BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20126_g1_i1 len=2566 path=[41:0-817 859:818-2565]

Length=2566
                                                                      Score     E

ref|NP_001234350.1|  meiotic serine proteinase                         1149   0.0      
ref|XP_006359213.1|  PREDICTED: subtilisin-like protease-like          1149   0.0      
ref|XP_009587411.1|  PREDICTED: subtilisin-like protease isoform X2    1144   0.0      
ref|XP_009587410.1|  PREDICTED: subtilisin-like protease isoform X1    1140   0.0      
gb|AAB38743.1|  proteinase TMP                                         1124   0.0      Solanum lycopersicum
ref|XP_009774619.1|  PREDICTED: uncharacterized protein LOC104224633   1122   0.0      
ref|XP_011047561.1|  PREDICTED: subtilisin-like protease               1039   0.0      
ref|XP_010274498.1|  PREDICTED: subtilisin-like protease SBT3.5        1039   0.0      
gb|EYU20571.1|  hypothetical protein MIMGU_mgv1a001516mg               1028   0.0      
ref|XP_002524360.1|  peptidase, putative                               1026   0.0      Ricinus communis
ref|XP_011070284.1|  PREDICTED: subtilisin-like protease               1021   0.0      
ref|XP_006368945.1|  hypothetical protein POPTR_0001s15120g            1019   0.0      
ref|XP_010677140.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    986   0.0      
ref|XP_006477567.1|  PREDICTED: subtilisin-like protease SDD1-like      979   0.0      
gb|KDO57036.1|  hypothetical protein CISIN_1g044171mg                   978   0.0      
ref|XP_010919913.1|  PREDICTED: uncharacterized protein LOC105043884    931   0.0      
dbj|BAA04839.1|  serine proteinase                                      903   0.0      Lilium longiflorum [Easter lily]
ref|XP_006440167.1|  hypothetical protein CICLE_v10019138mg             843   0.0      
ref|NP_001053456.2|  Os04g0543700                                       780   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAE04340.2|  OSJNBb0038F03.4                                        780   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEE61430.1|  hypothetical protein OsJ_15646                          780   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC77734.1|  hypothetical protein OsI_16841                          777   0.0      Oryza sativa Indica Group [Indian rice]
gb|AAT84609.1|  meiotic serine protease                                 773   0.0      Oryza sativa Indica Group [Indian rice]
gb|AAU01906.1|  meiotic serine proteinase-like protein                  773   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010240197.1|  PREDICTED: subtilisin-like protease isoform X1     759   0.0      
ref|XP_010240198.1|  PREDICTED: subtilisin-like protease isoform X2     757   0.0      
ref|XP_004978162.1|  PREDICTED: subtilisin-like protease-like           758   0.0      
emb|CDP08333.1|  unnamed protein product                                793   0.0      
ref|XP_008669069.1|  PREDICTED: subtilisin-like protease                739   0.0      
ref|XP_008794931.1|  PREDICTED: subtilisin-like protease SBT5.3         699   0.0      
gb|EMS61151.1|  Subtilisin-like protease SDD1                           691   0.0      
ref|XP_006838486.1|  hypothetical protein AMTR_s00002p00159190          679   0.0      
gb|EMT15030.1|  Subtilisin-like protease                                646   0.0      
ref|XP_002975131.1|  hypothetical protein SELMODRAFT_102404             615   0.0      
ref|XP_002977534.1|  hypothetical protein SELMODRAFT_106806             613   0.0      
ref|XP_006850906.1|  hypothetical protein AMTR_s00025p00169730          612   0.0      
ref|XP_004242827.1|  PREDICTED: subtilisin-like protease                606   0.0      
ref|XP_010048581.1|  PREDICTED: subtilisin-like protease                603   0.0      
ref|XP_002267221.2|  PREDICTED: subtilisin-like protease SBT3.5         602   0.0      Vitis vinifera
ref|XP_006361635.1|  PREDICTED: subtilisin-like protease-like iso...    601   0.0      
ref|XP_010932085.1|  PREDICTED: subtilisin-like protease SBT3.5         600   0.0      
ref|XP_002269786.1|  PREDICTED: subtilisin-like protease isoform X4     598   0.0      Vitis vinifera
ref|XP_010656765.1|  PREDICTED: subtilisin-like protease isoform X2     599   0.0      
ref|XP_010656764.1|  PREDICTED: subtilisin-like protease isoform X1     599   0.0      
ref|XP_010656766.1|  PREDICTED: subtilisin-like protease isoform X3     598   0.0      
ref|XP_003549311.1|  PREDICTED: subtilisin-like protease-like iso...    597   0.0      
ref|XP_004966115.1|  PREDICTED: subtilisin-like protease-like           597   0.0      
gb|AES92256.2|  subtilisin-like serine protease                         596   0.0      
ref|XP_009359924.1|  PREDICTED: subtilisin-like protease isoform X1     596   0.0      
ref|XP_002518424.1|  subtilase, putative                                595   0.0      Ricinus communis
emb|CDO98551.1|  unnamed protein product                                595   0.0      
ref|XP_010244166.1|  PREDICTED: subtilisin-like protease SBT3.5         595   0.0      
ref|XP_002977363.1|  hypothetical protein SELMODRAFT_107145             595   0.0      
ref|XP_002437534.1|  hypothetical protein SORBIDRAFT_10g028870          594   0.0      Sorghum bicolor [broomcorn]
gb|KHN17628.1|  Subtilisin-like protease                                594   0.0      
ref|XP_008681561.1|  PREDICTED: uncharacterized protein LOC100274...    593   0.0      
gb|AES65305.2|  subtilisin-like serine protease                         593   0.0      
ref|XP_003610059.1|  Subtilisin-like serine protease                    593   0.0      
ref|XP_003610476.1|  Serine protease aprX                               592   0.0      
ref|XP_006409082.1|  hypothetical protein EUTSA_v10022560mg             591   0.0      
ref|NP_001058476.1|  Os06g0700000                                       591   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009617960.1|  PREDICTED: subtilisin-like protease                590   0.0      
ref|XP_008362983.1|  PREDICTED: subtilisin-like protease isoform X1     590   0.0      
ref|XP_002527706.1|  peptidase, putative                                590   0.0      Ricinus communis
ref|XP_009777383.1|  PREDICTED: subtilisin-like protease                590   0.0      
ref|XP_006283123.1|  hypothetical protein CARUB_v10004145mg             589   0.0      
ref|XP_006412776.1|  hypothetical protein EUTSA_v10024432mg             589   0.0      
ref|XP_010099159.1|  Subtilisin-like protease                           590   0.0      
ref|XP_008223890.1|  PREDICTED: subtilisin-like protease isoform X1     589   0.0      
ref|XP_010927223.1|  PREDICTED: subtilisin-like protease isoform X2     589   0.0      
gb|KDO61882.1|  hypothetical protein CISIN_1g003469mg                   589   0.0      
ref|XP_003533733.1|  PREDICTED: subtilisin-like protease-like           588   0.0      
ref|XP_002869402.1|  subtilase family protein                           588   0.0      
ref|XP_008798105.1|  PREDICTED: subtilisin-like protease                588   0.0      
ref|XP_010927222.1|  PREDICTED: subtilisin-like protease isoform X1     589   0.0      
ref|XP_006453271.1|  hypothetical protein CICLE_v10007470mg             587   0.0      
ref|XP_007213647.1|  hypothetical protein PRUPE_ppa001469mg             587   0.0      
ref|XP_006597795.1|  PREDICTED: subtilisin-like protease-like iso...    587   0.0      
emb|CDX68618.1|  BnaC01g08350D                                          587   0.0      
ref|XP_010688415.1|  PREDICTED: subtilisin-like protease                586   0.0      
ref|NP_567839.1|  PA-domain containing subtilase family protein         585   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009419985.1|  PREDICTED: subtilisin-like protease                585   0.0      
ref|XP_010541123.1|  PREDICTED: subtilisin-like protease isoform X2     585   0.0      
ref|XP_010447778.1|  PREDICTED: subtilisin-like protease                585   0.0      
ref|XP_004487981.1|  PREDICTED: subtilisin-like protease-like iso...    585   0.0      
gb|KDP27456.1|  hypothetical protein JCGZ_19817                         585   0.0      
ref|XP_009417494.1|  PREDICTED: subtilisin-like protease                585   0.0      
emb|CDY30179.1|  BnaA03g49910D                                          585   0.0      
ref|XP_010277212.1|  PREDICTED: subtilisin-like protease                585   0.0      
ref|XP_010541122.1|  PREDICTED: subtilisin-like protease isoform X1     585   0.0      
ref|XP_011094092.1|  PREDICTED: subtilisin-like protease                584   0.0      
ref|NP_565447.1|  subtilisin-like serine protease 3                     584   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003547451.1|  PREDICTED: subtilisin-like protease-like iso...    585   0.0      
gb|ACC68158.1|  putative subtilase family protein                       584   0.0      Arabidopsis halleri subsp. halleri
ref|XP_008391577.1|  PREDICTED: subtilisin-like protease isoform X1     584   0.0      
ref|XP_010433037.1|  PREDICTED: subtilisin-like protease isoform X1     584   0.0      
emb|CDY43550.1|  BnaA01g06940D                                          584   0.0      
ref|XP_003595054.1|  Subtilisin-like serine protease                    584   0.0      
ref|XP_010438228.1|  PREDICTED: subtilisin-like protease isoform X1     583   0.0      
emb|CDX82627.1|  BnaC07g02390D                                          583   0.0      
gb|KHN15331.1|  Subtilisin-like protease                                583   0.0      
ref|XP_007138780.1|  hypothetical protein PHAVU_009G236800g             583   0.0      
ref|XP_009137881.1|  PREDICTED: subtilisin-like protease isoform X1     583   0.0      
gb|KDP40114.1|  hypothetical protein JCGZ_02112                         583   0.0      
ref|XP_007154721.1|  hypothetical protein PHAVU_003G141800g             582   0.0      
ref|XP_002308119.1|  subtilase family protein                           582   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010526401.1|  PREDICTED: subtilisin-like protease                582   0.0      
ref|XP_002884175.1|  hypothetical protein ARALYDRAFT_480817             582   0.0      
ref|XP_009112595.1|  PREDICTED: subtilisin-like protease                582   0.0      
emb|CDY51088.1|  BnaA07g36110D                                          582   0.0      
ref|XP_010415086.1|  PREDICTED: subtilisin-like protease isoform X1     581   0.0      
ref|XP_011019996.1|  PREDICTED: subtilisin-like protease                581   0.0      
ref|XP_009102195.1|  PREDICTED: subtilisin-like protease                581   0.0      
ref|XP_011077723.1|  PREDICTED: subtilisin-like protease                581   0.0      
gb|EYU38752.1|  hypothetical protein MIMGU_mgv1a001891mg                578   0.0      
ref|XP_003563504.1|  PREDICTED: subtilisin-like protease                580   0.0      
ref|XP_007026177.1|  PA-domain containing subtilase family protein      580   0.0      
dbj|BAJ94838.1|  predicted protein                                      580   0.0      
ref|XP_009128155.1|  PREDICTED: subtilisin-like protease                580   0.0      
ref|XP_010467868.1|  PREDICTED: subtilisin-like protease                579   0.0      
ref|XP_010489462.1|  PREDICTED: subtilisin-like protease                579   0.0      
emb|CDP04444.1|  unnamed protein product                                579   0.0      
ref|XP_010087981.1|  Subtilisin-like protease                           583   0.0      
emb|CDY46723.1|  BnaC07g42280D                                          578   0.0      
ref|NP_001288400.1|  subtilisin-like protease precursor                 578   0.0      
ref|XP_006297001.1|  hypothetical protein CARUB_v10012994mg             577   0.0      
ref|XP_007153989.1|  hypothetical protein PHAVU_003G081700g             577   0.0      
ref|XP_002974943.1|  hypothetical protein SELMODRAFT_415166             578   0.0      
gb|KHG09526.1|  Subtilisin-like protease                                577   0.0      
gb|ACG29348.1|  SLP3                                                    576   0.0      Zea mays [maize]
ref|XP_004487980.1|  PREDICTED: subtilisin-like protease-like iso...    576   0.0      
ref|XP_011017651.1|  PREDICTED: subtilisin-like protease                575   0.0      
ref|XP_002324698.2|  hypothetical protein POPTR_0018s14020g             575   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007014396.1|  Subtilisin-like serine protease 3 isoform 1        574   0.0      
ref|XP_004163028.1|  PREDICTED: subtilisin-like protease-like           574   0.0      
gb|EPS72989.1|  hypothetical protein M569_01766                         574   0.0      
ref|XP_001769779.1|  predicted protein                                  573   0.0      
ref|XP_004148317.1|  PREDICTED: subtilisin-like protease-like           573   0.0      
gb|KHN35806.1|  Subtilisin-like protease                                570   0.0      
ref|XP_004296484.1|  PREDICTED: subtilisin-like protease-like           572   0.0      
ref|XP_008224714.1|  PREDICTED: subtilisin-like protease                572   0.0      
ref|XP_004235142.1|  PREDICTED: subtilisin-like protease SBT3.5         570   0.0      
ref|XP_009799224.1|  PREDICTED: subtilisin-like protease                569   0.0      
ref|XP_008451260.1|  PREDICTED: subtilisin-like protease                568   0.0      
gb|EMS48472.1|  Subtilisin-like protease                                579   0.0      
ref|XP_010415105.1|  PREDICTED: subtilisin-like protease isoform X2     565   0.0      
ref|XP_001769281.1|  predicted protein                                  564   0.0      
ref|XP_003543346.1|  PREDICTED: subtilisin-like protease-like iso...    565   0.0      
ref|XP_011095996.1|  PREDICTED: subtilisin-like protease SBT3.5         565   0.0      
ref|XP_010907007.1|  PREDICTED: subtilisin-like protease                565   0.0      
ref|XP_011004882.1|  PREDICTED: subtilisin-like protease                565   0.0      
ref|XP_004295296.1|  PREDICTED: subtilisin-like protease-like           564   0.0      
ref|XP_006370478.1|  hypothetical protein POPTR_0001s43080g             564   0.0      
dbj|BAB70678.1|  subtilisin-like serine protease                        562   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ADW11232.1|  subtilisin-like protease 1                              562   0.0      
ref|XP_006355166.1|  PREDICTED: subtilisin-like protease SDD1-like      565   0.0      
ref|XP_010098500.1|  Subtilisin-like protease                           562   0.0      
ref|XP_004508227.1|  PREDICTED: cucumisin-like                          561   0.0      
ref|XP_009624089.1|  PREDICTED: subtilisin-like protease                559   0.0      
ref|XP_008384255.1|  PREDICTED: subtilisin-like protease                560   0.0      
ref|XP_009123389.1|  PREDICTED: subtilisin-like protease SBT5.3         561   0.0      
ref|XP_010473453.1|  PREDICTED: subtilisin-like protease SBT3.5         560   0.0      
ref|XP_010686861.1|  PREDICTED: subtilisin-like protease SBT3.5         558   0.0      
emb|CDY08646.1|  BnaC04g19550D                                          558   0.0      
ref|XP_010430283.1|  PREDICTED: subtilisin-like protease SBT3.5         556   0.0      
ref|XP_006467378.1|  PREDICTED: subtilisin-like protease-like iso...    556   0.0      
ref|XP_010246696.1|  PREDICTED: subtilisin-like protease                557   0.0      
ref|XP_007014399.1|  Subtilisin-like serine protease 3 isoform 4        553   0.0      
ref|XP_009419011.1|  PREDICTED: subtilisin-like protease                556   0.0      
ref|XP_006836419.1|  hypothetical protein AMTR_s00092p00154570          556   0.0      
ref|XP_009357595.1|  PREDICTED: subtilisin-like protease                555   0.0      
ref|XP_007022969.1|  Subtilase family protein isoform 2                 556   0.0      
gb|KHG07654.1|  Subtilisin-like protease                                556   0.0      
ref|XP_006398065.1|  hypothetical protein EUTSA_v10000774mg             556   0.0      
ref|XP_003528700.1|  PREDICTED: subtilisin-like protease-like           554   0.0      
gb|KHN35712.1|  Subtilisin-like protease                                552   0.0      
ref|XP_010036631.1|  PREDICTED: subtilisin-like protease                554   0.0      
ref|XP_009115124.1|  PREDICTED: subtilisin-like protease                554   1e-180   
ref|XP_006449795.1|  hypothetical protein CICLE_v10014290mg             553   2e-180   
ref|XP_006468393.1|  PREDICTED: subtilisin-like protease-like           553   3e-180   
gb|EEC81259.1|  hypothetical protein OsI_24350                          554   4e-180   Oryza sativa Indica Group [Indian rice]
ref|XP_002317684.2|  subtilase family protein                           553   4e-180   Populus trichocarpa [western balsam poplar]
ref|NP_564793.2|  subtilisin-like serine protease ALE1                  552   5e-180   Arabidopsis thaliana [mouse-ear cress]
gb|KDO77536.1|  hypothetical protein CISIN_1g003005mg                   553   5e-180   
emb|CDY02310.1|  BnaA09g25920D                                          552   6e-180   
ref|XP_011040564.1|  PREDICTED: subtilisin-like protease                552   6e-180   
emb|CDY09557.1|  BnaC05g23620D                                          552   7e-180   
ref|XP_006363641.1|  PREDICTED: subtilisin-like protease-like           552   7e-180   
ref|XP_006448798.1|  hypothetical protein CICLE_v10014244mg             552   1e-179   
ref|XP_010418222.1|  PREDICTED: subtilisin-like protease SBT3.5         550   1e-179   
ref|XP_008225702.1|  PREDICTED: subtilisin-like protease                551   2e-179   
gb|EYU19074.1|  hypothetical protein MIMGU_mgv1a001321mg                551   2e-179   
ref|XP_006587105.1|  PREDICTED: subtilisin-like protease SDD1-like      551   2e-179   
ref|XP_008793537.1|  PREDICTED: subtilisin-like protease isoform X1     550   2e-179   
ref|XP_010315640.1|  PREDICTED: subtilisin-like protease isoform X2     548   3e-179   
gb|KHN29777.1|  Subtilisin-like protease SDD1                           550   3e-179   
ref|XP_010494483.1|  PREDICTED: subtilisin-like protease                550   3e-179   
ref|XP_004295458.1|  PREDICTED: subtilisin-like protease-like           551   5e-179   
ref|XP_009796976.1|  PREDICTED: subtilisin-like protease                550   9e-179   
ref|XP_010655857.1|  PREDICTED: subtilisin-like protease SDD1           549   1e-178   
ref|XP_006644772.1|  PREDICTED: subtilisin-like protease-like           549   1e-178   
ref|XP_009602760.1|  PREDICTED: subtilisin-like protease                549   1e-178   
ref|XP_010529345.1|  PREDICTED: subtilisin-like protease                549   2e-178   
ref|XP_008793538.1|  PREDICTED: subtilisin-like protease isoform X2     546   2e-178   
ref|XP_004145469.1|  PREDICTED: subtilisin-like protease SDD1-like      546   2e-178   
ref|XP_007211343.1|  hypothetical protein PRUPE_ppa001355mg             548   3e-178   
ref|XP_006281657.1|  hypothetical protein CARUB_v10027793mg             548   3e-178   
ref|XP_009101698.1|  PREDICTED: subtilisin-like protease isoform X1     548   3e-178   
ref|XP_009101701.1|  PREDICTED: subtilisin-like protease isoform X2     548   3e-178   
ref|XP_004231572.1|  PREDICTED: subtilisin-like protease isoform X1     548   3e-178   
emb|CDY49018.1|  BnaAnng10120D                                          548   4e-178   
ref|XP_007138552.1|  hypothetical protein PHAVU_009G218900g             548   4e-178   
gb|EAY75970.1|  hypothetical protein OsI_03889                          548   4e-178   Oryza sativa Indica Group [Indian rice]
ref|XP_006597917.1|  PREDICTED: subtilisin-like protease SDD1-like      549   5e-178   
ref|XP_002865359.1|  subtilase family protein                           547   5e-178   
gb|KHN09893.1|  Subtilisin-like protease SDD1                           548   6e-178   
gb|AAF70850.1|AC003113_17  F2401.7                                      543   1e-177   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001044371.1|  Os01g0769200                                       546   1e-177   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99303.1|  predicted protein                                      546   2e-177   
ref|NP_568634.1|  Subtilase family protein                              545   3e-177   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460865.1|  PREDICTED: subtilisin-like protease                545   3e-177   
ref|XP_002893636.1|  subtilase family protein                           545   3e-177   
ref|XP_011002567.1|  PREDICTED: subtilisin-like protease SBT3.5         543   3e-177   
ref|XP_011096735.1|  PREDICTED: subtilisin-like protease SBT3.5         545   3e-177   
ref|XP_003569908.2|  PREDICTED: subtilisin-like protease                546   3e-177   
ref|XP_002886474.1|  hypothetical protein ARALYDRAFT_893252             545   4e-177   
ref|XP_008383350.1|  PREDICTED: subtilisin-like protease                545   4e-177   
gb|KDP34877.1|  hypothetical protein JCGZ_09165                         545   5e-177   
dbj|BAG95740.1|  unnamed protein product                                540   5e-177   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006353035.1|  PREDICTED: subtilisin-like protease-like           545   8e-177   
ref|XP_004233183.1|  PREDICTED: subtilisin-like protease                545   8e-177   
ref|XP_006415447.1|  hypothetical protein EUTSA_v10006799mg             543   1e-176   
ref|XP_009403397.1|  PREDICTED: subtilisin-like protease                543   2e-176   
ref|XP_010441875.1|  PREDICTED: subtilisin-like protease                542   4e-176   
emb|CDP12620.1|  unnamed protein product                                542   5e-176   
ref|XP_009133843.1|  PREDICTED: subtilisin-like protease isoform X1     543   5e-176   
gb|EMT07893.1|  Subtilisin-like protease                                541   6e-176   
ref|XP_010054605.1|  PREDICTED: subtilisin-like protease                541   7e-176   
ref|XP_009353895.1|  PREDICTED: subtilisin-like protease                541   7e-176   
gb|KFK31649.1|  hypothetical protein AALP_AA6G140700                    542   8e-176   
ref|XP_006413867.1|  hypothetical protein EUTSA_v10024389mg             541   1e-175   
ref|XP_010478484.1|  PREDICTED: subtilisin-like protease                541   1e-175   
ref|XP_010439575.1|  PREDICTED: subtilisin-like protease                541   2e-175   
gb|EYU27728.1|  hypothetical protein MIMGU_mgv1a001453mg                540   2e-175   
ref|XP_010501666.1|  PREDICTED: subtilisin-like protease                541   2e-175   
emb|CDY49493.1|  BnaC07g18060D                                          541   3e-175   
emb|CDX78995.1|  BnaA01g10620D                                          540   4e-175   
ref|NP_174348.1|  subtilase-like protein                                539   4e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007014400.1|  Subtilisin-like serine protease 3 isoform 5        536   5e-175   
ref|XP_002456409.1|  hypothetical protein SORBIDRAFT_03g035770          540   6e-175   Sorghum bicolor [broomcorn]
ref|XP_006283103.1|  hypothetical protein CARUB_v10004119mg             540   6e-175   
ref|XP_010680007.1|  PREDICTED: subtilisin-like protease                538   9e-175   
ref|XP_008366897.1|  PREDICTED: subtilisin-like protease                538   1e-174   
ref|XP_009351231.1|  PREDICTED: subtilisin-like protease isoform X1     539   1e-174   
ref|XP_001753148.1|  predicted protein                                  541   1e-174   
gb|KFK28672.1|  hypothetical protein AALP_AA7G031200                    539   1e-174   
ref|XP_010519036.1|  PREDICTED: subtilisin-like protease                538   2e-174   
ref|XP_009359925.1|  PREDICTED: subtilisin-like protease isoform X2     533   2e-174   
ref|XP_006391901.1|  hypothetical protein EUTSA_v10023274mg             537   4e-174   
emb|CDM84374.1|  unnamed protein product                                537   4e-174   
ref|NP_567601.1|  Subtilase family protein                              537   5e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449169.1|  PREDICTED: subtilisin-like protease                537   6e-174   
ref|XP_008673072.1|  PREDICTED: uncharacterized protein LOC100381...    534   6e-174   
emb|CDX82765.1|  BnaC01g12150D                                          537   8e-174   
ref|XP_006306773.1|  hypothetical protein CARUB_v10008312mg             535   1e-173   
gb|KEH37751.1|  subtilisin-like serine protease                         536   2e-173   
gb|KGN49497.1|  hypothetical protein Csa_6G526310                       535   2e-173   
ref|XP_004970102.1|  PREDICTED: subtilisin-like protease-like           536   2e-173   
ref|XP_002867881.1|  subtilase family protein                           536   2e-173   
ref|XP_004488203.1|  PREDICTED: subtilisin-like protease SDD1-like      535   4e-173   
ref|XP_008673071.1|  PREDICTED: uncharacterized protein LOC100381...    535   4e-173   
ref|XP_001754695.1|  predicted protein                                  537   5e-173   
ref|XP_008439503.1|  PREDICTED: subtilisin-like protease                534   6e-173   
ref|XP_008673070.1|  PREDICTED: uncharacterized protein LOC100381...    535   6e-173   
ref|XP_009133860.1|  PREDICTED: subtilisin-like protease isoform X2     534   6e-173   
ref|XP_008362986.1|  PREDICTED: subtilisin-like protease isoform X2     529   9e-173   
ref|XP_010484839.1|  PREDICTED: subtilisin-like protease                533   9e-173   
gb|KHN48113.1|  Subtilisin-like protease                                533   1e-172   
ref|XP_008223891.1|  PREDICTED: subtilisin-like protease isoform X2     528   1e-172   
ref|XP_004158698.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    533   2e-172   
ref|XP_008657193.1|  PREDICTED: subtilisin-like protease isoform X2     533   2e-172   
ref|XP_008657192.1|  PREDICTED: subtilisin-like protease isoform X1     533   3e-172   
gb|KCW80863.1|  hypothetical protein EUGRSUZ_C02222                     527   5e-172   
gb|EMT32675.1|  Subtilisin-like protease                                532   8e-172   
ref|XP_010927226.1|  PREDICTED: subtilisin-like protease isoform X3     525   2e-171   
ref|XP_004134889.1|  PREDICTED: subtilisin-like protease SDD1-like      529   1e-170   
ref|XP_008391579.1|  PREDICTED: subtilisin-like protease isoform X2     523   1e-170   
ref|XP_010533791.1|  PREDICTED: subtilisin-like protease SBT3.5         527   1e-170   
ref|XP_002975845.1|  hypothetical protein SELMODRAFT_442989             528   2e-170   
ref|XP_006300951.1|  hypothetical protein CARUB_v10021339mg             527   2e-170   
ref|XP_009137883.1|  PREDICTED: subtilisin-like protease isoform X2     523   3e-170   
ref|XP_010433042.1|  PREDICTED: subtilisin-like protease isoform X2     522   4e-170   
ref|XP_002965751.1|  hypothetical protein SELMODRAFT_84191              525   4e-170   
gb|EMT00885.1|  Subtilisin-like protease                                526   5e-170   
ref|XP_008459133.1|  PREDICTED: LOW QUALITY PROTEIN: cucumisin          525   6e-170   
ref|XP_010438231.1|  PREDICTED: subtilisin-like protease isoform X2     521   7e-170   
ref|XP_002317149.2|  abnormal leaf shape family protein                 521   8e-169   
gb|AFW69323.1|  putative subtilase family protein                       521   1e-168   
ref|XP_007022968.1|  Subtilase family protein isoform 1                 521   1e-168   
ref|XP_002993122.1|  hypothetical protein SELMODRAFT_136624             520   2e-168   
ref|XP_006453270.1|  hypothetical protein CICLE_v10007470mg             517   1e-167   
ref|XP_007159610.1|  hypothetical protein PHAVU_002G251800g             520   3e-167   
gb|KCW77016.1|  hypothetical protein EUGRSUZ_D01361                     514   3e-166   
gb|KHG22299.1|  Subtilisin-like protease                                514   3e-166   
ref|XP_003532800.2|  PREDICTED: subtilisin-like protease-like iso...    515   1e-165   
emb|CDY32034.1|  BnaA03g60380D                                          512   1e-164   
ref|XP_003524240.2|  PREDICTED: subtilisin-like protease-like iso...    512   2e-164   
ref|XP_008663063.1|  PREDICTED: subtilisin-like protease                509   1e-163   
ref|NP_001190781.1|  Subtilase family protein                           507   8e-163   
ref|XP_002964545.1|  hypothetical protein SELMODRAFT_81707              503   3e-161   
ref|XP_004504167.1|  PREDICTED: subtilisin-like protease-like iso...    503   7e-161   
ref|XP_003630005.1|  Serine protease aprX                               502   1e-160   
dbj|BAJ87766.1|  predicted protein                                      492   6e-159   
ref|XP_007022970.1|  Subtilase family protein isoform 3                 494   1e-158   
ref|XP_009351232.1|  PREDICTED: subtilisin-like protease isoform X2     491   1e-156   
ref|XP_002447540.1|  hypothetical protein SORBIDRAFT_06g003020          488   3e-155   
gb|KDO77537.1|  hypothetical protein CISIN_1g003005mg                   476   4e-152   
ref|XP_006448797.1|  hypothetical protein CICLE_v10014244mg             475   9e-152   
ref|XP_007022971.1|  Subtilase family protein isoform 4                 474   1e-151   
ref|XP_010315642.1|  PREDICTED: subtilisin-like protease isoform X4     469   1e-149   
ref|XP_006580233.1|  PREDICTED: subtilisin-like protease-like iso...    472   2e-149   
ref|XP_010315641.1|  PREDICTED: subtilisin-like protease isoform X3     469   3e-149   
ref|XP_002446876.1|  hypothetical protein SORBIDRAFT_06g024130          462   5e-149   
emb|CBI40925.3|  unnamed protein product                                474   3e-148   
ref|XP_006467379.1|  PREDICTED: subtilisin-like protease-like iso...    464   1e-147   
gb|KHN03502.1|  Subtilisin-like protease                                446   2e-141   
ref|XP_001753131.1|  predicted protein                                  434   3e-135   
gb|KDO61884.1|  hypothetical protein CISIN_1g003469mg                   428   8e-135   
gb|AFW75873.1|  putative subtilase family protein                       407   1e-127   
ref|XP_006837258.1|  hypothetical protein AMTR_s00112p00083750          402   5e-126   
gb|EMS49017.1|  Subtilisin-like protease                                401   3e-122   
ref|XP_001761417.1|  predicted protein                                  397   1e-121   
ref|XP_010646374.1|  PREDICTED: subtilisin-like protease SBT3.5         363   2e-115   
gb|AAY54007.1|  subtilisin-like protease                                366   3e-112   
gb|EPS64802.1|  hypothetical protein M569_09977                         358   8e-110   
gb|EPS66289.1|  hypothetical protein M569_08487                         343   1e-103   
ref|XP_010270603.1|  PREDICTED: subtilisin-like protease SBT5.3         342   5e-101   
ref|XP_004287692.1|  PREDICTED: subtilisin-like protease-like           340   4e-100   
ref|XP_007046422.1|  Subtilisin-like serine endopeptidase family ...    340   6e-100   
ref|XP_008242125.1|  PREDICTED: subtilisin-like protease                338   2e-99    
ref|XP_007204641.1|  hypothetical protein PRUPE_ppa001800mg             336   1e-98    
ref|XP_004512297.1|  PREDICTED: subtilisin-like protease-like iso...    335   3e-98    
ref|XP_004512299.1|  PREDICTED: subtilisin-like protease-like iso...    334   4e-98    
ref|XP_003534221.1|  PREDICTED: subtilisin-like protease-like           333   1e-97    
gb|KEH20335.1|  subtilisin-like serine protease                         332   2e-97    
ref|XP_003629039.1|  Serine protease-like protein                       333   2e-97    
ref|XP_006467138.1|  PREDICTED: subtilisin-like protease-like iso...    332   3e-97    
ref|WP_034712814.1|  hypothetical protein                               337   3e-97    
gb|EWT07612.1|  hypothetical protein N864_03230                         337   5e-97    
ref|XP_006425216.1|  hypothetical protein CICLE_v10024941mg             332   7e-97    
gb|KHN38839.1|  Subtilisin-like protease                                330   2e-96    
ref|XP_010649320.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    329   2e-96    
ref|XP_009782970.1|  PREDICTED: subtilisin-like protease SBT5.4         330   3e-96    
ref|XP_006599275.1|  PREDICTED: subtilisin-like protease-like iso...    328   3e-96    
ref|XP_002263237.2|  PREDICTED: subtilisin-like protease SBT3.5 i...    329   5e-96    
ref|XP_010649319.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    328   5e-96    
emb|CBI37484.3|  unnamed protein product                                329   6e-96    
ref|XP_003547892.1|  PREDICTED: subtilisin-like protease-like iso...    328   7e-96    
ref|XP_009606152.1|  PREDICTED: subtilisin-like protease SBT5.4         328   7e-96    
ref|XP_009359651.1|  PREDICTED: subtilisin-like protease SBT5.4         328   1e-95    
ref|XP_004509478.1|  PREDICTED: subtilisin-like protease SDD1-lik...    327   1e-95    
gb|KEH27645.1|  subtilisin-like serine protease                         327   1e-95    
ref|XP_003612438.1|  Subtilisin-like protease                           328   2e-95    
ref|XP_010317055.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    327   3e-95    
ref|XP_004509477.1|  PREDICTED: subtilisin-like protease SDD1-lik...    327   4e-95    
gb|KDO71607.1|  hypothetical protein CISIN_1g004205mg                   327   4e-95    
gb|KDO77538.1|  hypothetical protein CISIN_1g003005mg                   320   9e-95    
ref|XP_002528535.1|  Cucumisin precursor, putative                      325   1e-94    
ref|XP_002529889.1|  peptidase, putative                                318   1e-94    
ref|XP_007156353.1|  hypothetical protein PHAVU_003G279300g             323   5e-94    
gb|KHN28302.1|  Subtilisin-like protease                                322   2e-93    
ref|XP_004233282.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    322   2e-93    
ref|XP_006849918.1|  hypothetical protein AMTR_s00022p00110120          319   3e-93    
emb|CDY70459.1|  BnaAnng33760D                                          312   3e-93    
emb|CDY68050.1|  BnaA09g52920D                                          312   3e-93    
ref|XP_009420549.1|  PREDICTED: subtilisin-like protease SBT5.3         321   5e-93    
ref|XP_003516513.1|  PREDICTED: subtilisin-like protease-like           320   9e-93    
ref|XP_003538919.1|  PREDICTED: subtilisin-like protease-like           320   1e-92    
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           318   5e-92    
ref|WP_030329454.1|  hypothetical protein                               323   7e-92    
ref|XP_011038086.1|  PREDICTED: subtilisin-like protease SBT3.5         317   1e-91    
ref|XP_006365013.1|  PREDICTED: subtilisin-like protease-like           317   1e-91    
ref|XP_008344175.1|  PREDICTED: subtilisin-like protease isoform X1     317   2e-91    
ref|XP_002317030.2|  hypothetical protein POPTR_0011s14930g             315   7e-91    
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                315   9e-91    
ref|XP_011004403.1|  PREDICTED: subtilisin-like protease SBT3.5         315   1e-90    
ref|XP_009369762.1|  PREDICTED: subtilisin-like protease SBT5.4         315   1e-90    
ref|XP_001757585.1|  predicted protein                                  313   3e-90    
ref|XP_008796284.1|  PREDICTED: subtilisin-like protease SBT5.3         313   3e-90    
ref|XP_010928976.1|  PREDICTED: subtilisin-like protease SBT3.5         313   6e-90    
ref|XP_007158047.1|  hypothetical protein PHAVU_002G119700g             312   7e-90    
ref|XP_004164351.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    301   9e-90    
ref|WP_020526087.1|  hypothetical protein                               317   1e-89    
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                311   2e-89    
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                311   2e-89    
ref|WP_036408763.1|  hypothetical protein                               311   4e-89    
ref|XP_007051971.1|  Subtilase family protein                           311   4e-89    
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    311   4e-89    
ref|WP_020576974.1|  hypothetical protein                               315   4e-89    
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     310   5e-89    
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                310   7e-89    
ref|WP_030486443.1|  hypothetical protein                               315   8e-89    
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                310   8e-89    
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg                310   8e-89    
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease                309   1e-88    
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     309   2e-88    
ref|XP_010661611.1|  PREDICTED: subtilisin-like protease                309   2e-88    
ref|NP_567972.1|  subtilisin-like serine protease 2                     308   2e-88    
ref|XP_004965849.1|  PREDICTED: cucumisin-like                          308   2e-88    
ref|XP_010101169.1|  Subtilisin-like protease                           308   2e-88    
ref|XP_004502100.1|  PREDICTED: subtilisin-like protease-like           308   2e-88    
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             308   4e-88    
gb|KDO84128.1|  hypothetical protein CISIN_1g047470mg                   307   4e-88    
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760          307   5e-88    
ref|XP_006473885.1|  PREDICTED: subtilisin-like protease-like           307   5e-88    
emb|CDY40653.1|  BnaA03g53100D                                          307   6e-88    
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159             307   6e-88    
gb|EPS74243.1|  subtilase family protein                                307   6e-88    
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease                307   7e-88    
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease                308   7e-88    
emb|CDP01740.1|  unnamed protein product                                306   1e-87    
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    306   1e-87    
ref|XP_010090170.1|  Subtilisin-like protease                           306   2e-87    
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                306   2e-87    
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             306   2e-87    
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like           306   2e-87    
ref|XP_002972374.1|  hypothetical protein SELMODRAFT_413072             305   3e-87    
gb|KCW53325.1|  hypothetical protein EUGRSUZ_J02574                     304   3e-87    
ref|XP_002974945.1|  hypothetical protein SELMODRAFT_102824             299   4e-87    
ref|XP_002971846.1|  hypothetical protein SELMODRAFT_412516             305   4e-87    
ref|XP_006434736.1|  hypothetical protein CICLE_v10003898mg             304   6e-87    
ref|XP_010033628.1|  PREDICTED: subtilisin-like protease SBT5.4         304   7e-87    
ref|XP_006412166.1|  hypothetical protein EUTSA_v10026999mg             304   7e-87    
emb|CDX72509.1|  BnaC07g45310D                                          304   9e-87    
ref|XP_010914489.1|  PREDICTED: subtilisin-like protease                305   9e-87    
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           304   1e-86    
ref|WP_033365059.1|  hypothetical protein                               308   1e-86    
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease                304   1e-86    
ref|NP_001159342.1|  putative subtilase family protein precursor        304   2e-86    
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                303   2e-86    
ref|XP_007201801.1|  hypothetical protein PRUPE_ppa001773mg             303   2e-86    
ref|XP_002526537.1|  Cucumisin precursor, putative                      303   2e-86    
gb|KCW89054.1|  hypothetical protein EUGRSUZ_A01380                     303   3e-86    
ref|WP_020388467.1|  hypothetical protein                               307   3e-86    
ref|WP_026211655.1|  hypothetical protein                               306   3e-86    
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                303   3e-86    
gb|EAZ01729.1|  hypothetical protein OsI_23755                          303   3e-86    
ref|XP_010255581.1|  PREDICTED: subtilisin-like protease                303   4e-86    
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like      302   4e-86    
ref|XP_010923357.1|  PREDICTED: subtilisin-like protease                302   5e-86    
ref|XP_010048355.1|  PREDICTED: subtilisin-like protease SBT5.3         302   5e-86    
emb|CAN60894.1|  hypothetical protein VITISV_019993                     297   6e-86    
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like           302   8e-86    
ref|XP_010489238.1|  PREDICTED: subtilisin-like protease                301   8e-86    
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease                302   8e-86    
ref|XP_003524185.1|  PREDICTED: subtilisin-like protease-like           301   8e-86    
ref|XP_010045213.1|  PREDICTED: subtilisin-like protease SBT5.3         301   9e-86    
ref|XP_009400347.1|  PREDICTED: subtilisin-like protease                301   9e-86    
gb|EYU31525.1|  hypothetical protein MIMGU_mgv1a001949mg                300   1e-85    
gb|KHN39834.1|  Cucumisin                                               301   1e-85    
ref|XP_009396709.1|  PREDICTED: subtilisin-like protease SBT5.3         301   1e-85    
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           301   2e-85    
ref|XP_006374912.1|  hypothetical protein POPTR_0014s02640g             300   2e-85    
ref|XP_003537841.1|  PREDICTED: cucumisin-like                          301   2e-85    
ref|XP_009362303.1|  PREDICTED: subtilisin-like protease                300   2e-85    
ref|XP_010090327.1|  Subtilisin-like protease                           301   2e-85    
gb|KCW53324.1|  hypothetical protein EUGRSUZ_J02574                     303   2e-85    
dbj|BAK05842.1|  predicted protein                                      300   3e-85    
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg             300   3e-85    
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                300   4e-85    
ref|XP_003578494.1|  PREDICTED: subtilisin-like protease SBT3.5         300   4e-85    
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                300   4e-85    
ref|XP_004973598.1|  PREDICTED: subtilisin-like protease-like           300   5e-85    
ref|XP_009119332.1|  PREDICTED: subtilisin-like protease SDD1           300   5e-85    
ref|NP_001174909.1|  Os06g0624100                                       304   5e-85    
gb|EAZ09847.1|  hypothetical protein OsI_32138                          299   6e-85    
emb|CDX89843.1|  BnaA10g02390D                                          299   6e-85    
ref|XP_011029629.1|  PREDICTED: subtilisin-like protease                299   7e-85    
ref|XP_002303550.2|  hypothetical protein POPTR_0003s11860g             298   8e-85    
ref|XP_002886065.1|  predicted protein                                  298   9e-85    
ref|XP_009804189.1|  PREDICTED: subtilisin-like protease SBT5.3         289   1e-84    
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease                299   1e-84    
ref|NP_001061952.1|  Os08g0452100                                       299   1e-84    
ref|XP_002993007.1|  hypothetical protein SELMODRAFT_236650             298   1e-84    
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                298   1e-84    
gb|KDP45154.1|  hypothetical protein JCGZ_15019                         298   1e-84    
ref|XP_004308418.1|  PREDICTED: subtilisin-like protease-like           297   2e-84    
ref|XP_008780995.1|  PREDICTED: subtilisin-like protease                298   2e-84    
ref|XP_008235585.1|  PREDICTED: subtilisin-like protease SDD1           298   2e-84    
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease-like           298   2e-84    
gb|ABD64827.1|  putative subtilisin serine protease of stomatal d...    298   2e-84    
ref|XP_007017191.1|  Subtilisin-like serine protease 2, putative        297   2e-84    
ref|XP_007041871.1|  Subtilisin-like serine protease 2                  297   3e-84    
gb|KEH30495.1|  subtilisin-like serine protease                         297   3e-84    
ref|WP_018347467.1|  hypothetical protein                               302   3e-84    
ref|NP_001063751.1|  Os09g0530800                                       297   3e-84    
ref|XP_011098007.1|  PREDICTED: subtilisin-like protease SBT3.5         297   3e-84    
gb|EPS74284.1|  hypothetical protein M569_00464                         296   4e-84    
ref|XP_002464103.1|  hypothetical protein SORBIDRAFT_01g012345          298   4e-84    
ref|XP_011012624.1|  PREDICTED: subtilisin-like protease SBT5.3         297   4e-84    



>ref|NP_001234350.1| meiotic serine proteinase [Solanum lycopersicum]
 gb|AAF13299.1|AF181496_1 meiotic serine proteinase [Solanum lycopersicum]
Length=809

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/791 (74%), Positives = 675/791 (85%), Gaps = 3/791 (0%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVSTRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTH  276
             +A AKI+MVLM+D PFVST  K    +V +YK+RM +QHD+ LGSLL +S YTK+YSYTH
Sbjct  20    LANAKIFMVLMKDDPFVSTESKNLE-DVNIYKERMRRQHDMLLGSLLEKSVYTKVYSYTH  78

Query  277   LLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVS  456
             L+NGFA+H+ SD+AL +L   EGVR IYED+KM+K+TTHTPDFLG+P  VWP+LGGP+ S
Sbjct  79    LINGFAIHLTSDEALDVLRNVEGVRAIYEDVKMKKLTTHTPDFLGLPVGVWPKLGGPTTS  138

Query  457   GEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR--KFTGKCITGDNFPATACNGKIVG  630
             G GVVIGMIDTGINPFH SF +      GR  I R  KF GKC+TGD FP TACN KIVG
Sbjct  139   GAGVVIGMIDTGINPFHPSFLAQASNGAGRGTIVRSGKFKGKCVTGDRFPETACNSKIVG  198

Query  631   AQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAP  810
             AQYFARAA AAG+FN SR YASPFDADGHGSHTASTAAGN+  PVI N FNYGYASGMAP
Sbjct  199   AQYFARAATAAGEFNTSRGYASPFDADGHGSHTASTAAGNHQVPVIVNHFNYGYASGMAP  258

Query  811   GAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLL  990
             GAGIAVYKA+YSFGG+MSDVVAAVDQAVEDGVDILSLSVGP+SVP+G SAFLNVLE+QLL
Sbjct  259   GAGIAVYKAMYSFGGFMSDVVAAVDQAVEDGVDILSLSVGPASVPTGPSAFLNVLEMQLL  318

Query  991   FATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLS  1170
             FATRAGVLVVQAAGN GPSS S+LSFSPW+TSVAASTTDRRY NSIVLGNGQ+FSGSGLS
Sbjct  319   FATRAGVLVVQAAGNGGPSSTSILSFSPWITSVAASTTDRRYNNSIVLGNGQSFSGSGLS  378

Query  1171  PPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEA  1350
             PPT  +  F LAAA +VC+ N+++ LLTVESCQ+   F+ +LV+GK+VICTYT+DFESEA
Sbjct  379   PPTLSEVHFPLAAASNVCKGNTSSALLTVESCQETEPFIRTLVQGKIVICTYTFDFESEA  438

Query  1351  ASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNS  1530
             ASIATVADT+   GAAGFVLTMDPDI SE+IKGAT+TL +PGLI+N+MEASTALR+YYNS
Sbjct  439   ASIATVADTIQEVGAAGFVLTMDPDISSEKIKGATMTLTVPGLILNSMEASTALREYYNS  498

Query  1531  NTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIM  1710
             NTLRSRSGRA++FRATA+ILDGR+A Y+ Q P VASYSSRGPDVNNALLDTADVLKPNIM
Sbjct  499   NTLRSRSGRAISFRATAKILDGRQASYNSQDPFVASYSSRGPDVNNALLDTADVLKPNIM  558

Query  1711  APGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSA  1890
             APGSSIWA+WSPNSEGD++IKGQ+FAL+SGTSMATPHIAGIAALIK +HP W P+AITSA
Sbjct  559   APGSSIWASWSPNSEGDQHIKGQNFALLSGTSMATPHIAGIAALIKQKHPGWSPAAITSA  618

Query  1891  MMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFL  2070
             MMT+ADVT+   S  +  Q + QL PATPFDFGSG +NPSRA++PGL+F   F+ Y+ FL
Sbjct  619   MMTTADVTNGYSSTPILAQQTNQLTPATPFDFGSGLVNPSRAIDPGLIFKASFKHYVLFL  678

Query  2071  CAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERY  2250
             C+VPGVDE SVRR VGV CP  KK WCSDLNTPSVTISNLVGSR V+RRVTNV G DE Y
Sbjct  679   CSVPGVDEMSVRRAVGVGCPSKKKAWCSDLNTPSVTISNLVGSRNVIRRVTNVAGVDETY  738

Query  2251  RVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVP  2430
             +VIV+EPLGV VT+ P+ F I A  S+H+  VLNAT+ TN+YSFGE++  G++NH VRVP
Sbjct  739   QVIVQEPLGVSVTVRPRVFNIIAKASKHITFVLNATQTTNTYSFGEIVFQGNQNHTVRVP  798

Query  2431  FAVYVTASLQS  2463
              AV+V+++L S
Sbjct  799   LAVFVSSTLHS  809



>ref|XP_006359213.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=809

 Score =  1149 bits (2971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/791 (74%), Positives = 676/791 (85%), Gaps = 3/791 (0%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVSTRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTH  276
             +A AK+++VLM+D PFVST+ K    ++ +YK+RM +QHD+ LGSLL +S YTK+YSYTH
Sbjct  20    LANAKVFIVLMKDDPFVSTKSKNFE-DIDVYKERMRRQHDMLLGSLLEKSVYTKVYSYTH  78

Query  277   LLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVS  456
             L+NGFA+H+ SD+AL IL   EGVR IYED+KM+K+TTHTPDFLG+P  VWP+LGGP+ S
Sbjct  79    LINGFAIHLASDEALDILRNVEGVRAIYEDVKMKKLTTHTPDFLGLPAGVWPKLGGPTTS  138

Query  457   GEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR--KFTGKCITGDNFPATACNGKIVG  630
             G GVVIGMIDTGINPFH SF +      GR  I +  KF GKC+TGD FP TACN KIVG
Sbjct  139   GAGVVIGMIDTGINPFHPSFLAQASNGAGRGTIVKSGKFKGKCVTGDRFPETACNSKIVG  198

Query  631   AQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAP  810
             AQYFARAA AAG+FN SR YASPFDADGHGSHTASTAAGN+  PVI N FNYGYASGMAP
Sbjct  199   AQYFARAATAAGEFNASRDYASPFDADGHGSHTASTAAGNHQVPVIVNHFNYGYASGMAP  258

Query  811   GAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLL  990
             GAGIAVYKA+YSFGG+MSDVVAAVDQAVEDGVDILSLSVGP+SVP+G SAFLNVLE+QLL
Sbjct  259   GAGIAVYKAMYSFGGFMSDVVAAVDQAVEDGVDILSLSVGPASVPTGPSAFLNVLEMQLL  318

Query  991   FATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLS  1170
             FATRAGVLVVQAAGN GPSS S+LSFSPW+TSVAASTTDRRY NSIVLGNGQ+FSGSGLS
Sbjct  319   FATRAGVLVVQAAGNGGPSSTSILSFSPWITSVAASTTDRRYNNSIVLGNGQSFSGSGLS  378

Query  1171  PPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEA  1350
             PPT  +  F LAAA DVC+ N+++ LLTVESCQ+   F+ +LV+GK+VICTYT+DFESEA
Sbjct  379   PPTLSEVHFPLAAASDVCKGNTSSALLTVESCQETEPFIRTLVQGKIVICTYTFDFESEA  438

Query  1351  ASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNS  1530
             ASIATVADT+   GAAGFVLTMDPDI SE+IKGAT+TL +PGLI+N+MEASTALR+YYNS
Sbjct  439   ASIATVADTIQNVGAAGFVLTMDPDISSEKIKGATMTLSVPGLILNSMEASTALREYYNS  498

Query  1531  NTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIM  1710
             NTLRSRSGRAV+FRATARILDGR+A Y+ Q PVVASYSSRGPDVNNALLDTADVLKPNIM
Sbjct  499   NTLRSRSGRAVSFRATARILDGRQASYNSQDPVVASYSSRGPDVNNALLDTADVLKPNIM  558

Query  1711  APGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSA  1890
             APGSSIWA+WSPNSEGD+YIKGQ+FAL+SGTSMATPHIAGIAALIK +H  W P+AITSA
Sbjct  559   APGSSIWASWSPNSEGDQYIKGQNFALLSGTSMATPHIAGIAALIKQKHHGWSPAAITSA  618

Query  1891  MMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFL  2070
             MMT+ADVT+   S  L  Q + QL PATPFDFGSG +NPSRA++PGL+F   F+ Y+ FL
Sbjct  619   MMTTADVTNGYSSTPLFAQQTNQLTPATPFDFGSGLVNPSRAIDPGLIFKASFKHYVLFL  678

Query  2071  CAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERY  2250
             C+VPGVDE SVRR VGV CP  KK WCSDLNTPSVTISNLVGSR V+RRVTNV G DE Y
Sbjct  679   CSVPGVDEMSVRRAVGVGCPSKKKAWCSDLNTPSVTISNLVGSRNVIRRVTNVAGVDETY  738

Query  2251  RVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVP  2430
             +VIV+EPLGV V++ P+ F I A  S+H+  VLNAT+ TN+YSFGE++  G++NH VRVP
Sbjct  739   QVIVQEPLGVSVSVSPRVFNIIAKASKHITFVLNATQTTNTYSFGEIVFQGNQNHTVRVP  798

Query  2431  FAVYVTASLQS  2463
              AV+V+++L S
Sbjct  799   LAVFVSSTLHS  809



>ref|XP_009587411.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana tomentosiformis]
Length=808

 Score =  1144 bits (2959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/791 (74%), Positives = 676/791 (85%), Gaps = 4/791 (1%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVSTRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTH  276
             +A AKI++VLMED PFVST+ K    +  +YK+ + KQHD+ L +LL RS YTK+YSY+H
Sbjct  20    IANAKIFLVLMEDDPFVSTQSKNFE-DFDIYKESIRKQHDMLLENLLERSVYTKVYSYSH  78

Query  277   LLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVS  456
             L+NGF+VH+ S +AL IL  AEGVR IYED+KM+K+TTHTP FLGIP  VWP+LGGP+ S
Sbjct  79    LINGFSVHLTSHEALDILENAEGVRAIYEDVKMKKLTTHTPHFLGIPAGVWPKLGGPTAS  138

Query  457   GEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR--KFTGKCITGDNFPATACNGKIVG  630
             G GVVIGMIDTGINPFH SF +       R  + +  KFTGKC+TGD FP TACN KIVG
Sbjct  139   GAGVVIGMIDTGINPFHPSFLAQASNGDRRGVVVKSGKFTGKCVTGDRFPETACNNKIVG  198

Query  631   AQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAP  810
             AQYFARAA AAG+FN SR YASPFDADGHGSHTASTAAGN+H PVI N FNYGYASGMAP
Sbjct  199   AQYFARAATAAGEFNASRDYASPFDADGHGSHTASTAAGNHHVPVIVNHFNYGYASGMAP  258

Query  811   GAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLL  990
             GAGIAVYKA+YSFGG+MSDVVAAVDQAVEDGVDILSLSVGP++VPSG SAFLNVLE+QLL
Sbjct  259   GAGIAVYKAMYSFGGFMSDVVAAVDQAVEDGVDILSLSVGPANVPSGPSAFLNVLEMQLL  318

Query  991   FATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLS  1170
             FATRAGVLVVQAAGN GPSS S+LSFSPW+TSVAASTTDRRY NSIVLGNG++FSGSGLS
Sbjct  319   FATRAGVLVVQAAGNGGPSSTSILSFSPWITSVAASTTDRRYNNSIVLGNGRSFSGSGLS  378

Query  1171  PPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEA  1350
             PPT    +FQLAAA DVC+ N+T+GLLTVESCQ+   F+ +LV GK+VICTYT+DFESE 
Sbjct  379   PPTLSGTYFQLAAASDVCKGNTTSGLLTVESCQETEPFIRTLVHGKIVICTYTFDFESET  438

Query  1351  ASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNS  1530
             ASIATVADT+ + GAAGFVLTMDPDIGSEQIKGAT+TL +PGLI+NNMEAST+LR+YYNS
Sbjct  439   ASIATVADTIQKVGAAGFVLTMDPDIGSEQIKGATMTLSVPGLILNNMEASTSLREYYNS  498

Query  1531  NTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIM  1710
             NTLRSRSGRA++FRATARILDGR+A Y+ Q PVVASYSSRGPDVNNA LDTADVLKPNIM
Sbjct  499   NTLRSRSGRAISFRATARILDGRQASYTKQDPVVASYSSRGPDVNNAFLDTADVLKPNIM  558

Query  1711  APGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSA  1890
             APGSSIWA+WSP SEGD+YIKGQ+FAL+SGTSMATPHIAGIAALIK +HP W P+AITSA
Sbjct  559   APGSSIWASWSPTSEGDRYIKGQNFALLSGTSMATPHIAGIAALIKQKHPGWTPAAITSA  618

Query  1891  MMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFL  2070
             MMT+ADVT    +  +  Q + QL PATPFDFG+G +NPSRA++PGLVF   F+ Y+ FL
Sbjct  619   MMTTADVTGH-SNAPILAQQTNQLTPATPFDFGAGLVNPSRAIDPGLVFKAGFKHYVLFL  677

