QYF   HC+D CV PKL+  LK
Sbjct  105  PEKEPHCYNQYFAIVHCVDVCVDPKLWPTLK  135



>ref|XP_005482393.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like, 
partial [Zonotrichia albicollis]
Length=55

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -3

Query  400  PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
             KCV+  ++ + C +RV       + CT + FD+ H  D CVA KLF+KLK
Sbjct  5    EKCVKAREQLELCNERVASRSHTEEQCTEELFDFLHARDHCVAHKLFSKLK  55



>ref|XP_002737367.1| PREDICTED: cytochrome b-c1 complex subunit 6, mitochondrial-like 
[Saccoglossus kowalevskii]
Length=93

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -3

Query  400  PKCVRQLKEYQACAKRVDGDESGHKHCTGQYFDYWHCIDKCVAPKLFTKLK  248
             +C +   E + C +RV+   +  + CT + +D++HC D CVA  LF+KLK
Sbjct  43   SECQKLKTELEVCNERVNSRSNTEETCTQELYDFFHCTDHCVAKTLFSKLK  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 619402163716