Query  2071  CAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERY  2250
             C+VPGVDE SVRR VGV CP  KK WCSDLNTPSVTISNLVGSR V+RRVTNVGG DE+Y
Sbjct  678   CSVPGVDEMSVRRAVGVGCPNKKKAWCSDLNTPSVTISNLVGSRNVIRRVTNVGGVDEKY  737

Query  2251  RVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVP  2430
             +VIV+EPLGV V++ PQ F I A+ SRH+ IVLNAT+ TN YSFGE++  G++NH VRVP
Sbjct  738   QVIVKEPLGVSVSVTPQVFKIMANASRHITIVLNATQTTNVYSFGEIVFEGNQNHRVRVP  797

Query  2431  FAVYVTASLQS  2463
              AV+V+++L S
Sbjct  798   LAVFVSSTLHS  808



>ref|XP_009587410.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana tomentosiformis]
Length=809

 Score =  1140 bits (2948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/792 (74%), Positives = 676/792 (85%), Gaps = 5/792 (1%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVSTRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTH  276
             +A AKI++VLMED PFVST+ K    +  +YK+ + KQHD+ L +LL RS YTK+YSY+H
Sbjct  20    IANAKIFLVLMEDDPFVSTQSKNFE-DFDIYKESIRKQHDMLLENLLERSVYTKVYSYSH  78

Query  277   LLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVS  456
             L+NGF+VH+ S +AL IL  AEGVR IYED+KM+K+TTHTP FLGIP  VWP+LGGP+ S
Sbjct  79    LINGFSVHLTSHEALDILENAEGVRAIYEDVKMKKLTTHTPHFLGIPAGVWPKLGGPTAS  138

Query  457   GEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR--KFTGKCITGDNFPATACNGKIVG  630
             G GVVIGMIDTGINPFH SF +       R  + +  KFTGKC+TGD FP TACN KIVG
Sbjct  139   GAGVVIGMIDTGINPFHPSFLAQASNGDRRGVVVKSGKFTGKCVTGDRFPETACNNKIVG  198

Query  631   AQYFARAAIAAGDFNVSRHYASPFDADGHGS-HTASTAAGNYHTPVITNRFNYGYASGMA  807
             AQYFARAA AAG+FN SR YASPFDADGHGS HTASTAAGN+H PVI N FNYGYASGMA
Sbjct  199   AQYFARAATAAGEFNASRDYASPFDADGHGSSHTASTAAGNHHVPVIVNHFNYGYASGMA  258

Query  808   PGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQL  987
             PGAGIAVYKA+YSFGG+MSDVVAAVDQAVEDGVDILSLSVGP++VPSG SAFLNVLE+QL
Sbjct  259   PGAGIAVYKAMYSFGGFMSDVVAAVDQAVEDGVDILSLSVGPANVPSGPSAFLNVLEMQL  318

Query  988   LFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGL  1167
             LFATRAGVLVVQAAGN GPSS S+LSFSPW+TSVAASTTDRRY NSIVLGNG++FSGSGL
Sbjct  319   LFATRAGVLVVQAAGNGGPSSTSILSFSPWITSVAASTTDRRYNNSIVLGNGRSFSGSGL  378

Query  1168  SPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESE  1347
             SPPT    +FQLAAA DVC+ N+T+GLLTVESCQ+   F+ +LV GK+VICTYT+DFESE
Sbjct  379   SPPTLSGTYFQLAAASDVCKGNTTSGLLTVESCQETEPFIRTLVHGKIVICTYTFDFESE  438

Query  1348  AASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYN  1527
              ASIATVADT+ + GAAGFVLTMDPDIGSEQIKGAT+TL +PGLI+NNMEAST+LR+YYN
Sbjct  439   TASIATVADTIQKVGAAGFVLTMDPDIGSEQIKGATMTLSVPGLILNNMEASTSLREYYN  498

Query  1528  SNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNI  1707
             SNTLRSRSGRA++FRATARILDGR+A Y+ Q PVVASYSSRGPDVNNA LDTADVLKPNI
Sbjct  499   SNTLRSRSGRAISFRATARILDGRQASYTKQDPVVASYSSRGPDVNNAFLDTADVLKPNI  558

Query  1708  MAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITS  1887
             MAPGSSIWA+WSP SEGD+YIKGQ+FAL+SGTSMATPHIAGIAALIK +HP W P+AITS
Sbjct  559   MAPGSSIWASWSPTSEGDRYIKGQNFALLSGTSMATPHIAGIAALIKQKHPGWTPAAITS  618

Query  1888  AMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQF  2067
             AMMT+ADVT    +  +  Q + QL PATPFDFG+G +NPSRA++PGLVF   F+ Y+ F
Sbjct  619   AMMTTADVTGH-SNAPILAQQTNQLTPATPFDFGAGLVNPSRAIDPGLVFKAGFKHYVLF  677

Query  2068  LCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADER  2247
             LC+VPGVDE SVRR VGV CP  KK WCSDLNTPSVTISNLVGSR V+RRVTNVGG DE+
Sbjct  678   LCSVPGVDEMSVRRAVGVGCPNKKKAWCSDLNTPSVTISNLVGSRNVIRRVTNVGGVDEK  737

Query  2248  YRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRV  2427
             Y+VIV+EPLGV V++ PQ F I A+ SRH+ IVLNAT+ TN YSFGE++  G++NH VRV
Sbjct  738   YQVIVKEPLGVSVSVTPQVFKIMANASRHITIVLNATQTTNVYSFGEIVFEGNQNHRVRV  797

Query  2428  PFAVYVTASLQS  2463
             P AV+V+++L S
Sbjct  798   PLAVFVSSTLHS  809



>gb|AAB38743.1| proteinase TMP [Solanum lycopersicum]
Length=801

 Score =  1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/791 (73%), Positives = 665/791 (84%), Gaps = 11/791 (1%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVSTRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTH  276
             +A AKI+MVLM+D PFVST  K    +V +YK+RM +QHD+ LGSLL +S YTK+YSYTH
Sbjct  20    LANAKIFMVLMKDDPFVSTESKNLE-DVNIYKERMRRQHDMLLGSLLEKSVYTKVYSYTH  78

Query  277   LLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVS  456
             L+NGFA+H+ SD+AL +L   EGVR IYED+KM+K+TTHTPDFLG+P  VWP+LGGP+ S
Sbjct  79    LINGFAIHLTSDEALDVLRNVEGVRAIYEDVKMKKLTTHTPDFLGLPVGVWPKLGGPTTS  138

Query  457   GEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR--KFTGKCITGDNFPATACNGKIVG  630
             G GVVIGMIDTGINPFH SF +      GR  I +  KF GKC+ GD FP TACN KIVG
Sbjct  139   GAGVVIGMIDTGINPFHPSFLAQASNGAGRGTIVKSGKFKGKCVIGDRFPETACNSKIVG  198

Query  631   AQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAP  810
             AQYFARAA AAG+FN SR YASPFDADGHGSHTASTAAGN+  PVI N FNYGYASGMAP
Sbjct  199   AQYFARAATAAGEFNASRDYASPFDADGHGSHTASTAAGNHQVPVIVNHFNYGYASGMAP  258

Query  811   GAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLL  990
             GAGIAVYKA+YSFGG+MSDVVAAVDQAVEDGVDILSLSVGP+SVP+G SAFLNVLE+QLL
Sbjct  259   GAGIAVYKAMYSFGGFMSDVVAAVDQAVEDGVDILSLSVGPASVPTGPSAFLNVLEMQLL  318

Query  991   FATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLS  1170
             FATRAGVLVVQAAGN GPSS S+LSFSPW+TSVAASTTDRRY NSIVLGNGQ+FSGSGLS
Sbjct  319   FATRAGVLVVQAAGNGGPSSTSILSFSPWITSVAASTTDRRYNNSIVLGNGQSFSGSGLS  378

Query  1171  PPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEA  1350
             PPT  +  F LAAA DVC+ N+++ LLTVESCQ+   F+ +LV+GK+VICTYT+DFESEA
Sbjct  379   PPTLSEVHFPLAAASDVCKGNTSSALLTVESCQETEPFIRTLVQGKIVICTYTFDFESEA  438

Query  1351  ASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNS  1530
             ASIATVADT+   GAAGFVLTMDPDI SE+IKGAT+TL +PGLI+N+MEASTALR+YYNS
Sbjct  439   ASIATVADTIQEVGAAGFVLTMDPDISSEKIKGATMTLTVPGLILNSMEASTALREYYNS  498

Query  1531  NTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIM  1710
             NTLRSRSGRA++FRATA+ILDGR+A Y+ Q P VASYSSRGPDVNNALLDTADVLKPNIM
Sbjct  499   NTLRSRSGRAISFRATAKILDGRQASYNSQDPFVASYSSRGPDVNNALLDTADVLKPNIM  558

Query  1711  APGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSA  1890
             APGSSIWA+WSPN         Q+FAL+SGTSMATPHIAGIAALIK +HP W P+AITSA
Sbjct  559   APGSSIWASWSPNR--------QNFALLSGTSMATPHIAGIAALIKQKHPGWSPAAITSA  610

Query  1891  MMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFL  2070
             MMT+ADVT+   S  +  Q + QL PATPFDFGSG +NPSRA++PGL+F   F+ Y+ FL
Sbjct  611   MMTTADVTNGYSSTPILAQQTNQLTPATPFDFGSGLVNPSRAIDPGLIFKASFKHYVLFL  670

Query  2071  CAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERY  2250
             C+VPGVDE SVRR VGV CP  KK WCSDLNTPSVTISNLVGSR V+RRVTNV G DE Y
Sbjct  671   CSVPGVDEMSVRRAVGVGCPSKKKAWCSDLNTPSVTISNLVGSRNVIRRVTNVAGVDETY  730

Query  2251  RVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVP  2430
             +VIV+EPLGV VT+ P+ F I A  S+H+  VLNAT+ TN+YSFGE++  G++NH VRVP
Sbjct  731   QVIVQEPLGVSVTVRPRVFNIIAKASKHITFVLNATQTTNTYSFGEIVFQGNQNHTVRVP  790

Query  2431  FAVYVTASLQS  2463
              AV+V+++L S
Sbjct  791   LAVFVSSTLHS  801



>ref|XP_009774619.1| PREDICTED: uncharacterized protein LOC104224633 [Nicotiana sylvestris]
Length=2610

 Score =  1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/766 (75%), Positives = 657/766 (86%), Gaps = 4/766 (1%)
 Frame = +1

Query  175   NVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRG  354
             N  +YK+ + KQHD+ L +LL RS YTK+YSYTHL+NGF++H+ S +AL IL  AEGVR 
Sbjct  1846  NFDIYKETLRKQHDMLLENLLERSVYTKVYSYTHLINGFSIHLTSHEALDILENAEGVRA  1905

Query  355   IYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEY  534
             IYED+KM+K+TTHTPDFLGIP  VWP+LGG + SG GVVIGMIDTGINPFH SF +    
Sbjct  1906  IYEDVKMKKLTTHTPDFLGIPAGVWPKLGGATASGAGVVIGMIDTGINPFHPSFLAQASN  1965

Query  535   NIGRPRITR--KFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDA  708
                R  + +  KF GKC+TGD FP TACN KIVGAQYFARAA AAG+FN SR YASPFDA
Sbjct  1966  GDRRGVVVKSGKFKGKCVTGDRFPETACNNKIVGAQYFARAATAAGEFNASRDYASPFDA  2025

Query  709   DGHGS-HTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavd  885
             DGHGS HTASTAAGN++ PVI N FNYGYASGMAPGAGIAVYKA+YSFGG+MSDVVAAVD
Sbjct  2026  DGHGSSHTASTAAGNHNVPVIVNHFNYGYASGMAPGAGIAVYKAMYSFGGFMSDVVAAVD  2085

Query  886   qavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLS  1065
             QAVEDGVDILSLSVGP++VPSG SAFLNVLE+QLLFATRAGVLVVQAAGN GPSS S+LS
Sbjct  2086  QAVEDGVDILSLSVGPANVPSGPSAFLNVLEMQLLFATRAGVLVVQAAGNGGPSSTSILS  2145

Query  1066  FSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAG  1245
             FSPW+TSVAASTTDRRY NSIVLGNGQ+FSGSGLSPPT    +FQLAAA DVC+ N+T+G
Sbjct  2146  FSPWITSVAASTTDRRYNNSIVLGNGQSFSGSGLSPPTLSGTYFQLAAASDVCKGNTTSG  2205

Query  1246  LLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPD  1425
             LLTVESCQ+   F+ +LV GK+VICTYT+DFESE ASIATVADT+ + GAAGFVLTMDPD
Sbjct  2206  LLTVESCQETETFIRTLVHGKIVICTYTFDFESETASIATVADTIQKIGAAGFVLTMDPD  2265

Query  1426  IGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRA  1605
             IGSEQIKGAT+TL +PGLI+NNMEASTALR+YYNSNTLRSRSGRA++FRATARILDGR+A
Sbjct  2266  IGSEQIKGATMTLSVPGLILNNMEASTALREYYNSNTLRSRSGRAISFRATARILDGRQA  2325

Query  1606  IYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHF  1785
              Y+ Q PVVASYSSRGPDVNNA LDTADVLKPNIMAPGSSIWA+WSP SEGD+YIKGQ+F
Sbjct  2326  SYTKQDPVVASYSSRGPDVNNAFLDTADVLKPNIMAPGSSIWASWSPTSEGDRYIKGQNF  2385

Query  1786  ALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqla  1965
             AL+SGTSMATPHIAGIAALIK +HP W P+AITSAMMT+ADVT +  +  +  Q + QL 
Sbjct  2386  ALLSGTSMATPHIAGIAALIKQKHPGWTPAAITSAMMTTADVTGQ-SNAPILAQQTNQLT  2444

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF  2145
             PATPFDFGSG +NPSRA++PGLVF   F+ Y+ FLC+VPGVDE SVRR VGV CP  KK 
Sbjct  2445  PATPFDFGSGLVNPSRAIDPGLVFKAGFKHYVLFLCSVPGVDEMSVRRAVGVGCPNKKKA  2504

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
             WCSDLNTPSVTISNLVGSR V+RRVTNVGG DE+Y+VIV+EPLGV V++ PQ F I A+ 
Sbjct  2505  WCSDLNTPSVTISNLVGSRNVIRRVTNVGGVDEKYQVIVKEPLGVSVSVAPQVFKIMANA  2564

Query  2326  SRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
             SRH+ IVLNAT+ TN YSFGE++  G++NH VRVP AV+V+++L S
Sbjct  2565  SRHITIVLNATQTTNVYSFGEIVFEGNQNHRVRVPLAVFVSSTLHS  2610



>ref|XP_011047561.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=836

 Score =  1039 bits (2687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/801 (68%), Positives = 643/801 (80%), Gaps = 17/801 (2%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVSTRIK---GTSGNVT---------MYKQRMTKQHDVFLGSLLR  240
             +AEAK+ +VLM+D P  S++ K       N+T          YK+R+   HDVFL SLL 
Sbjct  41    IAEAKVLIVLMDDEPVFSSKSKEAHSRKSNMTPHRIEEASLAYKERLRTSHDVFLESLLL  100

Query  241   RSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPD  420
             +  Y KLYSYTHLLNGFAV+V+S + L+ L  A GVR I+ED+KMEK+TTHTP FLGIP 
Sbjct  101   KDTYNKLYSYTHLLNGFAVNVQSKEVLRTLKNATGVRSIHEDVKMEKLTTHTPRFLGIPT  160

Query  421   TVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFP  600
              VWP LGG   SGEGV+IG IDTGINP H SF+        R   + KF GKC+TG+ FP
Sbjct  161   GVWPILGGAESSGEGVIIGFIDTGINPLHPSFTGGSS---ARFTNSSKFKGKCVTGEKFP  217

Query  601   ATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRF  780
             +TACNGKIVGAQYFARAAIAAGDFN +R YASP+DADGHGSHTASTAAGNY  PVI N F
Sbjct  218   STACNGKIVGAQYFARAAIAAGDFNATRDYASPYDADGHGSHTASTAAGNYQIPVIANDF  277

Query  781   NYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSA  960
             NYGYASGMAPGA IAVYKALY+FGGYMSDVVAAVDQAVEDGVDILSLS+GPSSVPSG SA
Sbjct  278   NYGYASGMAPGARIAVYKALYTFGGYMSDVVAAVDQAVEDGVDILSLSIGPSSVPSGPSA  337

Query  961   FLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGN  1140
             FLNVLE++LLFAT+AGV VVQAAGN GPS  S+LSFSPW+TSVAAS  DR+Y NSI+LGN
Sbjct  338   FLNVLEMELLFATKAGVFVVQAAGNGGPSPSSILSFSPWITSVAASIIDRKYKNSIILGN  397

Query  1141  GQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVIC  1320
             G++FSG+GL+PPTAG+  +++ AA DV  RN+T+ +L VESCQ    F+ S VR KLVIC
Sbjct  398   GRSFSGTGLAPPTAGEMPYRIVAAADVSHRNTTS-VLEVESCQHPEHFILSSVRNKLVIC  456

Query  1321  TYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEA  1500
             TYT+DFE EAASIA VA+T+ + GAAGF++TMDPDIGSEQ+KG T+T+Q+P +I+NNM++
Sbjct  457   TYTFDFEYEAASIAAVANTIQKIGAAGFIITMDPDIGSEQVKGTTMTMQVPAIILNNMQS  516

Query  1501  STALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLD  1680
             S AL +YYNSNT+RS SG+AV F A ARILDGRRA ++ Q P+VASYSSRGPDVNNALL 
Sbjct  517   SRALWEYYNSNTIRSTSGQAVGFAARARILDGRRAFFTQQAPIVASYSSRGPDVNNALLQ  576

Query  1681  TADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHP  1860
             TADVLKPN+MAPGSSIWAAWSPNSEGD  IKGQ+FALVSGTSMATPHIAG+AALIK +HP
Sbjct  577   TADVLKPNVMAPGSSIWAAWSPNSEGDPSIKGQNFALVSGTSMATPHIAGVAALIKQKHP  636

Query  1861  NWKPSAITSAMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFN  2040
              W P+AITSAMMT+A   D      +  Q + Q+APATPFDFG+GFINP  A++PGLVF+
Sbjct  637   RWSPAAITSAMMTTASTFDH-SGSPILAQLTNQIAPATPFDFGAGFINPVHAIDPGLVFD  695

Query  2041  TYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRV  2220
             ++F+QY+QFLCAVPGVDE SVRR VG  CP  ++ WCSDLNT SVTISNLVGSR V+R V
Sbjct  696   SHFEQYVQFLCAVPGVDEGSVRRAVGTGCPTKRRAWCSDLNTASVTISNLVGSRKVIRSV  755

Query  2221  TNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILL  2400
             TNV G +E YRV VR+P GV+VT+ P+   I+ + S+HL IVL A KAT +Y+FGEM+L 
Sbjct  756   TNVSGRNEVYRVTVRQPSGVKVTVSPRVVVINGNASKHLRIVLTAIKATRTYTFGEMVLH  815

Query  2401  GDRNHIVRVPFAVYVTASLQS  2463
             G R H+VRVP AV V+ SL+S
Sbjct  816   GSRKHVVRVPIAVCVSTSLKS  836



>ref|XP_010274498.1| PREDICTED: subtilisin-like protease SBT3.5 [Nelumbo nucifera]
Length=766

 Score =  1039 bits (2687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/760 (70%), Positives = 631/760 (83%), Gaps = 3/760 (0%)
 Frame = +1

Query  184   MYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYE  363
             +YK+ +  QHD FLGSLL+  +YTKLYSYTHL+NGFA+HVKS++AL  L  A  V+ I E
Sbjct  10    VYKENVVIQHDSFLGSLLQTGSYTKLYSYTHLINGFAIHVKSEEALDALQGAREVKRIEE  69

Query  364   DIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIG  543
             DIKMEK+TTHTP+FLGIP  VWP+LGG   SG+GVVIGMIDTGINP H SF+        
Sbjct  70    DIKMEKLTTHTPEFLGIPTGVWPKLGGAQNSGDGVVIGMIDTGINPNHPSFARVSSEGTK  129

Query  544   RPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGS  723
                   +F G+C TG  FP TACNGKIVGAQ+FAR AIAAGDFN +R Y SP+DADGHGS
Sbjct  130   TSANRTRFKGECATGKGFPQTACNGKIVGAQHFARGAIAAGDFNATRDYTSPYDADGHGS  189

Query  724   HTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedg  903
             HTASTAAGN+  PV+   FNYGYASGMAPGA IAVYKALY FGGYMSDVVAAVDQAVEDG
Sbjct  190   HTASTAAGNHQIPVMVKGFNYGYASGMAPGARIAVYKALYMFGGYMSDVVAAVDQAVEDG  249

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDILSLS+GPSSVP G SAFLN+LE++LLFAT+AGVLVVQAAGN GPS+ S+LSFSPW+T
Sbjct  250   VDILSLSIGPSSVPPGPSAFLNMLEIELLFATKAGVLVVQAAGNGGPSASSILSFSPWIT  309

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVES  1263
             SVAASTTDR+Y N+I LGNGQ+FSG+GL+P TAG+  F +AAA DVC RN++   + V++
Sbjct  310   SVAASTTDRKYNNTIQLGNGQSFSGTGLAPATAGEVHFPIAAAADVCSRNTS--YVLVQN  367

Query  1264  CQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQI  1443
             CQ    F+PSLVRG+L+ICTYTYDFE EAASI++VA+T+ + GAAGF++TMDPD+GSEQ+
Sbjct  368   CQHTEPFIPSLVRGRLIICTYTYDFEFEAASISSVAETMEKVGAAGFIMTMDPDLGSEQV  427

Query  1444  KGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQG  1623
             KG T+TL++PG+++NNM+ASTAL +YYNS+ +R+R+G  VAF AT RILDGR+A+++ Q 
Sbjct  428   KGTTITLRVPGIVLNNMQASTALWEYYNSHAIRNRNGDVVAFTATGRILDGRQAVFTEQA  487

Query  1624  PVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGT  1803
             P+VASYSSRGPDVNNALL TADVLKPNIMAPGSSIWAAWSPNSEGD YIKGQ FALVSGT
Sbjct  488   PIVASYSSRGPDVNNALLQTADVLKPNIMAPGSSIWAAWSPNSEGDHYIKGQSFALVSGT  547

Query  1804  SMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlapaTPFD  1983
             SMATPH+AG+AALIK ++PNW P+AITSAMMT+A+VTD      +  Q S QLA ATPFD
Sbjct  548   SMATPHVAGVAALIKHKYPNWSPAAITSAMMTTANVTDH-SGAAILAQQSNQLAAATPFD  606

Query  1984  FGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLN  2163
             +GSG INP++AL+PGLVFN  F+ YIQFLCAVPGVD++SVRR VGV CP  +K WCSDLN
Sbjct  607   YGSGVINPAQALDPGLVFNVSFKHYIQFLCAVPGVDDESVRRAVGVGCPTRRKRWCSDLN  666

Query  2164  TPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLII  2343
               SVT+SNLVGSR V+RRVTNVGG  E Y+V V+EP+GV V + PQ F ISA+ SR L +
Sbjct  667   MASVTVSNLVGSRKVIRRVTNVGGTKEMYQVRVQEPMGVSVKVSPQVFVISANASRQLTV  726

Query  2344  VLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
             VL A +ATNSY+FGEM+L G RNH+VRVP AVYV++SL S
Sbjct  727   VLGAKEATNSYTFGEMVLEGSRNHVVRVPIAVYVSSSLGS  766



>gb|EYU20571.1| hypothetical protein MIMGU_mgv1a001516mg [Erythranthe guttata]
Length=804

 Score =  1028 bits (2657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/788 (67%), Positives = 642/788 (81%), Gaps = 4/788 (1%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLL  282
             +AK++MVLMED P V   +  +S +  M+K+R+ + HD F+ + L   +YTKLYSYTHLL
Sbjct  20    DAKVFMVLMEDDPLVMMSLS-SSEDTAMHKERIARDHDNFIKTRLGEGSYTKLYSYTHLL  78

Query  283   NGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGE  462
             NGFA+H   D+ + +L  A+ VR ++ED KMEK TTHTPDFLGI D  WP LGG +V+G+
Sbjct  79    NGFAIHADDDQVIHMLRGADKVRSVHEDTKMEKQTTHTPDFLGITDGAWPALGGSTVAGD  138

Query  463   GVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQYF  642
              VVIG+IDTGINPFH SF +    N        KF GKCITG+ FP +ACNGKIVGAQYF
Sbjct  139   EVVIGLIDTGINPFHPSFITQTSNNNILFDKNSKFKGKCITGEQFPLSACNGKIVGAQYF  198

Query  643   ARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGI  822
             ARAAIAAG+FN +RH++SPFD+DGHGSHTASTAAGN H  V+ N F+YGYASGMAPGA I
Sbjct  199   ARAAIAAGEFNSTRHFSSPFDSDGHGSHTASTAAGNNHIQVVANNFSYGYASGMAPGARI  258

Query  823   AVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATR  1002
             AVYKALY FGGYMSDVVAAVDQAVEDGVDIL+LS+GP+S+PSG SAFLNVLE++LLFAT+
Sbjct  259   AVYKALYPFGGYMSDVVAAVDQAVEDGVDILNLSIGPASIPSGPSAFLNVLEMELLFATK  318

Query  1003  AGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTA  1182
             AGVLVVQA GN GP+  S+LSFSPW+ SVA+STTDR+Y+NS+ LGNGQ   G+GL+PPT 
Sbjct  319   AGVLVVQAVGNGGPTPSSILSFSPWIVSVASSTTDRKYSNSLFLGNGQHLPGTGLAPPTV  378

Query  1183  GKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIA  1362
             G  +F +AAA DV  RN T G+  +ESCQ+A  FV  L RGK++ICTYT+DF+SEAASI+
Sbjct  379   GGVYFPVAAAADVSERNVTVGV--IESCQNADPFVRELARGKIIICTYTFDFDSEAASIS  436

Query  1363  TVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLR  1542
              V DT+H+ GAAGF+LTMDPD+GS QIKG+T+TL +PG+I+NNME+S+AL +YYNSNT+R
Sbjct  437   AVVDTIHKIGAAGFILTMDPDLGSHQIKGSTITLPVPGIILNNMESSSALWEYYNSNTIR  496

Query  1543  SRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGS  1722
              RSG A+ FRA ARILDGR+A Y+ Q P VASYSSRGPD+NNALL+TADVLKP IMAPGS
Sbjct  497   GRSGAAIVFRARARILDGRQASYNVQAPAVASYSSRGPDLNNALLETADVLKPTIMAPGS  556

Query  1723  SIWAAWS-PNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMT  1899
             SIWAAW+ PNS GD Y K Q FAL+SGTSMATPHIAGIAALIK +H +W P+A+ SAMMT
Sbjct  557   SIWAAWTKPNSRGDDYTKSQTFALLSGTSMATPHIAGIAALIKQKHRHWSPAAVASAMMT  616

Query  1900  SADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAV  2079
             +AD TD  GSP+LAQ  +  L+PATPFDFG+G INPS+A++PGLVF  YF+ Y++FLCAV
Sbjct  617   TADQTDHSGSPILAQGKNGLLSPATPFDFGAGSINPSKAIDPGLVFEAYFKNYVEFLCAV  676

Query  2080  PGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVI  2259
             PG+D+KSVRR VGV CP+ +K WCSDLNT SVT+SNLVGSR V+RRVTNVGG DE+YRV+
Sbjct  677   PGLDDKSVRRAVGVGCPDKRKEWCSDLNTASVTVSNLVGSRKVVRRVTNVGGFDEKYRVV  736

Query  2260  VREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             VREP+GVRV++ PQ F IS + S H+ ++L AT+ TN Y+FGEM+L G  NH+VRVP  V
Sbjct  737   VREPVGVRVSVEPQVFTISVNESTHITVMLQATQRTNRYTFGEMVLEGSNNHVVRVPITV  796

Query  2440  YVTASLQS  2463
             +V++ L S
Sbjct  797   FVSSYLGS  804



>ref|XP_002524360.1| peptidase, putative [Ricinus communis]
 gb|EEF37971.1| peptidase, putative [Ricinus communis]
Length=804

 Score =  1026 bits (2654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/788 (68%), Positives = 646/788 (82%), Gaps = 9/788 (1%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTRIKGTS---GNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYT  273
             EAK++M+LM++ P  + + K T+     V  YK+ ++  HD+FL SLL++  YTKLYSYT
Sbjct  23    EAKVFMILMDEEPVFAFKSKYTNPRIEEVMDYKESLSNSHDLFLESLLQKGTYTKLYSYT  82

Query  274   HLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSV  453
             HLLNG AVHV+S++   IL  A GVR I+ED KMEK+TTHTPDFLGIP  +WP LGGP  
Sbjct  83    HLLNGVAVHVESEEVSSILKNARGVRAIHEDTKMEKLTTHTPDFLGIPAGIWPSLGGPER  142

Query  454   SGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGA  633
             SGEGVVIGMIDTGINP+H SF++    +I     + KF G+C TG+NFP TACNGKIVGA
Sbjct  143   SGEGVVIGMIDTGINPYHPSFTNMSMGSIN----STKFRGQCATGENFPLTACNGKIVGA  198

Query  634   QYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPG  813
             QYFARAAIAAGDF  SR +ASPFDADGHGSHTASTAAGN+  PVI N FNYG ASGMAPG
Sbjct  199   QYFARAAIAAGDFITSRDFASPFDADGHGSHTASTAAGNHQIPVIANDFNYGNASGMAPG  258

Query  814   AGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLF  993
             A IAVYKALY+FGGYMSDVVAAV++AVEDGVDILSLS+GPSSVP G SAFLNVLE++LLF
Sbjct  259   ARIAVYKALYTFGGYMSDVVAAVEKAVEDGVDILSLSIGPSSVPPGPSAFLNVLEMELLF  318

Query  994   ATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSP  1173
             AT+AG+ VVQAAGN GPSS S+LSFSPW+TS AAS TDR+Y N+I+LGNG++FSG+GL+P
Sbjct  319   ATKAGIFVVQAAGNGGPSSSSVLSFSPWITSAAASITDRKYNNTIILGNGKSFSGTGLAP  378

Query  1174  PTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAA  1353
             PT+G+  F LAAA DV   N T+ ++ VESCQ    F+ SLV  KL+ICTYT+DFE E A
Sbjct  379   PTSGEVPFLLAAAADVSHGNVTS-VVEVESCQHPEHFIKSLVWEKLIICTYTFDFEYEDA  437

Query  1354  SIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSN  1533
             SIATV DT+ + GAAGF++TMDPDI SEQIKG T+T+++P +I+N M+AS+AL +YYNSN
Sbjct  438   SIATVEDTIQQIGAAGFIITMDPDISSEQIKGTTMTMRVPAIILNTMQASSALWEYYNSN  497

Query  1534  TLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMA  1713
             T+RSRSG+AVAF ATARILDGR+A ++GQ P+VASYSSRGPDVNNALL TADVLKPNIMA
Sbjct  498   TIRSRSGQAVAFSATARILDGRQAFFTGQAPIVASYSSRGPDVNNALLQTADVLKPNIMA  557

Query  1714  PGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAM  1893
             PGSSIWAAWSP+SEGD Y+KGQ+FALVSGTSMATPHIAG+AALIK +HP W P+AITSAM
Sbjct  558   PGSSIWAAWSPDSEGDPYVKGQNFALVSGTSMATPHIAGVAALIKQKHPKWSPAAITSAM  617

Query  1894  MTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLC  2073
             MT+AD TD      +  Q+S QLAPATPFDFG+G INP+RA++PGL+F+  F+ Y+QFLC
Sbjct  618   MTTADTTD-CFGSPILAQSSNQLAPATPFDFGAGSINPARAIDPGLIFDARFEHYVQFLC  676

Query  2074  AVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYR  2253
             AVPGVD++SVRR VG+ CP   + WCSDLNT SVTISNLVGSR V+RRVTNV   +E YR
Sbjct  677   AVPGVDDESVRRAVGIGCPIRGRAWCSDLNTASVTISNLVGSRKVIRRVTNVSRRNEVYR  736

Query  2254  VIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPF  2433
             V VREPLGV VT+ PQ F++  + SRH  I+L A KA  +Y+FGE+IL G RNH+VRVP 
Sbjct  737   VTVREPLGVNVTVKPQVFWVRGNASRHFRILLKARKAMRTYTFGEIILYGSRNHVVRVPI  796

Query  2434  AVYVTASL  2457
             AVYV+ +L
Sbjct  797   AVYVSTTL  804



>ref|XP_011070284.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =  1021 bits (2639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/760 (69%), Positives = 630/760 (83%), Gaps = 7/760 (1%)
 Frame = +1

Query  184   MYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYE  363
             MYK+RMT++HDVFL S+L   +Y KLYSYTHLLNGFA++   ++ + +L +A  VR + E
Sbjct  1     MYKERMTQEHDVFLKSVLEEGSYVKLYSYTHLLNGFAIYANGEEVIDVLRRAGRVRSVQE  60

Query  364   DIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIG  543
             D+KMEK TTHTPDFLGI    WP LGG + +GEG+VIG++DTGINPFH SF++  + + G
Sbjct  61    DVKMEKHTTHTPDFLGISSGAWPALGGSTAAGEGIVIGLVDTGINPFHPSFAT--QTSTG  118

Query  544   RPRITR--KFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGH  717
             RP  T+  KF G C  G+ F A+ACNGKIVGAQYFARAA+AAG+FN +R YASPFDADGH
Sbjct  119   RPVFTQGSKFKGTCAMGEQFSASACNGKIVGAQYFARAAVAAGEFNTTRDYASPFDADGH  178

Query  718   GSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqave  897
             GSHTASTAAGN+H PVI N FNYGYASGMAPGA IA YKALYSFGGYMSDVVAAVDQAVE
Sbjct  179   GSHTASTAAGNHHIPVIANNFNYGYASGMAPGARIAAYKALYSFGGYMSDVVAAVDQAVE  238

Query  898   dgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPW  1077
             DGVD+LSLS+GP  VPSG  AFLN+LE++LLFAT+AGVLVVQA GN GPSS S+LSFSPW
Sbjct  239   DGVDVLSLSIGPGKVPSGPCAFLNILELELLFATKAGVLVVQAVGNGGPSSSSILSFSPW  298

Query  1078  VTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTV  1257
             +TSVAAS TDR+Y NS+ LGNGQ   G+GL+PPT G  +F +AAA DVCR+N T GL+  
Sbjct  299   ITSVAASITDRKYNNSLALGNGQRLLGTGLAPPTFGGVYFPIAAAADVCRKNFTTGLM--  356

Query  1258  ESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSE  1437
             E+CQ+A  F+ +  RGKL+ICTYT+DFESEAASI+ VA T  + GAAGF+LTMDPD+GSE
Sbjct  357   ETCQNADPFIRANARGKLIICTYTFDFESEAASISNVAATAQKIGAAGFILTMDPDVGSE  416

Query  1438  QIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSG  1617
             QIKGATVTLQ+PG+I+NNME+S+AL +YYNSNT+RSRSG A+ FRA ARI DGRRA Y+G
Sbjct  417   QIKGATVTLQVPGIILNNMESSSALWEYYNSNTIRSRSGEALFFRARARIQDGRRATYAG  476

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
             + PVVASYSSRGPDVNNA+L+ ADVLKPNIMAPGSSIWAAWSPNSEGD YIKGQ FAL+S
Sbjct  477   RAPVVASYSSRGPDVNNAILEAADVLKPNIMAPGSSIWAAWSPNSEGDVYIKGQSFALLS  536

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlapaTP  1977
             GTSMATPHIAGIAALIK +H +W P+AITSAMMT+ADV D      +  Q   +L+PATP
Sbjct  537   GTSMATPHIAGIAALIKQKHRHWSPAAITSAMMTTADVIDH-SGAPILAQHKNRLSPATP  595

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSD  2157
             FDFG+G +NPSRA++PGLVF+ YF+ Y+QFLCAVPGVD+ S+RR VGV CP  +  WCSD
Sbjct  596   FDFGAGSVNPSRAIDPGLVFDAYFENYLQFLCAVPGVDDMSIRRAVGVGCPAKRNEWCSD  655

Query  2158  LNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHL  2337
             LNT SVT+SNLVGSR V+RRVTNV  ADE+Y V+VREPLGVRV ++P  F IS + SR +
Sbjct  656   LNTASVTVSNLVGSRKVIRRVTNVADADEKYTVMVREPLGVRVRVMPAAFKISVNASRFI  715

Query  2338  IIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASL  2457
              ++L AT+ TN+Y+FGE++L G +NH+VRVP AV+V++SL
Sbjct  716   TLLLEATQRTNAYTFGEVVLRGSKNHVVRVPIAVFVSSSL  755



>ref|XP_006368945.1| hypothetical protein POPTR_0001s15120g [Populus trichocarpa]
 gb|ERP65514.1| hypothetical protein POPTR_0001s15120g [Populus trichocarpa]
Length=827

 Score =  1019 bits (2635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/811 (66%), Positives = 638/811 (79%), Gaps = 28/811 (3%)
 Frame = +1

Query  100   AEAKIYMVLMEDHP---FVSTRIKGTSGNVT---------MYKQRMTKQHDVFLGSLLRR  243
             AEAK+ +VLM+D P   F S +      N+T          YK+R+   HDVFL SLL +
Sbjct  22    AEAKVLIVLMDDEPVFSFKSKQAHSRKSNLTPHRIEEASLAYKERLRTSHDVFLESLLLK  81

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSYTHLLNGFAV+V+S + L+ L  A GVR I+ED+KMEK TTHTP FLGIP  
Sbjct  82    DTYNKLYSYTHLLNGFAVNVQSKEVLRTLKNATGVRAIHEDVKMEKFTTHTPRFLGIPTG  141

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPA  603
             VWP LGG   SGEGV+IG IDTGINP H SF+        R   + KF GKC+TG+ FP+
Sbjct  142   VWPILGGAESSGEGVIIGFIDTGINPLHPSFTGGSS---ARFTNSSKFKGKCVTGEKFPS  198

Query  604   TACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGS-----------HTASTAAGN  750
             TACNGKIVGAQYFARAAIAAGDFN +R YASP+DADGHG            H  STAAGN
Sbjct  199   TACNGKIVGAQYFARAAIAAGDFNATRDYASPYDADGHGRQVIPSAVAFFLHDTSTAAGN  258

Query  751   YHTPVITNRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvg  930
             +  PVI N FNYGYASGMAPGA IAVYKALY+FGGYMSDVVAAVDQAVEDGVDILSLS+G
Sbjct  259   HQIPVIANDFNYGYASGMAPGARIAVYKALYTFGGYMSDVVAAVDQAVEDGVDILSLSIG  318

Query  931   pssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDR  1110
             PSSVPSG SAFLNVLE++LLFAT+AGV VVQAAGN GPS  S+LSFSPW+TSVAAS  DR
Sbjct  319   PSSVPSGPSAFLNVLEMELLFATKAGVFVVQAAGNGGPSPSSILSFSPWITSVAASIIDR  378

Query  1111  RYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVP  1290
             +Y+NSI+LGNG++FSG+GL+PPTAG+  +++ AA DV  RN+T+ +L VESCQ    F+ 
Sbjct  379   KYSNSIILGNGRSFSGTGLAPPTAGEMPYRIVAAADVSHRNTTS-VLEVESCQHPEHFIL  437

Query  1291  SLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQI  1470
             S VR KLVICTYT+DFE EAASIA VA+T+ + GAAGF++TMDPDIGSEQ+KG T+T+Q+
Sbjct  438   SSVRNKLVICTYTFDFEYEAASIAAVANTIQKIGAAGFIITMDPDIGSEQVKGTTMTMQV  497

Query  1471  PGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSR  1650
             P +I+NN+++S AL +YYNSNT+RS SG+AV F A ARI+DGRRA ++ Q P+VASYSSR
Sbjct  498   PAIILNNIQSSRALWEYYNSNTIRSTSGQAVGFAARARIMDGRRAFFTRQAPIVASYSSR  557

Query  1651  GPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAG  1830
             GPDV+NALL TADVLKPN+MAPGSSIWAAWSPNSEGD  IKGQ+FALVSGTSMATPHIAG
Sbjct  558   GPDVSNALLQTADVLKPNVMAPGSSIWAAWSPNSEGDPSIKGQNFALVSGTSMATPHIAG  617

Query  1831  IAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPS  2010
             +AALIK +HP W P+AITSAMMT+A   D      +  Q + Q+APATPFDFG+GFINP 
Sbjct  618   VAALIKQKHPRWSPAAITSAMMTTASTFDH-SGSPILAQLTNQIAPATPFDFGAGFINPV  676

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              A++PGLVF+++F+QY+QFLCAVPGVDE SVRR VG  CP N++ WCSDLNT SVTISNL
Sbjct  677   HAIDPGLVFDSHFEQYVQFLCAVPGVDEGSVRRAVGTSCPTNRRAWCSDLNTASVTISNL  736

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             VGSR V+R VTNV   +E YRV VR+P GV VT+ P+   I+ + S+HL IVL A KAT 
Sbjct  737   VGSRKVIRSVTNVSSRNEVYRVTVRQPSGVNVTVSPRVVVINGNASKHLRIVLTAIKATR  796

Query  2371  SYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
             +Y+FGEM+L G R H+VRVP AVYV+ SL+S
Sbjct  797   TYTFGEMVLHGSRKHVVRVPIAVYVSTSLKS  827



>ref|XP_010677140.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104892830 
[Beta vulgaris subsp. vulgaris]
Length=2582

 Score =   986 bits (2550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/758 (68%), Positives = 618/758 (82%), Gaps = 5/758 (1%)
 Frame = +1

Query  196   RMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKM  375
             + ++QHDV L +LL   ++TKLYSY+HLLNGFA+ V S K ++ L    GVR I+EDIKM
Sbjct  1828  KSSRQHDVLLENLLDSGSFTKLYSYSHLLNGFAIDVTSKKVVESLRNVTGVRAIHEDIKM  1887

Query  376   EKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSS-PEEYNIGR-P  549
             EK+TTHTPD+LGIP  VWP LGG   SGEG VIG+IDTGINP H SF++ P     G   
Sbjct  1888  EKLTTHTPDYLGIPTGVWPALGGARSSGEGTVIGLIDTGINPSHPSFANLPSMSTKGSMD  1947

Query  550   RITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHT  729
               + +F GKC +G+ FP TACNGKIVGAQYFARAAIAAGDFN +R YASP+DADGHGSHT
Sbjct  1948  DYSSRFKGKCASGEMFPPTACNGKIVGAQYFARAAIAAGDFNATRDYASPYDADGHGSHT  2007

Query  730   ASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvd  909
             ASTAAG+Y TPVI N FNYG ASGMAPGA IAVYKALY+FGGYMSDVVAAVDQAVEDGVD
Sbjct  2008  ASTAAGSYETPVIVNGFNYGNASGMAPGASIAVYKALYTFGGYMSDVVAAVDQAVEDGVD  2067

Query  910   IlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSV  1089
             ILSLSVGPSSVP G SAFLNVLE++LLFAT+AGV+V+QAAGN GPSS S+LSFSPW+T+V
Sbjct  2068  ILSLSVGPSSVPPGPSAFLNVLEMELLFATKAGVVVIQAAGNGGPSSSSILSFSPWITTV  2127

Query  1090  AASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQ  1269
             AAS  DR+Y NSIVLG+G + SG GL+PPT G A F +AAA DV R NS+ GLL  ESCQ
Sbjct  2128  AASIIDRKYNNSIVLGSGHSLSGMGLAPPTPGNALFPMAAAADVSRHNSSIGLL--ESCQ  2185

Query  1270  DAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKG  1449
                 F+PSLVRGKL+ICTYT+DFE ++ASI  VA+T++  GAAGF++TMDPD+GSE++KG
Sbjct  2186  TPDAFIPSLVRGKLIICTYTFDFEFDSASIVRVAETMNNVGAAGFIMTMDPDVGSEEVKG  2245

Query  1450  ATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPV  1629
              TVTL +PG+++NN++ASTAL QYYN+ T R R+GR +AF ATARILDGR+AIY+GQ P+
Sbjct  2246  TTVTLGVPGIVLNNIQASTALWQYYNARTFRGRTGRVLAFGATARILDGRQAIYTGQAPI  2305

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             VAS+SSRGPDVNNALL TADVLKP +MAPGSSIWAAWSPNSEGD YIKGQ FALVSGTSM
Sbjct  2306  VASFSSRGPDVNNALLQTADVLKPTVMAPGSSIWAAWSPNSEGDHYIKGQSFALVSGTSM  2365

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlapaTPFDFG  1989
             ATPH+AG+AALIK +HPNWKPSAI SAMMT+ D+ D      +  Q + QLAPATPFD+G
Sbjct  2366  ATPHVAGVAALIKHKHPNWKPSAIVSAMMTTTDIADN-AGNPIMAQKTNQLAPATPFDYG  2424

Query  1990  SGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTP  2169
             +G INPSRA++PGLVF + F+ Y+QFLCAVPGVD++SVRR VGV CP  K  WCSDLN+P
Sbjct  2425  AGSINPSRAVDPGLVFISKFKNYVQFLCAVPGVDDESVRRSVGVGCPTKKGGWCSDLNSP  2484

Query  2170  SVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVL  2349
             ++TISNLVGSR V R VTNVG   E Y V+V+ P+GVRV + P+ F +S +G+R L +VL
Sbjct  2485  TITISNLVGSRKVTRVVTNVGNESETYSVVVKPPMGVRVKVTPKTFTVSHNGTRLLKLVL  2544

Query  2350  NATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
              AT ATN+YSFGEM+L GD+ H+ RVP  V V++ L S
Sbjct  2545  EATDATNNYSFGEMLLRGDKGHLARVPITVLVSSVLGS  2582



>ref|XP_006477567.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=812

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/793 (66%), Positives = 634/793 (80%), Gaps = 12/793 (2%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTRIKGTSGNVT---MYKQRMTKQHDVFLGSLLRRSAYTKLYSYTH  276
             AK+++VLM++ P  S +++ +    T   +YK+R++  HD FL SLL   +YTKLYSYTH
Sbjct  23    AKVFIVLMDEEPVTSLKLERSYDRFTDAIVYKERISGGHDRFLESLLHGHSYTKLYSYTH  82

Query  277   LLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVS  456
             LL+GFA+H++S++A+  L  A+GVR I+EDIKMEK+T HTP+FLGIP  VWP LGG   S
Sbjct  83    LLSGFAIHIESEEAVSTLQNAKGVRIIHEDIKMEKLTMHTPEFLGIPVGVWPTLGGAEFS  142

Query  457   GEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQ  636
             GEGVVIG IDTGINP H SF+S   ++    +   KF GKC TG+ FP+TACN KIVGAQ
Sbjct  143   GEGVVIGFIDTGINPEHPSFAS---HSFRGNQSISKFKGKCTTGNRFPSTACNSKIVGAQ  199

Query  637   YFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGA  816
             YFARAAIA GDFN +R YASPFDADGHGSHTASTAAGN+  PVI + FNYGYASGMAPGA
Sbjct  200   YFARAAIAYGDFNSTRDYASPFDADGHGSHTASTAAGNHRVPVIVSGFNYGYASGMAPGA  259

Query  817   GIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFA  996
              IAVYKALY+FGGYM+DVVAAVDQAVEDGVDI+SLSVGPS+VPSG +AFLN LE++LLFA
Sbjct  260   RIAVYKALYTFGGYMADVVAAVDQAVEDGVDIISLSVGPSAVPSGPAAFLNALEMELLFA  319

Query  997   TRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPP  1176
             T+AGVLVVQAAGNSGPSS S+LSFSPW+TS+AAS TDR+Y N+I L NG +FSG GL+PP
Sbjct  320   TKAGVLVVQAAGNSGPSSSSILSFSPWITSIAASITDRKYNNTIKLANGHSFSGIGLAPP  379

Query  1177  TAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAAS  1356
             T G+ ++ LAAA DVC RN + G+ ++ESCQ    F+P+LVRGKL+ICTY++DFE++ A+
Sbjct  380   TLGRVYYPLAAAADVCHRNVSTGIFSLESCQYPELFIPALVRGKLIICTYSFDFENDDAT  439

Query  1357  IATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNT  1536
             IATVAD + +  AAGF+L MDPD      K   + L +PG+I+NNM++S  L +YYNS T
Sbjct  440   IATVADNIKKIEAAGFILRMDPDQDFSPNKFKDMALDVPGIILNNMQSSMDLLEYYNSRT  499

Query  1537  LRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAP  1716
             ++SR+G+AV F A ARILDGRRAIY GQ PVVASYSSRGPDVNNALL TADVLKPNIMAP
Sbjct  500   IKSRAGQAVVFHARARILDGRRAIYHGQAPVVASYSSRGPDVNNALLQTADVLKPNIMAP  559

Query  1717  GSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMM  1896
             GSSIWAAWSP+SEGD  +KG++FAL+SGTSMATPHIAG+AALIK RHP W P+AITSAMM
Sbjct  560   GSSIWAAWSPSSEGDPNLKGRNFALLSGTSMATPHIAGVAALIKQRHPKWSPAAITSAMM  619

Query  1897  TSADVTDRlgspllaq------qasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQY  2058
             TSA+VTD  GSP+LAQ           L  ATPFDFG+GFINP+RA++PGL+FN +FQ+Y
Sbjct  620   TSAEVTDHSGSPILAQDYSDSPILEHVLVHATPFDFGAGFINPARAIDPGLIFNAHFQEY  679

Query  2059  IQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGA  2238
             +QFLCAVPGVD+  VRRV G  CP   + WCSDLNTPS+TISNLVGSR V+RRV NV  A
Sbjct  680   VQFLCAVPGVDDDYVRRVTGYGCPTENQGWCSDLNTPSITISNLVGSRKVIRRVRNVSSA  739

Query  2239  DERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHI  2418
             +E Y V V+EP GV+V++ PQ F I    SR L IVL AT +T +YSFG M+L G+ NHI
Sbjct  740   NETYTVTVKEPSGVKVSVSPQVFKIRGLASRELKIVLKATNSTRAYSFGAMVLQGNNNHI  799

Query  2419  VRVPFAVYVTASL  2457
             +R+P AVYV+ SL
Sbjct  800   IRIPIAVYVSTSL  812



>gb|KDO57036.1| hypothetical protein CISIN_1g044171mg [Citrus sinensis]
Length=813

 Score =   978 bits (2529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/794 (65%), Positives = 629/794 (79%), Gaps = 13/794 (2%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTRIKGT----SGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYT  273
             AK+++VLM++ P  S +++ +      +  +YK+R++  HD FL SLL   +YTKLYSYT
Sbjct  23    AKVFIVLMDEEPVTSLKLERSYDRNETDAIVYKERISGGHDRFLESLLHGHSYTKLYSYT  82

Query  274   HLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSV  453
             HLL+GFA+H++S++A+  L  A+GVR I+EDIKMEK+T HTP+FLGIP  VWP LGG   
Sbjct  83    HLLSGFAIHIESEEAVSTLQNAKGVRIIHEDIKMEKLTMHTPEFLGIPVGVWPTLGGAEF  142

Query  454   SGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGA  633
             SGEGVVIG IDTGINP H SF+S   ++    +   KF GKC TG+ FP+TACN KIVGA
Sbjct  143   SGEGVVIGFIDTGINPEHPSFAS---HSFRGNQSISKFKGKCTTGNRFPSTACNSKIVGA  199

Query  634   QYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPG  813
             QYFARAAIA GDFN +R YASPFDADGHGSHTASTAAGN+  PVI + FNYGYASGMAPG
Sbjct  200   QYFARAAIAYGDFNSTRDYASPFDADGHGSHTASTAAGNHRVPVIVSGFNYGYASGMAPG  259

Query  814   AGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLF  993
             A IAVYKALY+FGGYM+DVVAAVDQAVEDGVDI+SLSVGPS+VPSG +AFLN LE++LLF
Sbjct  260   ARIAVYKALYTFGGYMADVVAAVDQAVEDGVDIISLSVGPSAVPSGPAAFLNALEMELLF  319

Query  994   ATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSP  1173
             AT+AGVLVVQAAGNSGPSS S+LSFSPW+TS+AAS TDR+Y N+I L NG +FSG GL+P
Sbjct  320   ATKAGVLVVQAAGNSGPSSSSILSFSPWITSIAASITDRKYNNTIKLANGHSFSGIGLAP  379

Query  1174  PTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAA  1353
             PT G+ ++ LAAA DVC RN + G+ ++ESCQ    F+P+LVRGKL+ICTY++DFE++ A
Sbjct  380   PTLGRVYYPLAAAADVCHRNVSTGIFSLESCQYPELFIPALVRGKLIICTYSFDFENDDA  439

Query  1354  SIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSN  1533
             +IATVAD + +  AAGF+L MDPD      K   + L +PG+I+NNM++S  L +YYNS+
Sbjct  440   TIATVADNIKKIEAAGFILRMDPDQDFSPNKFKDMALDVPGIILNNMQSSMDLLEYYNSH  499

Query  1534  TLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMA  1713
             T++SR+G+AV F A ARILDGRRAIY GQ PVVASYSSRGPDVNNALL TADVLKPNIMA
Sbjct  500   TIKSRAGQAVVFHARARILDGRRAIYHGQAPVVASYSSRGPDVNNALLQTADVLKPNIMA  559

Query  1714  PGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAM  1893
             PGSSIWAAWSP+SEGD  +KG++FAL+SGTSMATPHIAG+AALIK RHP W P+AITSAM
Sbjct  560   PGSSIWAAWSPSSEGDPNLKGRNFALLSGTSMATPHIAGVAALIKQRHPKWSPAAITSAM  619

Query  1894  MTSADVTDR------lgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQ  2055
             MTSA+VTD             +      L  ATPFDFG+GFINP+RA++PGL+FN +FQ+
Sbjct  620   MTSAEVTDHSGSPILAQDYSDSPILEHVLVHATPFDFGAGFINPARAIDPGLIFNAHFQE  679

Query  2056  YIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGG  2235
             Y+QFLCAVPGVD+  VRRV G  CP   + WCSDLNTPS+TISNLVGSR V+RRV NV  
Sbjct  680   YVQFLCAVPGVDDDYVRRVTGYGCPTENQGWCSDLNTPSITISNLVGSRKVIRRVRNVSS  739

Query  2236  ADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNH  2415
             A+E Y V V+EP GV+V++ PQ F I    SR L IVL AT +T +YSFG M+L G+ NH
Sbjct  740   ANETYTVTVKEPSGVKVSVSPQVFKIRGLASRELKIVLKATNSTRAYSFGAMVLQGNNNH  799

Query  2416  IVRVPFAVYVTASL  2457
             I+R+P AVYV+ SL
Sbjct  800   IIRIPIAVYVSTSL  813



>ref|XP_010919913.1| PREDICTED: uncharacterized protein LOC105043884 [Elaeis guineensis]
Length=2153

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/794 (61%), Positives = 612/794 (77%), Gaps = 21/794 (3%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTRIKGTS---GNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTH  276
             AK+YMV+MED P +S +    S        YK+++  +HD+FL SLL   +YTKLYSYTH
Sbjct  1373  AKVYMVVMEDDPVISYKESQNSMIGDEAQKYKEKVISRHDIFLESLLPTGSYTKLYSYTH  1432

Query  277   LLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVS  456
             LLNGFA+H  S++A++IL  A GVR ++ED+KM KMTTHTPD++GI   VWP LGG   S
Sbjct  1433  LLNGFALHTASEEAVEILSNARGVRLMHEDMKMVKMTTHTPDYIGISAGVWPHLGGAERS  1492

Query  457   GEGVVIGMIDTGINPFHASFSSPEEYNIGRPR----ITRKFTGKCITGDNFPATACNGKI  624
             G+G+VIGMIDTGINP H SF++       RP+    +TR F G+C  GD FP  ACNGKI
Sbjct  1493  GDGIVIGMIDTGINPDHPSFANL------RPQPASNLTR-FKGRCEVGDEFPLAACNGKI  1545

Query  625   VGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGM  804
             VGAQ+FARAAIAAGDFN +R YASPFDADGHGSHT+S AAGNY   V++  +NYGYASGM
Sbjct  1546  VGAQHFARAAIAAGDFNATRDYASPFDADGHGSHTSSIAAGNYRIAVLSKGYNYGYASGM  1605

Query  805   APGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQ  984
             APGA IA YKA+YSFGGYMSDVVAAVD+AVEDGVDILSLS+GPS+VP G +AFLN+LEV+
Sbjct  1606  APGARIAAYKAVYSFGGYMSDVVAAVDKAVEDGVDILSLSIGPSAVPPGPAAFLNILEVE  1665

Query  985   LLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSG  1164
             LLFA +AGV V+QA GN GP+S S+LSFSPWVTSVAASTTDR+Y NSI+LG GQ+  G+G
Sbjct  1666  LLFAAKAGVSVIQAVGNGGPASSSILSFSPWVTSVAASTTDRKYNNSIILGTGQSLPGTG  1725

Query  1165  LSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFES  1344
             LSP T  K FF +AAA DVC RN++   L V++CQ    F+P LVRGKL++CTY  +F  
Sbjct  1726  LSPATMEKEFFPIAAAEDVCSRNTS--FLVVQNCQHPDPFIPELVRGKLIVCTYISEFIY  1783

Query  1345  EAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYY  1524
                SI  +A T+   GA GF++TMD    SE    +T TL +PG+++++ EAS AL +YY
Sbjct  1784  APTSIEAIASTIQEIGAVGFIITMDRSYDSEPPVDSTSTLSVPGIVLSSREASQALWEYY  1843

Query  1525  NSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPN  1704
             +SNT+R  +G    F AT RILDGRRAIY+GQGP +ASYSSRGPDVNNAL++TADVLKPN
Sbjct  1844  DSNTVRGINGGVAHFGATGRILDGRRAIYTGQGPAIASYSSRGPDVNNALMETADVLKPN  1903

Query  1705  IMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAIT  1884
             IMAPGS+IWAAWSP S+ ++      FAL SGTSMATPH+AG+AALIK +HPNW P+AIT
Sbjct  1904  IMAPGSAIWAAWSPKSDNNQ--NAIEFALQSGTSMATPHVAGVAALIKQKHPNWSPAAIT  1961

Query  1885  SAMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQ  2064
             SAMMTSADVTDR  S    +    ++A ATPFD+G+G IN +RA++PGL+ +  F+ YIQ
Sbjct  1962  SAMMTSADVTDR--SGSPMRSQGNEVATATPFDYGAGAINAARAIDPGLILDIAFKNYIQ  2019

Query  2065  FLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADE  2244
             FLCAVPGVD++SVRR VG+ CP  +  WCSDLNTPSVT++NLVGSRTV+RRVT+V G +E
Sbjct  2020  FLCAVPGVDDESVRRAVGLGCPAARSEWCSDLNTPSVTVANLVGSRTVVRRVTSVAGFEE  2079

Query  2245  RYRVIVR-EPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIV  2421
              Y+V V+ EP GV V + PQ F I  + SR++ I+L A +ATN+Y+FGE++L GDR H+V
Sbjct  2080  TYQVAVKDEPAGVEVAVRPQEFTIGPNESRNIKIMLKAREATNAYAFGELVLNGDRKHVV  2139

Query  2422  RVPFAVYVTASLQS  2463
             R+P A++V+++L+S
Sbjct  2140  RIPLAIFVSSTLRS  2153



>dbj|BAA04839.1| serine proteinase [Lilium longiflorum]
Length=813

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/784 (61%), Positives = 596/784 (76%), Gaps = 12/784 (2%)
 Frame = +1

Query  109   KIYMVLMEDHPFVSTRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNG  288
             K++MVLME+ P ++ + K  S +   YKQR+  QHD+FL SLL   +Y KLYSYTHLLNG
Sbjct  42    KVFMVLMEEDPVITYKTK-NSDDAQKYKQRVISQHDIFLESLLPIGSYKKLYSYTHLLNG  100

Query  289   FAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGV  468
             FA+H  SD+A++IL  A GVR + ED+KM KMTTHTPD+LGI   VWP LGG   SG+GV
Sbjct  101   FAIHATSDEAVEILRDAHGVRVVQEDVKMMKMTTHTPDYLGIQTGVWPELGGAERSGDGV  160

Query  469   VIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFAR  648
             VIGMIDTGINP H SF +P    +      ++F G+C+ GD FP T+CNGKIVGAQYFA 
Sbjct  161   VIGMIDTGINPNHPSFMNPWSREVAD---LKRFKGRCVPGDQFPLTSCNGKIVGAQYFAH  217

Query  649   AAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAV  828
              AIA G+FN +R YASPFDADGHGSHTASTAAGNY   V++N +N+GYASGMAPGA IAV
Sbjct  218   GAIAVGEFNATRDYASPFDADGHGSHTASTAAGNYRVAVLSNGYNFGYASGMAPGAWIAV  277

Query  829   YKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAG  1008
             YKALYSFGGYMSDVVAAVD+AVEDGVDI+SLSVGPS+VPSG +AFL++LEV+LLFAT+AG
Sbjct  278   YKALYSFGGYMSDVVAAVDKAVEDGVDIISLSVGPSAVPSGPTAFLDILEVELLFATKAG  337

Query  1009  VLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGK  1188
             V VVQA GN GPSS S+LSFSPW+ SVAAS TDR+Y N+I+L NG + SG GLSPPT  +
Sbjct  338   VTVVQAIGNGGPSSSSILSFSPWIMSVAASITDRQYNNTIILSNGHSISGIGLSPPTPER  397

Query  1189  AFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATV  1368
                 +AAA DVC RN++   + + SCQ    F+ SLVRGKL+ICT T D  S   SI  +
Sbjct  398   ELIPIAAAEDVCSRNTS--FVVLRSCQSPDPFISSLVRGKLIICTLTTD-SSSPMSIEAI  454

Query  1369  ADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSR  1548
               T+ + GA G ++TMD DI  E   G      +PG+++ N +AS AL +YY+ +TLR R
Sbjct  455   LSTIQKIGAVGVIITMDHDIEPEPPSGGASAFPVPGIVLINSDASEALWEYYSGHTLRGR  514

Query  1549  SGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSI  1728
             +G  ++F AT RILDGRRAIY+GQ P+VA YSSRGPDVNNALL TADVLKPNI+APG+SI
Sbjct  515   NGAVISFGATGRILDGRRAIYTGQSPMVARYSSRGPDVNNALLQTADVLKPNILAPGTSI  574

Query  1729  WAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSAD  1908
             WAAWS NS      +G++FAL SGTSMATPH+AGIAALIK  HPNW P+AI SA+MT+A 
Sbjct  575   WAAWSSNST-----EGENFALQSGTSMATPHVAGIAALIKQMHPNWSPAAIASAIMTTAQ  629

Query  1909  VTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGV  2088
             V D     LLAQQA+   + ATPFD+G+G INP++A+NPGL+F+  F+ YIQFLCAVPGV
Sbjct  630   VVDSYDHALLAQQATTDPSTATPFDYGAGAINPAQAINPGLIFDADFKNYIQFLCAVPGV  689

Query  2089  DEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVRE  2268
             DE+SVRR VGV CP     WCSDLNTPSVT++NLVGSR V+R+V +VG   E Y+ +V+ 
Sbjct  690   DEESVRRAVGVGCPSQHTDWCSDLNTPSVTVANLVGSRRVLRKVMSVGDEQETYKAMVKS  749

Query  2269  PLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVT  2448
             P GV VT+ P  F I+ + S+ L I+L+A + TN+Y+FGE++L GD+ H+VR+P  V+V+
Sbjct  750   PSGVSVTVTPSAFTINPNTSKGLAILLDAVEVTNAYTFGEVVLNGDKKHVVRIPLVVFVS  809

Query  2449  ASLQ  2460
             ++L 
Sbjct  810   STLN  813



>ref|XP_006440167.1| hypothetical protein CICLE_v10019138mg [Citrus clementina]
 gb|ESR53407.1| hypothetical protein CICLE_v10019138mg [Citrus clementina]
Length=684

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/721 (63%), Positives = 545/721 (76%), Gaps = 49/721 (7%)
 Frame = +1

Query  313   KALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTG  492
             +A+  L  A+GVR I+EDIKMEK+T HTP+FLGIP  VWP LGG   SGEGVVIG IDTG
Sbjct  7     QAVSTLQNAKGVRIIHEDIKMEKLTMHTPEFLGIPAGVWPTLGGAEFSGEGVVIGFIDTG  66

Query  493   INPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDF  672
             INP H SF+S   ++    +   KF GKC TG+ FP+TACN KIVGAQYFARAAIA GDF
Sbjct  67    INPEHPSFAS---HSFRGNQSISKFKGKCTTGNRFPSTACNSKIVGAQYFARAAIAYGDF  123

Query  673   NVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYSFG  852
             N +R YASPFDADGHGSHTASTAAGN+  PV                  IAV   +    
Sbjct  124   NSTRDYASPFDADGHGSHTASTAAGNHRVPV------------------IAVEDGV----  161

Query  853   GYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAG  1032
                               DI+SLSVGPS+VPSG +AFLN LE++LLFAT+AGVLVVQAAG
Sbjct  162   ------------------DIISLSVGPSAVPSGPAAFLNALEMELLFATKAGVLVVQAAG  203

Query  1033  NSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAA  1212
             NSGPSS S+LSFSPW+TS+AAS TDR+Y N+I L NG +FSG GL+PPT G+ ++ LAAA
Sbjct  204   NSGPSSSSILSFSPWITSIAASITDRKYNNTIKLANGHSFSGIGLAPPTLGRVYYPLAAA  263

Query  1213  VDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAG  1392
              DVC RN + G+ ++ESCQ    F+P+LVRGKL+ICTY++DFE++ A+IATVAD + + G
Sbjct  264   ADVCHRNVSTGIFSLESCQYPELFIPALVRGKLIICTYSFDFENDDATIATVADNIKKIG  323

Query  1393  AAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFR  1572
             AAGF+L MDPD      K   + L +PG+I+NNM++S  L +YYNS+T++SR+G+AV FR
Sbjct  324   AAGFILRMDPDQDFSPNKFKDMALDVPGIILNNMQSSMDLLEYYNSHTIKSRAGQAVVFR  383

Query  1573  ATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNS  1752
             A ARILDGRRAIY GQ PVVASYSSRGPDVNNALL TADVLKPNIMAPGSSIWAAWSP+S
Sbjct  384   ARARILDGRRAIYHGQAPVVASYSSRGPDVNNALLQTADVLKPNIMAPGSSIWAAWSPSS  443

Query  1753  EGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgsp  1932
             EGD  +KG++FAL+SGTSMATPHIAG+AALIK RHP W P+AITSAMMTSA+VTD  GSP
Sbjct  444   EGDPNLKGRNFALLSGTSMATPHIAGVAALIKQRHPKWSPAAITSAMMTSAEVTDHSGSP  503

Query  1933  llaqqasqq------lapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDE  2094
             +LAQ  S        L  ATPFDFG+GFINP+RA++PGL+FN +FQ+Y+QFLCAVPGVD+
Sbjct  504   ILAQDYSDSPILEHVLVHATPFDFGAGFINPARAIDPGLIFNAHFQEYVQFLCAVPGVDD  563

Query  2095  KSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPL  2274
               VRRV G  CP   + WCSDLNTPS+T+SNLVGSR V+RRV NV  A+E Y V V+EP 
Sbjct  564   DYVRRVTGYGCPTENQGWCSDLNTPSITVSNLVGSRKVIRRVRNVSSANETYTVTVKEPS  623

Query  2275  GVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTAS  2454
             GV+V++ PQ F I    SR L IVL AT +T +YSFG M+L G+ NHI+R+P AVYV+ S
Sbjct  624   GVKVSVSPQVFKIRGLASRELKIVLKATNSTRAYSFGAMVLQGNNNHIIRIPIAVYVSTS  683

Query  2455  L  2457
             L
Sbjct  684   L  684



>ref|NP_001053456.2| Os04g0543700 [Oryza sativa Japonica Group]
 dbj|BAF15370.2| Os04g0543700, partial [Oryza sativa Japonica Group]
Length=815

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/790 (54%), Positives = 558/790 (71%), Gaps = 15/790 (2%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR------IKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYS  267
             AK++MV+MED P +S +      ++G       YK   T +HD+FL S L   +Y KLYS
Sbjct  33    AKVFMVVMEDDPIISPKSSQKKVMRGEEAQ--KYKAMTTTKHDIFLDSFLPAGSYKKLYS  90

Query  268   YTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGP  447
             YTHLLNGFA++ KS+KA+K L  A+GVR I EDIKM KMTT+TP ++G  + VWP LGG 
Sbjct  91    YTHLLNGFAIYAKSEKAIKTLSGAKGVRLIQEDIKMAKMTTYTPRYIGA-NVVWPLLGGA  149

Query  448   SVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIV  627
               +G+GVVIGM+DTGI+P + SF S  +     P     F G C TG+ FP  +CNGKIV
Sbjct  150   EKAGDGVVIGMVDTGIDPSNPSFLSTSDQAKPPPA---SFKGTCQTGERFPPDSCNGKIV  206

Query  628   GAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMA  807
             GA++FARA  A G+FN + HYASP+D DGHGSHTASTAAGN+HTP I+  +N+G+ASG+A
Sbjct  207   GARWFARAGQATGEFNATMHYASPYDPDGHGSHTASTAAGNFHTPAISKGYNFGHASGVA  266

Query  808   PGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQL  987
             PGA +A+YKA YSFGGYMSDV+AAVD+AVEDGVDI+SLS+GP+++ SG ++FLN+LE QL
Sbjct  267   PGAHLAIYKAAYSFGGYMSDVIAAVDKAVEDGVDIISLSLGPTTITSGPASFLNLLETQL  326

Query  988   LFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGL  1167
             L AT+AG+ VVQA GN GP + S++SFSPW+TSV ASTTDR+Y  SI++GNGQ FS  GL
Sbjct  327   LLATKAGISVVQAVGNGGPDANSVVSFSPWITSVGASTTDRKYNKSIIIGNGQVFSCGGL  386

Query  1168  SPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESE  1347
             SP T G+  + LA A DVC  NST G     +CQD   F+ SLV+GK++IC +      E
Sbjct  387   SPSTPGETMYPLALADDVCNTNSTGG---SSNCQDPDVFIRSLVQGKVIICMFVSSNYYE  443

Query  1348  AASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYN  1527
                +A + DT+ + GAAG ++T      S+     T    IP  I+ N   + AL +YY+
Sbjct  444   GDFLAGIVDTIQKIGAAGVIITDRSSSDSDIEYHPTFPTSIPSAIVVNSADAQALLEYYD  503

Query  1528  SNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNI  1707
              N +R + G    F AT RILDGRRAIY+ + PVVA YSSRGPDV++  +  ADVLKPN+
Sbjct  504   DNLVRDKEGSVTKFGATIRILDGRRAIYTREAPVVAEYSSRGPDVDDMQMQAADVLKPNV  563

Query  1708  MAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITS  1887
             MAPG  IW AWSP S+     +G+ +A++SGTSMATPH+AG+ ALI+ RHP W P+ + S
Sbjct  564   MAPGHHIWGAWSPTSDAMVEFQGESYAMLSGTSMATPHVAGVVALIRQRHPKWSPAMVMS  623

Query  1888  AMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQF  2067
             A+MT+ADVTDR G PL+A++    L  ATPFD G+G IN +RA++PGLVF+  ++ Y+QF
Sbjct  624   AIMTTADVTDRSGRPLMARRDGGVLERATPFDMGAGAINAARAVDPGLVFDAGYRDYLQF  683

Query  2068  LCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADER  2247
             LCAVPGVD+ +V R VGV CP ++  WCSDLN PSVT+++LVGSR V RRVT+VG  +E 
Sbjct  684   LCAVPGVDDAAVLRAVGVPCPPSRARWCSDLNAPSVTVASLVGSRRVDRRVTSVGAENET  743

Query  2248  YRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRV  2427
             Y   V+ P GV V + P  F ++   +  L IVLN T   N++SFGE++L GD+ H VR+
Sbjct  744   YMAHVQAPDGVAVRVSPDTFAVAPGATATLRIVLNTTAPGNTFSFGEVVLRGDKKHTVRI  803

Query  2428  PFAVYVTASL  2457
             P AV+  A+L
Sbjct  804   PLAVFPAAAL  813



>emb|CAE04340.2| OSJNBb0038F03.4 [Oryza sativa Japonica Group]
Length=836

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/790 (54%), Positives = 558/790 (71%), Gaps = 15/790 (2%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR------IKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYS  267
             AK++MV+MED P +S +      ++G       YK   T +HD+FL S L   +Y KLYS
Sbjct  54    AKVFMVVMEDDPIISPKSSQKKVMRGEEAQ--KYKAMTTTKHDIFLDSFLPAGSYKKLYS  111

Query  268   YTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGP  447
             YTHLLNGFA++ KS+KA+K L  A+GVR I EDIKM KMTT+TP ++G  + VWP LGG 
Sbjct  112   YTHLLNGFAIYAKSEKAIKTLSGAKGVRLIQEDIKMAKMTTYTPRYIGA-NVVWPLLGGA  170

Query  448   SVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIV  627
               +G+GVVIGM+DTGI+P + SF S  +     P     F G C TG+ FP  +CNGKIV
Sbjct  171   EKAGDGVVIGMVDTGIDPSNPSFLSTSDQAKPPPA---SFKGTCQTGERFPPDSCNGKIV  227

Query  628   GAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMA  807
             GA++FARA  A G+FN + HYASP+D DGHGSHTASTAAGN+HTP I+  +N+G+ASG+A
Sbjct  228   GARWFARAGQATGEFNATMHYASPYDPDGHGSHTASTAAGNFHTPAISKGYNFGHASGVA  287

Query  808   PGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQL  987
             PGA +A+YKA YSFGGYMSDV+AAVD+AVEDGVDI+SLS+GP+++ SG ++FLN+LE QL
Sbjct  288   PGAHLAIYKAAYSFGGYMSDVIAAVDKAVEDGVDIISLSLGPTTITSGPASFLNLLETQL  347

Query  988   LFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGL  1167
             L AT+AG+ VVQA GN GP + S++SFSPW+TSV ASTTDR+Y  SI++GNGQ FS  GL
Sbjct  348   LLATKAGISVVQAVGNGGPDANSVVSFSPWITSVGASTTDRKYNKSIIIGNGQVFSCGGL  407

Query  1168  SPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESE  1347
             SP T G+  + LA A DVC  NST G     +CQD   F+ SLV+GK++IC +      E
Sbjct  408   SPSTPGETMYPLALADDVCNTNSTGG---SSNCQDPDVFIRSLVQGKVIICMFVSSNYYE  464

Query  1348  AASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYN  1527
                +A + DT+ + GAAG ++T      S+     T    IP  I+ N   + AL +YY+
Sbjct  465   GDFLAGIVDTIQKIGAAGVIITDRSSSDSDIEYHPTFPTSIPSAIVVNSADAQALLEYYD  524

Query  1528  SNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNI  1707
              N +R + G    F AT RILDGRRAIY+ + PVVA YSSRGPDV++  +  ADVLKPN+
Sbjct  525   DNLVRDKEGSVTKFGATIRILDGRRAIYTREAPVVAEYSSRGPDVDDMQMQAADVLKPNV  584

Query  1708  MAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITS  1887
             MAPG  IW AWSP S+     +G+ +A++SGTSMATPH+AG+ ALI+ RHP W P+ + S
Sbjct  585   MAPGHHIWGAWSPTSDAMVEFQGESYAMLSGTSMATPHVAGVVALIRQRHPKWSPAMVMS  644

Query  1888  AMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQF  2067
             A+MT+ADVTDR G PL+A++    L  ATPFD G+G IN +RA++PGLVF+  ++ Y+QF
Sbjct  645   AIMTTADVTDRSGRPLMARRDGGVLERATPFDMGAGAINAARAVDPGLVFDAGYRDYLQF  704

Query  2068  LCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADER  2247
             LCAVPGVD+ +V R VGV CP ++  WCSDLN PSVT+++LVGSR V RRVT+VG  +E 
Sbjct  705   LCAVPGVDDAAVLRAVGVPCPPSRARWCSDLNAPSVTVASLVGSRRVDRRVTSVGAENET  764

Query  2248  YRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRV  2427
             Y   V+ P GV V + P  F ++   +  L IVLN T   N++SFGE++L GD+ H VR+
Sbjct  765   YMAHVQAPDGVAVRVSPDTFAVAPGATATLRIVLNTTAPGNTFSFGEVVLRGDKKHTVRI  824

Query  2428  PFAVYVTASL  2457
             P AV+  A+L
Sbjct  825   PLAVFPAAAL  834



>gb|EEE61430.1| hypothetical protein OsJ_15646 [Oryza sativa Japonica Group]
Length=882

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/790 (54%), Positives = 558/790 (71%), Gaps = 15/790 (2%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR------IKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYS  267
             AK++MV+MED P +S +      ++G       YK   T +HD+FL S L   +Y KLYS
Sbjct  100   AKVFMVVMEDDPIISPKSSQKKVMRGEEAQ--KYKAMTTTKHDIFLDSFLPAGSYKKLYS  157

Query  268   YTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGP  447
             YTHLLNGFA++ KS+KA+K L  A+GVR I EDIKM KMTT+TP ++G  + VWP LGG 
Sbjct  158   YTHLLNGFAIYAKSEKAIKTLSGAKGVRLIQEDIKMAKMTTYTPRYIGA-NVVWPLLGGA  216

Query  448   SVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIV  627
               +G+GVVIGM+DTGI+P + SF S  +     P     F G C TG+ FP  +CNGKIV
Sbjct  217   EKAGDGVVIGMVDTGIDPSNPSFLSTSDQAKPPPA---SFKGTCQTGERFPPDSCNGKIV  273

Query  628   GAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMA  807
             GA++FARA  A G+FN + HYASP+D DGHGSHTASTAAGN+HTP I+  +N+G+ASG+A
Sbjct  274   GARWFARAGQATGEFNATMHYASPYDPDGHGSHTASTAAGNFHTPAISKGYNFGHASGVA  333

Query  808   PGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQL  987
             PGA +A+YKA YSFGGYMSDV+AAVD+AVEDGVDI+SLS+GP+++ SG ++FLN+LE QL
Sbjct  334   PGAHLAIYKAAYSFGGYMSDVIAAVDKAVEDGVDIISLSLGPTTITSGPASFLNLLETQL  393

Query  988   LFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGL  1167
             L AT+AG+ VVQA GN GP + S++SFSPW+TSV ASTTDR+Y  SI++GNGQ FS  GL
Sbjct  394   LLATKAGISVVQAVGNGGPDANSVVSFSPWITSVGASTTDRKYNKSIIIGNGQVFSCGGL  453

Query  1168  SPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESE  1347
             SP T G+  + LA A DVC  NST G     +CQD   F+ SLV+GK++IC +      E
Sbjct  454   SPSTPGETMYPLALADDVCNTNSTGG---SSNCQDPDVFIRSLVQGKVIICMFVSSNYYE  510

Query  1348  AASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYN  1527
                +A + DT+ + GAAG ++T      S+     T    IP  I+ N   + AL +YY+
Sbjct  511   GDFLAGIVDTIQKIGAAGVIITDRSSSDSDIEYHPTFPTSIPSAIVVNSADAQALLEYYD  570

Query  1528  SNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNI  1707
              N +R + G    F AT RILDGRRAIY+ + PVVA YSSRGPDV++  +  ADVLKPN+
Sbjct  571   DNLVRDKEGSVTKFGATIRILDGRRAIYTREAPVVAEYSSRGPDVDDMQMQAADVLKPNV  630

Query  1708  MAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITS  1887
             MAPG  IW AWSP S+     +G+ +A++SGTSMATPH+AG+ ALI+ RHP W P+ + S
Sbjct  631   MAPGHHIWGAWSPTSDAMVEFQGESYAMLSGTSMATPHVAGVVALIRQRHPKWSPAMVMS  690

Query  1888  AMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQF  2067
             A+MT+ADVTDR G PL+A++    L  ATPFD G+G IN +RA++PGLVF+  ++ Y+QF
Sbjct  691   AIMTTADVTDRSGRPLMARRDGGVLERATPFDMGAGAINAARAVDPGLVFDAGYRDYLQF  750

Query  2068  LCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADER  2247
             LCAVPGVD+ +V R VGV CP ++  WCSDLN PSVT+++LVGSR V RRVT+VG  +E 
Sbjct  751   LCAVPGVDDAAVLRAVGVPCPPSRARWCSDLNAPSVTVASLVGSRRVDRRVTSVGAENET  810

Query  2248  YRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRV  2427
             Y   V+ P GV V + P  F ++   +  L IVLN T   N++SFGE++L GD+ H VR+
Sbjct  811   YMAHVQAPDGVAVRVSPDTFAVAPGATATLRIVLNTTAPGNTFSFGEVVLRGDKKHTVRI  870

Query  2428  PFAVYVTASL  2457
             P AV+  A+L
Sbjct  871   PLAVFPAAAL  880



>gb|EEC77734.1| hypothetical protein OsI_16841 [Oryza sativa Indica Group]
Length=882

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/790 (54%), Positives = 558/790 (71%), Gaps = 15/790 (2%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR------IKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYS  267
             AK++MV+MED P +S +      ++G       YK   T +HD+FL S L   +Y KLYS
Sbjct  100   AKVFMVVMEDDPIISPKSSQKKVMRGEEAQ--KYKAMTTTKHDIFLDSFLPAGSYKKLYS  157

Query  268   YTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGP  447
             YTHLLNGFA++ KS+KA+K L  A+GVR I EDIKM KMTT+TP ++G  + VWP LGG 
Sbjct  158   YTHLLNGFAIYAKSEKAIKTLSGAKGVRLIQEDIKMAKMTTYTPRYIGA-NVVWPLLGGA  216

Query  448   SVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIV  627
               +G+GVVIGM+DTGI+P + SF S  +     P     F G C TG+ FP  +CNGKIV
Sbjct  217   EKAGDGVVIGMVDTGIDPSNPSFLSTSDQAKPPPA---SFKGTCQTGERFPPDSCNGKIV  273

Query  628   GAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMA  807
             GA++FARA  A G+FN + HYASP+D DGHGSHTASTAAGN+HTP I+  +N+G+ASG+A
Sbjct  274   GARWFARAGQATGEFNATMHYASPYDPDGHGSHTASTAAGNFHTPAISKGYNFGHASGVA  333

Query  808   PGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQL  987
             PGA +A+YKA YSFGGYMSDV+AAVD+AVEDGVDI+SLS+GP+++ SG ++FLN+LE QL
Sbjct  334   PGAHLAIYKAAYSFGGYMSDVIAAVDKAVEDGVDIISLSLGPTTITSGPASFLNLLETQL  393

Query  988   LFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGL  1167
             L AT+AG+ VVQA GN GP + S++SFSPW+TSV ASTTDR+Y  SI++GNG+ FS  GL
Sbjct  394   LLATKAGISVVQAVGNGGPDANSVVSFSPWITSVGASTTDRKYNKSIIIGNGKVFSCGGL  453

Query  1168  SPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESE  1347
             SP T G+  + LA A DVC  NST G     +CQD   F+ SLV+GK++IC +      E
Sbjct  454   SPSTPGETMYPLALADDVCNTNSTGG---SSNCQDPDVFIRSLVQGKVIICMFVSSNYYE  510

Query  1348  AASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYN  1527
                +A + DT+ + GAAG ++T      S+     T    IP  I+ N   + AL +YY+
Sbjct  511   GDFLAGIVDTIQKIGAAGVIITDRSSSDSDIEYHPTFPTSIPSAIVVNSADAQALLEYYD  570

Query  1528  SNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNI  1707
              N +R + G    F AT RILDGRRAIY+ + PVVA YSSRGPDV++  +  ADVLKPN+
Sbjct  571   DNLVRDKEGSVTKFGATIRILDGRRAIYTREAPVVAEYSSRGPDVDDMQMQAADVLKPNV  630

Query  1708  MAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITS  1887
             MAPG  IW AWSP S+     +G+ +A++SGTSMATPH+AG+ ALI+ RHP W P+ + S
Sbjct  631   MAPGHHIWGAWSPTSDAMVEFQGEIYAMLSGTSMATPHVAGVVALIRQRHPKWSPAMVMS  690

Query  1888  AMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQF  2067
             A+MT+ADVTDR G PL+A++    L  ATPFD G+G IN +RA++PGLVF+  ++ Y+QF
Sbjct  691   AIMTTADVTDRSGRPLMARRDGGVLERATPFDMGAGAINAARAVDPGLVFDAGYRDYLQF  750

Query  2068  LCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADER  2247
             LCAVPGVD+ +V R VGV CP ++  WCSDLN PSVT+++LVGSR V RRVT+VG  +E 
Sbjct  751   LCAVPGVDDAAVLRAVGVPCPPSRARWCSDLNAPSVTVASLVGSRRVDRRVTSVGAENET  810

Query  2248  YRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRV  2427
             Y   V+ P GV V + P  F ++   +  L IVLN T   N++SFGE++L GD+ H VR+
Sbjct  811   YMAHVQAPDGVAVRVSPDTFAVAPGATATLRIVLNTTAPGNTFSFGEVVLRGDKKHTVRI  870

Query  2428  PFAVYVTASL  2457
             P AV+  A+L
Sbjct  871   PLAVFPAAAL  880



>gb|AAT84609.1| meiotic serine protease [Oryza sativa Indica Group]
Length=814

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/790 (54%), Positives = 557/790 (71%), Gaps = 15/790 (2%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR------IKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYS  267
             AK++MV+MED P +S +      ++G       YK   T +HD+FL S L   +Y KLYS
Sbjct  32    AKVFMVVMEDDPIISPKSSQKKVMRGEEAQ--KYKAMTTTKHDIFLDSFLPAGSYKKLYS  89

Query  268   YTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGP  447
             YTHLLNGFA++ KS+KA+K L  A+GVR I EDIKM KMTT+TP ++G  + VWP LGG 
Sbjct  90    YTHLLNGFAIYAKSEKAIKTLSGAKGVRLIQEDIKMAKMTTYTPRYIGA-NVVWPLLGGA  148

Query  448   SVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIV  627
               +G+GVVIGM+DTGI+P + SF S  +     P     F G C TG+ FP  +CNGKIV
Sbjct  149   EKAGDGVVIGMVDTGIDPSNPSFLSTSDQAKPPPA---SFKGTCQTGERFPPDSCNGKIV  205

Query  628   GAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMA  807
             GA++FARA  A G+FN + HYASP+D DGHGSHTASTAAGN+HTP I+  +N+G+ASG+A
Sbjct  206   GARWFARAGQATGEFNATMHYASPYDPDGHGSHTASTAAGNFHTPAISKGYNFGHASGVA  265

Query  808   PGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQL  987
             PGA +A+YKA YSFGGYMSDV+AAVD+AVEDGVDI+SLS+GP+++ SG ++FLN+LE QL
Sbjct  266   PGAHLAIYKAAYSFGGYMSDVIAAVDKAVEDGVDIISLSLGPTTITSGPASFLNLLETQL  325

Query  988   LFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGL  1167
             L AT+AG+ VVQA GN GP + S++SFSPW+TSV ASTTDR+Y  SI++GNG+ FS  GL
Sbjct  326   LLATKAGISVVQAVGNGGPDANSVVSFSPWITSVGASTTDRKYNKSIIIGNGKVFSCGGL  385

Query  1168  SPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESE  1347
             SP T G+  + LA A DV   NST G     +CQD   F+ SLV+GK++IC +      E
Sbjct  386   SPSTPGETMYPLALADDVSNTNSTGG---SSNCQDPDVFIRSLVQGKVIICMFVSSNYYE  442

Query  1348  AASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYN  1527
                +A + DT+ + GAAG ++T      S+     T    IP  I+ N   + AL +YY+
Sbjct  443   GDFLAGIVDTIQKIGAAGVIITDRSSSDSDIEYHPTFPTSIPSAIVVNSADAQALLEYYD  502

Query  1528  SNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNI  1707
              N +R + G    F AT RILDGRRAIY+ + PVVA YSSRGPDV++  +  ADVLKPN+
Sbjct  503   DNLVRDKEGSVTKFGATIRILDGRRAIYTREAPVVAEYSSRGPDVDDMQMQAADVLKPNV  562

Query  1708  MAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITS  1887
             MAPG  IW AWSP S+     +G+ +A++SGTSMATPH+AG+ ALI+ RHP W P+ + S
Sbjct  563   MAPGHHIWGAWSPTSDAMVEFQGEIYAMLSGTSMATPHVAGVVALIRQRHPKWSPAMVMS  622

Query  1888  AMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQF  2067
             A+MT+ADVTDR G PL+A++    L  ATPFD G+G IN +RA++PGLVF+  ++ Y+QF
Sbjct  623   AIMTTADVTDRSGRPLMARRDGGVLERATPFDMGAGAINAARAVDPGLVFDAGYRDYLQF  682

Query  2068  LCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADER  2247
             LCAVPGVD+ +V R VGV CP ++  WCSDLN PSVT+++LVGSR V RRVT+VG  +E 
Sbjct  683   LCAVPGVDDAAVLRAVGVPCPPSRARWCSDLNAPSVTVASLVGSRRVDRRVTSVGAENET  742

Query  2248  YRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRV  2427
             Y   V+ P GV V + P  F ++   +  L IVLN T   N++SFGE++L GD+ H VR+
Sbjct  743   YMAHVQAPDGVAVRVSPDTFAVAPGATATLRIVLNTTAPGNTFSFGEVVLRGDKKHTVRI  802

Query  2428  PFAVYVTASL  2457
             P AV+  A+L
Sbjct  803   PLAVFPAAAL  812



>gb|AAU01906.1| meiotic serine proteinase-like protein [Oryza sativa Indica Group]
Length=836

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/790 (54%), Positives = 557/790 (71%), Gaps = 15/790 (2%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR------IKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYS  267
             AK++MV+MED P +S +      ++G       YK   T +HD+FL S L   +Y KLYS
Sbjct  54    AKVFMVVMEDDPIISPKSSQKKVMRGEEAQ--KYKAMTTTKHDIFLDSFLPAGSYKKLYS  111

Query  268   YTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGP  447
             YTHLLNGFA++ KS+KA+K L  A+GVR I EDIKM KMTT+TP ++G  + VWP LGG 
Sbjct  112   YTHLLNGFAIYAKSEKAIKTLSGAKGVRLIQEDIKMAKMTTYTPRYIGA-NVVWPLLGGA  170

Query  448   SVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIV  627
               +G+GVVIGM+DTGI+P + SF S  +     P     F G C TG+ FP  +CNGKIV
Sbjct  171   EKAGDGVVIGMVDTGIDPSNPSFLSTSDQAKPPPA---SFKGTCQTGERFPPDSCNGKIV  227

Query  628   GAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMA  807
             GA++FARA  A G+FN + HYASP+D DGHGSHTASTAAGN+HTP I+  +N+G+ASG+A
Sbjct  228   GARWFARAGQATGEFNATMHYASPYDPDGHGSHTASTAAGNFHTPAISKGYNFGHASGVA  287

Query  808   PGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQL  987
             PGA +A+YKA YSFGGYMSDV+AAVD+AVEDGVDI+SLS+GP+++ SG ++FLN+LE QL
Sbjct  288   PGAHLAIYKAAYSFGGYMSDVIAAVDKAVEDGVDIISLSLGPTTITSGPASFLNLLETQL  347

Query  988   LFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGL  1167
             L AT+AG+ VVQA GN GP + S++SFSPW+TSV ASTTDR+Y  SI++GNG+ FS  GL
Sbjct  348   LLATKAGISVVQAVGNGGPDANSVVSFSPWITSVGASTTDRKYNKSIIIGNGKVFSCGGL  407

Query  1168  SPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESE  1347
             SP T G+  + LA A DV   NST G     +CQD   F+ SLV+GK++IC +      E
Sbjct  408   SPSTPGETMYPLALADDVSNTNSTGG---SSNCQDPDVFIRSLVQGKVIICMFVSSNYYE  464

Query  1348  AASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYN  1527
                +A + DT+ + GAAG ++T      S+     T    IP  I+ N   + AL +YY+
Sbjct  465   GDFLAGIVDTIQKIGAAGVIITDRSSSDSDIEYHPTFPTSIPSAIVVNSADAQALLEYYD  524

Query  1528  SNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNI  1707
              N +R + G    F AT RILDGRRAIY+ + PVVA YSSRGPDV++  +  ADVLKPN+
Sbjct  525   DNLVRDKEGSVTKFGATIRILDGRRAIYTREAPVVAEYSSRGPDVDDMQMQAADVLKPNV  584

Query  1708  MAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITS  1887
             MAPG  IW AWSP S+     +G+ +A++SGTSMATPH+AG+ ALI+ RHP W P+ + S
Sbjct  585   MAPGHHIWGAWSPTSDAMVEFQGEIYAMLSGTSMATPHVAGVVALIRQRHPKWSPAMVMS  644

Query  1888  AMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQF  2067
             A+MT+ADVTDR G PL+A++    L  ATPFD G+G IN +RA++PGLVF+  ++ Y+QF
Sbjct  645   AIMTTADVTDRSGRPLMARRDGGVLERATPFDMGAGAINAARAVDPGLVFDAGYRDYLQF  704

Query  2068  LCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADER  2247
             LCAVPGVD+ +V R VGV CP ++  WCSDLN PSVT+++LVGSR V RRVT+VG  +E 
Sbjct  705   LCAVPGVDDAAVLRAVGVPCPPSRARWCSDLNAPSVTVASLVGSRRVDRRVTSVGAENET  764

Query  2248  YRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRV  2427
             Y   V+ P GV V + P  F ++   +  L IVLN T   N++SFGE++L GD+ H VR+
Sbjct  765   YMAHVQAPDGVAVRVSPDTFAVAPGATATLRIVLNTTAPGNTFSFGEVVLRGDKKHTVRI  824

Query  2428  PFAVYVTASL  2457
             P AV+  A+L
Sbjct  825   PLAVFPAAAL  834



>ref|XP_010240197.1| PREDICTED: subtilisin-like protease isoform X1 [Brachypodium 
distachyon]
Length=810

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/794 (54%), Positives = 549/794 (69%), Gaps = 23/794 (3%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTRIKGTSGNV------TMYKQRMTKQHDVFLGSLLRRSAYTKLYS  267
             AK+YMV+MED P VS   K +  N+        YKQ  T +HD+FL S L   +Y KLYS
Sbjct  28    AKVYMVVMEDDPVVS--YKASRKNIMRGEEAQKYKQIATTKHDIFLESFLPTGSYKKLYS  85

Query  268   YTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGP  447
             YTHLLNGFA+H KS +  +IL  A+GVR + EDIKM KMTT+TP ++G    VWP LGG 
Sbjct  86    YTHLLNGFALHAKSVETARILSGAKGVRLVQEDIKMAKMTTYTPKYIGA-SGVWPLLGGA  144

Query  448   SVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIV  627
               SG+G+VIGMIDTGI+P + SF+   +     P     F G C +GD FP  +CNGKIV
Sbjct  145   ENSGDGIVIGMIDTGIDPKNPSFAGFSDQAKPPPA---SFKGMCRSGDRFPPDSCNGKIV  201

Query  628   GAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMA  807
             GA++FARA  A G+FN + HYASP+D DGHGSHTASTAAGN+H P I+  +N+GYASGMA
Sbjct  202   GARWFARAGQATGEFNATIHYASPYDPDGHGSHTASTAAGNFHAPAISRGYNFGYASGMA  261

Query  808   PGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQL  987
             PGA +A+YKA Y FGGYMSDV+AAVDQAVEDGVD++SLS+ PSSV SG ++FLN+LE QL
Sbjct  262   PGARLAIYKAAYPFGGYMSDVIAAVDQAVEDGVDVISLSMAPSSVSSGPASFLNLLETQL  321

Query  988   LFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGL  1167
             L AT+AGV VVQA GN GP + S++SFSPW+TSVAASTTDR+Y  SI+ G+GQ FS   +
Sbjct  322   LLATKAGVSVVQAVGNGGPDASSIVSFSPWITSVAASTTDRKYNKSIITGHGQVFSCGAI  381

Query  1168  SPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESE  1347
             SP T G+  + LA A DV   NST G     SCQD   F+ SLV+GK++IC        E
Sbjct  382   SPSTPGETMYPLALADDVSIANSTDG---SNSCQDPKVFIRSLVQGKVIICMIVSSNYYE  438

Query  1348  AASIATVADTVHRAGAAGFVL----TMDPDIGSEQIKGATVTLQIPGLIINNMEASTALR  1515
               S+  + DT  + GA G V+    + D DI  +     T    IP  I+ N   +  L 
Sbjct  439   GDSLTNIIDTAQKIGAVGVVIADRYSGDVDIEYQP----TFPTAIPSAIVVNGVDTMNLL  494

Query  1516  QYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVL  1695
             +YY++NT R   G  +AF A+ RIL+GRRA YSG+ P+VA YSSRGP+V NA +  ADVL
Sbjct  495   EYYDNNTARGDDGGVMAFGASVRILEGRRASYSGEPPMVADYSSRGPNVENAQMQAADVL  554

Query  1696  KPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPS  1875
             KPN+MAPG  IW AWSP S+    I+G+ +A++SGTSM+TPH+AG+AALI+ RHP W P+
Sbjct  555   KPNVMAPGHHIWGAWSPTSDAMPEIQGESYAILSGTSMSTPHVAGVAALIRQRHPTWSPA  614

Query  1876  AITSAMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQ  2055
              + SA+MT+A+ TDR G PL+A++    +  ATPFD G+G IN +RAL+PGLV +  +++
Sbjct  615   MVMSAIMTTAEATDRSGRPLMARRDVGAVVAATPFDMGAGAINAARALDPGLVLDATYRE  674

Query  2056  YIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGG  2235
             Y+QFLCAVPGVDE +VRR  G  CP  +  WCSDLNTPSVT+++LVGSR V RRV +VG 
Sbjct  675   YLQFLCAVPGVDEAAVRRATGALCPSARARWCSDLNTPSVTVASLVGSRRVDRRVWSVGA  734

Query  2236  ADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNH  2415
              +E Y   VR P GV V + P  F I+   +  L IVLN T   N++SFGE++L GD+ H
Sbjct  735   ENETYMAYVRAPDGVAVRVSPDEFTIAPGATAVLRIVLNTTAPGNAFSFGEVVLRGDKKH  794

Query  2416  IVRVPFAVYVTASL  2457
              VR+P AVY  A L
Sbjct  795   SVRIPLAVYPAAVL  808



>ref|XP_010240198.1| PREDICTED: subtilisin-like protease isoform X2 [Brachypodium 
distachyon]
Length=784

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/793 (54%), Positives = 548/793 (69%), Gaps = 23/793 (3%)
 Frame = +1

Query  109   KIYMVLMEDHPFVSTRIKGTSGNV------TMYKQRMTKQHDVFLGSLLRRSAYTKLYSY  270
             ++YMV+MED P VS   K +  N+        YKQ  T +HD+FL S L   +Y KLYSY
Sbjct  3     QVYMVVMEDDPVVS--YKASRKNIMRGEEAQKYKQIATTKHDIFLESFLPTGSYKKLYSY  60

Query  271   THLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPS  450
             THLLNGFA+H KS +  +IL  A+GVR + EDIKM KMTT+TP ++G    VWP LGG  
Sbjct  61    THLLNGFALHAKSVETARILSGAKGVRLVQEDIKMAKMTTYTPKYIGA-SGVWPLLGGAE  119

Query  451   VSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVG  630
              SG+G+VIGMIDTGI+P + SF+   +     P     F G C +GD FP  +CNGKIVG
Sbjct  120   NSGDGIVIGMIDTGIDPKNPSFAGFSDQAKPPPA---SFKGMCRSGDRFPPDSCNGKIVG  176

Query  631   AQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAP  810
             A++FARA  A G+FN + HYASP+D DGHGSHTASTAAGN+H P I+  +N+GYASGMAP
Sbjct  177   ARWFARAGQATGEFNATIHYASPYDPDGHGSHTASTAAGNFHAPAISRGYNFGYASGMAP  236

Query  811   GAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLL  990
             GA +A+YKA Y FGGYMSDV+AAVDQAVEDGVD++SLS+ PSSV SG ++FLN+LE QLL
Sbjct  237   GARLAIYKAAYPFGGYMSDVIAAVDQAVEDGVDVISLSMAPSSVSSGPASFLNLLETQLL  296

Query  991   FATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLS  1170
              AT+AGV VVQA GN GP + S++SFSPW+TSVAASTTDR+Y  SI+ G+GQ FS   +S
Sbjct  297   LATKAGVSVVQAVGNGGPDASSIVSFSPWITSVAASTTDRKYNKSIITGHGQVFSCGAIS  356

Query  1171  PPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEA  1350
             P T G+  + LA A DV   NST G     SCQD   F+ SLV+GK++IC        E 
Sbjct  357   PSTPGETMYPLALADDVSIANSTDG---SNSCQDPKVFIRSLVQGKVIICMIVSSNYYEG  413

Query  1351  ASIATVADTVHRAGAAGFVL----TMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQ  1518
              S+  + DT  + GA G V+    + D DI  +     T    IP  I+ N   +  L +
Sbjct  414   DSLTNIIDTAQKIGAVGVVIADRYSGDVDIEYQP----TFPTAIPSAIVVNGVDTMNLLE  469

Query  1519  YYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLK  1698
             YY++NT R   G  +AF A+ RIL+GRRA YSG+ P+VA YSSRGP+V NA +  ADVLK
Sbjct  470   YYDNNTARGDDGGVMAFGASVRILEGRRASYSGEPPMVADYSSRGPNVENAQMQAADVLK  529

Query  1699  PNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSA  1878
             PN+MAPG  IW AWSP S+    I+G+ +A++SGTSM+TPH+AG+AALI+ RHP W P+ 
Sbjct  530   PNVMAPGHHIWGAWSPTSDAMPEIQGESYAILSGTSMSTPHVAGVAALIRQRHPTWSPAM  589

Query  1879  ITSAMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQY  2058
             + SA+MT+A+ TDR G PL+A++    +  ATPFD G+G IN +RAL+PGLV +  +++Y
Sbjct  590   VMSAIMTTAEATDRSGRPLMARRDVGAVVAATPFDMGAGAINAARALDPGLVLDATYREY  649

Query  2059  IQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGA  2238
             +QFLCAVPGVDE +VRR  G  CP  +  WCSDLNTPSVT+++LVGSR V RRV +VG  
Sbjct  650   LQFLCAVPGVDEAAVRRATGALCPSARARWCSDLNTPSVTVASLVGSRRVDRRVWSVGAE  709

Query  2239  DERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHI  2418
             +E Y   VR P GV V + P  F I+   +  L IVLN T   N++SFGE++L GD+ H 
Sbjct  710   NETYMAYVRAPDGVAVRVSPDEFTIAPGATAVLRIVLNTTAPGNAFSFGEVVLRGDKKHS  769

Query  2419  VRVPFAVYVTASL  2457
             VR+P AVY  A L
Sbjct  770   VRIPLAVYPAAVL  782



>ref|XP_004978162.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=853

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/796 (54%), Positives = 552/796 (69%), Gaps = 19/796 (2%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTRIKGT----SGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYT  273
             AK+YMV+MED P +S ++             YKQ  T +HD FL S L   +Y KLYSYT
Sbjct  63    AKVYMVVMEDDPVISYKVNRKHVMRGEEAQKYKQVATTKHDSFLDSFLPMGSYKKLYSYT  122

Query  274   HLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSV  453
             HL+NGFA+H +S+K ++IL +A+GVR I EDIKM KMTTHTP+++G    VWP LGG   
Sbjct  123   HLINGFALHAESEKTVRILSRAKGVRLIQEDIKMVKMTTHTPNYIGA-SGVWPLLGGAEN  181

Query  454   SGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGA  633
             SG+GVVIGMIDTGI+P + SF S    +  +      F G C  G+ FP  +CNGKIVGA
Sbjct  182   SGDGVVIGMIDTGIDPKNPSFVSSNLSSQAK-SPPASFKGTCRAGNRFPPDSCNGKIVGA  240

Query  634   QYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPG  813
             ++FARAA A G+FN + HYASP+D+DGHGSHTAS AAGN+HTPVI+  +++GYASGMAPG
Sbjct  241   RWFARAAQATGEFNATVHYASPYDSDGHGSHTASIAAGNFHTPVISGGYSFGYASGMAPG  300

Query  814   AGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLF  993
             A +A+YKA Y FGGYMSDV+AAVDQAVEDGVD++SLS+ PS+V SG ++FLN+LE QLL 
Sbjct  301   ARLAIYKAAYPFGGYMSDVIAAVDQAVEDGVDVISLSMAPSAVSSGPASFLNLLEAQLLL  360

Query  994   ATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSP  1173
             AT+AGV VVQA GN+GP   +++SFSPW+ SVAASTTDR+Y  SI++GNG+ FS   LS 
Sbjct  361   ATKAGVSVVQAVGNAGPDENTIVSFSPWILSVAASTTDRKYRKSIIIGNGKAFSCGALSA  420

Query  1174  PTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAA  1353
             PT G+  + LA A DV   NST        C+D   F+  LV+GKL++C +      +  
Sbjct  421   PTPGETMYPLAWADDVIVENSTDDGW-YNKCRDPRIFIKPLVQGKLIVCMFDSSDYYDDI  479

Query  1354  SIATVADTVHRAGAAGFVLT----MDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQY  1521
             S++++ DT+ + GAAG ++T     D DI  E     T    +P  I+       AL +Y
Sbjct  480   SLSSIIDTIQKIGAAGVIITDHSSHDVDIEFEP----TFPTTVPSAILLKGSDMRALLRY  535

Query  1522  YNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKP  1701
             YN+NT+R   G  V+F ATARIL+GR A Y+G+ PVVA YSSRGPDV N+ +  A+VLKP
Sbjct  536   YNNNTVRDDDGNVVSFGATARILEGRHATYTGESPVVADYSSRGPDVENSQMQPAEVLKP  595

Query  1702  NIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAI  1881
             N+MAPG  IW AWSP S     I G+ +AL+SGTSMA PH+AG+AALIK RHP W P+ I
Sbjct  596   NVMAPGHLIWGAWSPTSTALPEIHGESYALLSGTSMAAPHVAGVAALIKQRHPAWSPAMI  655

Query  1882  TSAMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYI  2061
              SA+MT+AD TDR G PL+A+     L PATPFD G+G +N +RAL+PGLVF+  +  ++
Sbjct  656   MSAIMTTADATDRSGRPLMARGEEGSLDPATPFDMGAGAVNAARALDPGLVFDAGYLDHL  715

Query  2062  QFLCAVPGVDEKSVRRVVGVECPENK----KFWCSDLNTPSVTISNLVGSRTVMRRVTNV  2229
             QFLCAVPGVD+ +V R VG  CP  +      WCSDLN+PSVT+++LVGSR V RRVT+V
Sbjct  716   QFLCAVPGVDDAAVLRAVGAPCPPPRAGGAARWCSDLNSPSVTVASLVGSRRVERRVTSV  775

Query  2230  GGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDR  2409
             G  +E Y   VR P GV V + P  F I+   +R L IVLN T   N++SFGE++L GDR
Sbjct  776   GAQNETYAAYVRAPEGVAVRVSPAQFAIAPGATRALRIVLNTTAPGNAFSFGEVVLRGDR  835

Query  2410  NHIVRVPFAVYVTASL  2457
              H VR+P AVY   +L
Sbjct  836   KHHVRIPLAVYPAGTL  851



>emb|CDP08333.1| unnamed protein product [Coffea canephora]
Length=2310

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/579 (72%), Positives = 502/579 (87%), Gaps = 2/579 (0%)
 Frame = +1

Query  721   SHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqaved  900
             SHTA+TAAGN+  PVI N FNYGYASGMAPGA IA+YKALY+FGGYMSDVVAAVDQAVED
Sbjct  1732  SHTAATAAGNHQIPVIANDFNYGYASGMAPGARIAIYKALYAFGGYMSDVVAAVDQAVED  1791

Query  901   gvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWV  1080
             GVDIL+LS+GPS VPSG SAFLN+LE++LLFAT+AGVLVVQAAGN GPSS SMLSFSPW+
Sbjct  1792  GVDILNLSIGPSKVPSGPSAFLNLLEMELLFATKAGVLVVQAAGNGGPSSSSMLSFSPWI  1851

Query  1081  TSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVE  1260
             TSVAAS TDRRY +S+ LGNGQ+FSG+GL+PPT G+ FF LAAA DV + NST GLLT++
Sbjct  1852  TSVAASITDRRYNSSVRLGNGQSFSGTGLAPPTVGEVFFPLAAAADVGQINSTDGLLTID  1911

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
             SCQ + QFV SLV+GK+VICTYT DF+SEA+ IATVADT+ + GAAGF+LT +PDIG EQ
Sbjct  1912  SCQSSEQFVRSLVQGKIVICTYTLDFDSEASGIATVADTMSKVGAAGFILTRNPDIGFEQ  1971

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQ  1620
             IKGA VTLQ+PG+I+NNMEAS+AL +YYN+NT+RSR+GRA+ FRATARILDGRRAIY+GQ
Sbjct  1972  IKGAAVTLQVPGVILNNMEASSALWEYYNANTIRSRNGRAIGFRATARILDGRRAIYTGQ  2031

Query  1621  GPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSG  1800
              P VASYSSRGPDVNN LL+ ADVLKPNIMAPGSSIWAAWSPNSEGD +IKGQ FAL+SG
Sbjct  2032  APTVASYSSRGPDVNNELLENADVLKPNIMAPGSSIWAAWSPNSEGDAHIKGQIFALLSG  2091

Query  1801  TSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlapaTPF  1980
             TSMATPHIAGIAALIK +HP+W PSAI SAM T+AD+ D+     +  Q ++Q++ ATPF
Sbjct  2092  TSMATPHIAGIAALIKQKHPHWNPSAIISAMTTTADIADQ-TGAPILAQKTKQISAATPF  2150

Query  1981  DFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDL  2160
             DFG G INPSRA++PGLVFN  F QY++FLC+VPGVD+ SVR+ VG+ CP  K  WCSDL
Sbjct  2151  DFGGGAINPSRAIDPGLVFNINFMQYVKFLCSVPGVDDMSVRQAVGISCPIQKT-WCSDL  2209

Query  2161  NTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLI  2340
             NTPSVT+S L+GSR ++R+VTNVG ADE+Y +IV+EPLGV+VT+IPQ F IS + SR + 
Sbjct  2210  NTPSVTVSKLIGSRRILRKVTNVGNADEKYMLIVKEPLGVKVTVIPQVFKISVNASRRIT  2269

Query  2341  IVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASL  2457
             I  NAT+ATN+Y+FGE+++LG++ H+VRVP AVYV++++
Sbjct  2270  IQFNATEATNAYTFGEILMLGEKKHVVRVPMAVYVSSTI  2308



>ref|XP_008669069.1| PREDICTED: subtilisin-like protease [Zea mays]
 tpg|DAA36616.1| TPA: hypothetical protein ZEAMMB73_435211 [Zea mays]
Length=819

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/799 (53%), Positives = 548/799 (69%), Gaps = 24/799 (3%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTRIKGT----SGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYT  273
             AK+YMV+MED P +S ++             YK+  T +HD FL S L   +Y KLYSYT
Sbjct  28    AKVYMVVMEDDPVISYKVNRKHVMRGDEAQKYKRVATTKHDSFLDSFLPVGSYKKLYSYT  87

Query  274   HLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSV  453
             HL+NGFA+H +S+K ++IL  A+GVR I EDIKM KMTTHTP ++G    VWP LGG   
Sbjct  88    HLINGFALHAESEKTVRILSGAKGVRLIQEDIKMAKMTTHTPSYIGA-TGVWPLLGGAEN  146

Query  454   SGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGA  633
             SG GVVIGMIDTGI+P + SF++    +   P     F G C TG+ FP  +C GKIVGA
Sbjct  147   SGNGVVIGMIDTGIDPKNPSFATSNTSSQAEPP-PASFKGICRTGNRFPPDSCGGKIVGA  205

Query  634   QYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPG  813
             ++FARAA A G+FN + HY SP+D DGHGSHTAS AAGN+HTP+I+  +N+GYASGMAPG
Sbjct  206   RWFARAAQATGEFNATIHYESPYDPDGHGSHTASIAAGNFHTPLISRGYNFGYASGMAPG  265

Query  814   AGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLF  993
             A +A+YKA Y FGGYMSDV+AAVDQAVEDGV+++SLS+ PSSV SG ++FLN+LE QLL 
Sbjct  266   ARLAIYKAAYPFGGYMSDVIAAVDQAVEDGVNVISLSMAPSSVSSGPASFLNLLEAQLLL  325

Query  994   ATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSP  1173
             AT+AGV VVQA GN+GP + +++SFSPW+ SVAAS TDR Y  SIV+GNG+ FS   LS 
Sbjct  326   ATKAGVSVVQAVGNAGPDANTVVSFSPWILSVAASMTDRTYRKSIVIGNGKVFSCGVLSA  385

Query  1174  PTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTY-TYDFESEA  1350
             PT G+  + LA A DV   NST G +   +CQD   F+  LV+GK++IC + + ++  + 
Sbjct  386   PTPGETMYPLAWADDVVNENSTDGSV---NCQDPRVFIRPLVQGKVIICMFDSSNYYEDD  442

Query  1351  ASIATVADTVHRAGAAGFVLTM----DPDIGSEQIKGATVTLQIPGLIINNMEASTALRQ  1518
              ++A V  T+ R GAAG V+T     D DI  E     T    +P  I+       AL +
Sbjct  443   PNLAGVIHTIERIGAAGVVVTDRSSGDIDIDYEP----TFPTTVPSAIVLRGSDMRALLR  498

Query  1519  YYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLK  1698
             YYN+NT+R   G  V+F AT RI +GRRA YSG+ PVVA YSSRGPDV NA +  A+VLK
Sbjct  499   YYNNNTVRDERGNVVSFGATIRITEGRRASYSGEAPVVADYSSRGPDVENAQMQPAEVLK  558

Query  1699  PNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSA  1878
             PN+MAPG+ +W AWSP S     I+G+ +AL+SGTSMA PH+AG+AALIK RHP W P+ 
Sbjct  559   PNVMAPGNLVWGAWSPTSNALPEIQGEEYALLSGTSMAAPHVAGVAALIKQRHPTWSPAM  618

Query  1879  ITSAMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQY  2058
             + SA+MT+ADVTDR G PL+A+  S  + PATPFD G+G +N +RAL+PGLVF+  +  Y
Sbjct  619   VMSAIMTTADVTDRSGRPLMARSDSGSVDPATPFDMGAGAVNAARALDPGLVFDAGYSDY  678

Query  2059  IQFLCAVPGVDEKSVRR------VVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRV  2220
             ++FLCAVPGVDE ++ R                  WCSDLN  SVT++NL+GSR V RRV
Sbjct  679   LRFLCAVPGVDEAALLRAVGAPCPAPAPPRAGAPRWCSDLNAASVTVANLLGSRRVDRRV  738

Query  2221  TNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILL  2400
             T+VG  +E Y   VR P GV V + P  F I+   +R L IVLN T   N++SFGE++L 
Sbjct  739   TSVGSQNETYMAYVRAPGGVAVRVAPSQFAIAPGATRALRIVLNTTAPGNAFSFGEVVLK  798

Query  2401  GDRNHIVRVPFAVYVTASL  2457
             GD+ H VR+P AVY  A+L
Sbjct  799   GDKKHRVRIPLAVYPAAAL  817



>ref|XP_008794931.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=626

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/580 (63%), Positives = 459/580 (79%), Gaps = 4/580 (1%)
 Frame = +1

Query  724   HTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedg  903
             HTAS AAGNY   V++  +NYGYASGMAPGA IAVYKA+YSFGGYMSDVVAA+D+AVEDG
Sbjct  51    HTASIAAGNYRIAVLSKGYNYGYASGMAPGARIAVYKAVYSFGGYMSDVVAAIDKAVEDG  110

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDILSLS+GPS+VP G +AFLN+LEV+LLFAT+AGV V+QA GN GP+S S+LSFSPWVT
Sbjct  111   VDILSLSIGPSAVPPGPAAFLNILEVELLFATKAGVSVIQAGGNGGPASSSILSFSPWVT  170

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVES  1263
             S+AASTTDR+Y NSI+LG  Q+  GSGLSPPT  +    +AAA DVC RN++   L V++
Sbjct  171   SIAASTTDRKYNNSIILGTRQSLPGSGLSPPTMEEELLPIAAAEDVCSRNTS--FLVVQN  228

Query  1264  CQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQI  1443
             CQ    F+P LVRGKL+ICTY  +F     S+  +  T+ + GAAGF++TMD    SE  
Sbjct  229   CQHPEPFIPELVRGKLIICTYITEFIYAPTSMEAIVGTIQKIGAAGFIITMDRSYDSEPP  288

Query  1444  KGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQG  1623
               +T+TL IPG+++ +  AS AL +YY+SNT+R  +G  V F AT RILDGRRAIY+GQG
Sbjct  289   VDSTLTLSIPGIVLTSRRASQALWEYYDSNTVRGTNGGVVNFGATGRILDGRRAIYTGQG  348

Query  1624  PVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGT  1803
             P VASYSSRGPDVNNAL++TADVLKPNIMAPGS+IWAAWSP S  D+ +KGQ FAL+SGT
Sbjct  349   PAVASYSSRGPDVNNALMETADVLKPNIMAPGSAIWAAWSPKSHDDQNVKGQEFALLSGT  408

Query  1804  SMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlapaTPFD  1983
             SMATPH+AG+AALIK  HPNW P+AITSAMMT+ADVT+R  S    +    + A ATPFD
Sbjct  409   SMATPHVAGVAALIKQSHPNWSPAAITSAMMTTADVTER--SGGPMRSQGNEAAAATPFD  466

Query  1984  FGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLN  2163
             +G+G IN +RA++PGL+ +T F+ YIQFLCAVPGVD++SVRR VG+ CP ++  WCSDLN
Sbjct  467   YGAGAINAARAVDPGLILDTGFKHYIQFLCAVPGVDDESVRRAVGLGCPADRSDWCSDLN  526

Query  2164  TPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLII  2343
             TPSV ++NLVGSRTV+RRVT+V GA E YRV V+EP GV V + PQ F I  + SR + I
Sbjct  527   TPSVAVANLVGSRTVVRRVTSVAGAAETYRVAVKEPAGVAVAVRPQEFTIGPNESRTIKI  586

Query  2344  VLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
             +L A +ATN+Y+FGE++L GDR H+VR+P A++V+++L+S
Sbjct  587   MLKAGEATNAYTFGELVLTGDRKHVVRIPLAIFVSSTLRS  626



>gb|EMS61151.1| Subtilisin-like protease SDD1 [Triticum urartu]
Length=766

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/792 (52%), Positives = 516/792 (65%), Gaps = 64/792 (8%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTRI--KGT--SGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYT  273
             AK+YMV+MED P VS +   KG         YK+  T +HDVFL S L   +Y KLYSYT
Sbjct  28    AKVYMVVMEDDPVVSYKASRKGVMRGEEAQKYKEMATTKHDVFLESFLTVGSYKKLYSYT  87

Query  274   HLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSV  453
             HLLNGFAVH  S+KA KIL  A+GVR + EDIKM KMTT+TP ++G    VWP LGG   
Sbjct  88    HLLNGFAVHANSEKAAKILSGAKGVRLVQEDIKMAKMTTYTPKYIGA-SGVWPLLGGAEN  146

Query  454   SGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGA  633
             SG+G+VIGMIDTGI+P + SF+S    +   P     F G C +GD FP  +CNGKIVGA
Sbjct  147   SGDGIVIGMIDTGIDPKNPSFASFSNQSKQPPP---NFKGMCRSGDRFPPDSCNGKIVGA  203

Query  634   QYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPG  813
             ++FARA  A G+FN + HYASP+D DGHGS                              
Sbjct  204   RWFARAGQATGEFNATIHYASPYDPDGHGS------------------------------  233

Query  814   AGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLF  993
               +AVYKA Y FGGYMSDV+AAVDQAVEDGVD++SLS+ PSSV  G +AFLN+LE QLL 
Sbjct  234   --LAVYKAAYPFGGYMSDVIAAVDQAVEDGVDVISLSMAPSSVSPGPAAFLNLLETQLLL  291

Query  994   ATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSP  1173
             AT+AGV VVQA GN GP + S++SFSPW+TSVAASTTDR+Y  +IV GNGQ FS  GLSP
Sbjct  292   ATKAGVSVVQAVGNGGPDASSVVSFSPWITSVAASTTDRKYNKTIVAGNGQIFSCGGLSP  351

Query  1174  PTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAA  1353
             PT G   + LA A DV   NST G      CQD   F+ SLV+GK               
Sbjct  352   PTPGDTMYPLALADDVSTDNSTDG---SNGCQDPKVFIRSLVQGK-------------GD  395

Query  1354  SIATVADTVHRAGAAGFVL----TMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQY  1521
             + A + DT+ + GAAG V+    + D D   + I        +P  ++ +      L +Y
Sbjct  396   NFAGIIDTIQKIGAAGVVIIDRYSGDVDYEYQPI----FPTAVPSAMVVDGVDMMNLMEY  451

Query  1522  YNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKP  1701
             Y +NT R   G  + F AT RIL+GRRA YSG+ P VA YSSRGP++ N+ +  ADVLKP
Sbjct  452   YENNTARDGDGTVITFGATVRILEGRRASYSGERPEVADYSSRGPNIENSQMQLADVLKP  511

Query  1702  NIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAI  1881
             N+MAPG  IW AWSP S+    ++G+ +A++SGTSM+TPH+AG+ ALIK RHP W P+ I
Sbjct  512   NVMAPGHHIWGAWSPTSDALPEVQGESYAILSGTSMSTPHVAGVVALIKQRHPKWSPAMI  571

Query  1882  TSAMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYI  2061
              SA+MT+ADVTDR G PL+A++    +  ATPFD G+G IN +RAL+PGLVF+  +++Y+
Sbjct  572   MSAIMTTADVTDRSGRPLMARRDVGAVVAATPFDMGAGAINAARALDPGLVFDATYREYL  631

Query  2062  QFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGAD  2241
             QFLCAVPGVDE +VRR VG  CP ++  WCSDLN PSVT+++LVGSR V R+V +VG  +
Sbjct  632   QFLCAVPGVDEAAVRRAVGASCPTSRARWCSDLNAPSVTVASLVGSRRVDRKVWSVGAEN  691

Query  2242  ERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIV  2421
             E Y   VR P GV V + P  F ++   +  L IVLN T   N++SFGE++L GD+ H V
Sbjct  692   ETYMAYVRAPDGVAVRVSPDEFTVAPGETAALRIVLNTTAPGNAFSFGEVVLRGDKKHSV  751

Query  2422  RVPFAVYVTASL  2457
             R+P AVY  A L
Sbjct  752   RIPLAVYPAAVL  763



>ref|XP_006838486.1| hypothetical protein AMTR_s00002p00159190 [Amborella trichopoda]
 gb|ERN01055.1| hypothetical protein AMTR_s00002p00159190 [Amborella trichopoda]
Length=554

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/554 (66%), Positives = 455/554 (82%), Gaps = 3/554 (1%)
 Frame = +1

Query  802   MAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEV  981
             MAPGAGIAVYKALYSFGGYM+DVVAAVDQAVEDGVDI+SLS+GPSSVP G SAFLNVLE+
Sbjct  1     MAPGAGIAVYKALYSFGGYMADVVAAVDQAVEDGVDIVSLSIGPSSVPPGSSAFLNVLEI  60

Query  982   QLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGS  1161
             +LLFA +AGV+VVQAAGN GP+S S+LSFSPW+T+VAAS TDR+Y NSI LGNGQ F G+
Sbjct  61    ELLFAAKAGVMVVQAAGNGGPTSSSILSFSPWITTVAASITDRKYNNSIELGNGQRFPGT  120

Query  1162  GLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFE  1341
             GL+PPT     F +AAA+DV + N++   + VE+CQ    F+P L RGK++ICTYT++FE
Sbjct  121   GLAPPTLRMLHFPVAAAIDVSQSNTS--YIAVENCQHPGAFIPVLARGKIIICTYTFEFE  178

Query  1342  SEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQY  1521
              E+ASI TVADT+ + GAAGF++TMDPD+G+ Q+KG T+T+ +PG+I++NM+AS AL +Y
Sbjct  179   FESASITTVADTMEKIGAAGFIITMDPDLGASQVKGTTITMHVPGIILSNMQASGALWEY  238

Query  1522  YNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKP  1701
             YN+NT+RSR G A++F ATARI DGR A ++GQ P+VASYSSRGPDVNNALL TADVLKP
Sbjct  239   YNANTVRSRDGGAMSFGATARIGDGREATFTGQAPIVASYSSRGPDVNNALLQTADVLKP  298

Query  1702  NIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAI  1881
              IMAPGSSIWAAWSPNSEGD+Y KGQ FALVSGTSMA PH+AG+AALIK +HP+W P+AI
Sbjct  299   TIMAPGSSIWAAWSPNSEGDQYAKGQEFALVSGTSMAAPHVAGVAALIKQKHPDWSPAAI  358

Query  1882  TSAMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYI  2061
             TSA+MT+A VTD      +  Q S QL  ATPFDFG+G +NP++A++PGL+F+T F+ Y+
Sbjct  359   TSAIMTTATVTDH-SGNPIQAQRSNQLNTATPFDFGAGALNPTKAIDPGLIFDTNFKMYL  417

Query  2062  QFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGAD  2241
             +FLC+VPGVD+ SVRR VGV CP   KF CSDLNT S+T+SNLVGSR V+R+V NVG   
Sbjct  418   RFLCSVPGVDDDSVRRAVGVGCPSEGKFLCSDLNTASITVSNLVGSRRVVRKVKNVGAER  477

Query  2242  ERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIV  2421
             ERYRV VREP GV V I+P  F ++   ++ + I+L A +ATNSY+FGE+++ GD+ H+V
Sbjct  478   ERYRVRVREPEGVEVGIVPTKFAVNVSATKSIRILLKAMEATNSYTFGEVVMEGDKGHVV  537

Query  2422  RVPFAVYVTASLQS  2463
             R+P AV VT++L S
Sbjct  538   RLPLAVSVTSALGS  551



>gb|EMT15030.1| Subtilisin-like protease [Aegilops tauschii]
Length=730

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/756 (51%), Positives = 490/756 (65%), Gaps = 64/756 (8%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTRI--KGT--SGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYT  273
             AK+YMV+MED P VS +   KG         YK+  T +HDVFL S L   +Y KLYSYT
Sbjct  28    AKVYMVVMEDDPVVSYKASRKGVMRGEEAQKYKEMATTKHDVFLESFLTVGSYKKLYSYT  87

Query  274   HLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSV  453
             HLLNGFAVH  S+KA KIL  A+GVR + EDIKM KMTT+TP ++G    VWP LGG   
Sbjct  88    HLLNGFAVHANSEKAAKILSGAKGVRLVQEDIKMAKMTTYTPKYIGA-SGVWPLLGGAEN  146

Query  454   SGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGA  633
             SG+G+VIGMIDTGI+P + SF+S    +   P     F G C +GD FP  +CNGKIVGA
Sbjct  147   SGDGIVIGMIDTGIDPKNPSFASFSNQSKQPPP---NFKGMCRSGDRFPPDSCNGKIVGA  203

Query  634   QYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPG  813
             ++FARA  A G+FN + HYASP+D DGHGS                              
Sbjct  204   RWFARAGQATGEFNATIHYASPYDPDGHGS------------------------------  233

Query  814   AGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLF  993
               +AVYKA Y FGGYMSDV+AAVDQAVEDGVD++SLS+ PSSV  G +AFLN+LE QLL 
Sbjct  234   --LAVYKAAYPFGGYMSDVIAAVDQAVEDGVDVISLSMAPSSVSPGPAAFLNLLETQLLL  291

Query  994   ATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSP  1173
             AT+AGV VVQA GN GP + S++SFSPW+TSVAASTTDR+Y  +IV GNGQ FS  GLSP
Sbjct  292   ATKAGVSVVQAVGNGGPDASSVVSFSPWITSVAASTTDRKYNKTIVAGNGQIFSCGGLSP  351

Query  1174  PTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAA  1353
             PT G   + LA A DV   NST G      CQD   F+ SLV+GK               
Sbjct  352   PTPGDTMYPLALADDVSTDNSTDG---SNGCQDPKVFIRSLVQGK-------------GD  395

Query  1354  SIATVADTVHRAGAAGFVL----TMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQY  1521
             + A + DT+ + GAAG V+    + D D   + I        +P  ++ +      L +Y
Sbjct  396   NFAGIIDTIQKMGAAGVVIIDRYSGDVDYEYQPI----FPTAVPSAMVVDGVDMMNLMEY  451

Query  1522  YNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKP  1701
             Y +NT R   G  + F AT RIL+GRRA YSG+ P VA YSSRGP++ N+ +  ADVLKP
Sbjct  452   YENNTARDGDGTVITFGATVRILEGRRASYSGERPEVADYSSRGPNIENSQMQLADVLKP  511

Query  1702  NIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAI  1881
             N+MAPG  IW AWSP S+    ++G+ +A++SGTSM+TPH+AG+ ALIK RHP W P+ I
Sbjct  512   NVMAPGHHIWGAWSPTSDALPEVQGESYAILSGTSMSTPHVAGVVALIKQRHPKWSPAMI  571

Query  1882  TSAMMTSADVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYI  2061
              SA+MT+ADVTDR G PL+A++    +  ATPFD G+G IN +RAL+PGLVF+  +++Y+
Sbjct  572   MSAIMTTADVTDRSGRPLMARRDVGAVVAATPFDMGAGAINAARALDPGLVFDATYREYL  631

Query  2062  QFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGAD  2241
             QFLCAVPGVDE +VRR VG  CP ++  W SDLN PSVT+++LVGSR V R+V +VG  +
Sbjct  632   QFLCAVPGVDEAAVRRAVGASCPSSRARWGSDLNAPSVTVASLVGSRRVDRKVWSVGAEN  691

Query  2242  ERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVL  2349
             E Y   VR P GV V + P  F ++   +  L IVL
Sbjct  692   ETYMAYVRAPDGVAVRVSPDEFTVAPGETAALRIVL  727



>ref|XP_002975131.1| hypothetical protein SELMODRAFT_102404 [Selaginella moellendorffii]
 gb|EFJ23916.1| hypothetical protein SELMODRAFT_102404 [Selaginella moellendorffii]
Length=784

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/780 (46%), Positives = 484/780 (62%), Gaps = 32/780 (4%)
 Frame = +1

Query  166   TSGNVTMYKQRMTKQHDVFLGSLLRRSA--YTKLYSYTHLLNGFAVHVKSDKALKILHKA  339
             T   V +YK R+ +QHD FL      S   Y KLYSY HL+NGFAV ++  +A   L  A
Sbjct  6     TKNTVELYKSRLVQQHDKFLQETFASSGAGYQKLYSYHHLINGFAVKLQDHQA-DTLKSA  64

Query  340   EGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS  519
              GV  + +D ++ K+TTHTPDFLG+P  VW + GG   +G+G+V+G+IDTGI+P H SFS
Sbjct  65    PGVMLVQKDWRVSKLTTHTPDFLGLPTGVWSQQGGAGNAGDGIVVGIIDTGIDPTHPSFS  124

Query  520   SPEEYNIGRPRIT---RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHY  690
                  +      +   + F G C       A+ CNGKIVGA++FA AA A+G+FN S  +
Sbjct  125   GQAFASNSSSNTSSGLKSFRGSCEV-----ASFCNGKIVGARHFAAAATASGNFNASVDF  179

Query  691   ASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSd  867
              SP D DGHGSHTAS AAGNY+ PV  N ++YG ASGMAP A IAVYKALY  FGG+++D
Sbjct  180   DSPLDGDGHGSHTASIAAGNYNVPVTINGYSYGKASGMAPRARIAVYKALYRQFGGFVAD  239

Query  868   vvaavdqaved------------gvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGV  1011
             VVAA+D+A +                +       S   S  + FLNV ++ +L A + GV
Sbjct  240   VVAAIDKASKRNFRKSFHKLIDGVDVLNLSVGPNSPPSSSSATFLNVFDMAILAAVKQGV  299

Query  1012  LVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKA  1191
              V QAAGN GP  R+++SFSPW+ +VAA   DR Y N I LGN +T  G GL+PPT G +
Sbjct  300   FVAQAAGNGGPYPRTIVSFSPWIATVAAGLDDRSYPNYISLGNAKTLPGVGLAPPTPGSS  359

Query  1192  FFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVA  1371
              + +  A D    NS+    +   CQD   F   LV+GK++ICT+++ F    A++  VA
Sbjct  360   TYSMILAKDAVG-NSSNYFFSPNDCQDPSLFNAQLVKGKVLICTFSFSFIFGGATVHQVA  418

Query  1372  DTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRS  1551
              TV    A GFVL ++ D+   + +   V + +PG++I   E+S  L +YYNS+T R+ +
Sbjct  419   ATVANLSAVGFVLVVESDLAGSKFE--PVPISVPGIVITTSESSEELLRYYNSSTTRAAN  476

Query  1552  GRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIW  1731
             G+A +F ATA+I +G+ A+++   P VA YSSRGPDV N     ADVLKPNI+APGS IW
Sbjct  477   GKAASFNATAKIGNGQEAVFNSSAPQVALYSSRGPDVRNFAFQDADVLKPNILAPGSLIW  536

Query  1732  AAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADV  1911
              AW+P+   +   +G++FALVSGTSMA+PH+AGIAAL+K   P   P+ I SAMMT+A  
Sbjct  537   GAWTPSGTDEPNFQGKNFALVSGTSMASPHVAGIAALLKKEFPGRSPAVIASAMMTTAST  596

Query  1912  TDRlgspllaq----qasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAV  2079
             TD  GSPLLAQ     AS  L  ATPFD+G G INP  AL+PGLVF+  +  YI+FLCAV
Sbjct  597   TDNRGSPLLAQHPSSSASSDLESATPFDYGHGAINPKAALDPGLVFDAGYGDYIKFLCAV  656

Query  2080  PGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVI  2259
             PGV+  ++       C +      SDLN PS+TIS+L G R V R  T+VG   E+YRV+
Sbjct  657   PGVNATAIFNATRERCSQPAGL-MSDLNLPSITISSLGGERRVPRTATSVGAKTEKYRVV  715

Query  2260  VREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             V  P GV V++ P  F +    S  L I++ A  ++  +SFGEM L+GD  H VR+P  V
Sbjct  716   VTNPAGVAVSVKPSAFAVDPGRSVSLGILVRARDSSEEFSFGEMRLVGDLGHTVRLPITV  775



>ref|XP_002977534.1| hypothetical protein SELMODRAFT_106806 [Selaginella moellendorffii]
 gb|EFJ21538.1| hypothetical protein SELMODRAFT_106806 [Selaginella moellendorffii]
Length=784

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/776 (47%), Positives = 483/776 (62%), Gaps = 32/776 (4%)
 Frame = +1

Query  178   VTMYKQRMTKQHDVFLGSLLRRSA--YTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVR  351
             V +YK R+ +QHD FL      S   Y KLYSY HL+NGFAV ++  +A   L  A GV 
Sbjct  10    VELYKSRLVQQHDKFLQETFASSGAGYQKLYSYHHLINGFAVKLQDHQA-DTLKSAPGVM  68

Query  352   GIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEE  531
              + +D ++ K+TTHTPDFLG+P  VW + GG   +G+G+V+G+IDTGI+P H SFS    
Sbjct  69    LVQKDWRVSKLTTHTPDFLGLPTGVWSQQGGAGNAGDGIVVGIIDTGIDPTHPSFSGQAF  128

Query  532   YNIGRPRIT---RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPF  702
              +      +   + F G C       A+ CNGKIVGA++FA AA A+G+FN S  + SP 
Sbjct  129   ASNSSSNTSSGLKNFRGSCEV-----ASFCNGKIVGARHFAAAATASGNFNASVDFDSPL  183

Query  703   DADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaa  879
             D DGHGSHTAS AAGNY+ PV  N ++YG ASGMAP A IAVYKALY  FGG+++DVVAA
Sbjct  184   DGDGHGSHTASIAAGNYNVPVTINGYSYGKASGMAPRARIAVYKALYRQFGGFVADVVAA  243

Query  880   vdqavedg------------vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQ  1023
             +D+A +                +       S   S  + FLNV ++ +L A + GV V Q
Sbjct  244   IDKASKRNFRKSFHKLIDGVDVLNLSVGPNSPPSSSSATFLNVFDMAILAAVKQGVFVAQ  303

Query  1024  AAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQL  1203
             AAGN GP  R+++SFSPW+ +VAA   DR Y N I LGN +T  G GL+PPT G + + +
Sbjct  304   AAGNGGPYPRTIVSFSPWIATVAAGLDDRSYPNYISLGNAKTLPGVGLAPPTPGSSTYSM  363

Query  1204  AAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVH  1383
               A D    NS+    +   CQD   F   LV+GK++ICT+++ F    A++  VA TV 
Sbjct  364   ILAKDAVG-NSSNYFFSPNDCQDPSLFNAQLVKGKVLICTFSFSFIFGGATVHQVAATVA  422

Query  1384  RAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAV  1563
                A GFVL ++ D+   + +   V + +PG++I   E+S  L +YYNS+T R+ +G+A 
Sbjct  423   NLSAVGFVLVVESDLAGSKFE--PVPISVPGIVITTSESSEELLRYYNSSTTRAANGKAA  480

Query  1564  AFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWS  1743
             +F ATA+I +G+ A+++   P VA YSSRGPDV N     ADVLKPNI+APGS IW AW+
Sbjct  481   SFNATAKIGNGQEAVFNSSAPQVALYSSRGPDVRNFAFQDADVLKPNILAPGSLIWGAWT  540

Query  1744  PNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl  1923
             P+   +   +G++FALVSGTSMA+PH+AGIAAL+K   P   P+ I SAMMT+A  TD  
Sbjct  541   PSGTDEPNFQGKNFALVSGTSMASPHVAGIAALLKKEFPGRSPAVIASAMMTTASTTDNR  600

Query  1924  gspllaq----qasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVD  2091
             GSPLLAQ     AS  L  ATPFD+G G INP  AL+PGLVF+  +  YI+FLCAVPGV+
Sbjct  601   GSPLLAQHPSSSASSDLESATPFDYGHGAINPKAALDPGLVFDAGYGDYIKFLCAVPGVN  660

Query  2092  EKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREP  2271
               ++       C +      SDLN PS+TIS+L G R V R  T+VG   E+YRV+V  P
Sbjct  661   ATAIFNATRERCSQPAGL-MSDLNLPSITISSLGGERRVPRTATSVGAKTEKYRVVVTNP  719

Query  2272  LGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              GV V++ P  F +    S  L I++ A  ++  +SFGEM L+GD  H VR+P  V
Sbjct  720   AGVAVSVKPSAFAVDPGRSVSLGILVWARDSSEEFSFGEMRLVGDLGHTVRLPITV  775



>ref|XP_006850906.1| hypothetical protein AMTR_s00025p00169730 [Amborella trichopoda]
 gb|ERN12487.1| hypothetical protein AMTR_s00025p00169730 [Amborella trichopoda]
Length=820

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/804 (45%), Positives = 503/804 (63%), Gaps = 39/804 (5%)
 Frame = +1

Query  109   KIYMVLMEDHPFVS------------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +IY+V ++  P V+                   ++  TS +V  Y Q + KQHD  L SL
Sbjct  24    EIYIVTVQGEPVVTYQGGIDGFSATAIDSSSGVKMDTTSEHVVSYSQHLEKQHDTLLNSL  83

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
               + +Y K+YSY HL+NGF+VH+   +A + L+K   V+ + +D K++++TTHTP FLG+
Sbjct  84    FEKGSYEKIYSYRHLINGFSVHLSPAQA-EALNKDPKVKRVEKDWKVQRLTTHTPQFLGL  142

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE VVIG+ID+GI P H SF+S   YN         + GKC   + 
Sbjct  143   PTGVWPTGGGSERAGEDVVIGLIDSGIYPEHPSFAS---YNSPSYGPLPSYRGKC---EI  196

Query  595   FPATA---CNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPV  765
              PAT    CNGKIVGAQ+FA+AAIAAG FN +  +ASP D DGHGSHTA+ AAGN   PV
Sbjct  197   DPATKRDFCNGKIVGAQHFAKAAIAAGSFNPAIDFASPLDGDGHGSHTAAIAAGNNGIPV  256

Query  766   ITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv  942
               + + +G ASGMAP A IAVYKA+Y  FGG+++DVVAA+DQAV+DGVDIL+LSVGP++ 
Sbjct  257   RMHGYEFGRASGMAPRARIAVYKAIYRLFGGFVADVVAAIDQAVQDGVDILNLSVGPNNP  316

Query  943   -psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYT  1119
               +  + FLN  ++ LL A +AGV V QAAGN GP  +SM+SFSPW+TSVAA+  DR Y 
Sbjct  317   PATTKTTFLNPFDLALLGAVKAGVFVAQAAGNGGPFPKSMVSFSPWITSVAAAVDDRSYR  376

Query  1120  NSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLV  1299
             N + LGNG+   G GL+P T     ++L AA D    N++  LL+   CQ +     SLV
Sbjct  377   NHMTLGNGKLLPGIGLAPATHSNQTYKLVAAND-AMLNTSDILLSPSDCQRSEDLDKSLV  435

Query  1300  RGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGL  1479
              G +++C Y+++F    ASI  V+ T     AAGFVL ++    S   K   V + +PG+
Sbjct  436   EGNILVCGYSFNFILGGASIRKVSQTAKNLSAAGFVLAVENV--SPGTKFDPVPVGMPGI  493

Query  1480  IINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPD  1659
             +I ++  S  L +YYNS T+R +SGR  +FR TA I  G   ++    P VA +SSRGPD
Sbjct  494   LITDVTKSRDLIEYYNSTTIRDKSGRVTSFRGTAIIAGGLTPVFHKSAPQVAIFSSRGPD  553

Query  1660  VNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAA  1839
             V +     ADVLKP+I+APGS IWAAW+PN   +    G+ FA++SGTSMA PHI+GIAA
Sbjct  554   VKDFSFQDADVLKPDILAPGSLIWAAWTPNGTDEVNYMGEGFAMISGTSMAAPHISGIAA  613

Query  1840  LIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINP  2007
             LIK +H +W P+AI SA+MT+A   DR      +        Q L PATPFD+GSG ++P
Sbjct  614   LIKQKHRDWSPAAIKSALMTTATTVDRAGRPLRAQQYTGLQVQTLVPATPFDYGSGAVHP  673

Query  2008  SRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISN  2187
               AL+PGLVF + ++ +I+FLC+VPG++++ V+   G  C  +  +  +DLNTPS+ ISN
Sbjct  674   RAALDPGLVFESAYEDHIKFLCSVPGINQQEVKNFTGSNCNPHSGY-PTDLNTPSIVISN  732

Query  2188  LVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKAT  2367
             L G+RTV+R V NV    E Y           + + P    + A  +R+  + ++    T
Sbjct  733   LAGTRTVVRSVMNV-AETESYSTTTYIAPEASLMVSPPAMTLEAGATRNFTVTVSVRSVT  791

Query  2368  NSYSFGEMILLGDRNHIVRVPFAV  2439
              +Y FGE++L GDR H+VR+P AV
Sbjct  792   GTYCFGEVLLKGDRGHMVRIPVAV  815



>ref|XP_004242827.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010323354.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=817

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/802 (44%), Positives = 491/802 (61%), Gaps = 31/802 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A+IY+V +E  P +S                 +I  TS +VT Y Q + K+HD+ L 
Sbjct  19    VGKAEIYIVTVEGEPVISYKGGIDGFEATAAESDEKIDTTSESVTSYAQHLEKKHDMLLA  78

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  R  Y K+YSY HL+NGFA H+  ++A +IL +A GV+ +  D K++++TTHTP FL
Sbjct  79    LLFDRGTYKKIYSYRHLINGFAAHISHEQA-EILRRAPGVKSVERDWKVKRLTTHTPQFL  137

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG ID+GI P H SF+S      G      K+ GKC   
Sbjct  138   GLPTGVWPTGGGFDRAGEDIVIGFIDSGIYPHHPSFASHNTEPYGP---LPKYRGKCEID  194

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              N     CNGKI+GAQ+FA+AA AAG FN +  + SP D DGHGSHTA+ AAGN   PV 
Sbjct  195   PNTKKDYCNGKIIGAQHFAKAAKAAGSFNPAIDFDSPLDGDGHGSHTAAIAAGNNGIPVR  254

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-  942
              + F +G ASGMAP A IAVYKALY  FGG+++DVVAA++QAV DGVDIL+LSVGP+S  
Sbjct  255   MHGFEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIEQAVHDGVDILNLSVGPNSPP  314

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + FLN  +  LL A +AGV + QAAGN GP  ++++S+SPW+ SVAA+  DRRY N
Sbjct  315   ATTKTTFLNPFDATLLSAVKAGVFIAQAAGNGGPFPKTLVSYSPWIASVAAAVDDRRYKN  374

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+  +G GLSP T     F + AA DV   +S+    +   CQ       +LV+
Sbjct  375   HLTLGNGKVLAGLGLSPSTHPNRTFTMVAANDVLL-DSSVTKYSPADCQRPEVLNKNLVK  433

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F    ASI  VA+T    GAAGFVL ++    S   K   V ++IPG++
Sbjct  434   GNILLCGYSFNFVVGTASIKKVAETAKALGAAGFVLAVEN--ASPGTKFDPVPVRIPGIL  491

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++  S  L  YYN  T R  +GR  +F++T  I +G R I     P VA +S+RGP++
Sbjct  492   ITDVSMSMELVNYYNITTSRDWTGRVESFKSTGSIGNGLRPILHKSAPQVAVFSARGPNI  551

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAW+PN   +    G+ FAL+SGTSMA PHIAGIAAL
Sbjct  552   KDYSFQDADLLKPDILAPGSLIWAAWAPNGTDEANYCGEGFALISGTSMAAPHIAGIAAL  611

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             +K  HP+W P+AI SA+MT++ + DR      +   +   +  L PATPFD+GSG +NP 
Sbjct  612   VKQHHPHWSPAAIKSALMTTSSIIDRADRPLQAQQYSGSETLMLVPATPFDYGSGHVNPR  671

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+F+  +Q Y+ FLC VPG+D + +++     C        S+ N+PS+ +S+L
Sbjct  672   AALDPGLIFDAGYQDYLGFLCTVPGIDAQEIKKFTHSPCNYTLGH-PSNFNSPSIAVSHL  730

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             VG+R + R VTNV   +E Y V  R    + +   P    +    SR   + L       
Sbjct  731   VGTRIITRTVTNV-AEEETYVVTARMAPEIAIETNPPAMTLRHGASRKFTVTLTVRSVKG  789

Query  2371  SYSFGEMILLGDRNHIVRVPFA  2436
             +YSFGE++L G R H VR+P A
Sbjct  790   AYSFGEVLLKGSRGHKVRIPVA  811



>ref|XP_010048581.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW80862.1| hypothetical protein EUGRSUZ_C02222 [Eucalyptus grandis]
Length=816

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/800 (45%), Positives = 491/800 (61%), Gaps = 32/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             +A+A++Y+V +E  P +S                 +I  TS  VT Y + + K+HD+ LG
Sbjct  19    IAKAEVYIVTIEGEPVISYKGGVNGFEATAVESDEKIDPTSELVTSYAEHLEKKHDMLLG  78

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  R  Y KLYSY HL+NGFAVH+  ++A +IL +A GV+ +  D K++++TTHTP FL
Sbjct  79    MLFDRGTYQKLYSYRHLINGFAVHISPEQA-EILRRAPGVKSVERDWKVKRLTTHTPQFL  137

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG + +GE +VIG +D+GI P H SFSS  E     P    K+ GKC   
Sbjct  138   GLPTGVWPTGGGHAKAGEDIVIGFVDSGIYPHHPSFSSHTEPYGPLP----KYRGKCEVD  193

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +     CNGKI+GAQ+FA+AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV 
Sbjct  194   PDTKRAFCNGKIIGAQHFAKAAIAAGSFNPSVDFASPLDGDGHGSHTAAIAAGNNGIPVR  253

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
                  +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S  
Sbjct  254   VRGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVYDGVDILSLSVGPNSPP  313

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              S  + FLN  +  LL A +AGV V QAAGN GP S++++S+SPW+TSVAA+  DRRY N
Sbjct  314   TSTRTTFLNPFDATLLSAVKAGVFVAQAAGNGGPFSKTLVSYSPWITSVAAAIDDRRYKN  373

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+   G GLSP T     F + AA DV   +S+    +   CQ       +LV+
Sbjct  374   HLTLGNGKMLPGIGLSPSTQPNRTFTMVAANDVLL-DSSVMKYSPSDCQRPEVLNKNLVQ  432

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F +  ASI  V++T    GA GFVL ++    S   K   V + +PG++
Sbjct  433   GNILLCGYSFNFVTGTASIKKVSETAKSLGAIGFVLAVENV--SPGTKFDPVPVGVPGIL  490

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++  S  L  YYN +T R  +GR  +F+A   I DG   I     P VA +S+RGP++
Sbjct  491   ITDVSRSMDLIDYYNVSTTRDWTGRVKSFKAVGSIGDGLMPILHKSAPQVALFSARGPNI  550

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL
Sbjct  551   KDFGFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAAL  610

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             +K +HP+W P++I SA+MT++   DR      +   ++  + +L  ATPFD+GSG +NP 
Sbjct  611   VKQKHPHWSPASIKSALMTTSAKLDRAGRPLQAQQYSETEAMKLVTATPFDYGSGHVNPR  670

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGLVF+  +  Y+ FLC  PG+D   ++      C  +     S+LN+PS+TI++L
Sbjct  671   AALDPGLVFDAGYNDYLGFLCTTPGIDVHEIKNYTNSPCNFSMGH-PSNLNSPSITIAHL  729

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             V ++T+ R VTNV   +E Y +  R    + +   P    I    SR   + L     T 
Sbjct  730   VRTQTITRTVTNV-AQEETYVITTRMDPSIALAASPPAMTIRPGASRKFTVTLTVRSVTG  788

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
             +YSFGE+++ G R H VR+P
Sbjct  789   TYSFGEILMKGSRGHKVRIP  808



>ref|XP_002267221.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
 emb|CBI32993.3| unnamed protein product [Vitis vinifera]
Length=822

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/796 (45%), Positives = 480/796 (60%), Gaps = 25/796 (3%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTRIKG-------TSGNVTMYK---QRMTKQHDVFLGSLLRRSAY  252
             E  +Y+VLME  P    R  G          N  +YK   + +   HD  L + L   +Y
Sbjct  30    ERGMYLVLMEGDPVAFHRGSGPLEEGKRVDPNSEVYKAHAKHLVDSHDQLLQTTLDSGSY  89

Query  253   TKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWP  432
              KLYS+ H++NGF+VH    +A K+ H A GV  +  D   + MTT+TP FLG+P+ +W 
Sbjct  90    NKLYSFKHIVNGFSVHTTPSQANKLKH-APGVTLVERDRGAKLMTTYTPQFLGLPEGIWS  148

Query  433   RLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRI--TRKFTGKCITGDNFPAT  606
             + GG + +GEG+VIG +DTGINP H SF+    Y+   P    T  F G C  G  FPA+
Sbjct  149   QEGGDANAGEGLVIGFVDTGINPLHPSFA----YDPTNPYTSNTSHFKGTCEAGPGFPAS  204

Query  607   ACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNY  786
             +CNGKIV A++F+  A AA + N S  + SP DA GHGSH ASTAAGN   PV+ N F Y
Sbjct  205   SCNGKIVSARFFSAGAQAATNLNTSYDFLSPLDAVGHGSHVASTAAGNPGVPVVLNGFFY  264

Query  787   GYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFL  966
             G ASGMAP A IAVYKA+Y   G ++DVV+A+DQA  DGVD+L+LS+GP + P     FL
Sbjct  265   GRASGMAPRARIAVYKAIYPTVGTLTDVVSAMDQATMDGVDVLTLSIGPDTPPEDTMTFL  324

Query  967   NVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQ  1146
             +V ++ +LFA RAGV VVQAAGN GP   +++SFSPW    AAS+TDR Y +++VLGNGQ
Sbjct  325   SVFDIFMLFARRAGVFVVQAAGNQGPGPSTVVSFSPWAVGAAASSTDRSYPSTLVLGNGQ  384

Query  1147  TFSGSGLSPPTAGKAFFQ--LAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGKLV  1314
                G GLS PT G    Q  L  A D  + N T       VE CQ A    P LV+G +V
Sbjct  385   RIGGVGLSGPTLGNGLLQYKLVLAKDAVKVNGTFPRTAQYVEECQFAEALDPLLVQGSVV  444

Query  1315  ICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNM  1494
             IC ++  F +  +++  + DT    G  GFVL  +P+ G        +   +PG++I  +
Sbjct  445   ICIFSTGFFNGNSTLTAIIDTARALGFMGFVLVANPNYG--DFIAEPLPFSVPGILIPRV  502

Query  1495  EASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNAL  1674
               +  + QYY   T R ++G AV F   A I +GR + ++G+ P+V+ +SSRGPD  +  
Sbjct  503   AETQIIAQYYEQQTYRDQTGLAVRFSGRAAIGEGRISFFTGRAPIVSRFSSRGPDFIDKS  562

Query  1675  LDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDR  1854
                 DVLKP+I+APG  +WAAWSP S  D  + G  FAL+SGTSMATPH+AGIAALIK  
Sbjct  563   RKPVDVLKPDILAPGHQVWAAWSPISILDPILSGYSFALLSGTSMATPHVAGIAALIKQY  622

Query  1855  HPNWKPSAITSAMMTSADVTDRl-gspllaqqasqqlapaTPFDFGSGFINPSRALNPGL  2031
             +P+W PS I SAM T+A + D L    +        L  +T FDFG+GFI+P+ A++PGL
Sbjct  623   NPSWTPSMIASAMSTTATIVDNLGEPIMAEGYDIGSLYLSTHFDFGAGFISPNHAIDPGL  682

Query  2032  VFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVM  2211
             V  + F+ YI FLC++P V+  ++R + G  C +      SDLN PSVTIS L G+  V 
Sbjct  683   VLTSGFEDYISFLCSLPNVNPATIRAITGGVCTQLLNH-LSDLNLPSVTISELRGTLLVR  741

Query  2212  RRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEM  2391
             R V N+G   E Y   V  P GV V++ P +F I   G++ L I LN T+A   YSFG +
Sbjct  742   RNVKNIGSKQETYLCSVIPPKGVMVSLNPPSFTIVPQGTQDLEIQLNVTQAMEDYSFGGI  801

Query  2392  ILLGDRNHIVRVPFAV  2439
             IL G  NHIVR+P +V
Sbjct  802   ILTGSLNHIVRIPISV  817



>ref|XP_006361635.1| PREDICTED: subtilisin-like protease-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361636.1| PREDICTED: subtilisin-like protease-like isoform X2 [Solanum 
tuberosum]
Length=817

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/802 (44%), Positives = 485/802 (60%), Gaps = 31/802 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A+IY+V +E  P +S                 +I  TS +VT Y Q + K+HD+ L 
Sbjct  19    VGKAEIYIVTVEGEPVISYKGGIDGFEATAAESDEKIDTTSESVTSYAQHLEKKHDMLLA  78

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  R  Y K+YSY HL+NGFA H+  ++A +IL +A GV+ +  D K++++TTHTP FL
Sbjct  79    LLFDRGTYKKIYSYRHLINGFAAHISHEQA-EILRRAPGVKSVERDWKVKRLTTHTPQFL  137

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE ++IG ID+GI P H SF+S      G      K+ GKC   
Sbjct  138   GLPTGVWPTGGGFDRAGEDIIIGFIDSGIYPHHPSFASHNTEPYGP---LPKYRGKCEID  194

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              N     CNGKI+GAQ+FA AA AAG FN +  + SP D DGHGSHTA+ AAGN   PV 
Sbjct  195   PNTKKDYCNGKIIGAQHFAEAAKAAGSFNPAIDFDSPLDGDGHGSHTAAIAAGNNGIPVR  254

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              + F +G ASGMAP A IAVYKALY  FGG+++DVVAA++QAV DGVDIL+LSV   S  
Sbjct  255   MHGFEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIEQAVHDGVDILNLSVGPNSPP  314

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + FLN  +  LL A +AGV + QAAGN GP  +++LS+SPW+ +VAA+  DRRY N
Sbjct  315   ATTKTTFLNPFDATLLSAVKAGVFIAQAAGNGGPFPKTLLSYSPWIATVAAAVDDRRYKN  374

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+  +G GLSP T     F + AA DV   +S+    +   CQ       +LV 
Sbjct  375   HLTLGNGKVLAGLGLSPSTHPNRTFTMVAANDVLL-DSSVTKYSPADCQRPEVLNKNLVE  433

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F    ASI   A+T    GAAGFVL ++    S   K   V ++IPG++
Sbjct  434   GNILLCGYSFNFVVGTASIKKAAETAKALGAAGFVLAVEN--ASPGTKFDPVPVRIPGIL  491

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++  S  L  YYN  T R  +GR  +F++T  I +G R I     P VA +S+RGP++
Sbjct  492   ITDVSMSMELVNYYNITTSRDWTGRVKSFKSTGSIGNGLRPILHKSAPQVAVFSARGPNI  551

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAW+PN   +    G+ FAL+SGTSMA PHIAGIAAL
Sbjct  552   KDYSFQDADLLKPDILAPGSLIWAAWAPNGTDEANYCGEGFALISGTSMAAPHIAGIAAL  611

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             IK  HP+W P+AI SA+MT++   DR      +   +   +  L PATPFD+GSG +NP 
Sbjct  612   IKQHHPHWSPAAIKSALMTTSSTIDRAERPLQAQQYSGSETLMLVPATPFDYGSGHVNPR  671

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+F+  +Q Y+ FLC VPG+D + +++     C        S+ N+PS+ +S+L
Sbjct  672   AALDPGLIFDAGYQDYLGFLCTVPGIDAQEIKKFTHSPCNYTLGH-PSNFNSPSIAVSHL  730

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             VG++ + R VTNV   +E Y V  R    + +   P    +    SR   + L     T 
Sbjct  731   VGTQIITRIVTNV-AEEETYVVTARMAPEIAIETNPPAMTLRHGASRKFTVTLTVRSVTG  789

Query  2371  SYSFGEMILLGDRNHIVRVPFA  2436
             +YSFGE++L G R H VR+P A
Sbjct  790   AYSFGEVLLKGSRGHKVRIPVA  811



>ref|XP_010932085.1| PREDICTED: subtilisin-like protease SBT3.5 [Elaeis guineensis]
Length=806

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/801 (44%), Positives = 479/801 (60%), Gaps = 32/801 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV----------STRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAY  252
             E  IY+VL++  P              R +    +   +  R+ K HD  L S L   +Y
Sbjct  10    ERAIYLVLVDGEPVAFRPGATLPRQHARFQPECESCKTHATRLVKSHDRLLQSNLEAGSY  69

Query  253   TKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWP  432
             TKLYS+ H++NGFAVH  S +A K L  A GV  I +D   + MTT+TP  LG+P+ +W 
Sbjct  70    TKLYSFHHIVNGFAVHTTSSQA-KRLELAPGVLRIEKDRGAKLMTTYTPHLLGLPEGIWT  128

Query  433   RLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRP----RITRKFTGKCITGDNFP  600
             R GG   +GEG+ IG+IDTGI+P H SF+    YN   P    R T+   G C  G  FP
Sbjct  129   REGGEKHAGEGITIGVIDTGIDPTHPSFA----YNPLNPYEASRSTQFSDGACQLGPQFP  184

Query  601   ATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRF  780
               +CNGKIV A+YF+  A AA   N S+   SPFD  GHGSH AS AAGN+  PV+ N F
Sbjct  185   VGSCNGKIVSARYFSAGAAAALPLNASKDL-SPFDQVGHGSHVASIAAGNWGVPVVVNGF  243

Query  781   NYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSA  960
              YG ASGMAP A +A+YKALY  GG ++D+V+A+DQA +D VD++ LSVGP+  P     
Sbjct  244   MYGSASGMAPRARLAIYKALYPEGGTIADLVSAIDQAAQDRVDVMVLSVGPNEPPEVTPT  303

Query  961   FLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGN  1140
             F++V ++ LLFA R G  VVQAAGN GP   +++SFSPW   VAASTT R YT ++ +G+
Sbjct  304   FMSVFDISLLFARRTGQFVVQAAGNKGPGEATVVSFSPWTMGVAASTTGRSYTPTLTMGD  363

Query  1141  GQTFSGSGLSPPTAGKAF--FQLAAAVDVCRRNST----AGLLTVESCQDAMQFVPSLVR  1302
             G    G GLS PT G     F+L +A D    N +      L  VE CQ      P +V 
Sbjct  364   GHQLHGVGLSAPTPGDGLVQFRLVSARDAALANGSHPPATNLPYVEDCQHPEALQPEVVL  423

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +VIC+++  F +  +++  + D     G  GF+L  +P  G        +   IPG++
Sbjct  424   GSIVICSFSESFLNGTSTVTAILDNAKALGFIGFILVANPHYG--DFIAEPLPFPIPGIM  481

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I  +  +  L +YY  +T R   G  +++  +A I +GR A +    P+VA +SSRGPD+
Sbjct  482   IPRVADAQILWEYYEKHTYRDSGGAVISYGGSAAIREGRIAAFPDPAPIVARFSSRGPDI  541

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              ++ ++ ADVLKP+I+APG  IWAAWSP S  D  + G HFAL+SGTSMATPH+AG+ AL
Sbjct  542   IDSNMNPADVLKPDILAPGQQIWAAWSPTSALDPILSGNHFALLSGTSMATPHVAGVGAL  601

Query  1843  IKDRHPNWKPSAITSAMMTSA-DVTDRlgspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             IK  HP W PS I SA+ T+A    DR    +        L P+TPFD G+GF+NPS AL
Sbjct  602   IKQAHPTWTPSMIASAISTTARKHDDRGQPIMSQGSELYFLYPSTPFDHGAGFVNPSAAL  661

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWC-SDLNTPSVTISNLVG  2196
             +PGLVF++ F+ YI FLC++P +D  +VR   G  C  N+ F   +DLN PS+TIS L G
Sbjct  662   DPGLVFSSGFEDYISFLCSLPNLDPTAVRSATGTPC--NETFDSPTDLNLPSITISALRG  719

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
              + V R + NV    E Y   ++ P GV+V++ P  F I  +G+++L I  N T+ ++S+
Sbjct  720   FQLVRRSIKNVANRTETYLCSIQPPEGVQVSVQPSWFNIIPEGTQYLEIKFNVTQVSDSF  779

Query  2377  SFGEMILLGDRNHIVRVPFAV  2439
              FGE++L G  +HIVR+P AV
Sbjct  780   RFGEIVLTGALDHIVRLPLAV  800



>ref|XP_002269786.1| PREDICTED: subtilisin-like protease isoform X4 [Vitis vinifera]
 ref|XP_010656767.1| PREDICTED: subtilisin-like protease isoform X4 [Vitis vinifera]
 ref|XP_010656768.1| PREDICTED: subtilisin-like protease isoform X4 [Vitis vinifera]
 emb|CBI40107.3| unnamed protein product [Vitis vinifera]
Length=817

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/797 (45%), Positives = 481/797 (60%), Gaps = 31/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V +   P +S +                I  TS  VT Y + +  +HD+ L  L 
Sbjct  22    AEIYIVTVIGEPVISYKGGVPGFEATAVESDETIDVTSELVTSYSRHLEMKHDMLLSLLF  81

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                 Y KLYSY HL+NGFAVH+  ++A ++L +A GV+ +  D K+ ++TTHTP FLG+P
Sbjct  82    EHGTYKKLYSYRHLINGFAVHISPEQA-EVLRQAPGVKSVERDWKVRRLTTHTPQFLGLP  140

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF++   +N+       K+ GKC    + 
Sbjct  141   TGVWPTGGGFDRAGEDIVIGFVDSGIFPHHPSFAT---HNVEPYGPIPKYRGKCEVDPDT  197

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
                 CNGKIVGAQ+FA AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  198   KRNFCNGKIVGAQHFAEAAIAAGSFNPSVDFASPLDGDGHGSHTAAIAAGNNGIPVRMHG  257

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A +AVYKALY  FGG+++DVVAA+DQAV DGVDIL+LSV   S   + 
Sbjct  258   YEFGKASGMAPRARVAVYKALYRLFGGFVADVVAAIDQAVHDGVDILNLSVGPNSPPATT  317

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  +S+LS+SPW+ SVAA+  DRRY N + 
Sbjct  318   KTTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKSLLSYSPWIASVAAAIDDRRYKNHLT  377

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+   G GLSP T     F L AA DV   +S     +   CQ       +LV G +
Sbjct  378   LGNGKILPGIGLSPSTHFNRTFTLVAANDVLLDSSVVKY-SPSDCQRPEVLNKNLVEGNI  436

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + IPG++I  
Sbjct  437   LLCGYSFNFVVGTASIKKVSETAKSLGAIGFVLAVENV--SPGTKFDPVPVSIPGILITE  494

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L +YYN++T R  +GR  +F+AT  I DG   I     P VA +S+RGP++ + 
Sbjct  495   VSKSMDLIEYYNTSTSRDWTGRVKSFKATGSIGDGLMPILHKSAPQVALFSARGPNIRDF  554

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K 
Sbjct  555   NFQDADLLKPDILAPGSLIWAAWSPNGTDEANYVGEGFAMISGTSMAAPHIAGIAALVKQ  614

Query  1852  RHPNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP+W P+AI SA+MT++   DR      +   +   +  L  ATPFD+GSG + P  AL
Sbjct  615   KHPHWSPAAIKSALMTTSTTLDRAENPLRAQQYSGSETVTLVTATPFDYGSGHVTPRAAL  674

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ YI FLC  PG+D   ++    + C        S+LNTPS+TIS+LVG+
Sbjct  675   DPGLIFDAAYEDYIGFLCTTPGIDAHEIKNYTSLPC-NYTMGRPSNLNTPSITISHLVGT  733

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV R VTNV G  E Y +  R    + V   P    +    SR   + L A   T +YS
Sbjct  734   QTVTRTVTNVAGL-ETYVISTRMAPAIAVEANPPAMTLKPGASRKFSVTLTARSVTGTYS  792

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE++L G R H VR+P
Sbjct  793   FGEVLLKGSRGHKVRIP  809



>ref|XP_010656765.1| PREDICTED: subtilisin-like protease isoform X2 [Vitis vinifera]
Length=834

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/797 (45%), Positives = 481/797 (60%), Gaps = 31/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V +   P +S +                I  TS  VT Y + +  +HD+ L  L 
Sbjct  39    AEIYIVTVIGEPVISYKGGVPGFEATAVESDETIDVTSELVTSYSRHLEMKHDMLLSLLF  98

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                 Y KLYSY HL+NGFAVH+  ++A ++L +A GV+ +  D K+ ++TTHTP FLG+P
Sbjct  99    EHGTYKKLYSYRHLINGFAVHISPEQA-EVLRQAPGVKSVERDWKVRRLTTHTPQFLGLP  157

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF++   +N+       K+ GKC    + 
Sbjct  158   TGVWPTGGGFDRAGEDIVIGFVDSGIFPHHPSFAT---HNVEPYGPIPKYRGKCEVDPDT  214

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
                 CNGKIVGAQ+FA AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  215   KRNFCNGKIVGAQHFAEAAIAAGSFNPSVDFASPLDGDGHGSHTAAIAAGNNGIPVRMHG  274

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A +AVYKALY  FGG+++DVVAA+DQAV DGVDIL+LSV   S   + 
Sbjct  275   YEFGKASGMAPRARVAVYKALYRLFGGFVADVVAAIDQAVHDGVDILNLSVGPNSPPATT  334

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  +S+LS+SPW+ SVAA+  DRRY N + 
Sbjct  335   KTTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKSLLSYSPWIASVAAAIDDRRYKNHLT  394

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+   G GLSP T     F L AA DV   +S     +   CQ       +LV G +
Sbjct  395   LGNGKILPGIGLSPSTHFNRTFTLVAANDVLLDSSVVKY-SPSDCQRPEVLNKNLVEGNI  453

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + IPG++I  
Sbjct  454   LLCGYSFNFVVGTASIKKVSETAKSLGAIGFVLAVENV--SPGTKFDPVPVSIPGILITE  511

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L +YYN++T R  +GR  +F+AT  I DG   I     P VA +S+RGP++ + 
Sbjct  512   VSKSMDLIEYYNTSTSRDWTGRVKSFKATGSIGDGLMPILHKSAPQVALFSARGPNIRDF  571

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K 
Sbjct  572   NFQDADLLKPDILAPGSLIWAAWSPNGTDEANYVGEGFAMISGTSMAAPHIAGIAALVKQ  631

Query  1852  RHPNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP+W P+AI SA+MT++   DR      +   +   +  L  ATPFD+GSG + P  AL
Sbjct  632   KHPHWSPAAIKSALMTTSTTLDRAENPLRAQQYSGSETVTLVTATPFDYGSGHVTPRAAL  691

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ YI FLC  PG+D   ++    + C        S+LNTPS+TIS+LVG+
Sbjct  692   DPGLIFDAAYEDYIGFLCTTPGIDAHEIKNYTSLPC-NYTMGRPSNLNTPSITISHLVGT  750

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV R VTNV G  E Y +  R    + V   P    +    SR   + L A   T +YS
Sbjct  751   QTVTRTVTNVAGL-ETYVISTRMAPAIAVEANPPAMTLKPGASRKFSVTLTARSVTGTYS  809

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE++L G R H VR+P
Sbjct  810   FGEVLLKGSRGHKVRIP  826



>ref|XP_010656764.1| PREDICTED: subtilisin-like protease isoform X1 [Vitis vinifera]
Length=841

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/797 (45%), Positives = 481/797 (60%), Gaps = 31/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V +   P +S +                I  TS  VT Y + +  +HD+ L  L 
Sbjct  46    AEIYIVTVIGEPVISYKGGVPGFEATAVESDETIDVTSELVTSYSRHLEMKHDMLLSLLF  105

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                 Y KLYSY HL+NGFAVH+  ++A ++L +A GV+ +  D K+ ++TTHTP FLG+P
Sbjct  106   EHGTYKKLYSYRHLINGFAVHISPEQA-EVLRQAPGVKSVERDWKVRRLTTHTPQFLGLP  164

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF++   +N+       K+ GKC    + 
Sbjct  165   TGVWPTGGGFDRAGEDIVIGFVDSGIFPHHPSFAT---HNVEPYGPIPKYRGKCEVDPDT  221

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
                 CNGKIVGAQ+FA AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  222   KRNFCNGKIVGAQHFAEAAIAAGSFNPSVDFASPLDGDGHGSHTAAIAAGNNGIPVRMHG  281

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A +AVYKALY  FGG+++DVVAA+DQAV DGVDIL+LSV   S   + 
Sbjct  282   YEFGKASGMAPRARVAVYKALYRLFGGFVADVVAAIDQAVHDGVDILNLSVGPNSPPATT  341

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  +S+LS+SPW+ SVAA+  DRRY N + 
Sbjct  342   KTTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKSLLSYSPWIASVAAAIDDRRYKNHLT  401

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+   G GLSP T     F L AA DV   +S     +   CQ       +LV G +
Sbjct  402   LGNGKILPGIGLSPSTHFNRTFTLVAANDVLLDSSVVKY-SPSDCQRPEVLNKNLVEGNI  460

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + IPG++I  
Sbjct  461   LLCGYSFNFVVGTASIKKVSETAKSLGAIGFVLAVENV--SPGTKFDPVPVSIPGILITE  518

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L +YYN++T R  +GR  +F+AT  I DG   I     P VA +S+RGP++ + 
Sbjct  519   VSKSMDLIEYYNTSTSRDWTGRVKSFKATGSIGDGLMPILHKSAPQVALFSARGPNIRDF  578

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K 
Sbjct  579   NFQDADLLKPDILAPGSLIWAAWSPNGTDEANYVGEGFAMISGTSMAAPHIAGIAALVKQ  638

Query  1852  RHPNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP+W P+AI SA+MT++   DR      +   +   +  L  ATPFD+GSG + P  AL
Sbjct  639   KHPHWSPAAIKSALMTTSTTLDRAENPLRAQQYSGSETVTLVTATPFDYGSGHVTPRAAL  698

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ YI FLC  PG+D   ++    + C        S+LNTPS+TIS+LVG+
Sbjct  699   DPGLIFDAAYEDYIGFLCTTPGIDAHEIKNYTSLPC-NYTMGRPSNLNTPSITISHLVGT  757

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV R VTNV G  E Y +  R    + V   P    +    SR   + L A   T +YS
Sbjct  758   QTVTRTVTNVAGL-ETYVISTRMAPAIAVEANPPAMTLKPGASRKFSVTLTARSVTGTYS  816

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE++L G R H VR+P
Sbjct  817   FGEVLLKGSRGHKVRIP  833



>ref|XP_010656766.1| PREDICTED: subtilisin-like protease isoform X3 [Vitis vinifera]
Length=833

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/797 (45%), Positives = 481/797 (60%), Gaps = 31/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V +   P +S +                I  TS  VT Y + +  +HD+ L  L 
Sbjct  38    AEIYIVTVIGEPVISYKGGVPGFEATAVESDETIDVTSELVTSYSRHLEMKHDMLLSLLF  97

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                 Y KLYSY HL+NGFAVH+  ++A ++L +A GV+ +  D K+ ++TTHTP FLG+P
Sbjct  98    EHGTYKKLYSYRHLINGFAVHISPEQA-EVLRQAPGVKSVERDWKVRRLTTHTPQFLGLP  156

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF++   +N+       K+ GKC    + 
Sbjct  157   TGVWPTGGGFDRAGEDIVIGFVDSGIFPHHPSFAT---HNVEPYGPIPKYRGKCEVDPDT  213

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
                 CNGKIVGAQ+FA AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  214   KRNFCNGKIVGAQHFAEAAIAAGSFNPSVDFASPLDGDGHGSHTAAIAAGNNGIPVRMHG  273

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A +AVYKALY  FGG+++DVVAA+DQAV DGVDIL+LSV   S   + 
Sbjct  274   YEFGKASGMAPRARVAVYKALYRLFGGFVADVVAAIDQAVHDGVDILNLSVGPNSPPATT  333

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  +S+LS+SPW+ SVAA+  DRRY N + 
Sbjct  334   KTTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKSLLSYSPWIASVAAAIDDRRYKNHLT  393

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+   G GLSP T     F L AA DV   +S     +   CQ       +LV G +
Sbjct  394   LGNGKILPGIGLSPSTHFNRTFTLVAANDVLLDSSVVKY-SPSDCQRPEVLNKNLVEGNI  452

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + IPG++I  
Sbjct  453   LLCGYSFNFVVGTASIKKVSETAKSLGAIGFVLAVENV--SPGTKFDPVPVSIPGILITE  510

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L +YYN++T R  +GR  +F+AT  I DG   I     P VA +S+RGP++ + 
Sbjct  511   VSKSMDLIEYYNTSTSRDWTGRVKSFKATGSIGDGLMPILHKSAPQVALFSARGPNIRDF  570

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K 
Sbjct  571   NFQDADLLKPDILAPGSLIWAAWSPNGTDEANYVGEGFAMISGTSMAAPHIAGIAALVKQ  630

Query  1852  RHPNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP+W P+AI SA+MT++   DR      +   +   +  L  ATPFD+GSG + P  AL
Sbjct  631   KHPHWSPAAIKSALMTTSTTLDRAENPLRAQQYSGSETVTLVTATPFDYGSGHVTPRAAL  690

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ YI FLC  PG+D   ++    + C        S+LNTPS+TIS+LVG+
Sbjct  691   DPGLIFDAAYEDYIGFLCTTPGIDAHEIKNYTSLPC-NYTMGRPSNLNTPSITISHLVGT  749

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV R VTNV G  E Y +  R    + V   P    +    SR   + L A   T +YS
Sbjct  750   QTVTRTVTNVAGL-ETYVISTRMAPAIAVEANPPAMTLKPGASRKFSVTLTARSVTGTYS  808

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE++L G R H VR+P
Sbjct  809   FGEVLLKGSRGHKVRIP  825



>ref|XP_003549311.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006600481.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
 ref|XP_006600482.1| PREDICTED: subtilisin-like protease-like isoform X3 [Glycine 
max]
 ref|XP_006600483.1| PREDICTED: subtilisin-like protease-like isoform X4 [Glycine 
max]
 ref|XP_006600484.1| PREDICTED: subtilisin-like protease-like isoform X5 [Glycine 
max]
 ref|XP_006600485.1| PREDICTED: subtilisin-like protease-like isoform X6 [Glycine 
max]
 ref|XP_006600486.1| PREDICTED: subtilisin-like protease-like isoform X7 [Glycine 
max]
Length=817

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/798 (44%), Positives = 484/798 (61%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A++Y+V +E  P +S                  I  TS  VT Y + + K+HD+ LG L
Sbjct  21    DAEVYIVTVEGEPIISYTGGIDGFKATAVESDEEIDTTSELVTSYARHLEKKHDMLLGLL  80

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
                  Y KLYSY HL+NGFAVH+  ++A  + H A GV+ +  D K++++TTHTP FLG+
Sbjct  81    FEEGTYQKLYSYRHLINGFAVHISPEQAETLRH-APGVKSVERDWKVKRLTTHTPQFLGL  139

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG++DTGI P H SF++      G      K+ GKC     
Sbjct  140   PTGVWPTGGGFDRAGEDIVIGLVDTGIYPQHPSFATHNSEPYGP---VPKYRGKCEADPE  196

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                + CNGKIVGAQ+FA AAIAAG FN S  +ASP D DGHGSHTAS AAGN   PV  N
Sbjct  197   TKRSYCNGKIVGAQHFAHAAIAAGSFNPSIDFASPLDGDGHGSHTASIAAGNNGIPVRMN  256

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKA+Y  FGG+++DVVAA+DQAV DGVDIL+LSV   S   +
Sbjct  257   GHEFGRASGMAPRARIAVYKAIYRLFGGFVADVVAAIDQAVYDGVDILNLSVGPDSPPAA  316

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N +
Sbjct  317   TKTTFLNPFDATLLGAVKAGVFVAQAAGNHGPLPKTLVSYSPWIASVAAAIDDRRYKNHL  376

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
             +LGNG+T +G GLSP T     + L AA DV   +S+    +   CQ       +L++G 
Sbjct  377   ILGNGKTLAGIGLSPSTHLNETYTLVAANDVLL-DSSLMKYSPTDCQRPELLNKNLIKGN  435

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  V++T    GA GFVL ++ +I S   K   V + +PG++I 
Sbjct  436   ILLCGYSFNFVVGTASIKKVSETAKALGAVGFVLCVE-NI-SLGTKFNPVPVGLPGILII  493

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN  T R  +GR  +F    +I DG   I     P VA +S+RGP++ +
Sbjct  494   DVSNSKELIDYYNITTPRDWTGRVKSFEGKGKIGDGLMPILHKSAPQVALFSARGPNIKD  553

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAW PN   +    G+ FA++SGTSMA PHIAGIAALIK
Sbjct  554   FSFQEADLLKPDILAPGSLIWAAWCPNGTDEPNYVGEAFAMISGTSMAAPHIAGIAALIK  613

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG ++P+ A
Sbjct  614   QKHPHWSPAAIKSALMTTSTTLDRAGDPLLAQQTSESEAMRLVKATPFDYGSGHVDPTAA  673

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ YI FLC  P +D   +R      C        S+LNTPS+TIS+LV 
Sbjct  674   LDPGLIFDAGYEDYIGFLCTTPSIDVHEIRNYTHTPC-NTSMGKPSNLNTPSITISHLVR  732

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++ V R VTNV   +E Y +  R    V + + P    I A  SR  ++ L     T  Y
Sbjct  733   TQVVTRTVTNV-AEEETYVITARMEPAVAIEVNPPAMTIKAGASRQFLVSLTVRSVTGRY  791

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+++ G R H VR+P
Sbjct  792   SFGEVLMKGSRGHKVRIP  809



>ref|XP_004966115.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=819

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/797 (46%), Positives = 482/797 (60%), Gaps = 32/797 (4%)
 Frame = +1

Query  112   IYMVLMEDHPFVSTR--IKG--------------TSGNVTMYKQRMTKQHDVFLGSLLRR  243
             +Y+V ME  P VS R  ++G              TS  VT Y   + + HD  L SL   
Sbjct  24    VYIVTMEGDPVVSYRGGVEGFPATAVDLDEEMDVTSETVTSYSLHLRRHHDNLLDSLFVE  83

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSY HL+NGFAVH+ S +A + L KA GV+ +  D+K++K+TTHTP FLG+P  
Sbjct  84    GTYEKLYSYHHLINGFAVHMSSLQA-EFLRKAPGVKHVERDMKIQKLTTHTPQFLGLPTG  142

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR-PRITRKFTGKCITGDNFP  600
             VWP  GG   +GE VVIG +D+GI P H SFSS +    G  PR    + GKC       
Sbjct  143   VWPTGGGFDRAGEDVVIGFVDSGIYPQHPSFSSHKTDPYGPVPR----YKGKCEMDPVTH  198

Query  601   ATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRF  780
              + CNGKIVGAQ+FA+AA+AAG FN    +ASP D DGHGSHTA+ AAGN   PV  +  
Sbjct  199   RSFCNGKIVGAQHFAKAAMAAGAFNPDIEFASPLDGDGHGSHTAAIAAGNNGIPVRMHGH  258

Query  781   NYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsgD  954
              +G ASGMAP A IAVYK LY  FGGY++DVVAA+DQAV+DGVDIL+LSV   S   +  
Sbjct  259   EFGKASGMAPRARIAVYKVLYRLFGGYVADVVAAIDQAVQDGVDILNLSVGPNSPPTATR  318

Query  955   SAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVL  1134
             + FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA   DRRY N + L
Sbjct  319   TTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAGVDDRRYKNHLTL  378

Query  1135  GNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLV  1314
             GNG+  SG G+SP T G   F L +A D     S+A   +   CQ         V+GK++
Sbjct  379   GNGKLLSGLGVSPATHGNKSFSLISAADALL-GSSATKYSALDCQRPELLNKRKVQGKIL  437

Query  1315  ICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNM  1494
             +C Y++++ S  ASI  V+ T    GA GF++ ++      +     V + IPG++I ++
Sbjct  438   LCGYSFNYISGTASIKKVSQTAKSLGATGFIVAVENSYPGTKFD--PVPVSIPGILITDV  495

Query  1495  EASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNAL  1674
               +T L  YYNS+T R  +GRA  F+ATA I DG         P VA +SSRGPDV +  
Sbjct  496   SKTTDLIDYYNSSTTRDWAGRATVFKATAGIADGLAPTLYNSAPQVALFSSRGPDVKDFS  555

Query  1675  LDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDR  1854
                ADVLKP+I+APG+ IWAAW+PN   +    G+ FA+VSGTSMA PHIAGIAALIK +
Sbjct  556   FQDADVLKPDILAPGNLIWAAWAPNGTDESNYAGEGFAMVSGTSMAAPHIAGIAALIKQK  615

Query  1855  HPNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRALN  2022
             +P W PSAI SA+MT+A+  D+      +          L+ ATPFD GSG +NP  AL+
Sbjct  616   NPKWSPSAIKSALMTTANTLDKGSHPLRAQQYTTSEMMTLSRATPFDCGSGAVNPKAALD  675

Query  2023  PGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-DLNTPSVTISNLVGS  2199
             PGLV +   + YI FLC++P V+   V  + G  C  + K     DLN PS+TIS L G+
Sbjct  676   PGLVLDATHEDYITFLCSIPDVNHSEVSNIAGASCNSSSKGQRPYDLNIPSITISQLRGT  735

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
              TV R VT+V    E Y ++ R P  + + + P    +    SR + + L A   T +YS
Sbjct  736   VTVKRTVTSVSEETETYTIMTRMPPEIALDVTPAALTVLPGASRDITVTLTARSVTGTYS  795

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ + GDR H+VR+P
Sbjct  796   FGEIRMKGDRGHLVRIP  812



>gb|AES92256.2| subtilisin-like serine protease [Medicago truncatula]
Length=818

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/798 (45%), Positives = 490/798 (61%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             + +IY+V +E  P +S                 +I  TS  VT Y + + K+HD+ LG L
Sbjct  22    KGEIYIVTVEGEPIISYTGGIDEFEATAVESDEKIDTTSELVTSYGRHLEKRHDMILGML  81

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
               +  Y KLYSY HL+NGFAVH+  ++A  + H A GV+ +  D K++++TTHTP FLG+
Sbjct  82    FEQGTYKKLYSYRHLINGFAVHISPEQAETLRH-APGVKSVARDWKVKRLTTHTPQFLGL  140

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG +D+GI P H SF++   +N        ++ GKC    +
Sbjct  141   PTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFAT---HNTEPYEPVPRYRGKCEVDPD  197

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                  CNGKIVGAQ+FA+AAIA+G FN S  +ASP D DGHGSHT S AAGN   PV  +
Sbjct  198   TKINFCNGKIVGAQHFAQAAIASGAFNPSIDFASPLDGDGHGSHTTSIAAGNNGIPVRMH  257

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-ps  948
                +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP+S   +
Sbjct  258   GHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVYDGVDILSLSVGPNSPPAA  317

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV V QAAGN GP  ++M+S+SPW+ SVAA+  DRRY N +
Sbjct  318   AKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTMVSYSPWIASVAAAIDDRRYKNHL  377

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG   +G GLSP T     + L AA DV   +S+    +   CQ        L+ G 
Sbjct  378   TLGNGNILAGIGLSPSTHLNRTYTLVAANDVLL-DSSVTKYSPTDCQRPELLNKKLIEGN  436

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    AS+  V++T    GAAGFVL ++ +I S   K   V + +PG++I 
Sbjct  437   ILLCGYSFNFVVGTASMKKVSETAKALGAAGFVLCVE-NI-SPGAKFDPVPVGLPGILIT  494

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN +T R  +GR  +F+   +I DG   I     P VA +S+RGP+V +
Sbjct  495   DVGNSKKLIDYYNISTPRDWTGRVKSFKGLGKIGDGLIPILHKSAPQVALFSARGPNVKD  554

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAWSPN   +    G+ FA+VSGTSM+ PHIAGIAALIK
Sbjct  555   FSFQEADLLKPDILAPGSLIWAAWSPNGTDEANFIGEGFAMVSGTSMSAPHIAGIAALIK  614

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP+W P+AI SA+MT++   DR      +   ++  + +   ATPFD+GSG ++P+ A
Sbjct  615   QKHPHWSPAAIKSALMTTSTTLDRAGNPLLAQQTSETEAIKFVKATPFDYGSGHVDPTAA  674

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ Y+ FLC  PG+D   +R    V C        S+LNTPS+TIS+LVG
Sbjct  675   LDPGLIFDAGYEDYLGFLCTTPGIDVHEIRNYTHVPC-NTSMGKPSNLNTPSITISHLVG  733

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++ V R VTNV   +E Y +  R    V + + P    I+   SR   + L +   T SY
Sbjct  734   TQVVHRTVTNV-AEEETYVITARMEPAVAIEVNPPAMTINGGTSRQFSVTLTSQSVTGSY  792

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+++ G R H VR+P
Sbjct  793   SFGEVLMKGSRGHKVRIP  810



>ref|XP_009359924.1| PREDICTED: subtilisin-like protease isoform X1 [Pyrus x bretschneideri]
Length=820

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/800 (44%), Positives = 485/800 (61%), Gaps = 31/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A +Y+V +E  P +S                 +I  TS +VT Y + +  +HD+ LG
Sbjct  22    IGKADVYIVTIEGEPIISYQGGVDGFEATAVESDEKIDTTSESVTSYARHLESKHDMLLG  81

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L    +Y KLYSY HL+NGFAVH+  ++A  ++H A GV+ +  D K++++TTHTP FL
Sbjct  82    MLFEEGSYQKLYSYQHLINGFAVHISHEQAETLMH-APGVKSVERDWKVKRLTTHTPQFL  140

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SF+SP   NI       K+ GKC   
Sbjct  141   GLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASP---NIDPYGPVPKYRGKCEVD  197

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +     CNGKI+GA +FA+AAIAAG FN S  + SP D DGHGSHTA+ AAGN   PV 
Sbjct  198   PDTKRNFCNGKIIGAHHFAKAAIAAGVFNPSVDFDSPMDGDGHGSHTAAIAAGNNGIPVR  257

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
                  +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S  
Sbjct  258   MRGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVYDGVDILSLSVGPNSPP  317

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + +LN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N
Sbjct  318   ATTKTTYLNPFDATLLSAVKAGVFVAQAAGNGGPFPKTLVSYSPWIASVAAAIDDRRYKN  377

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+  +G GLSP T     + L AA DV   +S     +   CQ       +LV+
Sbjct  378   HLTLGNGKLLAGLGLSPSTHPNQTYTLVAAKDVLLDSSVVKY-SPSDCQKPEVLNKNLVQ  436

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + +PG++
Sbjct  437   GNILLCGYSFNFVVGTASIKKVSETAKSLGAIGFVLVVENV--SPGTKFDPVPVGVPGIL  494

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++E S  L  YYN +T+R  +GR  +F+A   I +G   I     P VA +S+RGP++
Sbjct  495   ITDVERSMDLIDYYNISTVRDWTGRVKSFKAIGSIGNGLTPILHKSAPQVAIFSARGPNI  554

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL
Sbjct  555   KDFSFQEADLLKPDILAPGSLIWAAWSPNGTDEPDYVGEGFAMISGTSMAAPHIAGIAAL  614

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             IK +HP+W PSAI SA+MT++   DR      +   ++  + +   ATPFD+GSG ++P 
Sbjct  615   IKQKHPHWSPSAIKSALMTTSTTMDRAGRPLQAQQNSETQAIKFVSATPFDYGSGHVDPR  674

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+F+  +Q Y+ FLC  PG++   +++     C        S+ N+PS+T+++L
Sbjct  675   AALDPGLIFDAGYQDYLGFLCTTPGINSNEIKKYTNSPC-NYTMVRPSNFNSPSITVAHL  733

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             V S+TV R VTNV   +E Y +  R    V +   P+   +    SR   + L     T 
Sbjct  734   VKSQTVTRTVTNV-AQEETYVITTRMAPAVAIEASPRAMTLRPGASRKFSVTLTVRSVTG  792

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
             SYSFGE+++ G R H VR+P
Sbjct  793   SYSFGEVMMKGSRGHKVRIP  812



>ref|XP_002518424.1| subtilase, putative [Ricinus communis]
 gb|EEF43811.1| subtilase, putative [Ricinus communis]
Length=816

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/795 (45%), Positives = 475/795 (60%), Gaps = 24/795 (3%)
 Frame = +1

Query  103   EAKIYMVLME---------DHPFVSTRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYT  255
             E  IY+VLME           P+ + +++  S     + +R+   HD  L S L   +YT
Sbjct  24    ERSIYLVLMEGQPVAFLGGHEPYTTRKLELNSEASQAHARRLVDSHDQLLQSTLEIGSYT  83

Query  256   KLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPR  435
             KLYS+ H++NGFAVH    +A K L  A GV+ +  D   + MTT+TP FL +   VW +
Sbjct  84    KLYSFKHIVNGFAVHATHSQAKK-LKDAPGVKVVERDRGAKLMTTYTPQFLELSQGVWTQ  142

Query  436   LGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR--KFTGKCITGDNFPATA  609
              GG   +GEG+VIG IDTGINP H SF+    YN   P  +    F+G C TG  FPA +
Sbjct  143   EGGDRNAGEGIVIGFIDTGINPLHPSFA----YNPLNPFTSNISHFSGACETGPRFPAGS  198

Query  610   CNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYG  789
             CNGKIV A++F+  A A    N S  + SP+DA GHGSH ASTAAGN   PV+ N F YG
Sbjct  199   CNGKIVSARFFSAGAQAVSPLNTSLDFLSPYDAVGHGSHVASTAAGNARVPVVANGFYYG  258

Query  790   YASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLN  969
              ASGMAP A IAVYKA+Y   G ++DV+AA+DQA +DGVDI++LSVGP   P     FL+
Sbjct  259   RASGMAPRARIAVYKAIYPTVGTLTDVIAAIDQATKDGVDIITLSVGPDEPPEDTITFLS  318

Query  970   VLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQT  1149
             V +V +LFA RAGV VVQAAGN GPS  +++S+SPW   VAASTTDR Y  S++LGNGQ 
Sbjct  319   VFDVFMLFAQRAGVFVVQAAGNHGPSLSTVVSYSPWAVGVAASTTDRIYPASLLLGNGQK  378

Query  1150  FSGSGLSPPTAGKAFFQ--LAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGKLVI  1317
               G GLS PT G   F+  L  A D  + N T       +E CQ      P LVR ++VI
Sbjct  379   VGGVGLSGPTFGYGLFKYKLVFAQDAVKANGTFPRTPQYIEECQHPESLDPKLVRRRIVI  438

Query  1318  CTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNME  1497
             CT++  F +  +SI  + DT       GF L  +P  G        +   +PG++I  + 
Sbjct  439   CTFSAGFYNGTSSITAIIDTSRTLRFTGFALVANPSYG--DFIAEPIPFAVPGIMIPKVA  496

Query  1498  ASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALL  1677
              +  + +YY    LR   G    F A   I +GR A + G+ P+V+ +SSRGPD  +   
Sbjct  497   DAEIISKYYEQEILRDERGFVSKFCARGAIGEGRVAAFEGRAPIVSRFSSRGPDFLDINR  556

Query  1678  DTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRH  1857
               ADVLKP+I+APG  IWAAWSP S  D  + G +FAL+SGTSMATPHI GIAALIK  H
Sbjct  557   IPADVLKPDILAPGHQIWAAWSPLSALDPILTGDNFALLSGTSMATPHIVGIAALIKQFH  616

Query  1858  PNWKPSAITSAMMTSADVTDRl-gspllaqqasqqlapaTPFDFGSGFINPSRALNPGLV  2034
             P+W PS I SA+ T+A   D      L        L P+T FD G+GF+NP+RA++PGLV
Sbjct  617   PSWTPSMIASALSTTAGNYDNYGELILAEGFDINSLYPSTHFDLGAGFVNPTRAMDPGLV  676

Query  2035  FNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMR  2214
             F + FQ YI FLC++PG+D   V+   G  C ++     ++LN PSVTIS L GS+TV R
Sbjct  677   FPSEFQNYISFLCSLPGIDPAIVKATTGEPCNQSLS-SPANLNLPSVTISALRGSQTVER  735

Query  2215  RVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMI  2394
              V NVG   E Y   V  P G  V + P  F I+  G++++ I  + T A N +SFG+++
Sbjct  736   NVKNVGIKPETYLSSVIAPNGTTVNLSPTWFIIAPQGTQNIDIEFHVTHARNEFSFGQIV  795

Query  2395  LLGDRNHIVRVPFAV  2439
             L G  +HIVR+P ++
Sbjct  796   LTGSLDHIVRIPLSI  810



>emb|CDO98551.1| unnamed protein product [Coffea canephora]
Length=818

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/801 (45%), Positives = 483/801 (60%), Gaps = 35/801 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS------------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             +A+IYMV+ME  P +S                   +I  TS  VT Y   + K+HD+ LG
Sbjct  20    KAEIYMVMMEGEPVISYKGGVIGFEATAVDSDSDEKIDVTSEAVTSYAHHLEKRHDMLLG  79

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  R  Y K+YSY HL+NGFAVH+  ++A +IL +A GV+ +  D K+ ++TTHTP FL
Sbjct  80    MLFDRGTYKKVYSYRHLINGFAVHITPEQA-EILRQAPGVKSVERDWKVRRLTTHTPQFL  138

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +++G +D+GI+P H SFS+      G      K+ GKC   
Sbjct  139   GLPTGVWPTGGGFDRAGEDIILGFVDSGIHPNHPSFSTHNTEPYGP---VPKYRGKCEVN  195

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +     CNGKI+GAQ+FA AA AAG FN S  + SP D DGHGSHTA+ AAGN   PV 
Sbjct  196   PDTKRDFCNGKIIGAQHFAEAAKAAGAFNPSIDFDSPLDGDGHGSHTAAIAAGNNGIPVR  255

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              + F +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDIL+LSV   S  
Sbjct  256   MHGFEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILNLSVGPNSPP  315

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + FLN  +  LL A +AGV V QAAGN GP  +++LSFSPW+ SVAA+  DRRY N
Sbjct  316   ATTKTTFLNPFDATLLSAVKAGVFVAQAAGNGGPFPKTLLSFSPWIISVAAAVDDRRYKN  375

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+  +G GLSP T     + + AA DV   +S     +   CQ       +LV 
Sbjct  376   HLTLGNGKILAGLGLSPATLANRTYTMVAANDVLLDSSVVKY-SPSDCQRPEVLNKNLVE  434

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + IPG++
Sbjct  435   GNILLCGYSFNFVIGTASIKKVSETARSLGAIGFVLAVENV--SPGTKFDPVPVGIPGIL  492

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++  S  L  YYN +T R  +GR  +F+A   I DG   I     P VA +SSRGP++
Sbjct  493   IADVSKSLELIDYYNVSTPRDWTGRVKSFKAVGSIGDGLNPILHKSAPQVALFSSRGPNI  552

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +   + AD+LKP+I+APGS IWAAW+PN   +    G+ FA+VSGTSMA PHIAGIAAL
Sbjct  553   RDYSFEDADILKPDILAPGSLIWAAWAPNGTDEANYVGEEFAMVSGTSMAAPHIAGIAAL  612

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             +K +HP+W P+AI SA+MT++   DR      +   +   +     ATPFD+GSG +NP 
Sbjct  613   VKQKHPHWSPAAIKSALMTTSTTIDRAERPLQAQQYSGSETMTFVQATPFDYGSGHVNPR  672

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFW-CSDLNTPSVTISN  2187
              AL+PGLVF+  ++ Y+ FLC VPGVD   +R+     C  N      S+LN+PS+TIS+
Sbjct  673   AALDPGLVFDAGYEDYLGFLCTVPGVDANEIRKFSHSPC--NYTLGRPSNLNSPSITISH  730

Query  2188  LVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKAT  2367
             LVG++TV R VTNV   +E Y +  R    + +   P    +    S    + L     T
Sbjct  731   LVGTQTVTRTVTNV-AEEETYVITARMAPEIAIETSPPAMTLRPGASGKFTVTLTVRSVT  789

Query  2368  NSYSFGEMILLGDRNHIVRVP  2430
              SYSFGE++L G R H VRVP
Sbjct  790   GSYSFGEVLLKGSRRHKVRVP  810



>ref|XP_010244166.1| PREDICTED: subtilisin-like protease SBT3.5 [Nelumbo nucifera]
Length=826

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/804 (44%), Positives = 484/804 (60%), Gaps = 27/804 (3%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV-----------STRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSA  249
             E  IY+VLME  P               ++   S     + + +   HD  L + L   +
Sbjct  31    EPAIYLVLMEGDPVAFHQGSSPDHLHGKKLDPDSEAFKAHAKHLVDSHDQLLQATLEVGS  90

Query  250   YTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVW  429
             Y KLYS+ H++NGFAVH    +A K L    GV+ + +D   + MTT+TP+FL +P+ VW
Sbjct  91    YRKLYSFKHIVNGFAVHTSPSQAKK-LKMTPGVKLVEKDRGAQLMTTYTPEFLSLPERVW  149

Query  430   PRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR--KFTGKCITGDNFPA  603
              + GG   +GEG+VIG++DTGI+P H SF+    Y+   P  T+  +F G C TG +FP 
Sbjct  150   TQEGGERNAGEGIVIGVVDTGIDPTHPSFA----YDPLNPFTTKPSRFKGACETGPHFPE  205

Query  604   TACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFN  783
             +ACNGKI+ A+YF+  A      N S  + SP DA GHGSH AS AAGN+  PV+ N F 
Sbjct  206   SACNGKIISARYFSAGAQTTAPLNASIDFLSPTDAVGHGSHVASIAAGNFGVPVVVNGFF  265

Query  784   YGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAF  963
             YG ASGMAP A IAVYKA++   G ++DVV A+DQAV DGVD+L LSVGP   P     F
Sbjct  266   YGRASGMAPRARIAVYKAIFPSVGTLADVVCAIDQAVLDGVDVLVLSVGPDDPPEDTLTF  325

Query  964   LNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNG  1143
             LNV ++ +LFA RAGV VVQAAGN GPS  +++S+SPW   VAA TTDR +  ++VLG+G
Sbjct  326   LNVFDIFMLFARRAGVFVVQAAGNKGPSPSTVVSYSPWAMGVAACTTDRSFPGTLVLGDG  385

Query  1144  QTFSGSGLSPPTAGKAFF--QLAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGKL  1311
             +   G GLS P+ G   F  +L  A D  + N T  +    +E CQ    F  ++V+G++
Sbjct  386   RRIGGVGLSGPSFGGGIFLYKLVLAKDAMKANRTFPMTPEYIEECQHPEAFDRTVVQGRI  445

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             VICT++  F +  ++I  + DT    G AGFV   +PD G        +   +PG++I  
Sbjct  446   VICTFSAGFANATSTITAIIDTARVLGLAGFVFVANPDYG--DFVAQPLPFSVPGIVIPK  503

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  +  L  YY   T R + G    F   A I +GR A Y G+ P+V+ +SSRGPD+ + 
Sbjct  504   IADTQILLDYYQRTTKRDQCGLVTEFGGNAAIREGRIASYQGRAPIVSLFSSRGPDIVDK  563

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
               +  DVLKP+I+APG  +WAAWSP S  D  + G +FAL+SGTSM+TPH+ GIAALIK 
Sbjct  564   SGNLTDVLKPDILAPGDLVWAAWSPVSALDPILTGYNFALLSGTSMSTPHVGGIAALIKQ  623

Query  1852  RHPNWKPSAITSAMMTSADVTD-RlgspllaqqasqqlapaTPFDFGSGFINPSRALNPG  2028
              +P+W P  I SA+ T+A   D +    L        L P+TPFDFG G INP+RAL+PG
Sbjct  624   SNPSWTPDMIASAISTTASKNDNQGKPILAQGPDINGLYPSTPFDFGPGLINPARALDPG  683

Query  2029  LVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTV  2208
             LVF + F+ YI FLC++P +D  +V+   GV C  +     SDLN PS+TIS LV  ++V
Sbjct  684   LVFPSGFEDYIGFLCSLPNIDPATVKAATGVSC-NHSLAKPSDLNLPSITISALVRYQSV  742

Query  2209  MRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGE  2388
              R V NV    E Y   VR P GV V I P  F I+  G++ L I ++  +A  ++SFGE
Sbjct  743   QRSVKNVASKTETYLCSVRPPKGVLVHINPPLFTIAPQGTQDLEIGISVVQALKTFSFGE  802

Query  2389  MILLGDRNHIVRVPFAVY-VTASL  2457
             ++L G+ +HIVR+P +V+ V+ SL
Sbjct  803   IVLTGNLDHIVRIPLSVFPVSTSL  826



>ref|XP_002977363.1| hypothetical protein SELMODRAFT_107145 [Selaginella moellendorffii]
 gb|EFJ21367.1| hypothetical protein SELMODRAFT_107145 [Selaginella moellendorffii]
Length=842

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/800 (45%), Positives = 493/800 (62%), Gaps = 29/800 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV--------------STRIKGT-SGNVTMYKQRMTKQHDVFLGSLL  237
             E K+Y+V++   P V                RI    S     Y   +  +HD  L    
Sbjct  41    ERKVYLVVVRGRPVVHYQGGIPGFPATSSEQRINNALSDEDKNYASLLVARHDELLAKAF  100

Query  238   R-RSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
                 +Y KLYSY HL+NGFAV +   +A + L + + V  +  D +++ MTTHTP+++G+
Sbjct  101   PGEKSYRKLYSYHHLINGFAVELTETQAAR-LERMDDVVHVERDERVQTMTTHTPEYMGL  159

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P   WP+LGG + +G+GVVIG++DTGI+P H SF S             K+TGKC   D 
Sbjct  160   PGKCWPKLGGVANAGQGVVIGIVDTGIDPSHQSFKSSSSSTNSSSSSPGKYTGKCEVADE  219

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
             FP  +C+GKIVGA++FA+AAIA+G+FN S HYASP D DGHG+HTA+TAAGN    V+ N
Sbjct  220   FPQGSCSGKIVGARHFAQAAIASGEFNASVHYASPLDGDGHGTHTAATAAGNSGVSVVVN  279

Query  775   RFNYGYASGMAPGAGIAVYKALYSF-GGYMSdvvaavdqavedgvdIlslsvgpssvpsg  951
              FN+G +SGMAP A IAVYKALY + GG+ +DVVAA+DQAV DGVD+LSLSVGP+ +P  
Sbjct  280   GFNFGSSSGMAPAAKIAVYKALYRYIGGFFADVVAAIDQAVADGVDVLSLSVGPNGLPRR  339

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
             +  F++  ++ LL A +AGV V QA GN GP  R+ LSFSPW+ SVAA+T DR Y N+I 
Sbjct  340   NLTFMSTFDLALLSAVKAGVFVTQAVGNGGPYPRTSLSFSPWIFSVAAATHDRTYPNAIT  399

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LG+  T +G+GL+  T G   F L  A D    N     + V+ CQDA  +  SLV G++
Sbjct  400   LGSNITITGTGLASGTNGS--FSLITAADAT--NGNVSRIVVDECQDAGNYNRSLVSGRI  455

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C+Y+  +    +++A          A+G V    PD+       + +    P +II +
Sbjct  456   LVCSYSLRYLFGVSTLADAVAAAQELRASGLVFLATPDLDGHSFPPSPIGF--PAIIIPS  513

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
              + S  L  YYN++T R  SGR  +  A A I  GR A++S   P VA+YSSRGPDVN+ 
Sbjct  514   SKDSAVLLHYYNTSTRRDESGRLSSSAAMATIAGGREALFSFSAPKVATYSSRGPDVNSN  573

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
              LD ADVLKPNI+APG+ IWAAWS     ++  +GQ FAL+SGTSMATPHIAGIAAL+K 
Sbjct  574   NLDVADVLKPNILAPGNLIWAAWSSIGSDEREFEGQEFALISGTSMATPHIAGIAALVKQ  633

Query  1852  RHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlap----aTPFDFGSGFINPSRAL  2019
             R P+  P+ I SAM T+A   D  G PLLAQ  S  +      ATPFDFG+GF+NP+ A+
Sbjct  634   RFPSLSPAGIASAMSTTALTLDSNGQPLLAQHPSSNVDSILGPATPFDFGAGFVNPAAAI  693

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  FQ YIQFLC++P +   +V    G  C  +  F  SDLNTP V+I++L G+
Sbjct  694   DPGLIFDAGFQDYIQFLCSIPALSNSTVSAATGSSCFISSSF-ASDLNTPYVSIASLNGA  752

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             R+V+R  T+V   DE Y   +  P GV VT+ P +F +       L + L A   +++ S
Sbjct  753   RSVVRIATSVSERDEAYNATLVVPAGVSVTVKPSSFSVRGGQLVKLTLTLKALVTSSAPS  812

Query  2380  FGEMILLGDRNHIVRVPFAV  2439
             FGE++L GDR H + +P  V
Sbjct  813   FGELLLDGDRGHRLHLPICV  832



>ref|XP_002437534.1| hypothetical protein SORBIDRAFT_10g028870 [Sorghum bicolor]
 gb|EER88901.1| hypothetical protein SORBIDRAFT_10g028870 [Sorghum bicolor]
Length=820

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/796 (46%), Positives = 484/796 (61%), Gaps = 30/796 (4%)
 Frame = +1

Query  112   IYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSLLRR  243
             +Y+V ME  P VS R                +  TS  VT Y   +   HD  L SLL  
Sbjct  25    VYIVTMEGDPVVSYRGGVDGFPATAVDLDEEMDVTSEAVTSYALHLRGHHDKLLDSLLVE  84

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSY HL+NGFAVH+ S +A + L KA GV+ +  D+K++K+TTHTP FLG+P  
Sbjct  85    GTYEKLYSYHHLINGFAVHMSSLQA-EFLRKAPGVKHVERDMKVQKLTTHTPQFLGLPTG  143

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPA  603
             VWP  GG   +GE VVIG +D+GI P H SF++ +    G       + GKC        
Sbjct  144   VWPTGGGLDRAGEDVVIGFVDSGIYPEHPSFAAHKTDPYGP---IPHYKGKCEMDPVTQR  200

Query  604   TACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFN  783
             + CNGKIVGAQ+FA+AA+AAG FN    +ASP D DGHGSHTA+ AAGN   PV  +   
Sbjct  201   SFCNGKIVGAQHFAKAAMAAGAFNPDVEFASPLDGDGHGSHTAAIAAGNNGIPVRMHGHE  260

Query  784   YGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-psgDS  957
             +G ASGMAP A +AVYK LY  FGGY++DVVAA+DQAV+DGVDIL+LSVGP+S   +  +
Sbjct  261   FGKASGMAPRARVAVYKVLYRLFGGYVADVVAAIDQAVQDGVDILNLSVGPNSPPTATRT  320

Query  958   AFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLG  1137
              FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA   DRRY N + LG
Sbjct  321   TFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAGVDDRRYKNHLTLG  380

Query  1138  NGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVI  1317
             NG+  SG G+SP T G   F L +A D    +S+     ++ CQ         V+GK+++
Sbjct  381   NGKLISGLGVSPATHGNMSFSLISAADALLGSSSTKYSALD-CQRPELLNKRKVQGKILL  439

Query  1318  CTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNME  1497
             C Y++++ S  ASI  V+ T    GAAGF++ ++      +     V + IPG++I ++ 
Sbjct  440   CGYSFNYISGTASIKKVSQTARNLGAAGFIVAVENSYPGTKFD--PVPVSIPGILITDVS  497

Query  1498  ASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALL  1677
              +  L  YYNS+T+R  +GRA AF+ATA I DG         P VA +SSRGPDV +   
Sbjct  498   KTEDLIDYYNSSTIRDWAGRATAFKATAGIADGLAPTLYNSAPQVALFSSRGPDVKDFSF  557

Query  1678  DTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRH  1857
               ADVLKP+I+APG+ IWAAW+PN   +    G+ FA++SGTSMA PHIAGIAALIK ++
Sbjct  558   QDADVLKPDILAPGNLIWAAWAPNGTDESNYAGEGFAMISGTSMAAPHIAGIAALIKQKN  617

Query  1858  PNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRALNP  2025
             P W PSAI SA+MT+A+  D+      +          L+ ATPFD GSG +NP  AL+P
Sbjct  618   PKWSPSAIKSALMTTANTLDKGSHPLRAQQYTASEMMTLSRATPFDCGSGAVNPKAALDP  677

Query  2026  GLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-DLNTPSVTISNLVGSR  2202
             GLV +   + YI FLC++P V++  V  + G  C  N K     DLN PS+ IS L G+ 
Sbjct  678   GLVLDATHEDYITFLCSIPDVNQSEVSNIAGSACNSNSKGQRPFDLNIPSIAISQLRGTV  737

Query  2203  TVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSF  2382
             TV R VT+V    E Y ++ R P  V + + P    +    SR + + L A   T +YSF
Sbjct  738   TVKRTVTSVSDETETYTMMTRMPPEVALEVTPPAVTVLPGASREITVTLTARSVTGTYSF  797

Query  2383  GEMILLGDRNHIVRVP  2430
             GE+ + GDR H+VR+P
Sbjct  798   GEIAMKGDRGHLVRIP  813



>gb|KHN17628.1| Subtilisin-like protease [Glycine soja]
Length=817

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/798 (44%), Positives = 482/798 (60%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A++Y+V +E  P +S                  I  TS  VT Y + + K+HD+ LG L
Sbjct  21    DAEVYIVTVEGDPIISYTGGIDGFKATAVESDEEIDTTSELVTSYARHLEKKHDMLLGLL  80

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
                  Y KLYSY HL+NGFAVH+  ++A  + H A GV+ +  D K+ ++TTHTP FLG+
Sbjct  81    FEEGTYQKLYSYRHLINGFAVHISPEQAETLRH-APGVKSVERDWKVRRLTTHTPQFLGL  139

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG++DTGI P H SF++      G      K+ GKC     
Sbjct  140   PTGVWPTGGGFDRAGEDIVIGLVDTGIYPQHPSFATHNSEPYGP---VPKYRGKCEADPE  196

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                + CNGKIVGAQ+FA AAIAAG FN S  +ASP D DGHGSHTAS AAGN   PV  N
Sbjct  197   TKRSYCNGKIVGAQHFAHAAIAAGSFNPSIDFASPLDGDGHGSHTASIAAGNNGIPVRMN  256

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKA+Y  FGG+++DVVAA+DQAV DGVDIL+LSV   S   +
Sbjct  257   GHEFGRASGMAPRARIAVYKAIYRLFGGFVADVVAAIDQAVYDGVDILNLSVGPDSPPAA  316

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N +
Sbjct  317   TKTTFLNPFDATLLGAVKAGVFVAQAAGNHGPLPKTLVSYSPWIASVAAAIDDRRYKNHL  376

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
             +LGNG+T +G GLSP T     + L AA DV   +S+    +   CQ       +L++G 
Sbjct  377   ILGNGKTLAGIGLSPSTHLNETYTLVAANDVLL-DSSLMKYSPTDCQRPELLNKNLIKGN  435

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  V++T    GA GFVL ++ +I S   K   V + +PG++I 
Sbjct  436   ILLCGYSFNFVVGTASIKKVSETAKALGAVGFVLCVE-NI-SLGTKFNPVPVGLPGILII  493

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN  T R  +GR  +F    +I DG   I     P VA +S+RGP++ +
Sbjct  494   DVSNSKELIDYYNITTPRDWTGRVKSFEGKGKIGDGLMPILHKSAPQVALFSARGPNIKD  553

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAW PN   +    G+ FA++SGTSMA PHIAGIAALIK
Sbjct  554   FSFQEADLLKPDILAPGSLIWAAWCPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAALIK  613

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG ++P+ A
Sbjct  614   QKHPHWSPAAIKSALMTTSTTLDRAGDPLLAQQTSESEAMRLVKATPFDYGSGHVDPTAA  673

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ YI FLC  P +D   +R      C        S+LNTPS+TIS+LV 
Sbjct  674   LDPGLIFDAGYEDYIGFLCTTPSIDVHEIRNYTHTPC-NTSMGKPSNLNTPSITISHLVR  732

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++ V R VTNV   +E Y +  R    V + + P    I A  S   ++ L     T  Y
Sbjct  733   TQVVTRTVTNV-AEEETYVITARMEPAVAIEVNPPAMTIKAGASHQFLVSLTVRSVTGRY  791

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+++ G R H VR+P
Sbjct  792   SFGEVLMKGSRGHKVRIP  809



>ref|XP_008681561.1| PREDICTED: uncharacterized protein LOC100274487 isoform X1 [Zea 
mays]
 gb|AFW69324.1| putative subtilase family protein [Zea mays]
Length=821

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/797 (46%), Positives = 484/797 (61%), Gaps = 32/797 (4%)
 Frame = +1

Query  112   IYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSLLRR  243
             +Y+V+ME  P VS R                +  TS  VT Y   +   HD  L S L  
Sbjct  26    VYIVVMEGDPVVSYRGGVDGFPATAVDLDEEMDVTSEAVTSYALHLRGHHDKLLDSHLVE  85

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSY HL+NGFAVH+ S +A + L KA GV+ +  D+K++K+TTHTP FLG+P  
Sbjct  86    GTYEKLYSYHHLINGFAVHMSSLQA-EFLRKAPGVKHVERDMKVQKLTTHTPQFLGLPTG  144

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR-PRITRKFTGKCITGDNFP  600
             VWP  GG   +GE VVIG +D+GI P H SF++ +    G  PR   K     +T  +F 
Sbjct  145   VWPTGGGLDRAGEDVVIGFVDSGIYPQHPSFAAHKTDRYGPVPRYKGKCEKDLVTQRSF-  203

Query  601   ATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRF  780
                CNGKIVGAQ+FA+AA+AAG FN    +ASP D DGHGSHTA+ AAGN   PV  +  
Sbjct  204   ---CNGKIVGAQHFAKAAMAAGAFNPDVEFASPLDGDGHGSHTAAIAAGNNGIPVRMHGH  260

Query  781   NYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-psgD  954
              +G ASGMAP A +AVYK LY  FGGY++DVVAA+DQAV+DGVDIL+LSVGP+S   +  
Sbjct  261   EFGKASGMAPRARVAVYKVLYRLFGGYVADVVAAIDQAVQDGVDILNLSVGPNSPPTATR  320

Query  955   SAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVL  1134
             + FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA   DRRY N + L
Sbjct  321   TTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAGVDDRRYKNHLTL  380

Query  1135  GNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLV  1314
             GNG+  SG G+SP T G   F L +A D     S+A   +   CQ         V+GK++
Sbjct  381   GNGKLISGLGVSPATHGNMSFSLISAADALL-GSSASKYSALDCQRPELLNKRKVQGKIL  439

Query  1315  ICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNM  1494
             +C Y++++ S  ASI  V+ T    GAAGFV+ ++      +     V + IPG++I ++
Sbjct  440   LCGYSFNYISGTASIKKVSQTARSLGAAGFVVAVENSYPGTKFD--PVPVSIPGILITDV  497

Query  1495  EASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNAL  1674
               +  L  YYNS+T+R  +GRA AF+ATA I DG         P VA +SSRGPDV +  
Sbjct  498   SKTEDLIDYYNSSTVRDWAGRATAFKATAGIADGLAPTLYNSAPQVALFSSRGPDVKDFS  557

Query  1675  LDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDR  1854
                ADVLKP+I+APG+ IWAAW+PN   +    G+ FA+VSGTSMA PHIAGIAALIK +
Sbjct  558   FQDADVLKPDILAPGNLIWAAWAPNGTDESNYAGEGFAMVSGTSMAAPHIAGIAALIKQK  617

Query  1855  HPNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRALN  2022
             +P W PSAI SA+MT+A+  D+      +          L+ ATPFD GSG +NP  AL+
Sbjct  618   NPKWSPSAIKSALMTTANTLDKGSHPLRAQQYTASEMMTLSRATPFDCGSGAVNPKGALD  677

Query  2023  PGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-DLNTPSVTISNLVGS  2199
             PGLV +   + YI FLC++P V++  V  + G  C  N K     DLN PS+ +S L G+
Sbjct  678   PGLVLDASHEDYITFLCSIPDVNQSEVSNIAGSACNSNSKGQRPFDLNIPSIAVSQLRGT  737

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
               V R VT+V    E Y ++ R P  V + + P    +    SR + + L A   T +YS
Sbjct  738   VVVKRTVTSVSDETETYTIMTRMPPEVALEVTPPAVTVVPGASREITVTLTARSVTGTYS  797

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ + GDR H+VR+P
Sbjct  798   FGEIAMKGDRGHLVRIP  814



>gb|AES65305.2| subtilisin-like serine protease [Medicago truncatula]
Length=818

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/799 (44%), Positives = 491/799 (61%), Gaps = 33/799 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             EA++Y+V +E  P +S                 +I  +S  VT Y + + K+HD+ LG L
Sbjct  22    EAEVYIVTVEGEPIISYTGGIDGFEATAVESDEKIDTSSELVTSYARHLEKRHDMLLGML  81

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
                  YTKLYSY HL+NGFAVH+ S + ++ L  A GV+ +  D K+ ++TTHTP FLG+
Sbjct  82    FESGTYTKLYSYRHLINGFAVHL-SPEQVETLRHAPGVKSVERDWKVRRLTTHTPQFLGL  140

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P +VWP  GG   +GE +VIG +D+GI+P H SF++      G      K+ GKC     
Sbjct  141   PTSVWPTGGGCDRAGEDIVIGFVDSGIDPHHPSFTTHNTEPYGP---LAKYRGKCEVDPK  197

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                + CNGKI+GAQ+FA+AAIA+G+FN S  +ASP D DGHGSHTAS AAG    PV   
Sbjct  198   TKKSFCNGKIIGAQHFAQAAIASGNFNPSIDFASPLDGDGHGSHTASIAAGRNGIPVRLY  257

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-ps  948
                +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP+    +
Sbjct  258   GHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAALDQAVHDGVDILSLSVGPNGPPAA  317

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV V QAAGN GP  +S++S+SPW+ SVAA+  DRRY N +
Sbjct  318   TKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKSLVSYSPWIVSVAAAIDDRRYKNHL  377

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+  +G GLSP T     F L AA DV   +S+    +   CQ       +L++GK
Sbjct  378   TLGNGKILAGLGLSPSTHLNGTFTLVAANDVLL-DSSVMKYSPTDCQRPEVLNKNLIKGK  436

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+Y+F    AS+  V++T    GA GFVL ++    S   K   V + +PG++I 
Sbjct  437   ILLCGYSYNFVVGTASMKKVSETAKALGAVGFVLCVENV--SPGTKFDPVPVGLPGVLIT  494

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN +T R  +GR  +F+ T +I DG + I     P VA +S+RGP++ +
Sbjct  495   DVRKSKELIDYYNISTTRDWTGRVKSFKGTGKIGDGLKPILYKSAPQVALFSARGPNIRD  554

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IW AWS N   +    G+ FA+VSGTSMA PHIAGIAALIK
Sbjct  555   FSFQEADLLKPDILAPGSLIWGAWSRNGTDEPNYDGEGFAMVSGTSMAAPHIAGIAALIK  614

Query  1849  DRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP W P+AI SA++T+    DR    + S   ++  + +L  ATPFD+G+G +NP  A
Sbjct  615   QKHPRWSPAAIKSALLTTTTTLDRGGNPILSQQYSETEAMKLVKATPFDYGNGHVNPRAA  674

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-DLNTPSVTISNLV  2193
             L+PGL+F+  ++ Y+ FLC  PG+D   +++     C  N+      +LNTPS+T+S+LV
Sbjct  675   LDPGLIFDAGYKDYLGFLCTTPGIDVHEIKKYTNSPC--NRTMGHPYNLNTPSITVSHLV  732

Query  2194  GSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNS  2373
              ++T+ R+VTNV   +E Y +  R    V + I P    I A  SR   + L     T +
Sbjct  733   RTQTITRKVTNV-AKEETYVLTARMQPAVAIEITPPAMTIRAGASRRFTVTLTVRSVTGT  791

Query  2374  YSFGEMILLGDRNHIVRVP  2430
             YSFGE+++ G R H VR+P
Sbjct  792   YSFGEVLMKGSRGHKVRIP  810



>ref|XP_003610059.1| Subtilisin-like serine protease [Medicago truncatula]
Length=823

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/802 (44%), Positives = 489/802 (61%), Gaps = 34/802 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             + +IY+V +E  P +S                 +I  TS  VT Y + + K+HD+ LG L
Sbjct  22    KGEIYIVTVEGEPIISYTGGIDEFEATAVESDEKIDTTSELVTSYGRHLEKRHDMILGML  81

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKA----LKILHKAEGVRGIYEDIKMEKMTTHTPD  402
               +  Y KLYSY HL+NGFAVH+  ++      + L  A GV+ +  D K++++TTHTP 
Sbjct  82    FEQGTYKKLYSYRHLINGFAVHISPEQVKFSVAETLRHAPGVKSVARDWKVKRLTTHTPQ  141

Query  403   FLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCI  582
             FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++   +N        ++ GKC 
Sbjct  142   FLGLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFAT---HNTEPYEPVPRYRGKCE  198

Query  583   TGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTP  762
                +     CNGKIVGAQ+FA+AAIA+G FN S  +ASP D DGHGSHT S AAGN   P
Sbjct  199   VDPDTKINFCNGKIVGAQHFAQAAIASGAFNPSIDFASPLDGDGHGSHTTSIAAGNNGIP  258

Query  763   VITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpss  939
             V  +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP+S
Sbjct  259   VRMHGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVYDGVDILSLSVGPNS  318

Query  940   v-psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRY  1116
                +  + FLN  +  LL A +AGV V QAAGN GP  ++M+S+SPW+ SVAA+  DRRY
Sbjct  319   PPAAAKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTMVSYSPWIASVAAAIDDRRY  378

Query  1117  TNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSL  1296
              N + LGNG   +G GLSP T     + L AA DV   +S+    +   CQ        L
Sbjct  379   KNHLTLGNGNILAGIGLSPSTHLNRTYTLVAANDVLL-DSSVTKYSPTDCQRPELLNKKL  437

Query  1297  VRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPG  1476
             + G +++C Y+++F    AS+  V++T    GAAGFVL ++ +I S   K   V + +PG
Sbjct  438   IEGNILLCGYSFNFVVGTASMKKVSETAKALGAAGFVLCVE-NI-SPGAKFDPVPVGLPG  495

Query  1477  LIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGP  1656
             ++I ++  S  L  YYN +T R  +GR  +F+   +I DG   I     P VA +S+RGP
Sbjct  496   ILITDVGNSKKLIDYYNISTPRDWTGRVKSFKGLGKIGDGLIPILHKSAPQVALFSARGP  555

Query  1657  DVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIA  1836
             +V +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA+VSGTSM+ PHIAGIA
Sbjct  556   NVKDFSFQEADLLKPDILAPGSLIWAAWSPNGTDEANFIGEGFAMVSGTSMSAPHIAGIA  615

Query  1837  ALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFIN  2004
             ALIK +HP+W P+AI SA+MT++   DR      +   ++  + +   ATPFD+GSG ++
Sbjct  616   ALIKQKHPHWSPAAIKSALMTTSTTLDRAGNPLLAQQTSETEAIKFVKATPFDYGSGHVD  675

Query  2005  PSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTIS  2184
             P+ AL+PGL+F+  ++ Y+ FLC  PG+D   +R    V C        S+LNTPS+TIS
Sbjct  676   PTAALDPGLIFDAGYEDYLGFLCTTPGIDVHEIRNYTHVPC-NTSMGKPSNLNTPSITIS  734

Query  2185  NLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKA  2364
             +LVG++ V R VTNV   +E Y +  R    V + + P    I+   SR   + L +   
Sbjct  735   HLVGTQVVHRTVTNV-AEEETYVITARMEPAVAIEVNPPAMTINGGTSRQFSVTLTSQSV  793

Query  2365  TNSYSFGEMILLGDRNHIVRVP  2430
             T SYSFGE+++ G R H VR+P
Sbjct  794   TGSYSFGEVLMKGSRGHKVRIP  815



>ref|XP_003610476.1| Serine protease aprX [Medicago truncatula]
 ref|XP_003619266.1| Serine protease aprX [Medicago truncatula]
 gb|AES92673.1| subtilisin-like serine protease [Medicago truncatula]
Length=820

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/795 (44%), Positives = 485/795 (61%), Gaps = 27/795 (3%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV---------STRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYT  255
             E  IY+VL+E              S++I    G    +++ +   HD+ L S L   +Y 
Sbjct  31    ERSIYLVLLEGEAVAFHGASQNEDSSKIHLIRGASKAHEKYLLASHDMLLQSTLENGSYN  90

Query  256   KLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPR  435
             KL+SY H++NGF+VH    +A K L    GV+ + +D  ++ MTT+TPDFL +P  +W +
Sbjct  91    KLHSYKHIINGFSVHTTPSQA-KRLRATPGVKLVEKDRGVKLMTTYTPDFLNLPKGLWAQ  149

Query  436   LGGPSVSGEGVVIGMIDTGINPFHASFS-SPEEYNIGRPRITRKFTGKCITGDNFPATAC  612
             +GG   +G+G+VIG++D+GINP H SF+  P   NI        F+G C TG +FP  +C
Sbjct  150   VGGDKNAGDGIVIGIVDSGINPIHPSFAYQPFTSNISH------FSGACETGPHFPPGSC  203

Query  613   NGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGY  792
             NGKI+ A+YF+  A A+  F+ S  + SPFDA GHGSH AS AAGN   PV+ N F YG 
Sbjct  204   NGKIISAKYFSAGAQASPTFDASVDFLSPFDAGGHGSHVASIAAGNAGVPVVVNGFFYGQ  263

Query  793   ASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNV  972
             ASGMAP A IAVYKA+Y  GG M+D VAA++QAV+DGVDI+SLS+GP+        FLN+
Sbjct  264   ASGMAPRARIAVYKAIYPSGGTMADAVAAIEQAVQDGVDIISLSIGPNEPTKDTLTFLNI  323

Query  973   LEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTF  1152
              ++ LLFA +AGVLVVQAAGN+GPSS +++SFSPW   VAA  TDR Y +SI+L NG   
Sbjct  324   FDITLLFARKAGVLVVQAAGNNGPSSSTVVSFSPWSVGVAACNTDRHYYSSILLRNGTIV  383

Query  1153  SGSGLSPPT--AGKAFFQLAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGKLVIC  1320
              G GL+ P+   GK +  L  A D  + N T       +E CQ      PS V G ++IC
Sbjct  384   GGVGLTGPSFGNGKVYHTLVLAKDAVKINGTFPRTPEYLEECQHPEALDPSKVFGSIIIC  443

Query  1321  TYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEA  1500
             T++  F ++ +++A + DT       GF+ T +P  G        +   IPG++I ++  
Sbjct  444   TFSEGFLNQTSTLAAIIDTAKALKFEGFIFTANPSYG--DYIAEPIPFGIPGILIPSVAD  501

Query  1501  STALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLD  1680
             S  + QYY  +T R   G    F A A   +GR A + G+ PVV+ +SSRGPD+ ++   
Sbjct  502   SKVIMQYYEEHTKRDERGTVTEFGAAASTGEGRDASFKGRSPVVSRFSSRGPDIIDSKRT  561

Query  1681  TADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHP  1860
              ADVLKP+I+APG  IWAAWSP S     + G +FAL+SGTSMA PH+AGIAALIK  +P
Sbjct  562   LADVLKPDILAPGHQIWAAWSPISAKQPMLTGHNFALLSGTSMAAPHVAGIAALIKQHNP  621

Query  1861  NWKPSAITSAMMTSADVTDRl-gspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVF  2037
             +W PS I SA+ T++   D+L    +     +  L P+TPF+ G+G ++PSR  NPGLV 
Sbjct  622   SWTPSMIASAITTTSRKYDKLGDPLMAEGYEANTLHPSTPFEHGAGIVDPSRVNNPGLVL  681

Query  2038  NTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF-WCSDLNTPSVTISNLVGSRTVMR  2214
             ++ ++ +I FLC++P +D K++ R  G  C  N  F + S+LN PSVTIS L GS  + R
Sbjct  682   SSDYEDFISFLCSLPNIDTKTITRATGETC--NSPFDYPSNLNLPSVTISALKGSIYLKR  739

Query  2215  RVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMI  2394
              V NVG + E Y   VR P    V + P  F I+  G++ L I +N T+ +  +SFGE++
Sbjct  740   TVMNVGNSTETYLCGVRAPNRTAVNLYPTFFTITPQGTQDLEIQINVTQPSEDFSFGEIV  799

Query  2395  LLGDRNHIVRVPFAV  2439
             L G  NHIVR+  +V
Sbjct  800   LAGSMNHIVRITLSV  814



>ref|XP_006409082.1| hypothetical protein EUTSA_v10022560mg [Eutrema salsugineum]
 gb|ESQ50535.1| hypothetical protein EUTSA_v10022560mg [Eutrema salsugineum]
Length=815

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/797 (44%), Positives = 477/797 (60%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A++Y+V ME  P +S                 +I  +S  VT+Y + + ++HD+ LG L 
Sbjct  19    AEVYIVTMEGDPIISYKGGENGFEATAVESDEKIDTSSELVTLYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  ++A + L +A GV+ + +D K+ ++TTHTP+FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPEQA-ETLRRAPGVKSVNKDWKVRRLTTHTPEFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LPHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN   P+  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIPLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     + L +A DV   +S+        CQ        LV+GK+
Sbjct  375   LGNGKMLAGMGLSPSTRPHKLYTLVSANDVLL-DSSVSKYNPSDCQRPEVLNKKLVQGKI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V +T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVETAKHLGAAGFVLVVENV--SPGTKFDPVPSAIPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +TLR  +GR  +F+A   I DG   +     P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNVSTLRDWTGRVKSFKAEGSIGDGLTPVLHKSAPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA PHIAG+AAL+K 
Sbjct  552   SFQDADLLKPDILAPGYLIWAAWCPNGTDEPNYVGEGFALISGTSMAAPHIAGLAALVKQ  611

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   +   +     ATPFD+GSG +NPS AL
Sbjct  612   KHPQWSPAAIKSALMTTSTVIDRAGRPLQAQQYSDTETVTFVKATPFDYGSGHVNPSAAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+D   +R      C  + K   S+ N PS+ IS+LVG+
Sbjct  672   DPGLIFDAGYEDYLGFLCTTPGIDAHEIRNYTNTPCNYDMKH-PSNFNAPSIAISHLVGT  730

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNVG  +E Y +  R      + + P    +    SR   + L     +  YS
Sbjct  731   QTVTRRVTNVGEVEETYTITARMQPSTAIEVNPPAMTLRPGASRSFSVTLTVRSVSGVYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H VR+P
Sbjct  791   FGEVKLKGSRGHKVRIP  807



>ref|NP_001058476.1| Os06g0700000 [Oryza sativa Japonica Group]
 dbj|BAD54004.1| putative meiotic serine proteinase [Oryza sativa Japonica Group]
 dbj|BAF20390.1| Os06g0700000 [Oryza sativa Japonica Group]
 gb|EEE66299.1| hypothetical protein OsJ_22526 [Oryza sativa Japonica Group]
Length=820

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/797 (45%), Positives = 481/797 (60%), Gaps = 31/797 (4%)
 Frame = +1

Query  112   IYMVLMEDHPFVSTR--IKG--------------TSGNVTMYKQRMTKQHDVFLGSLLRR  243
             +Y+V ME  P VS R  ++G              TS  VT Y   + + HD  L SLL  
Sbjct  24    VYIVTMEGEPVVSYRGGVEGFPATAIDLDEDMEITSEAVTSYSLHLRRYHDKLLDSLLVE  83

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSY HL+NGFAVH+   +A + L KA GV+ +  D+K++K+TTHTP FLG+P  
Sbjct  84    GTYEKLYSYHHLINGFAVHMSPLQA-EFLRKAPGVKHVERDMKIQKLTTHTPQFLGLPTG  142

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPA  603
             VWP  GG   +GE VVIG +D+GI P H SFS+ +    G       + GKC        
Sbjct  143   VWPTGGGFDRAGEDVVIGFVDSGIYPQHPSFSAHKTDPYGP---VPHYKGKCEMDPVTRR  199

Query  604   TACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFN  783
             + CNGKIVGAQ+FA+AAIAAG FN    +ASP D DGHGSHTA+ AAGN   PV  +   
Sbjct  200   SFCNGKIVGAQHFAKAAIAAGAFNPDVDFASPLDGDGHGSHTAAIAAGNNGIPVRMHGHE  259

Query  784   YGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsgDS  957
             +G ASGMAP A IAVYK LY  FGGY+SDVVAA+DQAV+DGVDIL+LSV   S   +  +
Sbjct  260   FGKASGMAPRARIAVYKVLYRLFGGYVSDVVAAIDQAVQDGVDILNLSVGPNSPPTATRT  319

Query  958   AFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLG  1137
              FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA   DRRY N +VLG
Sbjct  320   TFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAGVDDRRYKNHLVLG  379

Query  1138  NGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVI  1317
             NG+   G G+SP T     F L +A D     S+A   +   CQ         ++GK+++
Sbjct  380   NGKLLPGLGVSPATHENKSFSLISAADALL-GSSATKYSALDCQRPELLNKRKIQGKILL  438

Query  1318  CTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNME  1497
             C Y++++ S  ASI  V++T    GAAGF++ ++      +     V + +PG++I ++ 
Sbjct  439   CGYSFNYISGTASIKKVSETARSLGAAGFIVAVENSYPGTKFD--PVPVSMPGILITDVS  496

Query  1498  ASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALL  1677
              +  L  YYNS+T+R  +GRA  F+ATA I DG         P VA +SSRGPDV +   
Sbjct  497   RTKDLIDYYNSSTIRDWAGRATTFQATAAIADGLAPTLYNSAPQVALFSSRGPDVKDFSF  556

Query  1678  DTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRH  1857
               ADVLKP+I+APG+ IWAAW+PN   +    G+ FA+VSGTSMA PHIAGIAALIK ++
Sbjct  557   QDADVLKPDILAPGNLIWAAWAPNGTDEANYAGEGFAMVSGTSMAAPHIAGIAALIKQKN  616

Query  1858  PNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRALNP  2025
             P W PSAI SA+MT+++  D+      +   +      L  ATPFD+GSG +NP  AL+P
Sbjct  617   PKWSPSAIKSALMTTSNTLDKGSHPLRAQQYSTSEIMTLTRATPFDYGSGAVNPKAALDP  676

Query  2026  GLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS--DLNTPSVTISNLVGS  2199
             GLV +   Q YI FLC++P V+   V  + G  C  + K      DLN PS+TIS L G+
Sbjct  677   GLVLDATHQDYITFLCSIPDVEHSEVSNITGSTCSSSSKVQQRPYDLNIPSITISQLRGT  736

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV R VT+V    E Y ++ R    + + + P    +    SR +   L A   T +YS
Sbjct  737   QTVKRTVTSVAAEAETYTIMTRMSPEIALEVSPPALTVLPGASREITATLTARSVTGTYS  796

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ + GDR H+VR+P
Sbjct  797   FGEITMKGDRGHLVRIP  813



>ref|XP_009617960.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 ref|XP_009617961.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=817

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/800 (45%), Positives = 477/800 (60%), Gaps = 31/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A+IY+V +E  P +S                 +I  TS  VT Y Q + K+HD+ L 
Sbjct  19    VGKAEIYIVTVEGEPVISYKGDIDGFEATASESDEKIDTTSELVTSYAQHLEKKHDMLLA  78

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L     Y K+YSY HL+NGFA H+  ++A +IL +A GV+ +  D K+ ++TTHTP FL
Sbjct  79    LLFDHGTYKKIYSYHHLINGFAAHISHEQA-EILRRAPGVKSVERDWKVRRLTTHTPQFL  137

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SFSS      G      K+ GKC   
Sbjct  138   GLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFSSHNAEPYGP---LPKYRGKCEVD  194

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              N     CNGKI+GAQ+FA AA AAG FN +  Y SP D DGHGSHTA+ AAGN   PV 
Sbjct  195   PNTKKDYCNGKIIGAQHFAEAAKAAGAFNPTMDYDSPLDGDGHGSHTAAIAAGNNGIPVR  254

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              + F +G ASGMAP A IAVYKALY  FGG+++DVVAA++QAV DGVDIL+LSV   S  
Sbjct  255   MHGFEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIEQAVRDGVDILNLSVGPNSPP  314

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + FLN  +  LL A +AGV V QAAGN GP  +++LS+SPW+ SVAA+  DRRY N
Sbjct  315   ATTKTTFLNPFDATLLSAVKAGVFVAQAAGNGGPFPKTLLSYSPWIVSVAAAVDDRRYKN  374

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+   G GLSP T     F + AA DV   +S+    +   CQ       +LV 
Sbjct  375   YLTLGNGKILPGIGLSPSTHPNRTFTMVAANDVLL-DSSVTKYSPADCQRPEVLNKNLVE  433

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F    ASI  VA+T    GAAGFVL ++    S   K   V + IPG++
Sbjct  434   GNILLCGYSFNFVVGTASIKKVAETAKALGAAGFVLAVEN--ASPGTKFDPVPVSIPGIL  491

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I +   S  L  YYN  T R  +GR  +F++T  I +G R I     P VA +S+RGP++
Sbjct  492   ITDASKSMELVDYYNITTSRDWTGRVKSFKSTGSIGNGLRPILHKSAPQVAIFSARGPNI  551

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAW+PN   +    G+ FAL+SGTSMA PHIAGIAAL
Sbjct  552   KDYSFQDADLLKPDILAPGSLIWAAWAPNGTDEANFCGEGFALISGTSMAAPHIAGIAAL  611

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             IK  HP+W P+AI SA+MT++   DR      +   +   S  L PATPFD+GSG +NP 
Sbjct  612   IKQHHPHWNPAAIKSALMTTSSTIDRAERPLQAQQYSGSESLTLVPATPFDYGSGHVNPR  671

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+FN  +Q Y+ FLC VPG+D   ++      C        S+ N+PS+ +S+L
Sbjct  672   AALDPGLIFNAGYQDYLGFLCTVPGIDPHEIKNFTHSPCNYTLGH-PSNFNSPSIAVSHL  730

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             VG+RTV R V NV   +E Y +  R    + +   P    +    SR   + L     T 
Sbjct  731   VGTRTVTRTVINV-AEEETYVITARMAPEIAIETNPPAMTLRHGASRKFTVTLTVRSVTG  789

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
             +YSFGE++L G R H VR+P
Sbjct  790   AYSFGEVLLKGSRGHKVRIP  809



>ref|XP_008362983.1| PREDICTED: subtilisin-like protease isoform X1 [Malus domestica]
 ref|XP_008362984.1| PREDICTED: subtilisin-like protease isoform X1 [Malus domestica]
 ref|XP_008362985.1| PREDICTED: subtilisin-like protease isoform X1 [Malus domestica]
Length=817

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/799 (43%), Positives = 485/799 (61%), Gaps = 31/799 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A +Y+V +E  P +S                 +I  TS +VT Y + +  +HD+ LG
Sbjct  19    IGKADVYIVTIEGEPIISYQGGVDGFEATAVESDEKIDTTSESVTSYARHLESKHDMLLG  78

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L    +Y KLYSY HL+NGFAVH+  ++A + L +A GV+ +  D K++++TTHTP FL
Sbjct  79    MLFEEGSYQKLYSYQHLINGFAVHISHEQA-ETLMRAPGVKSVERDWKVKRLTTHTPQFL  137

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SF+SP   NI       K+ GKC   
Sbjct  138   GLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASP---NIDPYGPVPKYRGKCEVD  194

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +     CNGKI+GA +FA+AAIAAG FN S  + SP D DGHGSHTA+ AAGN   PV 
Sbjct  195   PDTKRNFCNGKIIGAHHFAKAAIAAGVFNPSIDFDSPMDGDGHGSHTAAIAAGNNGIPVR  254

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
                  +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S  
Sbjct  255   MRGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVYDGVDILSLSVGPNSPP  314

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + +LN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N
Sbjct  315   ATTKTTYLNPFDATLLSAVKAGVFVAQAAGNGGPFPKTLVSYSPWIASVAAAIDDRRYKN  374

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+  +G GLSP T     + L AA DV   +S     +   CQ       +LV+
Sbjct  375   HLTLGNGKLLAGLGLSPSTHPNQTYTLVAANDVLLDSSVVKY-SPSDCQKPEVLNKNLVQ  433

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + +PG++
Sbjct  434   GNILLCGYSFNFVVGTASIKKVSETAKSLGAIGFVLVVENV--SPGTKFDPVPVGVPGIL  491

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++E S  L +YYN +T+R  +GR  +F+A   I +G   I     P VA +S+RGP++
Sbjct  492   ITDVEKSMDLIEYYNISTVRDWTGRVKSFKAIGSIGNGLTPILHKSAPQVAIFSARGPNI  551

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL
Sbjct  552   KDFSYQEADLLKPDILAPGSLIWAAWSPNGTDEPDYVGEGFAMISGTSMAAPHIAGIAAL  611

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             IK +HP+W P+AI SA+MT++   DR      +   ++  + +   A PFD+GSG ++P 
Sbjct  612   IKQKHPHWSPAAIKSALMTTSTTMDRAGRPLQAQQYSETQAIKFVSANPFDYGSGHVDPR  671

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+F+  +Q Y+ FLC  PG++   +++     C        S+ N+PS+T+++L
Sbjct  672   AALDPGLIFDAGYQDYLGFLCTTPGINSNEIKKYTNSPCNYTMGH-PSNFNSPSITVAHL  730

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             V S+TV R VTNV   +E Y +  R    V +   P+   +    SR   ++L     T 
Sbjct  731   VKSQTVTRTVTNV-AQEETYVITTRMAPAVAIEASPRAMTLRPGASRKFSVILTVRSVTG  789

Query  2371  SYSFGEMILLGDRNHIVRV  2427
             SYSFGE+++ G R H VR+
Sbjct  790   SYSFGEVMMKGSRGHKVRI  808



>ref|XP_002527706.1| peptidase, putative [Ricinus communis]
 gb|EEF34665.1| peptidase, putative [Ricinus communis]
Length=822

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/802 (44%), Positives = 481/802 (60%), Gaps = 36/802 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTR-------------------IKGTSGNVTMYKQRMTKQHDVFL  225
             +A+IY+V ME  P +S R                   I  TS  VT Y + + + HD  L
Sbjct  23    KAEIYLVTMEGEPVISYRGGVPGFEPTALDTDDDDEKIDTTSQLVTSYAEHLEQTHDTLL  82

Query  226   GSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDF  405
              SL     Y KLYSY HL+NGFAVH   ++A + L +A GV+ +  D K+ ++TTHTP F
Sbjct  83    SSLFDHGTYKKLYSYRHLINGFAVHTSPEQA-ETLRRASGVKSVERDWKVRRLTTHTPQF  141

Query  406   LGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCIT  585
             LG+P  VWP  GG   +GE +VIG +D+GI P H SF++      G      K+ GKC  
Sbjct  142   LGLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFATLHTDPYGP---LPKYRGKCEV  198

Query  586   GDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPV  765
               +     CNGKI+GAQ+FA+AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV
Sbjct  199   DPDTKKRFCNGKIIGAQHFAQAAIAAGTFNPSIDFASPLDGDGHGSHTAAIAAGNNGIPV  258

Query  766   ITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIlslsv-gpss  939
               +   +G ASGMAP A IAVYKALY +FGGY++DVVAA+DQAV DGVDILSLSV   S 
Sbjct  259   RMHGHEFGKASGMAPRARIAVYKALYRNFGGYVADVVAAIDQAVHDGVDILSLSVGPNSP  318

Query  940   vpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYT  1119
               +  + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+TSVAA+  DRRY 
Sbjct  319   AATTKTTFLNPFDATLLAAVKAGVFVAQAAGNGGPFPKTLVSYSPWITSVAAAIDDRRYK  378

Query  1120  NSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLV  1299
             N + LGNG+  +G GLSP T     + L AA DV   +S+    +   CQ       +LV
Sbjct  379   NHLTLGNGKILAGIGLSPSTHPNQTYTLVAANDVLL-DSSVTKYSPSDCQRPELLNKNLV  437

Query  1300  RGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGL  1479
              G +++C Y+++F    ASI  V++T    GAAGFVL ++ D  S   K   V + +PG+
Sbjct  438   EGNILLCGYSFNFVVGTASIKKVSETAKSLGAAGFVLAVEND--SPGAKFDPVPVGLPGI  495

Query  1480  IINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPD  1659
             ++ ++  S  L  YYN +T R  +GR   F AT  I DG   I     P VA +S+RGP+
Sbjct  496   LVTDVTKSMDLIDYYNISTPRDWTGRVKRFNATGSIGDGLMPILHKSAPQVALFSARGPN  555

Query  1660  VNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAA  1839
             + +     AD+LKP+I+APG+ IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAA
Sbjct  556   IKDFSFQDADLLKPDILAPGALIWAAWSPNGIDEPNYVGEGFAMISGTSMAAPHIAGIAA  615

Query  1840  LIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINP  2007
             L+K +HP+W P+AI SA+MT++   DR      +   +   + +L  ATPFD+GSG +NP
Sbjct  616   LVKQKHPHWSPAAIKSALMTTSTKLDRAGSPLQAQQYSDTEAMKLVTATPFDYGSGHVNP  675

Query  2008  SRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-DLNTPSVTIS  2184
               AL+PGL+F+  ++ Y+ FLC  PG+D   +R      C  N     S + NTPS+T+S
Sbjct  676   RAALDPGLIFDAGYEDYLGFLCTTPGIDAHEIRNYTNAPC--NYTMGHSYNFNTPSITVS  733

Query  2185  NLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKA  2364
             +LV ++TV R VTN    +E Y +  R    + + + P    I +  S+     L     
Sbjct  734   HLVKTQTVTRTVTNA-AEEETYVITARMQPAIAIEVNPSAMTIKSGASQKFTASLTVRSV  792

Query  2365  TNSYSFGEMILLGDRNHIVRVP  2430
             T +YSFGE+++ G R H VR+P
Sbjct  793   TGTYSFGEILMKGSRGHKVRIP  814



>ref|XP_009777383.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
 ref|XP_009777384.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=817

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/800 (45%), Positives = 478/800 (60%), Gaps = 31/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A+IY+V +E  P +S                 +I  TS  VT Y + + K+HD+ L 
Sbjct  19    VGKAEIYIVTVEGEPVISYKGGIDGFEATASESDEKIDTTSELVTSYARHLEKKHDMLLA  78

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  R  Y K+YSY HL+NGFA H+  ++A +IL +A GV+ +  D K+ ++TTHTP FL
Sbjct  79    LLFDRGTYKKIYSYHHLINGFATHISHEQA-EILRQAPGVKSVERDWKVRRLTTHTPQFL  137

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SFSS      G      K+ GKC   
Sbjct  138   GLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFSSHNTEPYGP---LPKYRGKCEVD  194

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              N     CNGKI+GAQ+FA AA AAG FN +  Y SP D DGHGSHTA+ AAGN   PV 
Sbjct  195   PNTKKDYCNGKIIGAQHFAEAAKAAGAFNPTIDYDSPIDGDGHGSHTAAIAAGNNGIPVR  254

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              + F +G ASGMAP A IAVYKALY  FGG+++DVVAA++QAV DGVDIL+LSV   S  
Sbjct  255   MHGFEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIEQAVRDGVDILNLSVGPNSPP  314

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + FLN  +  LL A +AGV V QAAGN GP  +++LS+SPW+ SVAA+  DRRY N
Sbjct  315   ATTKTTFLNPFDATLLSAVKAGVFVAQAAGNGGPFPKTLLSYSPWIVSVAAAVDDRRYKN  374

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+   G GLSP T     F + AA DV   +S+    +   CQ       +LV 
Sbjct  375   HLTLGNGKILPGIGLSPSTHPNRTFTMVAANDVLL-DSSVTKYSPADCQRPEVLNKNLVE  433

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F    ASI  VA+T    GAAGFVL ++    S   K   V + IPG++
Sbjct  434   GNILLCGYSFNFVVGTASIKKVAETAKALGAAGFVLAVEN--ASPGTKFDPVPVSIPGIL  491

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I +   S  L  YYN  T R  +GR  +F++T  I +G R I     P VA +S+RGP++
Sbjct  492   ITDASQSMELVDYYNITTSRDWTGRVKSFKSTGSIGNGLRPILHKSAPQVAIFSARGPNI  551

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAW+PN   +    G+ FAL+SGTSMA PHIAGIAAL
Sbjct  552   KDYSFQDADLLKPDILAPGSLIWAAWAPNGTDEANFCGEGFALISGTSMAAPHIAGIAAL  611

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             IK  HP+W P+AI SA+MT++   DR      +   +   +  L PATPFD+GSG +NP 
Sbjct  612   IKQHHPHWSPAAIKSALMTTSSTIDRAERPLQAQQYSGSETMTLVPATPFDYGSGHVNPR  671

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+FN  +Q Y+ FLC VPG+D   ++      C        S+ N+PS+ +++L
Sbjct  672   AALDPGLIFNAGYQDYLGFLCTVPGIDPHEIKNFTHSPCNYTLGH-PSNFNSPSIAVAHL  730

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             VG+RTV R V NV   +E Y +  R    + +   P    +    SR   + L     T 
Sbjct  731   VGTRTVTRTVINV-AEEETYVITARMAPEIAIETNPPAMTLRHGASRKFTVTLTVRSVTG  789

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
             +YSFGE++L G R H VR+P
Sbjct  790   AYSFGEVLLKGSRGHKVRIP  809



>ref|XP_006283123.1| hypothetical protein CARUB_v10004145mg [Capsella rubella]
 gb|EOA16021.1| hypothetical protein CARUB_v10004145mg [Capsella rubella]
Length=816

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/797 (45%), Positives = 476/797 (60%), Gaps = 29/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S                 +I  TS  VT Y + + ++HD+ LG L 
Sbjct  19    AEIYIVTMEGEPIISYKGGDNGFEATAVESDEKIDTTSELVTSYARHLERKHDMLLGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  D+A ++L +A GV+ +  D K+ K+TTHTP FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPDQA-EMLRRAPGVKSVSRDWKVRKLTTHTPQFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG ID+GI P H SF+S        P  + K  GKC    + 
Sbjct  138   TDVWPTGGGYDRAGEDIVIGFIDSGIFPHHPSFASHHTALPYGPHPSYK--GKCEEDPHT  195

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  196   KKSFCNGKIIGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIPVRMHG  255

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  256   YEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPATT  315

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  316   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  375

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV    S+        CQ        LV G +
Sbjct  376   LGNGKMLAGIGLSPSTRPHRSYKMVSANDVLL-GSSGTKFNPSDCQKPEVLNKKLVEGNI  434

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  435   LLCGYSFNFVAGSASIKKVAETAKHLGAAGFVLVVENV--SPGTKFDPVPSCIPGILITD  492

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R   GR   F+A   I DG   I     P VA +S+RGP+  + 
Sbjct  493   VSKSMDLIDYYNVSTSRDWMGRVKDFKAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  552

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IW+AWS N   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  553   SFQDADLLKPDILAPGSLIWSAWSQNGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  612

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   ++  +  L  ATPFD+GSG +NPS AL
Sbjct  613   KHPQWSPAAIKSALMTTSTVIDRAGMPLKAQQYSETETMTLVKATPFDYGSGHVNPSAAL  672

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ YI FLC  PG+D   +       C   K    S+ NTPS+ IS+L  +
Sbjct  673   DPGLIFDAGYEDYIGFLCTTPGIDAHEITNFTNTPC-NFKMVHPSNFNTPSIAISHLART  731

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    + A  SR   + L     T +YS
Sbjct  732   QTVTRRVTNVAEEEETYTITARMEPAIAIEVSPPAMTVRAGASRTFSVTLTVRSVTGAYS  791

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H V +P
Sbjct  792   FGEVTLKGSRGHKVTLP  808



>ref|XP_006412776.1| hypothetical protein EUTSA_v10024432mg [Eutrema salsugineum]
 gb|ESQ54229.1| hypothetical protein EUTSA_v10024432mg [Eutrema salsugineum]
Length=816

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/797 (45%), Positives = 482/797 (60%), Gaps = 29/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S R                I  TS  VT Y + + ++HD+ LG L 
Sbjct  19    AEIYIVTMEGDPIISYRGGDNGFEATAVESDEKIDTTSELVTSYARHLERKHDMLLGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV   +A ++L +A GV+ +  D K+ K+TTHTP FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPSQA-EMLRRAPGVKSVSRDWKVRKLTTHTPQFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S        P  + K  GKC    + 
Sbjct  138   TDVWPTGGGYDRAGEDIVIGFVDSGIFPHHPSFASHHTALPYGPHPSYK--GKCEDDPHT  195

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  196   KMSFCNGKIIGAQHFAEAAKAAGAFNPDVDYASPMDGDGHGSHTAAIAAGNNGIPVRMHG  255

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-psg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP+S   + 
Sbjct  256   YEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPATT  315

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV VVQAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  316   KTTFLNPFDATLLGAVKAGVFVVQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  375

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV    S+        CQ        LV G +
Sbjct  376   LGNGKMLAGMGLSPSTRPHRSYKMVSANDVLL-GSSGMKYNPSDCQRPEVLNKKLVEGNI  434

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  435   LLCGYSFNFVAGSASIKKVAETAKHLGAAGFVLVVENV--SPGTKFDPVPSCIPGILITD  492

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN  T R   GR  +F+A   I DG   I     P VA +S+RGP+  + 
Sbjct  493   VSKSMDLIDYYNVTTSRDWMGRVKSFKAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  552

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IW+AWS N   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  553   SFQDADLLKPDILAPGSLIWSAWSENGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  612

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   ++  +  L  ATPFD+GSG +NPS AL
Sbjct  613   KHPQWSPAAIKSALMTTSTVIDRAGRPLQAQQYSETETVTLVKATPFDYGSGHVNPSAAL  672

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+D   +R      C   K    S+ N+PS+ IS+LV +
Sbjct  673   DPGLIFDAGYEDYLGFLCTTPGIDSHEIRNFTNTPC-NFKMGHPSNFNSPSIAISHLVRT  731

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    + A  SR+ ++ L     T  YS
Sbjct  732   QTVTRRVTNVAEEEETYTITSRMEPSIAIEVSPPAMTLRAGASRNFLVTLTVRSVTGGYS  791

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H V +P
Sbjct  792   FGEVTLKGSRGHKVSLP  808



>ref|XP_010099159.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB77031.1| Subtilisin-like protease [Morus notabilis]
Length=830

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/806 (44%), Positives = 483/806 (60%), Gaps = 38/806 (5%)
 Frame = +1

Query  103   EAKIYMVLMEDHPF-------VSTRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKL  261
             E  +Y+V MED P        +S +    S     + +R+   HD  L S L   +YTKL
Sbjct  30    ERALYLVTMEDEPAAFLGGSNLSHKGHKHSEVSRAHAKRLVNSHDKLLQSTLETGSYTKL  89

Query  262   YSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLG  441
             +S+ H++NGFAVH    +A K L   EGVR + +D   + MTT+TP FLG+ + VW + G
Sbjct  90    HSFKHIVNGFAVHTTPSQASK-LRDVEGVRLVEKDRGAKLMTTYTPKFLGLREGVWAQEG  148

Query  442   GPSVSGEGVVIGMIDTGINPFHASFS----SPEEYNIGRPRITRKFTGKCITGDNFPATA  609
             G   +GEG+VIG +DTGINP H SF+    +P   N+ R      F+G C  G +FPA++
Sbjct  149   GERNAGEGIVIGFVDTGINPTHPSFAFNPFNPFTSNLSR------FSGACEAGPHFPASS  202

Query  610   CNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYG  789
             CNGKIV A++F+  A AA   N S  + SP+DA GHGSH ASTAAGN   PV+ N F YG
Sbjct  203   CNGKIVSARFFSAGAQAATTLNTSVDFLSPYDAVGHGSHVASTAAGNAGVPVVVNGFFYG  262

Query  790   YASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLN  969
              ASGMAP A IA+YKA+Y     ++DV++A+DQAV DGVDIL+LSVGP   P     FLN
Sbjct  263   RASGMAPRAQIAIYKAVYPTVATLTDVISAIDQAVLDGVDILTLSVGPDEPPEDTITFLN  322

Query  970   VLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQT  1149
             + ++ LLFA RAGVLVVQAAGN GP   +++SFSPW   VAAS TDR Y   ++LGNG+ 
Sbjct  323   LFDIALLFARRAGVLVVQAAGNKGPGPSTVVSFSPWAVGVAASGTDRSYPGCLLLGNGRK  382

Query  1150  FSGSGLSPPTAGKAFF--QLAAAVDVCRRN----STAGLLTVESCQDAMQFVPSLVRGKL  1311
               G GLS P+ G   F  +L  A D  R N     T  L  +E CQ      P +VRG +
Sbjct  383   VGGLGLSGPSLGNGLFLHKLVLARDAARTNGSFPETPSL--IEECQSPQALDPRVVRGSI  440

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             VICT++  F +  +S+  +  T    G AGFV   +P  G        +   IPGL+I +
Sbjct  441   VICTFSEGFSNGTSSVTAIISTAKALGFAGFVFVANPSYG--DFIAEPIPFDIPGLLIPS  498

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +     +  YY  +T R  S     FRA A I +GR A +  Q P V+ +SSRGPD  +A
Sbjct  499   VADVQVILNYYERHTHRGESKLVRRFRAKAAIGEGRVASFKSQAPTVSRFSSRGPDFIDA  558

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
               +  DVLKP+I+APG  +WAAWSP S  D  ++G  FALVSGTSMATPHIAGIAALIK 
Sbjct  559   KRNPTDVLKPDILAPGQRVWAAWSPISASDPILEGLSFALVSGTSMATPHIAGIAALIKQ  618

Query  1852  RHPNWKPSAITSAMMTSADVTD-RlgspllaqqasqqlapaTPFDFGSGFINPSRALNPG  2028
              +P+W PS I+SA+ T+A   D      +    +   L P+TPF+ GSG + PS A++PG
Sbjct  619   YNPSWTPSMISSAIDTTATKYDNHGQVIMAEGFSIGSLYPSTPFELGSGLVTPSCAIDPG  678

Query  2029  LVFNTY--------FQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTIS  2184
             LVF++         ++ Y+ FLC++PG++  +++  +G  C  +     ++LN PS+TIS
Sbjct  679   LVFSSESWGVDEAGYKDYVAFLCSLPGMNPATIKIAIGESCNYSLTH-PANLNLPSITIS  737

Query  2185  NLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKA  2364
              L+GS +V R V NV    E Y   V  P G  V++ P  F I+  G++ L + LN TKA
Sbjct  738   ALIGSLSVQRTVRNVRNEPETYLCAVLPPNGTTVSLNPPWFTIAPQGTQELDVQLNVTKA  797

Query  2365  TNSYSFGEMILLGDRNHIVRVPFAVY  2442
              N +SFGE+IL G   HIV++P +V+
Sbjct  798   MNDFSFGEIILTGSLGHIVKIPLSVF  823



>ref|XP_008223890.1| PREDICTED: subtilisin-like protease isoform X1 [Prunus mume]
Length=820

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/800 (43%), Positives = 484/800 (61%), Gaps = 31/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             +  A +Y+V +E  P +S                 +I  TS +VT Y + +  +HD+ LG
Sbjct  22    VGRADVYIVTIEGEPIISYKGDVDGFEATAVESDEKIDPTSESVTSYARHLESKHDMLLG  81

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  +  Y KLYSY HL+NGFAVH+  ++A K++ +A GV+ +  D K+ ++TTHTP FL
Sbjct  82    MLFEQGTYQKLYSYQHLINGFAVHISHEQAEKLM-RAPGVKSVERDWKVRRLTTHTPQFL  140

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SF+S   YN        K+ GKC   
Sbjct  141   GLPTGVWPTGGGFDRAGENIVIGFVDSGIYPQHPSFAS---YNSDPYGPVPKYRGKCEVD  197

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +   + CNGKI+GA +FA+AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV 
Sbjct  198   PDTKRSFCNGKIIGAHHFAKAAIAAGVFNPSIDFASPMDGDGHGSHTAAIAAGNNGIPVK  257

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S  
Sbjct  258   MHGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVYDGVDILSLSVGPNSPP  317

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + +LN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N
Sbjct  318   ATTRTTYLNPFDATLLSAVKAGVFVAQAAGNGGPFPKTLVSYSPWIASVAAAIDDRRYKN  377

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              ++LGNG+  +G GLSP T     + L AA D    +S     +   CQ       +LV+
Sbjct  378   HLMLGNGKILAGIGLSPSTHPNRTYTLVAANDALLDSSVVKY-SPSDCQKPEVLNKNLVQ  436

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + +PG++
Sbjct  437   GNILLCGYSFNFVVGTASIKKVSETAKSLGAIGFVLAVENV--SPGTKFDPVPVGVPGIL  494

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++  S  L  YYN +T R  +GR  +F+    I DG   I     P+VA +S+RGP++
Sbjct  495   ITDVSKSLDLIDYYNISTSRDWTGRVKSFKGIGSIGDGLMPILHKSAPLVALFSARGPNI  554

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL
Sbjct  555   KDFSFQDADLLKPDILAPGSLIWAAWSPNGTDEPDYVGEGFAMISGTSMAAPHIAGIAAL  614

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             IK +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG ++P 
Sbjct  615   IKQKHPHWSPAAIKSALMTTSTTLDRAGRPLQAQQYSETQAMKLVSATPFDYGSGHVDPR  674

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+F+  +Q Y+ FLC  PG+D + +R      C        S+ N+PS+T+S+L
Sbjct  675   AALDPGLIFDVGYQDYLGFLCTTPGIDAREIRNYTNCACNYTIGH-PSNFNSPSITVSHL  733

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             V S+TV R VTNV    E Y +  R    + +   P    +    SR   + L     T 
Sbjct  734   VRSQTVTRTVTNV-AEQETYVITTRMAPAIAIEANPPAMTLKPGASRRFSVTLTVRSVTG  792

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
             +YSFGE+++ G+R H VR+P
Sbjct  793   AYSFGEVLMKGNRGHKVRIP  812



>ref|XP_010927223.1| PREDICTED: subtilisin-like protease isoform X2 [Elaeis guineensis]
 ref|XP_010927224.1| PREDICTED: subtilisin-like protease isoform X2 [Elaeis guineensis]
 ref|XP_010927225.1| PREDICTED: subtilisin-like protease isoform X2 [Elaeis guineensis]
Length=816

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/800 (45%), Positives = 487/800 (61%), Gaps = 31/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             +    IY+V ME  P VS                  +  TS  VT Y   + KQHD  L 
Sbjct  19    IGSGDIYIVTMEGEPIVSYSGGVEGFAPTATDSVEEMDITSEAVTSYALHLEKQHDALLD  78

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
             SL     Y KLYSY HL+NGF++H+  ++A + L +A GV+ + +D+K++K+TTHTP FL
Sbjct  79    SLFEVGTYKKLYSYRHLINGFSIHISPEQA-EALSRAPGVKYVEKDMKVKKLTTHTPQFL  137

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SFS+   YN        ++ G C   
Sbjct  138   GLPTGVWPAGGGFDRAGEDIVIGFVDSGIYPKHPSFST---YNSDPYGPLPRYRGNCEID  194

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +     CNGKI+GAQ+FA+AAIAAG FN +  +ASP D DGHGSHTA+ AAGN   PV 
Sbjct  195   PDTKRDFCNGKIIGAQHFAKAAIAAGAFNPTIDFASPLDGDGHGSHTAAIAAGNNGIPVR  254

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              +   +G ASGMAP A IAVYK LY  FGGY+SDVVAA++QAV+DGVDIL+LSV   S  
Sbjct  255   MHGHEFGKASGMAPRARIAVYKVLYRLFGGYVSDVVAAIEQAVQDGVDILNLSVGPNSPP  314

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              S  + FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA+  DRRY N
Sbjct  315   TSTKTTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAAVDDRRYKN  374

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              I+LGNG+   G GLSP T G   F L +A DV   +S      ++ CQ        +V 
Sbjct  375   HIILGNGKLLPGLGLSPATHGNKSFDLVSANDVLLDSSIMKYNPLD-CQRPELLNKKMVE  433

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G++++C Y+++F S  ASI  V++T    GAAGF++ ++      +     V + IPG++
Sbjct  434   GRILLCGYSFNFVSGTASIKKVSETAKSLGAAGFIVAVESSYPGTKFD--PVPVGIPGIL  491

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I+++  +  L  YYNS+T R  +GR ++F+A A I DG   I     P VA +SSRGPDV
Sbjct  492   ISDVSKTKDLIDYYNSSTKRDWAGRPLSFQAMASIEDGLAPILHKSAPQVALFSSRGPDV  551

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     ADVLKP+I+APG+ IWAAW+PN   +    G+ FA+VSGTSMA PHIAGIAAL
Sbjct  552   RDFSFQDADVLKPDILAPGNLIWAAWAPNGIDEANFVGEGFAMVSGTSMAAPHIAGIAAL  611

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             +K R+P+W P+AI SA+MT+A   DR      +   ++     L  ATPFD+GSG ++P 
Sbjct  612   VKQRYPHWSPAAIKSALMTTATTMDREDRPLQAQQYSKSEIMTLEQATPFDYGSGAVDPK  671

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+ +  FQ YI+FLC+VP VD   +  +    C        +DLN+PS+ IS+L
Sbjct  672   AALDPGLILDASFQDYIRFLCSVPDVDPHEILNITSSACNATGGH-PADLNSPSIAISHL  730

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
              G++TV R VTNV  + E Y +  R    + +   P    + +  SR + + L     T 
Sbjct  731   EGTQTVKRTVTNVAES-ETYVITTRMSPEIALEASPPAMTVLSGASREMTVSLTVRSVTG  789

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
              YSFGE+++ G+R H VR+P
Sbjct  790   GYSFGEILMKGNRGHKVRIP  809



>gb|KDO61882.1| hypothetical protein CISIN_1g003469mg [Citrus sinensis]
 gb|KDO61883.1| hypothetical protein CISIN_1g003469mg [Citrus sinensis]
Length=817

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/800 (44%), Positives = 484/800 (61%), Gaps = 31/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLG  228
             +  A++Y+V +E  P +S R                I  TS  VT Y + + K+HD+ LG
Sbjct  19    LGRAEVYIVTVEGEPIISYRGGDNGFEATAVESDEKIDTTSELVTSYARHLEKKHDMLLG  78

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  R  Y KLYSY HL+NGFAVH+  D+A +IL +A GV+ +  D K+ ++TTHTP+FL
Sbjct  79    LLFERDTYKKLYSYKHLINGFAVHITPDQA-EILQRAPGVKSVERDWKVRRLTTHTPEFL  137

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SF S      G      K+ GKC   
Sbjct  138   GLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFGSHHTDPYGP---VPKYRGKCEVD  194

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +   + CNGKI+GAQ+FA AAIAA  FN +  +ASP D DGHGSHTA+ AAGN   PV 
Sbjct  195   PDTKRSFCNGKIIGAQHFAEAAIAARAFNPAVDFASPLDGDGHGSHTAAIAAGNNGIPVR  254

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S  
Sbjct  255   MHGHEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPP  314

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + FLN  +V LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N
Sbjct  315   ATTKTTFLNPFDVTLLAAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKN  374

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+  +G GLSP T G   F L AA DV   +S+    +   CQ       +LV 
Sbjct  375   HLNLGNGKILAGIGLSPATHGNRTFTLVAANDVLL-DSSVMKYSASDCQRPEVLNKNLVE  433

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F +  ASI  V++T    GAAGFVL ++    S   K   V + IPG++
Sbjct  434   GNILLCGYSFNFVTGTASIKKVSETAKSLGAAGFVLAVENV--SPGTKFDPVPVGIPGIL  491

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++  S  L  YYN++T R  +GR  +F+ T  I DG   I     P VA +S+RGP++
Sbjct  492   ITDVTKSMDLVDYYNTSTTRDWTGRVKSFKGTGTIGDGLMPILHKSAPQVALFSARGPNI  551

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAWSPN   +    G+ FAL+SGTSMA PHIAGIAAL
Sbjct  552   KDFSFQDADLLKPDILAPGSLIWAAWSPNGTDEANFVGEGFALISGTSMAAPHIAGIAAL  611

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPS  2010
             +K +HP W P+AI SA+MT+    DR      +   ++  + +L  ATPFD+GSG +NP 
Sbjct  612   VKQKHPYWSPAAIKSALMTTTTKLDRASRPLQAQQYSETEAMKLVTATPFDYGSGHVNPR  671

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+F+  ++ Y+ FLC  PG+D   +R      C  +      + NTPS+T+++L
Sbjct  672   AALDPGLIFDAGYEDYLGFLCTTPGIDIHEIRNYTNQPCNYSMGH-PYNFNTPSITVAHL  730

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             V ++ V R VTNV   +E Y +  R    + + + P    +    SR   + L     T 
Sbjct  731   VKTQVVTRTVTNV-AEEETYSMSARMQPAIAIEVNPPAMTLKPGASRKFTVTLTVRSVTG  789

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
             +YSFGE+ + G R H V +P
Sbjct  790   TYSFGEICMKGSRGHKVNIP  809



>ref|XP_003533733.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=825

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/805 (44%), Positives = 491/805 (61%), Gaps = 35/805 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS---------------------TRIKGTSGNVTMYKQRMTKQH  213
               +A++Y+V +E  P +S                      ++  TS  VT Y + + K+H
Sbjct  21    FGKAEVYIVTVEGEPVISYKGGIDGFEATAVESDDDDDDEKLDSTSEVVTSYARHLEKRH  80

Query  214   DVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTH  393
             D+ LG L  R  Y KLYSY HL+NGFAVH+  ++A  + H A GV+ +  D K++++TTH
Sbjct  81    DMLLGLLFERGTYNKLYSYRHLINGFAVHLSPEQAETLRH-APGVKSVERDWKVKRLTTH  139

Query  394   TPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTG  573
             TP FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++      G      ++ G
Sbjct  140   TPQFLGLPTGVWPTGGGYERAGEDIVIGFVDSGIYPHHPSFTTHNTEPYGP---VSRYRG  196

Query  574   KCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNY  753
             KC    +   + CNGKIVGAQ+FA+AAIAAG FN S  + SP D DGHGSHTAS AAG  
Sbjct  197   KCEVDPDTKKSFCNGKIVGAQHFAQAAIAAGAFNPSIDFDSPLDGDGHGSHTASIAAGRN  256

Query  754   HTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvg  930
               PV  +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVG
Sbjct  257   GIPVRMHGHEFGKASGMAPRARIAVYKALYRLFGGFIADVVAAIDQAVHDGVDILSLSVG  316

Query  931   pssv-psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTD  1107
             P+S   +  + FLN  +  LL A +AGV V QAAGN GP  +S++S+SPW+ +VAA+  D
Sbjct  317   PNSPPSNTKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKSLVSYSPWIATVAAAIDD  376

Query  1108  RRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFV  1287
             RRY N ++LGNG+  +G GLSP T     + L AA DV   +S+A   +   CQ      
Sbjct  377   RRYKNHLILGNGKILAGLGLSPSTRLNQTYTLVAATDVLL-DSSATKYSPTDCQRPQLLN  435

Query  1288  PSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQ  1467
              +L++G +++C Y+++F   +ASI  V++T    GAAGFVL ++    S   K   V + 
Sbjct  436   KNLIKGNILLCGYSFNFVIGSASIKQVSETAKALGAAGFVLCVENV--SPGTKFDPVPVG  493

Query  1468  IPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSS  1647
             IPG++I +   S  L  YYN +T R  +GR   F  T +I DG   I     P VA +S+
Sbjct  494   IPGILITDASKSKELIDYYNISTPRDWTGRVKTFEGTGKIEDGLMPILHKSAPQVAIFSA  553

Query  1648  RGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIA  1827
             RGP++ + +   AD+LKP+I+APGS IWAAWS N   +    G+ FA++SGTSMA PHIA
Sbjct  554   RGPNIKDFIFQEADLLKPDILAPGSLIWAAWSLNGTDEPNYAGEGFAMISGTSMAAPHIA  613

Query  1828  GIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSG  1995
             GIAALIK +HP+W P+AI SA+MT++   DR      + L ++  + +L  ATPFD+GSG
Sbjct  614   GIAALIKQKHPHWSPAAIKSALMTTSTTLDRAGNPILAQLYSETEAMKLVKATPFDYGSG  673

Query  1996  FINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSV  2175
              +NP  AL+PGL+F+  ++ Y+ FLC  PG+D   ++      C  N     S+LNTPS+
Sbjct  674   HVNPQAALDPGLIFDAGYEDYLGFLCTTPGIDVNEIKNYTNSPC-NNTMGHPSNLNTPSI  732

Query  2176  TISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNA  2355
             TIS+LV ++ V R VTNV   +E Y +  R    V + + P    I A  SR   + L  
Sbjct  733   TISHLVRTQIVTRTVTNVADEEETYVISGRMQPAVAIEVNPPAMTIKAGASRRFTVTLTV  792

Query  2356  TKATNSYSFGEMILLGDRNHIVRVP  2430
                T +YSFGE+++ G R H VR+P
Sbjct  793   RSVTGTYSFGEVLMKGSRGHKVRIP  817



>ref|XP_002869402.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45661.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=816

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/797 (45%), Positives = 479/797 (60%), Gaps = 29/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S                 +I  TS  VT Y + + ++HD+ LG L 
Sbjct  19    AEIYIVTMEGEPIISYKGGDNGFQATAVESDEKIDTTSELVTSYARHLERKHDMLLGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  D+A ++L +A GV+ +  D K+ K+TTHTP FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPDQA-EMLRRAPGVKSVSRDWKVRKLTTHTPQFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG ID+GI P+H SF+S        P  + K  GKC    + 
Sbjct  138   TDVWPTGGGYDRAGEDIVIGFIDSGIFPYHPSFASHHTALPYGPHPSYK--GKCEEDSHS  195

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  196   KLSFCNGKIIGAQHFAEAAKAAGAFNPDIDFASPMDGDGHGSHTAAIAAGNNGIPVRMHG  255

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-psg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP+S   + 
Sbjct  256   YEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPATT  315

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  316   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  375

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV    S+        CQ        LV G +
Sbjct  376   LGNGKILAGIGLSPSTRPHCSYKMVSANDVLL-GSSGMKYNPSDCQKPEVLNKRLVEGNI  434

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  435   LLCGYSFNFVAGSASIKKVAETAKHLGAAGFVLVVENV--SPGTKFDPVPSCIPGILITD  492

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN  T R   GR   F+A   I DG   I     P VA +S+RGP+  + 
Sbjct  493   VSKSMDLIDYYNVTTSRDWMGRVKDFKAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  552

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IW+AWS N   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  553   SFQDADLLKPDILAPGSLIWSAWSENGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  612

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   ++  +  L  ATPFD+GSG +NPS AL
Sbjct  613   KHPQWSPAAIKSALMTTSTVIDRAGRPLQAQQYSETETVTLVKATPFDYGSGHVNPSAAL  672

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ YI FLC  PG+D   +       C   K    S+ NTPS+ IS+LV +
Sbjct  673   DPGLIFDAGYEDYIGFLCTTPGIDAHEITNFTNTPC-NFKMVHPSNFNTPSIAISHLVRT  731

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    +    SR   + L     T +YS
Sbjct  732   QTVTRRVTNVAEEEETYTITSRMEPAIAIEVSPPAMTVRVGASRTFSVTLTVRSVTGAYS  791

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H V +P
Sbjct  792   FGEVTLKGSRGHKVTLP  808



>ref|XP_008798105.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
 ref|XP_008798106.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
 ref|XP_008798107.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
 ref|XP_008798108.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
 ref|XP_008798109.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=816

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/800 (45%), Positives = 487/800 (61%), Gaps = 31/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             +    IY+V ME  P VS                  +  TS  VT Y   + KQHD  L 
Sbjct  19    IGSGDIYIVTMEGEPIVSYSGGVDGFAPTAADSVEEMDITSEAVTSYALHLEKQHDALLD  78

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
             SL     Y KLYSY HL+NGF+VH+  DKA + L +A GV+ + +D+K++K+TTHTP FL
Sbjct  79    SLFEVGTYKKLYSYRHLINGFSVHMSPDKA-EALSRAPGVKYVEKDMKVKKLTTHTPQFL  137

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SFS+   YN         + GKC   
Sbjct  138   GLPTGVWPTGGGFDKAGEDIVIGFVDSGIYPKHPSFST---YNSEPYGPLPHYRGKCEID  194

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +     CNGKI+GAQ+FA+AAIAAG FN +  +ASP D DGHGSHTA+ AAGN   PV 
Sbjct  195   PDTKRDFCNGKIIGAQHFAKAAIAAGAFNPTIDFASPLDGDGHGSHTAAIAAGNNGIPVR  254

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              +   +G ASGMAP A IAVYK LY  FGGY+SDVVAA++QAV+DGVDIL+LSV   S  
Sbjct  255   MHGHEFGKASGMAPRARIAVYKVLYRLFGGYVSDVVAAIEQAVQDGVDILNLSVGPNSPP  314

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              S  + FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA+  DRRY N
Sbjct  315   SSTKTTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAAVDDRRYKN  374

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              I+LGNG+   G GLSP T G   F L +A DV   +S      ++ CQ        +V 
Sbjct  375   HIILGNGKLIPGLGLSPATHGNKSFDLVSANDVLLDSSIMKYNPLD-CQRPELLNKKMVV  433

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G++++C Y+++F S  ASI  V++T    GAAGFV+ ++      +     V + IPG++
Sbjct  434   GRILLCGYSFNFVSGTASIKKVSETAKSLGAAGFVVAVENTYPGTKFD--PVPVGIPGIL  491

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I+++  +  L  +YNS+T R  +GR ++F+A A I DG   I     P VA +SSRGPDV
Sbjct  492   ISDVSMTKDLIDFYNSSTKRDWAGRPISFQAMASIADGLAPILHKSAPQVAIFSSRGPDV  551

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     ADVLKP+I+APG+ IWAAW+P+   +    G+ FA+VSGTSMA PHIAGIAAL
Sbjct  552   RDFSFQDADVLKPDILAPGNLIWAAWAPDGIDEANYVGEGFAMVSGTSMAAPHIAGIAAL  611

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTPFDFGSGFINPS  2010
             +K R+P+W P+AI SA+MT+A   DR    L +   +      L  ATPFD+G+G ++P 
Sbjct  612   VKQRYPHWSPAAIKSALMTTATTQDRGDRPLLAQQYSGSEIMTLVQATPFDYGAGAVDPK  671

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+ +  +Q YI+FLC+VP VD   +  +    C        +DLN PS+ IS+L
Sbjct  672   AALDPGLILDASYQDYIRFLCSVPDVDSHEILNITSSACNATGG-RPADLNNPSIAISHL  730

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
              G++TV R VTNV  A E Y +  R    + +   P    + +  SR + + L    AT 
Sbjct  731   EGTQTVKRTVTNV-AATETYVITTRMSPEIALEASPPAMTVLSGASREITVSLTVRSATG  789

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
              YSFGE+++ G+R H VR+P
Sbjct  790   GYSFGEILMKGNRGHKVRIP  809



>ref|XP_010927222.1| PREDICTED: subtilisin-like protease isoform X1 [Elaeis guineensis]
Length=854

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/800 (45%), Positives = 487/800 (61%), Gaps = 31/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             +    IY+V ME  P VS                  +  TS  VT Y   + KQHD  L 
Sbjct  57    IGSGDIYIVTMEGEPIVSYSGGVEGFAPTATDSVEEMDITSEAVTSYALHLEKQHDALLD  116

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
             SL     Y KLYSY HL+NGF++H+  ++A + L +A GV+ + +D+K++K+TTHTP FL
Sbjct  117   SLFEVGTYKKLYSYRHLINGFSIHISPEQA-EALSRAPGVKYVEKDMKVKKLTTHTPQFL  175

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SFS+   YN        ++ G C   
Sbjct  176   GLPTGVWPAGGGFDRAGEDIVIGFVDSGIYPKHPSFST---YNSDPYGPLPRYRGNCEID  232

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +     CNGKI+GAQ+FA+AAIAAG FN +  +ASP D DGHGSHTA+ AAGN   PV 
Sbjct  233   PDTKRDFCNGKIIGAQHFAKAAIAAGAFNPTIDFASPLDGDGHGSHTAAIAAGNNGIPVR  292

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              +   +G ASGMAP A IAVYK LY  FGGY+SDVVAA++QAV+DGVDIL+LSV   S  
Sbjct  293   MHGHEFGKASGMAPRARIAVYKVLYRLFGGYVSDVVAAIEQAVQDGVDILNLSVGPNSPP  352

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              S  + FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA+  DRRY N
Sbjct  353   TSTKTTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAAVDDRRYKN  412

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              I+LGNG+   G GLSP T G   F L +A DV   +S      ++ CQ        +V 
Sbjct  413   HIILGNGKLLPGLGLSPATHGNKSFDLVSANDVLLDSSIMKYNPLD-CQRPELLNKKMVE  471

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G++++C Y+++F S  ASI  V++T    GAAGF++ ++      +     V + IPG++
Sbjct  472   GRILLCGYSFNFVSGTASIKKVSETAKSLGAAGFIVAVESSYPGTKFD--PVPVGIPGIL  529

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I+++  +  L  YYNS+T R  +GR ++F+A A I DG   I     P VA +SSRGPDV
Sbjct  530   ISDVSKTKDLIDYYNSSTKRDWAGRPLSFQAMASIEDGLAPILHKSAPQVALFSSRGPDV  589

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     ADVLKP+I+APG+ IWAAW+PN   +    G+ FA+VSGTSMA PHIAGIAAL
Sbjct  590   RDFSFQDADVLKPDILAPGNLIWAAWAPNGIDEANFVGEGFAMVSGTSMAAPHIAGIAAL  649

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             +K R+P+W P+AI SA+MT+A   DR      +   ++     L  ATPFD+GSG ++P 
Sbjct  650   VKQRYPHWSPAAIKSALMTTATTMDREDRPLQAQQYSKSEIMTLEQATPFDYGSGAVDPK  709

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+ +  FQ YI+FLC+VP VD   +  +    C        +DLN+PS+ IS+L
Sbjct  710   AALDPGLILDASFQDYIRFLCSVPDVDPHEILNITSSACNATGGH-PADLNSPSIAISHL  768

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
              G++TV R VTNV  + E Y +  R    + +   P    + +  SR + + L     T 
Sbjct  769   EGTQTVKRTVTNVAES-ETYVITTRMSPEIALEASPPAMTVLSGASREMTVSLTVRSVTG  827

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
              YSFGE+++ G+R H VR+P
Sbjct  828   GYSFGEILMKGNRGHKVRIP  847



>ref|XP_006453271.1| hypothetical protein CICLE_v10007470mg [Citrus clementina]
 ref|XP_006474252.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474253.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
 gb|ESR66511.1| hypothetical protein CICLE_v10007470mg [Citrus clementina]
Length=817

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/800 (44%), Positives = 483/800 (60%), Gaps = 31/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLG  228
             +  A++Y+V +E  P +S R                I  TS  VT Y + + K+HD+ LG
Sbjct  19    LGRAEVYIVTVEGEPIISYRGGDNGFEATAVESDEKIDTTSELVTSYARHLEKKHDMLLG  78

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  R  Y KLYSY HL+NGFAVH+  D+A +IL +A GV+ +  D K+ ++TTHTP+FL
Sbjct  79    LLFERDTYKKLYSYKHLINGFAVHITPDQA-EILQRAPGVKSVERDWKVRRLTTHTPEFL  137

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SF S      G      K+ GKC   
Sbjct  138   GLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFGSHHTDPYGP---VPKYRGKCEVD  194

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +   + CNGKI+GAQ+FA AAIAA  FN +  +ASP D DGHGSHTA+ AAGN   PV 
Sbjct  195   PDTKRSFCNGKIIGAQHFAEAAIAARAFNPAVDFASPLDGDGHGSHTAAIAAGNNGIPVR  254

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S  
Sbjct  255   MHGHEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPP  314

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + FLN  +V LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N
Sbjct  315   ATTKTTFLNPFDVTLLAAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKN  374

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+  +G GLSP T G   F L AA DV   +S+    +   CQ       +LV 
Sbjct  375   HLNLGNGKILAGIGLSPATHGNRTFTLVAANDVLL-DSSVMKYSASDCQRPEVLNKNLVE  433

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F +  ASI  V++T    GAAGFVL ++    S   K   V + IPG++
Sbjct  434   GNILLCGYSFNFVTGTASIKKVSETAKSLGAAGFVLAVENV--SPGTKFDPVPVGIPGIL  491

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++  S  L  YYN++T R  +GR  +F+ T  I DG   I     P VA +S+RGP++
Sbjct  492   ITDVTKSMDLVDYYNTSTTRDWTGRVKSFKGTGTIGDGLMPILHKSAPQVALFSARGPNI  551

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAWSPN   +    G+ FAL+SGTSMA PHIAGIAAL
Sbjct  552   KDFSFQDADLLKPDILAPGSLIWAAWSPNGTDEANFVGEGFALISGTSMAAPHIAGIAAL  611

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPS  2010
             +K +HP W P+AI SA+MT+    DR      +   ++  + +L  ATPFD+GSG +NP 
Sbjct  612   VKQKHPYWSPAAIKSALMTTTTKLDRASRPLQAQQYSETEAMKLVTATPFDYGSGHVNPR  671

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+F+  +  Y+ FLC  PG+D   +R      C  +      + NTPS+T+++L
Sbjct  672   AALDPGLIFDAGYVDYLGFLCTTPGIDIHEIRNYTNQPCNYSMGH-PYNFNTPSITVAHL  730

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             V ++ V R VTNV   +E Y +  R    + + + P    +    SR   + L     T 
Sbjct  731   VKTQVVTRTVTNV-AEEETYSMSARMQPAIAIEVNPPAMTLKPGASRKFTVTLTVRSVTG  789

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
             +YSFGE+ + G R H V +P
Sbjct  790   TYSFGEICMKGSRGHKVNIP  809



>ref|XP_007213647.1| hypothetical protein PRUPE_ppa001469mg [Prunus persica]
 gb|EMJ14846.1| hypothetical protein PRUPE_ppa001469mg [Prunus persica]
Length=820

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/800 (43%), Positives = 483/800 (60%), Gaps = 31/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A +Y+V +E  P +S                 +I  TS +VT Y + +  +HD+ LG
Sbjct  22    VGKADVYIVTIEGEPIISYKGDVDGFEATAVESDEKIDTTSESVTSYARHLESKHDMLLG  81

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  +  Y KLYSY HL+NGFAVH+  ++A K++ +A GV+ +  D K+ ++TTHTP FL
Sbjct  82    MLFEQGTYQKLYSYQHLINGFAVHISHEQAEKLM-RAPGVKSVERDWKVRRLTTHTPQFL  140

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SF+S      G      K+ GKC   
Sbjct  141   GLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPQHPSFASHNSDPYGP---VPKYRGKCEVD  197

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +   + CNGKI+GA +FA+AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV 
Sbjct  198   PDTKRSFCNGKIIGAHHFAKAAIAAGVFNPSIDFASPMDGDGHGSHTAAIAAGNNGIPVR  257

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S  
Sbjct  258   MHGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVYDGVDILSLSVGPNSPP  317

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + +LN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N
Sbjct  318   ATTKTTYLNPFDATLLSAVKAGVFVAQAAGNGGPFPKTLVSYSPWIASVAAAIDDRRYKN  377

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              ++LGNG+  +G GLSP T     + L AA D    +S     +   CQ       +L++
Sbjct  378   HLMLGNGKILAGIGLSPSTHPNRTYTLVAANDALLDSSVVKY-SPSDCQKPEVLNKNLIQ  436

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + +PG++
Sbjct  437   GNILLCGYSFNFVVGTASIKKVSETAKSLGAIGFVLAVENV--SPGTKFDPVPVGVPGIL  494

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++  S  L  YYN +T R  +GR  +F+    I DG   I     P VA +S+RGP++
Sbjct  495   ITDVSKSLDLIDYYNISTSRDWTGRVKSFKGIGSIGDGLMPILHKSAPQVALFSARGPNI  554

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL
Sbjct  555   KDFSFQDADLLKPDILAPGSLIWAAWSPNGTDEPDYVGEGFAMISGTSMAAPHIAGIAAL  614

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             IK +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG ++P 
Sbjct  615   IKQKHPHWSPAAIKSALMTTSTTLDRAGRPLQAQQYSETQAMKLVSATPFDYGSGHVDPR  674

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+F+  +Q Y+ FLC  PG+D + +R      C        S+ N+PS+T+S+L
Sbjct  675   AALDPGLIFDVGYQDYLGFLCTTPGIDAREIRNYTNCACNYTIGH-PSNFNSPSITVSHL  733

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             V S+TV R VTNV    E Y +  R    + +   P    +    SR   + L     T 
Sbjct  734   VRSQTVTRTVTNV-AEQETYVITTRMAPAIAIEANPPAMTLKPGASRKFSVTLTVRSVTG  792

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
             +YSFGE+++ G+R H VR+P
Sbjct  793   TYSFGEVLMKGNRGHKVRIP  812



>ref|XP_006597795.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=819

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/802 (44%), Positives = 484/802 (60%), Gaps = 34/802 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS--------------------TRIKGTSGNVTMYKQRMTKQHDVF  222
             EA++Y+V +E  P +S                     ++  TS  V  Y + + K+HD+ 
Sbjct  18    EAEVYIVTVEGEPIISYKGGIDGFEATAVESDDDDDEKLDSTSEVVVSYARHLEKRHDML  77

Query  223   LGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPD  402
             LG L  R  Y KLYSY HL+NGFAVH+  ++A  + H A GV+ +  D K++++TTHTP 
Sbjct  78    LGMLFERGTYNKLYSYRHLINGFAVHLSPEQAETLRH-APGVKSVERDWKVKRLTTHTPQ  136

Query  403   FLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCI  582
             FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++      G      ++ GKC 
Sbjct  137   FLGLPTGVWPTGGGYERAGEDIVIGFVDSGIYPHHPSFTTHNTEPYGP---VSRYRGKCE  193

Query  583   TGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTP  762
                +   + CNGKI+GAQ+FA+AAIAAG FN S  + SP D DGHGSHTAS AAG    P
Sbjct  194   VDPDTKRSFCNGKIIGAQHFAQAAIAAGAFNPSIDFDSPLDGDGHGSHTASIAAGRNGIP  253

Query  763   VITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gps  936
             V  +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S
Sbjct  254   VRMHGHEFGKASGMAPRARIAVYKALYRLFGGFIADVVAAIDQAVHDGVDILSLSVGPNS  313

Query  937   svpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRY  1116
                +  + FLN  +  LL A +AGV V QAAGN GP  +S++S+SPW+ +VAA+  DRRY
Sbjct  314   PPSNTKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKSLVSYSPWIATVAAAIDDRRY  373

Query  1117  TNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSL  1296
              N ++LGNG+  +G GLSP T     + L AA DV   +S+    +   CQ       +L
Sbjct  374   KNHLILGNGKILAGLGLSPSTRLNQTYTLVAATDVLL-DSSVTKYSPTDCQRPELLNKNL  432

Query  1297  VRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPG  1476
             ++G +++C Y+Y+F   +ASI  V++T    GA GFVL ++    S   K   V + IPG
Sbjct  433   IKGNILLCGYSYNFVIGSASIKQVSETAKALGAVGFVLCVENV--SPGTKFDPVPVGIPG  490

Query  1477  LIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGP  1656
             ++I +   S  L  YYN +T R  +GR   F  T +I DG   I     P VA +S+RGP
Sbjct  491   ILITDASKSKELIDYYNISTPRDWTGRVKTFEGTGKIEDGLMPILHKSAPQVAMFSARGP  550

Query  1657  DVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIA  1836
             ++ +     AD+LKP+I+APGS IWAAWS N   +    G+ FA++SGTSMA PHIAGIA
Sbjct  551   NIKDFSFQEADLLKPDILAPGSLIWAAWSLNGTDEPNYVGEGFAMISGTSMAAPHIAGIA  610

Query  1837  ALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFIN  2004
             ALIK +HP+W P+AI SA+MT++   DR      + L ++  + +L  ATPFD+GSG +N
Sbjct  611   ALIKQKHPHWSPAAIKSALMTTSTTLDRAGNPILAQLYSETEAMKLVKATPFDYGSGHVN  670

Query  2005  PSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTIS  2184
             P  AL+PGL+F+  ++ Y+ FLC  PG+D   ++      C  N     S+LNTPS+TIS
Sbjct  671   PRAALDPGLIFDAGYEDYLGFLCTTPGIDVHEIKNYTNSPC-NNTMGHPSNLNTPSITIS  729

Query  2185  NLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKA  2364
             +LV S+ V R VTNV   +E Y +  R    V + + P    I A  SR   + L     
Sbjct  730   HLVRSQIVTRTVTNVADEEETYVITARMQPAVAIDVNPPAMTIKASASRRFTVTLTVRSV  789

Query  2365  TNSYSFGEMILLGDRNHIVRVP  2430
             T +YSFGE+++ G R H VR+P
Sbjct  790   TGTYSFGEVLMKGSRGHKVRIP  811



>emb|CDX68618.1| BnaC01g08350D [Brassica napus]
Length=818

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/797 (44%), Positives = 475/797 (60%), Gaps = 28/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S                 +I  +S  VT Y + + K+HD+ LG L 
Sbjct  20    AEIYIVTMEGDPIISYKGGVNGFEATAVESDEKIDTSSELVTSYARHLEKKHDMLLGMLF  79

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA H+   +A ++L +  GV+ +  D K++K+TTHTP FLG+P
Sbjct  80    EEGSYKKLYSYKHLINGFAAHLSPAQA-EVLSRTPGVKHLSRDWKVKKLTTHTPQFLGLP  138

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S        P  + K  GKC      
Sbjct  139   TDVWPTGGGYDRAGEDIVIGFVDSGIFPHHPSFASHHTAVPYGPHPSYK--GKCEDDPRT  196

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  197   KFSFCNGKIIGAQHFAEAAKAAGAFNPDVDFASPMDGDGHGSHTAAIAAGNNGIPVRMHG  256

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG++SDVVAA+D AV DGVDILSLSV   S   + 
Sbjct  257   YEFGKASGMAPRARIAVYKALYRLFGGFVSDVVAAIDMAVHDGVDILSLSVGPNSPPATT  316

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  317   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  376

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV   +S         CQ        LV+G +
Sbjct  377   LGNGKMLAGIGLSPSTRPHRSYKMVSANDVLLDSSGGNKYNPSDCQKPEVLNKKLVQGNI  436

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  437   LLCGYSFNFVAGSASIKKVAETAKHLGAAGFVLVVENV--SPGTKFDPVPSCIPGILITD  494

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN  T R   GR   F+A   I DG   I     P VA +S+RGP+  + 
Sbjct  495   VPKSMDLIDYYNVTTSRDWMGRVKDFKAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  554

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IW+AWS N   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  555   SFQDADLLKPDILAPGSLIWSAWSENGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  614

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   ++  +  L  ATPFD+GSG ++PS AL
Sbjct  615   KHPQWSPAAIKSALMTTSTVMDRAGRPLQAQQYSETETVTLVKATPFDYGSGHVSPSSAL  674

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+D   +R      C    K   S+ N+PS+ IS+LVG+
Sbjct  675   DPGLIFDAGYEDYLGFLCTTPGIDAHEIRNFTNTPCNYKMKL-PSNFNSPSIAISHLVGT  733

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    + A  SR   + L     T  YS
Sbjct  734   QTVTRRVTNVAEEEETYTITSRMEPSIAIEVSPPAMTLRAGASRSFTVTLTVRSVTGVYS  793

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H V +P
Sbjct  794   FGEVTLKGSRGHKVSIP  810



>ref|XP_010688415.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
 ref|XP_010688416.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=823

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/801 (44%), Positives = 481/801 (60%), Gaps = 32/801 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A+IY+V +++ P VS R                I  TS  V  Y + + K+HD+ LG
Sbjct  24    LIKAEIYIVTLDEEPVVSYRGGVNGFEATASETDEKIDVTSEAVISYARHLEKKHDMLLG  83

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L +   Y+KLYSY HL+NGFAVH+ S + ++ L +  GV+ I  D K+ ++TTHTP+FL
Sbjct  84    MLFKGGTYSKLYSYRHLINGFAVHI-SPEQVETLRRHPGVKSIERDWKVRRLTTHTPEFL  142

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SF+S E    G      K+ GKC   
Sbjct  143   GLPTEVWPTGGGHDKAGEDIVIGFVDSGIYPLHPSFASHEAERYGP---VPKYRGKCEVD  199

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +   + CNGKIVGAQ+FA+AAIAAG FN S   ASP D DGHGSHTAS AAGN   PV 
Sbjct  200   PDTKRSFCNGKIVGAQHFAKAAIAAGAFNPSVDSASPLDGDGHGSHTASIAAGNNGIPVR  259

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssv  942
              NR+++G ASGMAP A IAVYKALY  FGG+++DV+AA+DQAV DGVDI++LSV   S  
Sbjct  260   LNRYDFGKASGMAPRARIAVYKALYRLFGGFVADVMAAIDQAVHDGVDIINLSVGPNSPP  319

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + FLN  +  LL A +AG+ V QAAGN GP  +++LS+SPW+TSVAA+  DRRY N
Sbjct  320   AATKTTFLNPFDAALLSAVKAGIFVAQAAGNGGPFPKTILSYSPWITSVAAAIDDRRYKN  379

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
                LGNG+  +G+GLSP T     + L +A D     S     +   CQ        LV 
Sbjct  380   HFFLGNGKVLAGTGLSPATHLNKTYTLVSANDALLDTSVM-RFSPSDCQRPEVLNRKLVE  438

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             GK+++C Y+++F   +ASI  V++T    GAAGFVL ++    +   K   V   IPG++
Sbjct  439   GKILLCGYSFNFVVGSASIKKVSETARSLGAAGFVLAVESV--TPGTKFDPVPTSIPGIV  496

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             + ++  S  L  YYN +T R  +GR  +F A   I +G RAI     P VA +S+RGP++
Sbjct  497   VTDVRNSLELIDYYNVSTSRDWTGRVKSFGAKGSIGNGLRAILHKSAPQVALFSARGPNI  556

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APG+ IWAAW+PN   +   +G+ FA++SGTSMA PHI+GIAAL
Sbjct  557   KDYSFRDADLLKPDILAPGALIWAAWAPNGTDEPNYEGEAFAMISGTSMAAPHISGIAAL  616

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl-----gspllaqqasqqlapaTPFDFGSGFINP  2007
             IK +HP W P+AI SA+MT+    +R                  +  ATPFD+GSG +NP
Sbjct  617   IKQKHPTWSPAAIKSALMTTTTTINRAGGKLQAQQYTGSSEEMTMVTATPFDYGSGHVNP  676

Query  2008  SRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISN  2187
               AL+PGL+F+  +  Y+ FLC  PG++   +R      C   K    S+LNTPS+ IS+
Sbjct  677   RAALDPGLIFDAGYSDYLGFLCTTPGINPHEIRNYTRSPC-NFKMGHPSNLNTPSIAISH  735

Query  2188  LVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKAT  2367
             L G+  V R VTNV   +E Y +  R    V + + P    +    SR   + L A   +
Sbjct  736   LAGTHIVTRTVTNV-AEEETYTITARMAPSVAIEVNPPAITLLPGASRRFSVTLTARSVS  794

Query  2368  NSYSFGEMILLGDRNHIVRVP  2430
              SYSFG+++L G R H V +P
Sbjct  795   GSYSFGQVVLKGSRGHKVSIP  815



>ref|NP_567839.1| PA-domain containing subtilase family protein [Arabidopsis thaliana]
 emb|CAB43837.1| proteinase-like protein [Arabidopsis thaliana]
 emb|CAB80995.1| AT4g30020 [Arabidopsis thaliana]
 gb|AAM98098.1| AT4g30020/F6G3_50 [Arabidopsis thaliana]
 gb|AAO64757.1| AT4g30020/F6G3_50 [Arabidopsis thaliana]
 dbj|BAE98391.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85709.1| PA-domain containing subtilase family protein [Arabidopsis thaliana]
Length=816

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/797 (45%), Positives = 477/797 (60%), Gaps = 29/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S                 +I  TS  VT Y + + ++HD+ LG L 
Sbjct  19    AEIYIVTMEGEPIISYKGGDNGFEATAVESDEKIDTTSELVTSYARHLERKHDMLLGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  D+A ++L +A GV+ +  D K+ K+TTHTP FLG+P
Sbjct  79    VEGSYKKLYSYKHLINGFAAHVSPDQA-EMLRRAPGVKSVDRDWKVRKLTTHTPQFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG ID+GI P H SF+S        P  + K  GKC    + 
Sbjct  138   TDVWPTGGGYDRAGEDIVIGFIDSGIFPHHPSFASHHTTVPYGPHPSYK--GKCEEDPHT  195

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  196   KISFCNGKIIGAQHFAEAAKAAGAFNPDIDFASPMDGDGHGSHTAAIAAGNNGIPVRMHG  255

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  256   YEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPATT  315

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  316   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  375

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV    S+        CQ        LV G +
Sbjct  376   LGNGKMLAGIGLSPSTRPHRSYKMVSANDVLL-GSSGMKYNPSDCQKPEVLNKKLVEGNI  434

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  435   LLCGYSFNFVAGSASIKKVAETAKHLGAAGFVLVVENV--SPGTKFDPVPSCIPGILITD  492

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN  T R   GR   F+A   I DG   I     P VA +S+RGP+  + 
Sbjct  493   VSKSMDLIDYYNVTTSRDWMGRVKDFKAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  552

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IW+AWS N   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  553   SFQDADLLKPDILAPGSLIWSAWSANGTDEANYIGEGFALISGTSMAAPHIAGIAALVKQ  612

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   ++  +  L  ATPFD+GSG +NPS AL
Sbjct  613   KHPQWSPAAIKSALMTTSTVIDRAGRPLQAQQYSETETVTLVKATPFDYGSGHVNPSAAL  672

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ YI FLC  PG+D   ++      C   K    S+ NTPS+ IS+LV +
Sbjct  673   DPGLIFDAGYEDYIGFLCTTPGIDAHEIKNFTNTPC-NFKMVHPSNFNTPSIAISHLVRT  731

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    + A  SR   + L     T +YS
Sbjct  732   QTVTRRVTNVAEEEETYTITSRMEPAIAIEVSPPAMTVRAGASRTFSVTLTVRSVTGAYS  791

Query  2380  FGEMILLGDRNHIVRVP  2430
             FG++ L G R H V +P
Sbjct  792   FGQVTLKGSRGHKVTLP  808



>ref|XP_009419985.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009419986.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009419987.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=818

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/798 (45%), Positives = 491/798 (62%), Gaps = 37/798 (5%)
 Frame = +1

Query  112   IYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLLRR  243
             IY+V +E  P VS                 R+  TS +VT Y   + K+HD  L SL   
Sbjct  25    IYIVTVEGEPVVSYNGGVDGFSATAVDLVERMDITSESVTSYALHLEKRHDSLLDSLFEV  84

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSY HL+NGFA+H+  ++A +++ KA GV+ + +D+K++K+TTHTP FLG+P  
Sbjct  85    GTYKKLYSYHHLINGFAIHMSPEQA-EVVSKAPGVKYVEKDMKIKKLTTHTPQFLGLPTE  143

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIG-RPRITRKFTGKCITGDNFP  600
             VWP  GG + +GE +VIG +D+GI P H SFS+      G  PR    + GKC       
Sbjct  144   VWPTGGGFNRAGEDIVIGFVDSGIYPKHPSFSTHNTEPYGPLPR----YRGKCEVDSETK  199

Query  601   ATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRF  780
                CNGKI+GAQ+FA+AAIAAG FN    ++SP D DGHGSHTA+ AAGN   PV  +  
Sbjct  200   RAFCNGKIIGAQHFAKAAIAAGAFNPLIDFSSPLDGDGHGSHTAAIAAGNNGIPVRMHGH  259

Query  781   NYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDS  957
              +G ASGMAP A IAVYK LY  FGGY+SDVV+A++QAV DGVD+L+LSVGP+S P+   
Sbjct  260   EFGKASGMAPRARIAVYKVLYRLFGGYVSDVVSAIEQAVLDGVDVLNLSVGPNSPPTTTK  319

Query  958   A-FLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVL  1134
             A FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA+  DRRY N + L
Sbjct  320   ATFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAAIDDRRYKNHLTL  379

Query  1135  GNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVE--SCQDAMQFVPSLVRGK  1308
             GNG+   G GLSP T G   F L +A DV   +S   L+T     CQ       + V G 
Sbjct  380   GNGKKLPGLGLSPATHGNKSFNLVSANDVMLDSS---LMTYNPLDCQRPELLNRNKVEGN  436

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C ++++F S  ASI  V++T    GAAGF++ ++        K   V +  PG++I 
Sbjct  437   ILLCGFSFNFISGTASIKKVSETAKSLGAAGFIVAVEN--AYPGTKFDPVPVDTPGILIA  494

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  +  L  YYN +T R  +GR ++F+ATA I DG   I     P VA +SSRGPDV +
Sbjct  495   DVSKTKELIDYYNCSTKRDWAGRPISFQATASIADGLAPILHKSAPQVALFSSRGPDVKD  554

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  ADVLKP+I+APG+ IWAAW+PN   +    G+ FA+VSGTSMA PHI+GIAALI+
Sbjct  555   FSFQDADVLKPDILAPGNLIWAAWAPNGTDEANYIGEGFAMVSGTSMAAPHISGIAALIR  614

Query  1849  DRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              ++P W PSAI SA+MT+A   DR    + +   ++     L  ATPFD+GSG ++P  A
Sbjct  615   QKNPQWSPSAIKSALMTTASTLDRRDRPILAQQYSENGVMTLVQATPFDYGSGAVDPKAA  674

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+ ++ +  Y++FLC+VP +D   +  +    C E K    SDLNTPS+TIS L G
Sbjct  675   LDPGLILDSTYGDYVKFLCSVPDLDPGEILNITSSACNETKGH-PSDLNTPSITISRLAG  733

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++TV R VTNV  + E Y +  R    + +   P    + +  SR + + L     T  Y
Sbjct  734   TQTVKRTVTNVADS-ETYIITTRMSPEIALEASPPAMTVLSGASREITVTLTVRSVTGGY  792

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE++L GDR H VR+P
Sbjct  793   SFGEILLKGDRGHKVRIP  810



>ref|XP_010541123.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
 ref|XP_010541124.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
 ref|XP_010541125.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=815

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/798 (44%), Positives = 477/798 (60%), Gaps = 30/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A++Y+V ++  P +S R                I  TS  VT Y + + K+HD+ LG L
Sbjct  18    KAEVYIVTVDGDPIISYRGGENGFEATALESDEKIDTTSELVTSYARHLEKKHDMLLGML  77

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
              +   Y KLYSY HL+NGFA H+  ++A + L ++ GV+ +  D K+ K+TTHTP+FLG+
Sbjct  78    FQEGTYKKLYSYKHLINGFAAHITPEQA-ETLRRSPGVKSVDRDWKVRKLTTHTPEFLGL  136

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG +D+GI+P H SF+S      G       + GKC    N
Sbjct  137   PTDVWPTGGGYDRAGEDIVIGFVDSGIHPHHPSFASHHTAPYGP---LSSYKGKCEDDPN  193

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                + CNGKI+GAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN   PV  +
Sbjct  194   TKKSFCNGKIIGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIPVRLH  253

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
              + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   +
Sbjct  254   GYEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPAT  313

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N +
Sbjct  314   TKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHL  373

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+   G GLSP T     + + AA DV   +S+A   +   CQ        L+ G 
Sbjct  374   TLGNGKMLPGIGLSPSTHPHRSYTMVAANDVAL-DSSAAKFSPADCQRPEVLNKRLIEGN  432

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  VA+T    GA GFVL ++    S   K   V   IPG++I 
Sbjct  433   ILLCGYSFNFVVGTASIKKVAETAKHLGAVGFVLVVENV--SPGTKFDPVPSPIPGILIT  490

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
              +  ST L  YYN  T R  +GR   F+A   I DG   I     P VA +S+RGP+  +
Sbjct  491   EVSKSTDLIDYYNVTTSRDWTGRVKTFKAIGSIGDGLAPILHKSAPEVALFSARGPNTKD  550

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                + AD+LKP+I+APG  IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K
Sbjct  551   FSFEDADLLKPDILAPGCLIWAAWSPNGTDEANYVGEGFAMISGTSMAAPHIAGIAALVK  610

Query  1849  DRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP W P+AI SA+MT++   DR    L +   ++    +L  ATPFD+GSG +NP  A
Sbjct  611   QKHPQWSPAAIKSALMTTSTTIDRGGRPLQAQQYSETEVVRLIKATPFDYGSGHVNPRAA  670

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ Y+ FLC  PG+D   +R      C  + K   S+ N+PS+ IS+LV 
Sbjct  671   LDPGLIFDAGYEDYLGFLCTTPGIDAHEIRNYTNRACDYSMKH-PSNFNSPSIAISHLVR  729

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             + TV RRVTNV   +E + +  R    + + + P    + A  SR   + L     T  Y
Sbjct  730   TITVTRRVTNVAEEEETFTITARMQPSIAIEVSPPAMTLRAGASRKFSVTLTVRTVTGDY  789

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFG++ L G R H VR+P
Sbjct  790   SFGQVTLKGSRGHKVRIP  807



>ref|XP_010447778.1| PREDICTED: subtilisin-like protease [Camelina sativa]
 ref|XP_010447779.1| PREDICTED: subtilisin-like protease [Camelina sativa]
 ref|XP_010447781.1| PREDICTED: subtilisin-like protease [Camelina sativa]
 ref|XP_010447782.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=816

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/797 (45%), Positives = 475/797 (60%), Gaps = 29/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S                 +I  TS  VT Y + + ++HD+ LG L 
Sbjct  19    AEIYIVTMEGEPIISYKGGDNGFEATAVESDEKIDTTSELVTSYARHLERKHDMLLGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  D+A + L +A GV+ +  D K+ K+TTHTP FLG+P
Sbjct  79    EERSYKKLYSYKHLINGFAAHVSPDQA-ETLRRAPGVKSVDRDWKVRKLTTHTPQFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG ID+GI P H SF+S        P  + K  GKC    + 
Sbjct  138   TDVWPTGGGYDRAGEDIVIGFIDSGIFPHHPSFASHHTSVPYGPHPSYK--GKCEEDPHT  195

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  196   RKSFCNGKIIGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIPVRMHG  255

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  256   YEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPATT  315

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  316   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  375

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV    S+        CQ        LV G +
Sbjct  376   LGNGKMLAGMGLSPSTRPHRSYKMVSANDVLL-GSSGMKYNPSDCQKPEVLNKKLVEGNI  434

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  435   LLCGYSFNFVAGSASIKKVAETAKHLGAAGFVLVVENV--SPGTKFDPVPSCIPGILITD  492

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R   GR   F+A   I DG   I     P VA +S+RGP+  + 
Sbjct  493   VSKSMDLIDYYNVSTSRDWMGRVKDFKAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  552

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IW+AWS N   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  553   SFQDADLLKPDILAPGSLIWSAWSENGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  612

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NPS AL
Sbjct  613   KHPLWSPAAIKSALMTTSTVIDRAGRPLQAQQYSDTETITLVKATPFDYGSGHVNPSAAL  672

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ YI F+C  PG+D   +       C   K    S+ NTPS+ IS+LV +
Sbjct  673   DPGLIFDAGYEDYIGFMCTTPGIDAHEITNFTNTPC-NFKMVHPSNFNTPSIAISHLVRT  731

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    + A  SR   + L     T +YS
Sbjct  732   QTVTRRVTNVADEEETYTITSRMEPAIAIEVSPPAMTVRAGASRTFSVTLTVRSVTGAYS  791

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H V +P
Sbjct  792   FGEVTLKGSRGHKVTLP  808



>ref|XP_004487981.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
 ref|XP_004487982.1| PREDICTED: subtilisin-like protease-like isoform X3 [Cicer arietinum]
Length=819

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/799 (44%), Positives = 485/799 (61%), Gaps = 32/799 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             EA++Y+V +E  P +S                 +I  +S +VT Y + +  +HD+ LG L
Sbjct  22    EAEVYIVTVEGEPIISYTGGIDGFEATAVESDEKIDTSSESVTSYARHLENRHDMLLGML  81

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
               R  YTKLYSY HL+NGFAVH+ S + ++ L  A GV+ I  D K+ ++TTHTP+FLG+
Sbjct  82    FDRGTYTKLYSYRHLINGFAVHL-SPEQVETLRHAPGVKSIERDWKVRRLTTHTPEFLGL  140

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P +VWP  GG   +GE +VIG +D+GI P H SF++      G      K+ GKC     
Sbjct  141   PTSVWPTGGGCDRAGEDIVIGFVDSGIYPHHPSFATHNTEPYGP---LSKYRGKCEVDPE  197

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                + CNGKI+GAQ+FA+AA A+G FN S  +ASP D DGHGSHTAS AAG    PV  +
Sbjct  198   TKKSFCNGKIIGAQHFAQAAKASGAFNPSIDFASPLDGDGHGSHTASIAAGRNGIPVRLH  257

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-ps  948
                +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP+S   +
Sbjct  258   GHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAALDQAVHDGVDILSLSVGPNSPPAA  317

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV V QAAGN GP  +S++S+SPW+ SVAA+  DRRY N +
Sbjct  318   TKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKSLVSYSPWIVSVAAAIDDRRYKNHL  377

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+  +G GLSP T     + L AA D    +S      ++ CQ       +L++GK
Sbjct  378   TLGNGKILAGLGLSPSTHLNQTYTLVAANDALLDSSVMKYSPLD-CQRPEVLNKNLIKGK  436

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + +PG++I 
Sbjct  437   ILLCGYSFNFVVGTASIKKVSETAKALGAVGFVLCVENV--SPGTKFDPVPVGLPGILIT  494

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN +T R  +GR   F+   +I DG R I     P VAS+S+RGP++ +
Sbjct  495   DVSKSKELIDYYNISTSRDWTGRVKTFKGIGKIGDGLRPILHKSAPQVASFSARGPNIKD  554

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAWS N   D    G+ FA++SGTSMA PHIAGIAAL+K
Sbjct  555   FSFQDADLLKPDILAPGSLIWAAWSLNGTDDSNYDGEGFAMMSGTSMAAPHIAGIAALLK  614

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP W P+AI SA++T++   DR      +   ++  + +L  ATPFD+GSG +NP  A
Sbjct  615   QKHPRWSPAAIKSALLTTSTTLDRAGSPILAQQYSETEAVKLVRATPFDYGSGHVNPRAA  674

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-DLNTPSVTISNLV  2193
             ++PGL+F+  +  Y+ FLC  PG+D   ++      C  NK      +LNTPS+TIS+LV
Sbjct  675   MDPGLIFDAGYNDYLGFLCTTPGIDVHEIKNYTNSPC--NKTMGQPYNLNTPSITISHLV  732

Query  2194  GSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNS  2373
              ++   R VTNV    E Y +  R    + + + P    I A  SR   + L     T +
Sbjct  733   RTQIATRTVTNVAKEVETYVMTARMQPAIAIEVNPPAITIKAGASRRFTVTLTVRTVTGT  792

Query  2374  YSFGEMILLGDRNHIVRVP  2430
             YSFGE+++ G R H VR+P
Sbjct  793   YSFGEVLMKGSRGHKVRIP  811



>gb|KDP27456.1| hypothetical protein JCGZ_19817 [Jatropha curcas]
Length=819

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/798 (45%), Positives = 484/798 (61%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A+IY+V ME+ P +S R                I  TS  VT Y Q + ++HD  LGSL
Sbjct  23    KAEIYIVTMEEEPVISYRGGVPGFKATAVDADEEIDTTSELVTSYAQHLEEKHDTLLGSL  82

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
                 +Y KLYSY HL+NGF+VH+   +A + L +A GV+ +  D K+ ++TTHTP FLG+
Sbjct  83    FDDGSYKKLYSYRHLINGFSVHISPGQA-ETLRRAPGVKSVERDWKVRRLTTHTPQFLGL  141

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG +D+GI P H SF++   Y+        K+ GKC    +
Sbjct  142   PTGVWPTGGGFDRAGEDIVIGFVDSGIYPRHPSFAT---YHTDPYEPLPKYRGKCEVDPD  198

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                  CNGKIVGAQ+FA+AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV  +
Sbjct  199   TKKNYCNGKIVGAQHFAKAAIAAGAFNPSIDFASPMDGDGHGSHTAAIAAGNNGIPVRVH  258

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKALY  FGG++SDVVAA+DQAV DGVDILSLSV   S   +
Sbjct  259   GHEFGKASGMAPRARIAVYKALYRLFGGFVSDVVAAIDQAVHDGVDILSLSVGPNSPPAT  318

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV VVQAAGN GP  ++++S+SPW+TSVAA+  DRRY N +
Sbjct  319   TKTTFLNPFDATLLAAVKAGVFVVQAAGNGGPFPKTLVSYSPWITSVAAAIDDRRYKNHL  378

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+  +G GLSP T     F L AA DV   +S+    +   CQ       +LV+G 
Sbjct  379   TLGNGKILAGIGLSPSTRPNQTFTLVAANDVLL-DSSVMKYSPSDCQRPEVLNKNLVKGN  437

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + IPG++I 
Sbjct  438   ILLCGYSFNFVVGTASIKKVSETAKSLGAVGFVLAVENV--SPGTKFDPVPVGIPGILIT  495

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN +T R  +GR  +F AT  I DG   I     P VA +S+RGP++ +
Sbjct  496   DVAKSMDLIDYYNISTPRDWTGRVKSFNATGSIGDGLMPILHKSAPQVALFSARGPNIKD  555

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K
Sbjct  556   FSFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMMSGTSMAAPHIAGIAALLK  615

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG +NP  A
Sbjct  616   QKHPHWSPAAIKSALMTTSTKLDRAGRPLQAQQYSETEALKLVTATPFDYGSGHVNPRAA  675

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ Y+ FLC  PG+D   ++      C        S+ NTPS+ +S+LV 
Sbjct  676   LDPGLIFDAGYEDYLGFLCTTPGIDAHEIKNYTNSPCNYTMGH-PSNFNTPSIAVSHLVK  734

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             S+T  R VTNV   +E Y +  R    + +   P    +    SR   + L     T +Y
Sbjct  735   SQTFTRTVTNV-AEEETYVITARMQPAIAIETNPSAMTLKPGASRKFSVTLTVRSVTGTY  793

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+++ G R H VR+P
Sbjct  794   SFGEILMKGSRGHKVRLP  811



>ref|XP_009417494.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009417495.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009417496.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009417497.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=817

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/801 (45%), Positives = 485/801 (61%), Gaps = 33/801 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             +   ++Y+V +E  P VS                  +  TS +VT Y   + K+HD  L 
Sbjct  19    LGSGEVYIVTVEGEPVVSYSGGVDGFSATAIDLVEEMDITSESVTSYAFHLEKKHDALLD  78

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
             SL     Y KLYSY HL+NGFAVH+  ++A + L KA GV+ + +D+K++K TTHTP FL
Sbjct  79    SLFEVGTYKKLYSYRHLVNGFAVHISPEQA-EALSKAPGVKYVEKDMKIKKFTTHTPQFL  137

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIG-RPRITRKFTGKCIT  585
             G+P  VWP  GG   +GE +VIG +D+GI P H SFS+      G  PR    + GKC  
Sbjct  138   GLPTGVWPTRGGFDRAGEDIVIGFVDSGIYPKHPSFSTHNTEPYGPLPR----YRGKCEV  193

Query  586   GDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPV  765
                     CNGKI+GAQ+FA+AAIAAG FN +  + SP D DGHGSHTA+ AAGN    V
Sbjct  194   DPETQRDFCNGKIIGAQHFAKAAIAAGAFNPAIDFPSPLDGDGHGSHTAAIAAGNNGIRV  253

Query  766   ITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv  942
               + + +G ASGMAP A IAVYK LY  FGGY+SDVVAA++QAV DGVDIL+LSVGP+S 
Sbjct  254   KMHGYEFGKASGMAPRARIAVYKVLYRLFGGYVSDVVAAIEQAVLDGVDILNLSVGPNSP  313

Query  943   psgDSA-FLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYT  1119
             P+   A FLN  +  LL A RAGV V QAAGN GP  ++++SFSPW+T+VAA+  DRRY 
Sbjct  314   PTTTKATFLNPFDAALLSAVRAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAAIDDRRYK  373

Query  1120  NSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLV  1299
             N++ LGNG+   G GLSP T G   F L +A DV    S      ++ CQ       + V
Sbjct  374   NNLTLGNGKILPGLGLSPSTHGNKSFNLVSANDVMLDLSLLKYNPLD-CQRPELLNRNKV  432

Query  1300  RGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGL  1479
              G +++C Y+++F S  ASI  V++T    GAAGF++ ++      +     V +  PG+
Sbjct  433   EGNILLCGYSFNFVSGTASIKKVSETAKSLGAAGFIVAVENTYPGAKFD--PVPVDTPGI  490

Query  1480  IINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPD  1659
             +I +   +  L  YYN +T R  +GR ++F ATA I DG   I     P VA +SSRGPD
Sbjct  491   LITDARKTKELIDYYNCSTTRDWAGRPISFDATASIADGLAPILHKSAPQVALFSSRGPD  550

Query  1660  VNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAA  1839
             V +     ADVLKP+I+APG+ IWAAW+PN   +    G+ FA+VSGTSMA PHIAGIAA
Sbjct  551   VKDFSFQDADVLKPDILAPGNLIWAAWAPNGTDEANYIGEGFAMVSGTSMAAPHIAGIAA  610

Query  1840  LIKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTPFDFGSGFINP  2007
             LIK ++P+W P AI SA+MT+A   DR    + +   ++     L  ATPFD+GSG +NP
Sbjct  611   LIKQKNPHWSPGAIKSALMTTATTLDRGGRPILAQQYSETEIMTLVQATPFDYGSGAVNP  670

Query  2008  SRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISN  2187
               AL+PGL+ +T ++ YI+FLC+VP VD   VR +    C        +DLN PS+TIS+
Sbjct  671   KAALDPGLILDTTYEDYIRFLCSVPDVDPNEVRNITSSACNSTTGL-PADLNIPSITISH  729

Query  2188  LVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKAT  2367
             L G++TV R VTNV    E Y +  R    + +   P    + +  SR + + L     T
Sbjct  730   LEGTQTVKRTVTNVADT-ETYVITTRMSPEIALEASPPAMTVLSGASREITVSLTVRSVT  788

Query  2368  NSYSFGEMILLGDRNHIVRVP  2430
               YSFGE+++ GDR H VR+P
Sbjct  789   GGYSFGEILMKGDRGHRVRIP  809



>emb|CDY30179.1| BnaA03g49910D [Brassica napus]
Length=817

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/798 (44%), Positives = 478/798 (60%), Gaps = 30/798 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S                 +I  TS  VT Y + + ++HD+ LG L 
Sbjct  19    AEIYIVTMEGDPIISYKGGVNGFEATAVESDEKIDTTSDLVTSYGRHLERKHDMLLGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
             +  +Y KLYSY HL+NGFA H+  D+A ++L ++ GV+ +  D K+ K+TTHTP FLG+P
Sbjct  79    KEGSYKKLYSYKHLINGFAAHLSPDQA-EMLRRSPGVKSVSRDWKVRKLTTHTPQFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG ID+GI P H SF+S        P  + K  GKC      
Sbjct  138   TDVWPTGGGYDRAGEDIVIGFIDSGIFPHHPSFASHHTSVPYGPHPSYK--GKCEDDPRT  195

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  196   KLSFCNGKIIGAQHFAEAAKAAGAFNPDVDFASPMDGDGHGSHTAAIAAGNNGVPVRMHG  255

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG++SDVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  256   YEFGKASGMAPRARIAVYKALYRLFGGFVSDVVAAIDQAVHDGVDILSLSVGPNSPPTTT  315

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  316   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  375

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV    S+        CQ        LV G +
Sbjct  376   LGNGKMLAGIGLSPSTRPHRSYKMVSANDVL-LGSSGVRYNPSDCQKPEVLNKKLVEGNI  434

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  435   LLCGYSFNFVAGSASIKKVAETARHLGAAGFVLVVENV--SPGTKFDPVPSGIPGILITD  492

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN  T R   GR  +F A   I DG   I     P VA +S+RGP+  + 
Sbjct  493   VSKSMDLIDYYNVTTSRDWMGRVKSFNAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  552

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGD-KYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                 AD+LKP+I+APGS IW+AWS N   +  Y+ G+ FAL+SGTSMA PHIAGIAAL+K
Sbjct  553   SFQDADLLKPDILAPGSLIWSAWSQNGTDEANYVAGEGFALISGTSMAAPHIAGIAALVK  612

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP W P+AI SA+MT++ V DR      +   ++  +  L  ATPFD+GSG +NPS A
Sbjct  613   QKHPQWSPAAIKSALMTTSTVMDRAGRPLQAQQYSETETMTLVKATPFDYGSGHVNPSAA  672

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGLVF+  ++ Y+ FLC  PG++   +R      C   K    S+ N+PS+ +S+LV 
Sbjct  673   LDPGLVFDAGYEDYLGFLCTTPGINAHEIRNFTNTPC-NYKMRHPSNFNSPSIAVSHLVR  731

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++TV RRVTNV   +E Y +  R    + + + P    + A  SR   + L     T  Y
Sbjct  732   TQTVTRRVTNVAEEEETYTITSRMEPSIAIEVSPPAMTLRAGASREFSVTLTVRSVTGVY  791

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+ L G R H V +P
Sbjct  792   SFGEVTLKGSRGHKVSLP  809



>ref|XP_010277212.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
 ref|XP_010277213.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
 ref|XP_010277214.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
 ref|XP_010277215.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=819

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/797 (44%), Positives = 483/797 (61%), Gaps = 31/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVSTR---------------IKGTSGNVTMYKQRMTKQHDVFLGSLLR  240
             A++Y+V +E  P VS R               I  TS  V  Y   + K+ D+ LG L  
Sbjct  24    AEVYIVTLEGEPVVSYRGGVEGYEATASSDEKIDTTSELVISYSHHLEKRQDMLLGLLFE  83

Query  241   RSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPD  420
             R  Y KLYSY HL+NGFAVH+  ++A +IL +  GV+ +  D K++++TTHTP FLG+P 
Sbjct  84    RGTYKKLYSYRHLINGFAVHISPEQA-EILRRTPGVKSVERDWKVKRLTTHTPQFLGLPT  142

Query  421   TVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFP  600
              VWP  GG   +GE +VIG +D+GI P H SF++      G      K+ GKC    +  
Sbjct  143   GVWPTGGGFDKAGEDIVIGFVDSGIYPHHPSFATHNTEPFGP---VPKYRGKCEVDPDTK  199

Query  601   ATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRF  780
              + CNGKIVGAQ+FA AA AAG FN +  +ASP D DGHGSHTA+ AAGN   PV  +  
Sbjct  200   RSLCNGKIVGAQHFAAAATAAGAFNPAIDFASPLDGDGHGSHTAAIAAGNNGIPVRMHGH  259

Query  781   NYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsgD  954
              +G ASGMAP A IAVYKALY  FGG+++DVVAA++QAV+DGVDIL+LSV   S   +  
Sbjct  260   EFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIEQAVQDGVDILNLSVGPNSPPATTR  319

Query  955   SAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVL  1134
             + FLN  +  LL A +AGV VVQAAGN GP  +S+LS+SPW+TSVAA+  DRRY N + L
Sbjct  320   TTFLNPFDATLLSAVKAGVFVVQAAGNGGPFPKSLLSYSPWITSVAAAIDDRRYKNHLTL  379

Query  1135  GNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLV  1314
             GNG+   G GL+P T+    F L AA DV   +++    +   CQ       +LV G ++
Sbjct  380   GNGKILPGIGLAPATSWNKTFTLVAANDVML-DASVTKYSPSDCQRPEVLNKNLVEGNIL  438

Query  1315  ICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNM  1494
             +C Y+++F   +AS+  V++T    GA GFVL ++    S   K   V + IPG++I ++
Sbjct  439   LCGYSFNFVVGSASVKKVSETAKSLGAVGFVLAVENV--SPGTKFDPVPVGIPGIVITDV  496

Query  1495  EASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNAL  1674
               S  L  YYN +T R  +GR  +F+AT  I DG   I     P VA +S+RGP++ +  
Sbjct  497   SKSMELIDYYNISTSRDWTGRVRSFKATGSIGDGLMPILHKSAPQVALFSARGPNIKDYS  556

Query  1675  LDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDR  1854
                AD+LKP+I+APG  IWAAW+PN   D    G+ FAL+SGTSMA PHIAGIAAL+K +
Sbjct  557   FQDADLLKPDILAPGDLIWAAWAPNGTDDSNYIGEGFALISGTSMAAPHIAGIAALVKQK  616

Query  1855  HPNWKPSAITSAMMTSADVTDRl-----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             HP+W P+AI SA+MT++   DR               +  L  ATPFD+GSG +NP  AL
Sbjct  617   HPHWSPAAIKSALMTTSTTLDRADRPLLAQQYSGSSETITLVSATPFDYGSGHVNPRAAL  676

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+   + Y+ FLCA+PG+D   ++      C  +      DLNTPS+T+++LVG+
Sbjct  677   DPGLIFDAGHEDYVMFLCAIPGIDPHEIKNFTSSSC-NSTVGRAYDLNTPSITVAHLVGT  735

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV R VTNV   +E Y +  R    + + + P    +   GSR   + L     T +YS
Sbjct  736   QTVTRTVTNV-AEEETYVLAPRMSPDIAIEVDPPAMTLLPGGSRKFTVTLTVRSVTGTYS  794

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+++ G R H VR+P
Sbjct  795   FGEVLMKGSRGHKVRIP  811



>ref|XP_010541122.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
Length=836

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/798 (44%), Positives = 477/798 (60%), Gaps = 30/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A++Y+V ++  P +S R                I  TS  VT Y + + K+HD+ LG L
Sbjct  39    KAEVYIVTVDGDPIISYRGGENGFEATALESDEKIDTTSELVTSYARHLEKKHDMLLGML  98

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
              +   Y KLYSY HL+NGFA H+  ++A + L ++ GV+ +  D K+ K+TTHTP+FLG+
Sbjct  99    FQEGTYKKLYSYKHLINGFAAHITPEQA-ETLRRSPGVKSVDRDWKVRKLTTHTPEFLGL  157

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG +D+GI+P H SF+S      G       + GKC    N
Sbjct  158   PTDVWPTGGGYDRAGEDIVIGFVDSGIHPHHPSFASHHTAPYGP---LSSYKGKCEDDPN  214

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                + CNGKI+GAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN   PV  +
Sbjct  215   TKKSFCNGKIIGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIPVRLH  274

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
              + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   +
Sbjct  275   GYEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPAT  334

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N +
Sbjct  335   TKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHL  394

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+   G GLSP T     + + AA DV   +S+A   +   CQ        L+ G 
Sbjct  395   TLGNGKMLPGIGLSPSTHPHRSYTMVAANDVAL-DSSAAKFSPADCQRPEVLNKRLIEGN  453

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  VA+T    GA GFVL ++    S   K   V   IPG++I 
Sbjct  454   ILLCGYSFNFVVGTASIKKVAETAKHLGAVGFVLVVENV--SPGTKFDPVPSPIPGILIT  511

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
              +  ST L  YYN  T R  +GR   F+A   I DG   I     P VA +S+RGP+  +
Sbjct  512   EVSKSTDLIDYYNVTTSRDWTGRVKTFKAIGSIGDGLAPILHKSAPEVALFSARGPNTKD  571

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                + AD+LKP+I+APG  IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K
Sbjct  572   FSFEDADLLKPDILAPGCLIWAAWSPNGTDEANYVGEGFAMISGTSMAAPHIAGIAALVK  631

Query  1849  DRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP W P+AI SA+MT++   DR    L +   ++    +L  ATPFD+GSG +NP  A
Sbjct  632   QKHPQWSPAAIKSALMTTSTTIDRGGRPLQAQQYSETEVVRLIKATPFDYGSGHVNPRAA  691

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ Y+ FLC  PG+D   +R      C  + K   S+ N+PS+ IS+LV 
Sbjct  692   LDPGLIFDAGYEDYLGFLCTTPGIDAHEIRNYTNRACDYSMKH-PSNFNSPSIAISHLVR  750

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             + TV RRVTNV   +E + +  R    + + + P    + A  SR   + L     T  Y
Sbjct  751   TITVTRRVTNVAEEEETFTITARMQPSIAIEVSPPAMTLRAGASRKFSVTLTVRTVTGDY  810

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFG++ L G R H VR+P
Sbjct  811   SFGQVTLKGSRGHKVRIP  828



>ref|XP_011094092.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=821

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/802 (45%), Positives = 479/802 (60%), Gaps = 33/802 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS------------------TRIKGTSGNVTMYKQRMTKQHDVF  222
               +A+IY+V +E  P VS                   +I  TS  V  Y   + K+HD+ 
Sbjct  21    FGKAEIYIVTLEGEPVVSYKGGIEGFEATAVEHDSDEKIDMTSELVLSYAHHLEKRHDML  80

Query  223   LGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPD  402
             L  L     Y KLYSY HL+NGFAVH+  ++A +IL +A GV+ +  D K+ K+TTHTP 
Sbjct  81    LAMLFDEGTYKKLYSYRHLINGFAVHISPEQA-EILGRAPGVKSVERDWKVRKLTTHTPQ  139

Query  403   FLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCI  582
             FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++   +N        K+ GKC 
Sbjct  140   FLGLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFAT---HNTDPYGPVPKYRGKCE  196

Query  583   TGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTP  762
                +     CNGKIVGAQ+FA AA AAG FN    + SP D DGHGSHTA+ AAGN   P
Sbjct  197   VDPDTKRDFCNGKIVGAQHFAEAAKAAGAFNPDIDFDSPLDGDGHGSHTAAIAAGNNGVP  256

Query  763   VITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gps  936
             V      +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDIL+LSV   S
Sbjct  257   VRLCGIEFGKASGMAPRARIAVYKALYRIFGGFVADVVAAIDQAVHDGVDILNLSVGPNS  316

Query  937   svpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRY  1116
                +  + FLN  +  LL A +AGV VVQAAGN GP  +++LS+SPW+ SVAA+  DRRY
Sbjct  317   PPATTKTTFLNPFDATLLSAVKAGVFVVQAAGNGGPFPKTVLSYSPWIASVAAAVDDRRY  376

Query  1117  TNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSL  1296
              N + LGNG   +G GLSP T G   F L AA DV   +S A   +   CQ       +L
Sbjct  377   KNHLTLGNGNILAGIGLSPATHGNKTFTLVAANDVLLDSSVAKY-SPSDCQRPEVLNKNL  435

Query  1297  VRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPG  1476
             V G +++C Y+++F    ASI  V+DT    GA GFVL ++    S   K   V +  PG
Sbjct  436   VEGNILLCGYSFNFVVGTASIKRVSDTAKALGAVGFVLAVEN--ASPGTKFDPVPVSTPG  493

Query  1477  LIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGP  1656
             ++I ++  S  L  YYN +T R  +GR  +F+A   I +G + I     P VA +S+RGP
Sbjct  494   ILITDVSKSMELIDYYNVSTPRDWTGRVKSFKAVGSIGEGLKPILHKSAPQVALFSARGP  553

Query  1657  DVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIA  1836
             ++ +     AD+LKP+I+APGS IWAAW+PN   +    G+ FA++SGTSMATPHIAGIA
Sbjct  554   NIKDYSFRDADLLKPDILAPGSLIWAAWAPNGTDEPNYVGEGFAMISGTSMATPHIAGIA  613

Query  1837  ALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFIN  2004
             AL+K ++P+W P+AI SA+MT++   DR      +   +   +  L PATPFD+GSG +N
Sbjct  614   ALVKQKNPHWSPAAIKSALMTTSTTLDRAERPLQAQQYSGSETMSLVPATPFDYGSGHVN  673

Query  2005  PSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTIS  2184
             P  AL+PGL+F+  ++ Y+ FLC  PG+D   ++      C        S+LNTPSVTIS
Sbjct  674   PRAALDPGLIFDAGYEDYLGFLCTTPGIDALEIKNYTHTPCNYTLGH-PSNLNTPSVTIS  732

Query  2185  NLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKA  2364
             +LVG++TV R VTNV   +E Y +  R    V +   P    +    SR   + L A   
Sbjct  733   HLVGTQTVTRTVTNV-AEEETYTITARMAPAVAIETSPPAMTLKPGMSRKFSVTLTARSV  791

Query  2365  TNSYSFGEMILLGDRNHIVRVP  2430
             T +YSFGE++L G R H VR+P
Sbjct  792   TGTYSFGEVLLKGSRGHKVRIP  813



>ref|NP_565447.1| subtilisin-like serine protease 3 [Arabidopsis thaliana]
 gb|AAD12040.1| subtilisin-like serine protease [Arabidopsis thaliana]
 gb|AAK93686.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAM91760.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC06854.1| subtilisin-like serine protease 3 [Arabidopsis thaliana]
Length=815

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/797 (44%), Positives = 476/797 (60%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A++Y+V ME  P +S                 +I  +S  VT+Y + + ++HD+ LG L 
Sbjct  19    AEVYIVTMEGDPIISYKGGENGFEATAVESDEKIDTSSELVTVYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  ++A + L +A GVR + +D K+ ++TTHTP+FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPEQA-ETLRRAPGVRSVDKDWKVRRLTTHTPEFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LPHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN   P+  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIPLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSPPT     + L +A DV   +S+        CQ    F   LV G +
Sbjct  375   LGNGKMLAGMGLSPPTRPHRLYTLVSANDVLL-DSSVSKYNPSDCQRPEVFNKKLVEGNI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V  T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVATAKHLGAAGFVLVVENV--SPGTKFDPVPSAIPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN++T R  +GR  +F+A   I DG   +     P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNASTSRDWTGRVKSFKAEGSIGDGLAPVLHKSAPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  552   SFQDADLLKPDILAPGYLIWAAWCPNGTDEPNYVGEGFALISGTSMAAPHIAGIAALVKQ  611

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NPS AL
Sbjct  612   KHPQWSPAAIKSALMTTSTVIDRAGRLLQAQQYSDTEAVTLVKATPFDYGSGHVNPSAAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+    +R      C  + K   S+ N PS+ +S+LVG+
Sbjct  672   DPGLIFDAGYEDYLGFLCTTPGISAHEIRNYTNTACNYDMKH-PSNFNAPSIAVSHLVGT  730

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV R+VTNV   +E Y +  R    + + + P    +    +R   + +     +  YS
Sbjct  731   QTVTRKVTNVAEVEETYTITARMQPSIAIEVNPPAMTLRPGATRTFSVTMTVRSVSGVYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H VR+P
Sbjct  791   FGEVKLKGSRGHKVRIP  807



>ref|XP_003547451.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=827

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/804 (44%), Positives = 487/804 (61%), Gaps = 34/804 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS--------------------TRIKGTSGNVTMYKQRMTKQHD  216
               +A++Y+V +E  P +S                     ++  TS  V  Y + + K+HD
Sbjct  24    FGKAEVYIVTVEGEPIISYKGGIDGFEATAVESDDDDDEKLDSTSEVVVSYARHLEKRHD  83

Query  217   VFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHT  396
             + LG L  R  Y KLYSY HL+NGFAVH+  ++A  + H A GV+ +  D K++++TTHT
Sbjct  84    MLLGMLFERGTYNKLYSYRHLINGFAVHLSPEQAETLRH-APGVKSVERDWKVKRLTTHT  142

Query  397   PDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGK  576
             P FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++      G      ++ GK
Sbjct  143   PQFLGLPTGVWPTGGGYERAGEDIVIGFVDSGIYPHHPSFTTHNTEPYGP---VSRYRGK  199

Query  577   CITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYH  756
             C    +   + CNGKI+GAQ+FA+AAIAAG FN S  + SP D DGHGSHTAS AAG   
Sbjct  200   CEVDPDTKRSFCNGKIIGAQHFAQAAIAAGAFNPSIDFDSPLDGDGHGSHTASIAAGRNG  259

Query  757   TPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgp  933
              PV  +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP
Sbjct  260   IPVRMHGHEFGKASGMAPRARIAVYKALYRLFGGFIADVVAAIDQAVHDGVDILSLSVGP  319

Query  934   ssv-psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDR  1110
             +S   +  + FLN  +  LL A +AGV V QAAGN GP  +S++S+SPW+ +VAA+  DR
Sbjct  320   NSPPSNTKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKSLVSYSPWIATVAAAIDDR  379

Query  1111  RYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVP  1290
             RY N ++LGNG+  +G GLSP T     + L AA DV   +S+    +   CQ       
Sbjct  380   RYKNHLILGNGKILAGLGLSPSTRLNQTYTLVAATDVLL-DSSVTKYSPTDCQRPELLNK  438

Query  1291  SLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQI  1470
             +L++G +++C Y+Y+F   +ASI  V++T    GA GFVL ++    S   K   V + I
Sbjct  439   NLIKGNILLCGYSYNFVIGSASIKQVSETAKALGAVGFVLCVENV--SPGTKFDPVPVGI  496

Query  1471  PGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSR  1650
             PG++I +   S  L  YYN +T R  +GR   F  T +I DG   I     P VA +S+R
Sbjct  497   PGILITDASKSKELIDYYNISTPRDWTGRVKTFEGTGKIEDGLMPILHKSAPQVAMFSAR  556

Query  1651  GPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAG  1830
             GP++ +     AD+LKP+I+APGS IWAAWS N   +    G+ FA++SGTSMA PHIAG
Sbjct  557   GPNIKDFSFQEADLLKPDILAPGSLIWAAWSLNGTDEPNYVGEGFAMISGTSMAAPHIAG  616

Query  1831  IAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGF  1998
             IAALIK +HP+W P+AI SA+MT++   DR      + L ++  + +L  ATPFD+GSG 
Sbjct  617   IAALIKQKHPHWSPAAIKSALMTTSTTLDRAGNPILAQLYSETEAMKLVKATPFDYGSGH  676

Query  1999  INPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVT  2178
             +NP  AL+PGL+F+  ++ Y+ FLC  PG+D   ++      C  N     S+LNTPS+T
Sbjct  677   VNPRAALDPGLIFDAGYEDYLGFLCTTPGIDVHEIKNYTNSPC-NNTMGHPSNLNTPSIT  735

Query  2179  ISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNAT  2358
             IS+LV S+ V R VTNV   +E Y +  R    V + + P    I A  SR   + L   
Sbjct  736   ISHLVRSQIVTRTVTNVADEEETYVITARMQPAVAIDVNPPAMTIKASASRRFTVTLTVR  795

Query  2359  KATNSYSFGEMILLGDRNHIVRVP  2430
               T +YSFGE+++ G R H VR+P
Sbjct  796   SVTGTYSFGEVLMKGSRGHKVRIP  819



>gb|ACC68158.1| putative subtilase family protein [Arabidopsis halleri subsp. 
halleri]
Length=815

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/797 (44%), Positives = 474/797 (59%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A++Y+V ME  P +S                 +I  +S  VT+Y + + ++HD+ LG L 
Sbjct  19    AEVYIVTMEGDPIISYKGGENGFEATAVESDEKIDTSSELVTLYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  ++A + L +A GVR + +D K+ ++TTHTP+FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPEQA-ETLRRAPGVRSVDKDWKVRRLTTHTPEFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LHHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN   P+  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIPLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSPPT     + L +A DV   +S+        CQ        LV G +
Sbjct  375   LGNGKMLAGMGLSPPTRPHRLYTLVSANDVLL-DSSVSKYNPSDCQRPEVLNKKLVEGNI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V  T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVATAKHLGAAGFVLVVENV--SPGTKFDPVPSAIPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R  +GR  +F+A   I DG   +     P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNVSTSRDWTGRVKSFKAEGSIGDGLAPVLHKSAPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  552   SFQDADLLKPDILAPGYLIWAAWCPNGTDEPNYVGEGFALISGTSMAAPHIAGIAALVKQ  611

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NPS AL
Sbjct  612   KHPQWSPAAIKSALMTTSTVIDRAGRLLQAQQYSDTEAVTLVKATPFDYGSGHVNPSAAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+    +R      C  + K   S+ N PS+ +S+LVG+
Sbjct  672   DPGLIFDAGYEDYLGFLCTTPGISAHEIRNYSNTPCNYDMKH-PSNFNAPSIAVSHLVGT  730

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    +    SR   + +     +  YS
Sbjct  731   QTVTRRVTNVAEVEETYTITARMQPSIAIEVNPPAMTLRPGASRTFSVTMTVRSVSGVYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H VR+P
Sbjct  791   FGEVKLKGSRGHKVRIP  807



>ref|XP_008391577.1| PREDICTED: subtilisin-like protease isoform X1 [Malus domestica]
 ref|XP_008391578.1| PREDICTED: subtilisin-like protease isoform X1 [Malus domestica]
Length=820

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/800 (43%), Positives = 486/800 (61%), Gaps = 31/800 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A +Y+V +E  P +S                 +I  TS +VT Y + +  +HD+ LG
Sbjct  22    VGKADVYIVTIEGEPIISYQGGVDGFEATAVESDEKIDTTSESVTSYARHLESKHDMLLG  81

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L    +Y KLYSY HL+NGFAVH+  ++A + L +A GV+ +  D K+ ++TTHTP FL
Sbjct  82    MLFEEGSYQKLYSYQHLINGFAVHISHEQA-ETLMRAPGVKSVERDWKVRRLTTHTPQFL  140

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SF+S   +N        K+ GKC   
Sbjct  141   GLPTGVWPTGGGSDRAGEDIVIGFVDSGIYPHHPSFAS---HNTDPYGPVPKYRGKCEVD  197

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              +   + CNGKI+GA +FA+AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV 
Sbjct  198   PDTKRSFCNGKIIGAHHFAKAAIAAGVFNPSIDFASPMDGDGHGSHTAAIAAGNNGIPVR  257

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-  942
              +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP+S  
Sbjct  258   MHGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVYDGVDILSLSVGPNSPP  317

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
              +  + +LN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N
Sbjct  318   ATTKTTYLNPFDATLLSAVKAGVFVAQAAGNGGPFPKTLVSYSPWIASVAAAIDDRRYKN  377

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+  +G GLSP T     + L AA DV   +S     +   CQ       +LV+
Sbjct  378   HLTLGNGKILAGLGLSPSTHPNQTYTLVAANDVLLDSSVVKY-SPSDCQKPEVLNKNLVQ  436

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + +PG++
Sbjct  437   GNVLLCGYSFNFVVGTASIKKVSETAKSLGAIGFVLAVENV--SPGTKFDPVPVGVPGIL  494

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++E S  L  YYN +T+R  +GR  +F+A   I +G         P VA +S+RGP++
Sbjct  495   ITDVEKSMDLIDYYNISTVRDWTGRVKSFKAIGSIGNGLMPXLHKSAPQVALFSARGPNI  554

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL
Sbjct  555   KDFSFQEADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAAL  614

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPS  2010
             +K +HP+W P+AI SA+MT++   DR      +   ++  + +   ATPFD+GSG ++P 
Sbjct  615   VKQKHPHWSPAAIKSALMTTSTTIDRAGKPLQAQQYSETQTIKFVGATPFDYGSGHVDPK  674

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNL  2190
              AL+PGL+F+  +Q Y+ FLC   G++   ++      C        S+ N+PS+T+++L
Sbjct  675   AALDPGLIFDAGYQDYLGFLCTTAGINSNEIKNYTNSPCNYTMGH-PSNFNSPSITVAHL  733

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
             V S+TV R VTNV   +E Y +  R    + +   P+   +    SR   + L     T 
Sbjct  734   VKSQTVTRTVTNV-AEEETYVITTRMAPAIAIEASPRAMTLRPGASRKFSVTLTVRSITG  792

Query  2371  SYSFGEMILLGDRNHIVRVP  2430
             +YSFGE+I+ G R H VR+P
Sbjct  793   AYSFGEVIMKGSRGHKVRIP  812



>ref|XP_010433037.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010433038.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010433039.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010433040.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010433041.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
Length=816

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/797 (45%), Positives = 479/797 (60%), Gaps = 29/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S                 +I  TS  VT Y + + ++HD+ LG L 
Sbjct  19    AEIYIVTMEGEPIISYKGGDNGFEATAVESDEKIDTTSELVTSYARHLERKHDMLLGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  D+A ++L +A GV+ +  D K+ K+TTHTP FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPDQA-EMLRRAPGVKSVDRDWKVRKLTTHTPQFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG ID+GI P H SF+S        P  + K  GKC    + 
Sbjct  138   TDVWPTGGGYDRAGEDIVIGFIDSGIFPHHPSFASHHTSVPYGPHPSYK--GKCEDDPHT  195

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN    V  + 
Sbjct  196   RKSFCNGKIIGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGITVRMHG  255

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-psg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP+S   + 
Sbjct  256   YEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPATT  315

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  316   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  375

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV    S+        CQ        LV G +
Sbjct  376   LGNGKMLAGMGLSPSTRPHRSYKMVSANDVLL-GSSGMKYNPSDCQKPEVLNKKLVEGNI  434

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  435   LLCGYSFNFVAGSASIKKVAETAKHLGAAGFVLVVENV--SPGTKFDPVPSCIPGILITD  492

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R   GR   F+A   I DG   I     P VA +S+RGP+  + 
Sbjct  493   VSKSMDLIDYYNVSTSRDWMGRVKEFKAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  552

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IW+AWS N   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  553   SFQDADLLKPDILAPGSLIWSAWSENGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  612

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   ++  +  L  ATPFD+GSG +NPS AL
Sbjct  613   KHPLWSPAAIKSALMTTSTVIDRAGRPLQAQQYSETETITLVKATPFDYGSGHVNPSAAL  672

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ YI FLC  PG+D   +       C   K    S+ NTPS+ IS+LV +
Sbjct  673   DPGLIFDAGYEDYIGFLCTTPGIDAHEITNFTNTPC-NFKMVHPSNFNTPSIAISHLVRT  731

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    + A  SR   + L     T +YS
Sbjct  732   QTVTRRVTNVADEEETYTITSRMEPAIAIEVSPPAMTVRAGASRTFSVTLTVRSVTGAYS  791

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H V +P
Sbjct  792   FGEVTLKGSRGHKVTLP  808



>emb|CDY43550.1| BnaA01g06940D [Brassica napus]
Length=818

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/797 (44%), Positives = 475/797 (60%), Gaps = 28/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S                 +I  +S  VT Y + + ++HD+ LG L 
Sbjct  20    AEIYIVTMEGDPIISYNGGVNGFEATAVESDEKIDTSSELVTSYARHLERKHDMLLGMLF  79

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA H+   +A ++L +A GV+ +  D K++K+TTHTP FLG+P
Sbjct  80    EEGSYKKLYSYKHLINGFAAHLSPAQA-EVLRRAPGVKHLSRDWKVKKLTTHTPQFLGLP  138

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S        P  + K  GKC      
Sbjct  139   TDVWPTGGGYDRAGEDIVIGFVDSGIFPHHPSFASHHTAVPYGPHPSYK--GKCEDDPRT  196

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  197   KVSFCNGKIIGAQHFAEAAKAAGAFNPEVDFASPMDGDGHGSHTAAIAAGNNGIPVRMHG  256

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG++SDVVAA+D AV DGVDILSLSV   S   + 
Sbjct  257   YEFGKASGMAPRARIAVYKALYRLFGGFVSDVVAAIDMAVHDGVDILSLSVGPNSPPATT  316

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  317   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  376

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV   +S         CQ        LV+G +
Sbjct  377   LGNGKMLAGIGLSPSTRPHRSYKMVSANDVLLDSSGGNKYNPSDCQKPEVLNKKLVQGNI  436

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  437   LLCGYSFNFVAGSASIKKVAETAKHLGAAGFVLVVENV--SPGTKFDPVPSCIPGILITD  494

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN  T R   GR   F+A   I DG   I     P VA +S+RGP+  + 
Sbjct  495   VSKSMDLIDYYNVTTSRDWMGRVKDFKAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  554

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IW+AWS N   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  555   SFQDADLLKPDILAPGSLIWSAWSENGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  614

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   ++  +  L  ATPFD+GSG ++PS AL
Sbjct  615   KHPQWSPAAIKSALMTTSTVMDRAGRPLQAQQYSETETVTLVKATPFDYGSGHVSPSSAL  674

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+D   +R      C    K   S+ N+PS+ IS+LV +
Sbjct  675   DPGLIFDAGYEDYLGFLCTTPGIDAHEIRNFTNTPCNFKMKH-PSNFNSPSIAISHLVRT  733

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +T+ RRVTNV   +E Y +  R    + + + P    + A  SR   + L     T  YS
Sbjct  734   QTITRRVTNVAEEEETYTITSRMEPSIAIEVSPPAMTLRAGASRSFTVTLTVRSVTGVYS  793

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H V +P
Sbjct  794   FGEVTLKGSRGHKVSIP  810



>ref|XP_003595054.1| Subtilisin-like serine protease [Medicago truncatula]
Length=830

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/758 (46%), Positives = 475/758 (63%), Gaps = 17/758 (2%)
 Frame = +1

Query  178   VTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGI  357
             VT Y + + K+HD+ LG L     YTKLYSY HL+NGFAVH+ S + ++ L  A GV+ +
Sbjct  75    VTSYARHLEKRHDMLLGMLFESGTYTKLYSYRHLINGFAVHL-SPEQVETLRHAPGVKSV  133

Query  358   YEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYN  537
               D K+ ++TTHTP FLG+P +VWP  GG   +GE +VIG +D+GI+P H SF++     
Sbjct  134   ERDWKVRRLTTHTPQFLGLPTSVWPTGGGCDRAGEDIVIGFVDSGIDPHHPSFTTHNTEP  193

Query  538   IGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGH  717
              G      K+ GKC        + CNGKI+GAQ+FA+AAIA+G+FN S  +ASP D DGH
Sbjct  194   YGP---LAKYRGKCEVDPKTKKSFCNGKIIGAQHFAQAAIASGNFNPSIDFASPLDGDGH  250

Query  718   GSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqav  894
             GSHTAS AAG    PV      +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV
Sbjct  251   GSHTASIAAGRNGIPVRLYGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAALDQAV  310

Query  895   edgvdIlslsvgpssv-psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFS  1071
              DGVDILSLSVGP+    +  + FLN  +  LL A +AGV V QAAGN GP  +S++S+S
Sbjct  311   HDGVDILSLSVGPNGPPAATKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKSLVSYS  370

Query  1072  PWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLL  1251
             PW+ SVAA+  DRRY N + LGNG+  +G GLSP T     F L AA DV   +S+    
Sbjct  371   PWIVSVAAAIDDRRYKNHLTLGNGKILAGLGLSPSTHLNGTFTLVAANDVLL-DSSVMKY  429

Query  1252  TVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIG  1431
             +   CQ       +L++GK+++C Y+Y+F    AS+  V++T    GA GFVL ++    
Sbjct  430   SPTDCQRPEVLNKNLIKGKILLCGYSYNFVVGTASMKKVSETAKALGAVGFVLCVENV--  487

Query  1432  SEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIY  1611
             S   K   V + +PG++I ++  S  L  YYN +T R  +GR  +F+ T +I DG + I 
Sbjct  488   SPGTKFDPVPVGLPGVLITDVRKSKELIDYYNISTTRDWTGRVKSFKGTGKIGDGLKPIL  547

Query  1612  SGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFAL  1791
                 P VA +S+RGP++ +     AD+LKP+I+APGS IW AWS N   +    G+ FA+
Sbjct  548   YKSAPQVALFSARGPNIRDFSFQEADLLKPDILAPGSLIWGAWSRNGTDEPNYDGEGFAM  607

Query  1792  VSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqq  1959
             VSGTSMA PHIAGIAALIK +HP W P+AI SA++T+    DR    + S   ++  + +
Sbjct  608   VSGTSMAAPHIAGIAALIKQKHPRWSPAAIKSALLTTTTTLDRGGNPILSQQYSETEAMK  667

Query  1960  lapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENK  2139
             L  ATPFD+G+G +NP  AL+PGL+F+  ++ Y+ FLC  PG+D   +++     C  N+
Sbjct  668   LVKATPFDYGNGHVNPRAALDPGLIFDAGYKDYLGFLCTTPGIDVHEIKKYTNSPC--NR  725

Query  2140  KFWCS-DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFIS  2316
                   +LNTPS+T+S+LV ++T+ R+VTNV   +E Y +  R    V + I P    I 
Sbjct  726   TMGHPYNLNTPSITVSHLVRTQTITRKVTNV-AKEETYVLTARMQPAVAIEITPPAMTIR  784

Query  2317  ADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVP  2430
             A  SR   + L     T +YSFGE+++ G R H VR+P
Sbjct  785   AGASRRFTVTLTVRSVTGTYSFGEVLMKGSRGHKVRIP  822



>ref|XP_010438228.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010438229.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010438230.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010438232.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
Length=815

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/797 (45%), Positives = 478/797 (60%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S                 +I  TS  VT Y + + ++HD+ LG L 
Sbjct  19    AEIYIVTMEGEPIISYKGGDNGFEATAVESDEKIDTTSELVTSYARHLERKHDMLLGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  D+A ++L +A GV+ +  D K+ K+TTHTP FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPDQA-EMLRRAPGVKSVNRDWKVRKLTTHTPQFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG ID+GI P H SF+S        P  + K  GKC    + 
Sbjct  138   TDVWPTGGGYDRAGEDIVIGFIDSGIFPHHPSFASHHTSVPYGPHPSYK--GKCEEDPHT  195

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  196   RKSFCNGKIIGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIPVRMHG  255

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  256   YEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPATT  315

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  316   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  375

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV    S+        CQ        LV G +
Sbjct  376   LGNGKMLAGMGLSPSTRPHRSYKMVSANDVLL-GSSGMKYNPSDCQKPEVLNKKLVEGNI  434

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  435   LLCGYSFNFVAGSASIKKVAETAKHLGAAGFVLVVENV--SPGTKFDPVPSCIPGILITD  492

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R   GR   F+A   I DG   I     P VA +S+RGP+  + 
Sbjct  493   VSKSMDLIDYYNVSTSRDWMGRVKEFKAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  552

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IW+AWS N   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  553   SFQDADLLKPDILAPGSLIWSAWSENGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  612

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   +++ +  L  ATPFD+GSG +NPS AL
Sbjct  613   KHPLWSPAAIKSALMTTSTVIDRAGRPLQAQQYSERETITLVKATPFDYGSGHVNPSAAL  672

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ YI FLC  PG+D   +       C   K    S+ NTPS+ IS+LV +
Sbjct  673   DPGLIFDAGYEDYIGFLCTTPGIDAHEITNFTNTPC-NFKMVHPSNFNTPSIAISHLVRT  731

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    + A  SR   + L     T +YS
Sbjct  732   QTVTRRVTNVAD-EETYTITSRMEPAIAIEVSPPAMTVRAGASRTFSVTLTVRSVTGAYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H V +P
Sbjct  791   FGEVTLKGSRGHKVTLP  807



>emb|CDX82627.1| BnaC07g02390D [Brassica napus]
Length=816

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/798 (44%), Positives = 476/798 (60%), Gaps = 31/798 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A++Y+V ME  P +S                 +I  +S  VT Y + + ++HD+ LG L 
Sbjct  19    AEVYIVTMEGEPIISYQGGENGYEATAVESDEKIDTSSELVTSYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
              + +Y KLYSY HL+NGFA H+  ++A + L +  GV+ + +D K+ ++TTHTP+FLG+P
Sbjct  79    EKGSYKKLYSYKHLINGFAAHISPEQA-ETLRRTPGVKSVNKDWKVRRLTTHTPEFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGWERAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LPHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN +  YASP D DGHGSHTA+ AAGN   P+  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPNIDYASPMDGDGHGSHTAAIAAGNNGIPLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGNASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ +VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWIMTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     + L +A DV   +S +     E CQ    F   LV GK+
Sbjct  375   LGNGKMLAGMGLSPSTRPHKMYTLVSANDVLLDSSVSKHNPSE-CQRPEVFNKKLVEGKI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V  TV   GAAGFVL ++    S   K   V   +PG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVATVKHLGAAGFVLVVENV--SPGTKFDPVPSAVPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R  +GR  +F A   I DG   +     P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNVSTSRDWTGRVKSFNAQGSIGDGLAPVLHKSSPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGD-KYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                 AD+LKP+I+APG  IWAAW PN   +  Y+ G+ FAL+SGTSMA PHIAGIAAL+K
Sbjct  552   SFQDADLLKPDILAPGYLIWAAWCPNGTDEANYVAGEGFALISGTSMAAPHIAGIAALVK  611

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NPS A
Sbjct  612   QKHPRWSPAAIKSALMTTSKVVDRTGRLLQAQQYSDTEAVTLVKATPFDYGSGHVNPSAA  671

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ Y+ FLC  PG+D   +R      C    K   S+ N PS+ IS+LVG
Sbjct  672   LDPGLIFDAGYEDYLGFLCTTPGIDAHEIRNYTNTPCNYEMKH-PSNFNAPSIAISHLVG  730

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++TV RRV NV   +E Y +  R    + + + P    +    SR   + L     +  Y
Sbjct  731   TQTVTRRVKNVAEVEETYTITARMQPSIAIEVNPPAMTLRPGASRSFSVTLTVRSVSGVY  790

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+ L G R H VR+P
Sbjct  791   SFGEVKLKGSRGHKVRIP  808



>gb|KHN15331.1| Subtilisin-like protease [Glycine soja]
Length=819

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/802 (44%), Positives = 483/802 (60%), Gaps = 34/802 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS--------------------TRIKGTSGNVTMYKQRMTKQHDVF  222
             EA++Y+V +E  P +S                     ++  TS  V  Y + + K+HD+ 
Sbjct  18    EAEVYIVTVEGEPIISYKGGIDGFEATAVESDDDDDEKLDSTSEVVVSYARHLEKRHDML  77

Query  223   LGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPD  402
             LG L  R  Y KLYSY HL++GFAVH+  ++A  + H A GV+ +  D K++++TTHTP 
Sbjct  78    LGMLFERGTYNKLYSYRHLISGFAVHLSPEQAETLRH-APGVKSVERDWKVKRLTTHTPQ  136

Query  403   FLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCI  582
             FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++      G      ++ GKC 
Sbjct  137   FLGLPTGVWPTGGGYERAGEDIVIGFVDSGIYPHHPSFTTHNTEPYGP---VSRYRGKCE  193

Query  583   TGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTP  762
                +   + CNGKI+GAQ+FA+AAIAAG FN S  + SP D DGHGSHTAS AAG    P
Sbjct  194   VDPDTKRSFCNGKIIGAQHFAQAAIAAGAFNPSIDFDSPLDGDGHGSHTASIAAGRNGIP  253

Query  763   VITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gps  936
             V  +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S
Sbjct  254   VRMHGHEFGKASGMAPRARIAVYKALYRLFGGFIADVVAAIDQAVHDGVDILSLSVGPNS  313

Query  937   svpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRY  1116
                +  + FLN  +  LL A +AGV V QAAGN GP  +S++S+SPW+ +VAA+  DRRY
Sbjct  314   PPSNTKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKSLVSYSPWIATVAAAIDDRRY  373

Query  1117  TNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSL  1296
              N ++LGNG+  +G GLSP T     + L AA DV   +S+    +   CQ       +L
Sbjct  374   KNHLILGNGKILAGLGLSPSTRLNQTYTLVAATDVLL-DSSVTKYSPTDCQRPELLNKNL  432

Query  1297  VRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPG  1476
             ++G +++C Y+Y+F   +ASI  V++T    GA GFVL ++    S   K   V + IPG
Sbjct  433   IKGNILLCGYSYNFVIGSASIKQVSETAKALGAVGFVLCVENV--SPGTKFDPVPVGIPG  490

Query  1477  LIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGP  1656
             ++I +   S  L  YYN +T R  +GR   F  T +I DG   I     P VA +S+RGP
Sbjct  491   ILITDASKSKELIDYYNISTPRDWTGRVKTFEGTGKIEDGLMPILHKSAPQVAMFSARGP  550

Query  1657  DVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIA  1836
             ++ +     AD+LKP+I+APGS IWAAWS N   +    G+ FA++SGTSMA PHIAGIA
Sbjct  551   NIKDFSFQEADLLKPDILAPGSLIWAAWSLNGTDEPNYVGEGFAMISGTSMAAPHIAGIA  610

Query  1837  ALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFIN  2004
             ALIK +HP+W P+AI SA+MT++   DR      + L ++  + +L  ATPFD+GSG +N
Sbjct  611   ALIKQKHPHWSPAAIKSALMTTSTTLDRAGNPILAQLYSETEAMKLVKATPFDYGSGHVN  670

Query  2005  PSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTIS  2184
             P  AL+PGL+F+  ++ Y+ FLC  PG+D   ++      C  N     S+LNTPS+TIS
Sbjct  671   PRAALDPGLIFDAGYEDYLGFLCTTPGIDVHEIKNYTNSPC-NNTMGHPSNLNTPSITIS  729

Query  2185  NLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKA  2364
             +LV S+ V R VTNV   +E Y +  R    V + + P    I A  SR   + L     
Sbjct  730   HLVRSQIVTRTVTNVADEEETYVITARMQPAVAIDVNPPAMTIKASASRRFTVTLTVRSV  789

Query  2365  TNSYSFGEMILLGDRNHIVRVP  2430
             T  YSFGE+++ G R H VR+P
Sbjct  790   TGIYSFGEVLMKGSRGHKVRIP  811



>ref|XP_007138780.1| hypothetical protein PHAVU_009G236800g [Phaseolus vulgaris]
 gb|ESW10774.1| hypothetical protein PHAVU_009G236800g [Phaseolus vulgaris]
Length=820

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/802 (44%), Positives = 480/802 (60%), Gaps = 32/802 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS------------------TRIKGTSGNVTMYKQRMTKQHDVF  222
               +A+IY+V +E  P VS                   ++  TS  V  Y + + K+HD+ 
Sbjct  19    FGKAEIYIVTVEGEPIVSYTGGVDGFEATAVESDDDHKLDSTSEVVVSYARHLEKRHDML  78

Query  223   LGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPD  402
             LG L     Y KLYSY HL+NGFAVH+  ++A  + H A GV+ +  D K++++TTHTP 
Sbjct  79    LGLLFESGTYKKLYSYRHLINGFAVHLSPEQAETLRH-APGVKSVERDWKVKRLTTHTPQ  137

Query  403   FLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCI  582
             FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++   YN        ++ GKC 
Sbjct  138   FLGLPTGVWPTGGGYERAGEDIVIGFVDSGIYPHHPSFTT---YNTEPYGPVSRYRGKCE  194

Query  583   TGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTP  762
                +   + CNGKI+GAQ+FA+AAIAAG FN S  + SP D DGHGSHTAS AAG     
Sbjct  195   VDPDTKRSFCNGKIIGAQHFAKAAIAAGVFNPSIDFDSPLDGDGHGSHTASIAAGRTGIA  254

Query  763   VITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpss  939
             V      +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDIL+LSVGP S
Sbjct  255   VRMYGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILNLSVGPDS  314

Query  940   v-psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRY  1116
                +  + FLN  +  LL A +AGV V QAAGN GP  +S++S+SPW+ +VAA+  DRRY
Sbjct  315   PPSNTKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKSLVSYSPWIATVAAAIDDRRY  374

Query  1117  TNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSL  1296
              N ++L NG+  +G GLSP T     + L AA DV   +S+    +   CQ    F  +L
Sbjct  375   KNHLILENGKILAGIGLSPSTRLNQTYTLVAANDVLL-DSSVTKYSPTDCQRPEVFNKNL  433

Query  1297  VRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPG  1476
             ++G +++C Y+Y+F   +ASI  V++T    GA GFVL ++     E+     V + IPG
Sbjct  434   IKGNILLCGYSYNFVDGSASIKQVSETAKALGAVGFVLCVENVSPGEKFD--PVPVGIPG  491

Query  1477  LIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGP  1656
             ++I +   S  L  YYN +T R  +GR   F    +I DG   I     P VA +S+RGP
Sbjct  492   ILITDASKSKELIDYYNISTPRDWTGRVKTFTGKGKIEDGLMPILHKSAPQVAVFSARGP  551

Query  1657  DVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIA  1836
             ++ +     AD+LKP+I+APGS IWAAWS N   +    G+ FA++SGTSMA PHIAGIA
Sbjct  552   NIKDFSFQEADLLKPDILAPGSLIWAAWSLNGTDEPNFLGEGFAMISGTSMAAPHIAGIA  611

Query  1837  ALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFIN  2004
             AL+K +HP+W P+AI SA+MT++   DR      +    +  +  L  ATPFD+GSG ++
Sbjct  612   ALLKQKHPHWSPAAIKSALMTTSTTLDRAGNPILAQQYCESKAMNLVRATPFDYGSGHVH  671

Query  2005  PSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTIS  2184
             P  AL+PGLVF+  ++ Y+ FLC  PG+D   ++      C        S+LNTPS+TIS
Sbjct  672   PRAALDPGLVFDAGYEDYLGFLCTTPGIDVNEIKNYTNSPCNYTLGH-PSNLNTPSITIS  730

Query  2185  NLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKA  2364
             +LV ++ V R VTNV   +E Y +  R    V + + P    I A  SR   + L+    
Sbjct  731   HLVRTQIVTRTVTNVAHEEETYTMTARMQPAVAIDVNPPAMTIRAGSSRKFTVTLSVRSV  790

Query  2365  TNSYSFGEMILLGDRNHIVRVP  2430
             T +YSFGE+++ G R H VR+P
Sbjct  791   TGTYSFGEVLMKGSRGHKVRIP  812



>ref|XP_009137881.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
 ref|XP_009137882.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
Length=816

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/797 (44%), Positives = 476/797 (60%), Gaps = 29/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S                 +I  TS  VT Y + + ++HD+ LG L 
Sbjct  19    AEIYIVTMEGDPIISYKGGVNGFEATAVESDEKIDTTSELVTSYGRHLERKHDMLLGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
             +  +Y KLYSY HL+NGFA H+  D+A ++L ++ GV+ +  D K+ K+TTHTP FLG+P
Sbjct  79    KEGSYKKLYSYKHLINGFAAHLSPDQA-EMLRRSPGVKSVSRDWKVRKLTTHTPQFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG ID+GI P H SF+S        P  + K  GKC      
Sbjct  138   TDVWPTGGGYDRAGEDIVIGFIDSGIFPHHPSFASHHTSVPYGPHPSYK--GKCEDDPRT  195

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  196   KLSFCNGKIIGAQHFAEAAKAAGAFNPDVDFASPMDGDGHGSHTAAIAAGNNGVPVRMHG  255

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG++SDVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  256   YEFGKASGMAPRARIAVYKALYRLFGGFVSDVVAAIDQAVHDGVDILSLSVGPNSPPTTT  315

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  316   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  375

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV    S+        CQ        LV G +
Sbjct  376   LGNGKMLAGIGLSPSTRPHRSYKMVSANDVLL-GSSGVRYNPSDCQKPEVLNKKLVEGNI  434

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  435   LLCGYSFNFVAGSASIKKVAETARHLGAAGFVLVVENV--SPGTKFDPVPSGIPGILITD  492

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN  T R   GR  +F A   I DG   I     P VA +S+RGP+  + 
Sbjct  493   VSKSMDLIDYYNVTTSRDWMGRVKSFNAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  552

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IW+AWS N   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  553   SFQDADLLKPDILAPGSLIWSAWSQNGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  612

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   ++  +  L  ATPFD+GSG +NPS AL
Sbjct  613   KHPQWSPAAIKSALMTTSTVMDRAGRPLQAQQYSETETMTLVKATPFDYGSGHVNPSAAL  672

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGLVF+  ++ Y+ FLC  PG++   +R      C   K    S+ N+PS+ +S+LV +
Sbjct  673   DPGLVFDAGYEDYLGFLCTTPGINAHEIRNFTNTPC-NYKMRHPSNFNSPSIAVSHLVRT  731

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    + A  SR   + L     T  YS
Sbjct  732   QTVTRRVTNVAEEEETYTITSRMEPSIAIEVSPPAMTLRAGASREFSVTLTVRSVTGVYS  791

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H V +P
Sbjct  792   FGEVTLKGSRGHKVSLP  808



>gb|KDP40114.1| hypothetical protein JCGZ_02112 [Jatropha curcas]
Length=824

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/807 (44%), Positives = 473/807 (59%), Gaps = 38/807 (5%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV----------------STRIKGTSGNVTM-YKQRMTKQHDVFLGS  231
             E  +Y+VLME  P                    R  G +  V+  + +R+   HD  L S
Sbjct  24    ERSVYLVLMEGEPVAFHGGRSPHNYHHHHHHRKRKLGLNSEVSQAHAKRLVDSHDQLLQS  83

Query  232   LLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLG  411
              L   +Y+KLYS+ H++NGFAVHV   +  K L  A GV+ +  D   + MT++TP FLG
Sbjct  84    TLEIGSYSKLYSFKHIVNGFAVHVTPSQVDK-LRVAPGVKLVERDRGAKLMTSYTPQFLG  142

Query  412   IPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS----SPEEYNIGRPRITRKFTGKC  579
             +P  VW + GG   +GEG+VIG +DTGINP H SF+    +P   NI        F+G C
Sbjct  143   LPQGVWTQEGGDRNAGEGIVIGFVDTGINPRHPSFAYDPLNPLTSNISH------FSGTC  196

Query  580   ITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHT  759
              TG  FPA +CNGKIV A++F+  A A    + S    SPFDA GHGSH ASTAAGN   
Sbjct  197   QTGPRFPANSCNGKIVSAKFFSAGAQAIATLDPSVDILSPFDAVGHGSHVASTAAGNAGV  256

Query  760   PVITNRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpss  939
             PV+ N F YG ASGMAP A IAVYKA+Y   G ++DVVA +DQA  DGVDIL+LSVGP  
Sbjct  257   PVVANGFYYGRASGMAPRARIAVYKAVYPTVGTLTDVVAGIDQATMDGVDILTLSVGPDE  316

Query  940   vpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYT  1119
              P     FL+V +V +LFA RAGV VVQAAGN+GP   +++S+SPW   VAA TTDR Y 
Sbjct  317   PPEDTLTFLSVFDVFMLFARRAGVFVVQAAGNNGPDPSTVVSYSPWAVGVAACTTDRIYP  376

Query  1120  NSIVLGNGQTFSGSGLSPPT--AGKAFFQLAAAVDVCRRNSTAGLLT--VESCQDAMQFV  1287
              S++LGNGQ   G GLS PT   G+  ++L  A D  + N T       +E CQ      
Sbjct  377   GSLLLGNGQKVGGVGLSAPTFGDGRFLYKLVLAQDAVKANGTFPRTPQYIEECQYPESLD  436

Query  1288  PSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQ  1467
             PS+VR  +VICT++  F +  ++I  + DT    G  GF L  +P  G        +   
Sbjct  437   PSVVRDSIVICTFSTGFYNGTSTINAIIDTTRTLGFMGFALVANPIYG--DFIAEPIPFA  494

Query  1468  IPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSS  1647
             + G++I+N+  +  + QYY     R   G    F A A I +GR A + G+ P+V+ +SS
Sbjct  495   VSGIMISNVADAQIILQYYEQQIKRDERGFVTEFHARAAIGEGRVASFEGRAPIVSRFSS  554

Query  1648  RGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIA  1827
             RGPD  +     ADVLKP+I+APG  IWAAWSP S  +  + G  FAL+SGTSMATPHI 
Sbjct  555   RGPDFIDINRTPADVLKPDILAPGHQIWAAWSPLSALEPMLTGYKFALLSGTSMATPHIG  614

Query  1828  GIAALIKDRHPNWKPSAITSAMMTSADVTDRl-gspllaqqasqqlapaTPFDFGSGFIN  2004
             GIAA IK  +P W PS I+SAM T+A   D      L          P+T FD G+G +N
Sbjct  615   GIAAFIKQMNPFWTPSMISSAMSTTATKYDNYGQPILAEGFDINSFYPSTHFDLGAGLVN  674

Query  2005  PSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF-WCSDLNTPSVTI  2181
             P+R+++PGLVF + F+ YI FLC++P ++  +V+   G  C  N+ F   ++LN PSVTI
Sbjct  675   PTRSVDPGLVFTSEFEDYISFLCSLPNINRTTVKVATGESC--NQLFSHPANLNLPSVTI  732

Query  2182  SNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATK  2361
             S L GS+TV R V NVG   E Y   V  P G  VT+ P  F I+  G++H+ I    TK
Sbjct  733   SALKGSQTVQRSVKNVGSKPETYLGSVMSPNGTTVTLSPTWFTIAPQGTQHIEIQFLVTK  792

Query  2362  ATNSYSFGEMILLGDRNHIVRVPFAVY  2442
             A + +SFGE++  G  NHIVR+P +V+
Sbjct  793   AGDEFSFGEIVFTGSLNHIVRIPLSVF  819



>ref|XP_007154721.1| hypothetical protein PHAVU_003G141800g [Phaseolus vulgaris]
 gb|ESW26715.1| hypothetical protein PHAVU_003G141800g [Phaseolus vulgaris]
Length=817

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/798 (44%), Positives = 483/798 (61%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A+IY+V +E  P +S                 +I   S  VT Y + + K+HD+ LG L
Sbjct  21    DAEIYIVTVEGEPIISYTGGIDGFEATAVESDEKIDSESELVTSYARHLEKKHDMLLGLL  80

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
                  Y KLYSY HL+NGFAVH+  ++A + L +A GV+ +  D K+ K+TTHTP FLG+
Sbjct  81    FEEGTYQKLYSYRHLINGFAVHISPEQA-ETLRRAPGVKSVERDWKVRKLTTHTPQFLGL  139

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG +D+GI P H SF++      G      K+ GKC    +
Sbjct  140   PTGVWPTGGGFDRAGENIVIGFVDSGIYPHHPSFATHNAEPYGP---VPKYRGKCEADPD  196

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                + CNGKIVGAQ+FA+AAIAAG FN +  +ASP D DGHGSHTAS AAGN   PV  +
Sbjct  197   TKRSYCNGKIVGAQHFAQAAIAAGAFNPTIDFASPLDGDGHGSHTASIAAGNNGIPVRMH  256

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKALY  FGGY++DVVAA+DQAV DGVDILSLSV   S   +
Sbjct  257   GHEFGRASGMAPRARIAVYKALYRLFGGYVADVVAAIDQAVYDGVDILSLSVGPNSPPAA  316

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               ++FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N +
Sbjct  317   TRTSFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLISYSPWIASVAAAIDDRRYKNHL  376

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
             +LGNG+T +G GLSP T     + L AA DV   +S+    +   CQ       +L++G 
Sbjct  377   ILGNGKTLAGIGLSPSTHLNETYTLVAANDVLL-DSSVMKYSPTDCQRPELLNKNLIKGN  435

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  V+ T    GA GFVL ++    S   K   V + +PG++I 
Sbjct  436   ILLCGYSFNFVVGTASIKRVSATAKALGAVGFVLCVENV--SPGTKFDPVPVGLPGILIT  493

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             +   S  L  YYN  T R  +GR   F  T +I DG   I     P VA +S+RGP++ +
Sbjct  494   DASYSKDLIDYYNITTPRDWTGRVKRFEGTGKIGDGLMPILHKSAPQVALFSARGPNIKD  553

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAW PN   +    G+ FA++SGTSM+ PHIAGIAALIK
Sbjct  554   FSFQEADLLKPDILAPGSLIWAAWCPNGTDEPNYVGEGFAMISGTSMSAPHIAGIAALIK  613

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG ++P+ A
Sbjct  614   QKHPHWSPAAIKSALMTTSTTLDRAGNHLLAQQTSESEAMKLVKATPFDYGSGHVDPTAA  673

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ Y+ FLC  PG+D   +R      C        S+LNTPS+TIS+LV 
Sbjct  674   LDPGLIFDAGYKDYLGFLCTTPGIDVHEIRNYTHTPC-NTAMGKPSNLNTPSITISHLVR  732

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++ V R VTNV   +E Y +  R    V + + P    I A  SR   + L     T +Y
Sbjct  733   TQVVTRTVTNV-AEEETYVITARMEPAVAIEVNPPAMTIKAGASRQFSVTLTVRSVTGTY  791

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+++ G R H VR+P
Sbjct  792   SFGEVLMKGSRGHKVRIP  809



>ref|XP_002308119.1| subtilase family protein [Populus trichocarpa]
 gb|EEE91642.1| subtilase family protein [Populus trichocarpa]
Length=817

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/798 (44%), Positives = 482/798 (60%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A++Y+V ME  P +S                 ++  TS  VT Y Q + ++HD+ L SL
Sbjct  21    KAEVYIVTMEGEPVISYTGGIPGFEATAVESDEKLDATSQLVTSYAQHLEQKHDMLLDSL  80

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
               R  Y KLYSY HL+NGFAVH   ++A + L +A  V+ +  D K+ ++TTHTP FLG+
Sbjct  81    FDRGTYKKLYSYKHLINGFAVHTSPEQA-ETLRRAPDVKSVERDWKVRRLTTHTPQFLGL  139

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE ++IG +D+GI P H SF SP     G      K+ GKC    +
Sbjct  140   PTGVWPTGGGFDKAGEDIIIGFVDSGIFPRHPSFGSPSSDPYGP---LPKYRGKCEVDPD  196

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                  CNGKI+GAQ+FA AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV  +
Sbjct  197   TKREFCNGKIIGAQHFAEAAIAAGAFNPSIDFASPMDGDGHGSHTAAIAAGNNGIPVRIH  256

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   +
Sbjct  257   GHEFGKASGMAPRARIAVYKALYRLFGGFIADVVAAIDQAVHDGVDILSLSVGPNSPPAT  316

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + +LN  +V LL A +AGV V QAAGN GP  ++++S+SPW+TSVAA+  DRRY N +
Sbjct  317   TKTTYLNPFDVTLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITSVAAAIDDRRYKNHL  376

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+   G GLSP T     + L AA DV   +S+    +   CQ       +LV G 
Sbjct  377   YLGNGKVLPGIGLSPSTHPNQTYTLVAANDVLL-DSSVMKYSPSDCQRPEVLNKNLVEGN  435

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             ++IC Y+++F    ASI  V++T    GA GFVL ++    S   K   V + IPG++I 
Sbjct  436   VLICGYSFNFVVGTASIKKVSETAKSLGAIGFVLAVENV--SPGTKFDPVPVGIPGILIT  493

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN++T R  +GR  +F+ T  I +G   I     P VA +S+RGP++ +
Sbjct  494   DVTKSMDLIDYYNTSTPRDWTGRVKSFKGTGSIGNGLMPILYKSAPQVALFSARGPNIKD  553

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K
Sbjct  554   FSFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAALVK  613

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP+W P+AI SA++T++   DR      +   ++  + +L  ATPFD+GSG +NP  A
Sbjct  614   QKHPHWSPAAIKSALLTTSTKLDRAGRPLQAQQYSETEAMKLVTATPFDYGSGHVNPRSA  673

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ Y+ FLC  PG+D   +R      C        S+LNTPS+TIS+LV 
Sbjct  674   LDPGLIFDAGYEDYLGFLCTTPGIDAHEIRNYTNTPCNYTMGH-PSNLNTPSITISHLVK  732

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++TV R VTNV   +E Y +  R    V +   P    +    SR   + L     T +Y
Sbjct  733   TQTVTRTVTNV-AEEETYVITARMQPAVAIEANPPAMTLRPGASRKFTVSLTVRSVTGAY  791

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+++ G R H VR+P
Sbjct  792   SFGEILMKGSRGHQVRIP  809



>ref|XP_010526401.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
 ref|XP_010526402.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
 ref|XP_010526403.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=815

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/803 (44%), Positives = 475/803 (59%), Gaps = 38/803 (5%)
 Frame = +1

Query  100   AEAKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGS  231
             A+A++Y+V M+  P +S R                +   S +V  Y   + K+HD+ LG 
Sbjct  17    AKAEVYIVTMDGDPIISYRGGENGFEATAMESDEKVDAKSESVISYASHLEKKHDMLLGM  76

Query  232   LLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLG  411
             L     Y KLYSY HL+NGFA H+  ++A +IL +A  V+ +  D K++K+TTHTP+FLG
Sbjct  77    LFHEGTYRKLYSYKHLINGFAAHITHEQA-EILRRAPDVKSVDRDWKVKKLTTHTPEFLG  135

Query  412   IPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKC----  579
             +P  VWP  GG   +GE VVIG +D+GI P H SF+S      G       + GKC    
Sbjct  136   LPTDVWPTGGGYDRAGEDVVIGFVDSGIYPHHPSFASRHTVPYGP---LPGYKGKCEDDP  192

Query  580   ITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHT  759
             ++G +F    CNGKI+GAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN   
Sbjct  193   LSGKSF----CNGKIIGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGI  248

Query  760   PVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gp  933
             PV  + + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   
Sbjct  249   PVRMHGYEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPN  308

Query  934   ssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRR  1113
             +   +  + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRR
Sbjct  309   TPPATTKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRR  368

Query  1114  YTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPS  1293
             Y N + LGNG+T  G GL+P T  +  + + +A DV   +S A     + CQ        
Sbjct  369   YKNHLTLGNGKTLPGIGLTPSTHPRRSYVMVSANDVSVDSSMAKYNPAD-CQRPEVLNKR  427

Query  1294  LVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIP  1473
             LV G +++C Y+++F S  AS+  VA+T    GA GFVL ++    S   K       IP
Sbjct  428   LVEGNILLCGYSFNFVSGTASVKKVAETAKHLGAVGFVLVVENV--SPGTKFDPFPSPIP  485

Query  1474  GLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRG  1653
             G++I  +  S  L  YYN  T R  +GR  +F+A   I DG   I     P VA +S+RG
Sbjct  486   GILITEISKSMELIDYYNVTTARDWTGRVKSFKAMGSIGDGLEPILHKSAPEVALFSARG  545

Query  1654  PDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGI  1833
             P+  +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGI
Sbjct  546   PNTKDFSFQDADLLKPDILAPGSLIWAAWSPNGTDEANYVGEEFAMISGTSMAAPHIAGI  605

Query  1834  AALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFI  2001
             AAL+K +HP W P+AI SA+MT++ + DR      +   ++        ATPFD+GSG +
Sbjct  606   AALVKQKHPQWSPAAIKSALMTTSTIIDRAGRPLQAQQYSETEVVNFIKATPFDYGSGHV  665

Query  2002  NPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTI  2181
             NP  +L+PGL+F   ++ Y+ FLC   G+DE  +RR     C    K   S+ N PS+ I
Sbjct  666   NPRASLDPGLIFEAGYEDYVGFLCTTRGIDEDEIRRYTNRPCNYTMKH-PSNFNVPSIAI  724

Query  2182  SNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATK  2361
             ++L   +TV RRVTNV   +E Y V       + + + P    I A  SR   ++L    
Sbjct  725   AHLARIQTVTRRVTNVAEEEETYTVTATMDPSIAIEVNPPAMTIRAGNSREFSVILTVRS  784

Query  2362  ATNSYSFGEMILLGDRNHIVRVP  2430
              T  YSFGE++L G R H VR+P
Sbjct  785   VTGEYSFGEVMLKGSRGHKVRIP  807



>ref|XP_002884175.1| hypothetical protein ARALYDRAFT_480817 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60434.1| hypothetical protein ARALYDRAFT_480817 [Arabidopsis lyrata subsp. 
lyrata]
Length=815

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/797 (44%), Positives = 473/797 (59%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A++Y+V ME  P +S                 +I  +S  VT Y + + ++HD+ LG L 
Sbjct  19    AEVYIVTMEGDPIISYKGGENGFEPTAVESDEKIDTSSELVTSYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  ++A + L +A GVR + +D K+ ++TTHTP+FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPEQA-ETLRRAPGVRSVDKDWKVRRLTTHTPEFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LPHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN   P+  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIPLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDATLLGAVKAGVFVSQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSPPT     + L +A DV   +S+        CQ        LV G +
Sbjct  375   LGNGKMLAGMGLSPPTRPHRLYTLVSANDVLL-DSSVSKYNPSDCQRPEVLNKKLVEGNI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V  T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVATAKHLGAAGFVLVVENV--SPGTKFDPVPSAIPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R  +GR  +F+A   I DG   +     P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNVSTSRDWTGRVKSFKAEGSIGDGLAPVLHKSAPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  552   SFQDADLLKPDILAPGYLIWAAWCPNGTDEPNYVGEGFALISGTSMAAPHIAGIAALVKQ  611

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NPS AL
Sbjct  612   KHPQWSPAAIKSALMTTSTVIDRAGRLLQAQQYSDTEAVTLVKATPFDYGSGHVNPSAAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+    +R      C  + K   S+ N PS+ +S+LVG+
Sbjct  672   DPGLIFDAGYEDYLGFLCTTPGISAHEIRNYTNTPCNYDMKH-PSNFNAPSIAVSHLVGT  730

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    +    SR   + +     +  YS
Sbjct  731   QTVTRRVTNVAEVEETYTITARMQPSIAIEVNPPAMTLRPGASRSFSVTMTVRSVSGVYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H VR+P
Sbjct  791   FGEVKLKGSRGHKVRIP  807



>ref|XP_009112595.1| PREDICTED: subtilisin-like protease [Brassica rapa]
 ref|XP_009112596.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=815

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/797 (44%), Positives = 477/797 (60%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A +Y+V +E  P +S                 +I  +S  VT Y + + ++HD+ LG L 
Sbjct  19    ADVYIVTIEGDPIISYKGGENGYEATAVESDEKIDTSSELVTSYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFAVHV  ++A + L +  GV+ + +D K+ ++TTHTP+FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAVHVSPEQA-ETLRRTPGVKSVNKDWKVRRLTTHTPEFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGFERAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LHHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN +  YASP D DGHGSHTA+ AAGN   P+  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPNIDYASPMDGDGHGSHTAAIAAGNNGIPLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDAILLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     + L +A DV   +S+A       CQ    F   LV GK+
Sbjct  375   LGNGKMLAGMGLSPSTRPHRLYTLVSANDVLL-DSSASKYNPSDCQRPEVFNKKLVEGKI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V  TV   GAAGFVL ++    S   K   V   +PG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVATVKHLGAAGFVLVVENV--SPGTKFDPVPSAVPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R  +GR  +F+A   I DG   +Y    P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNVSTTRDWTGRVKSFKAEGSIGDGLAPVYHKSAPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  552   SFQDADLLKPDILAPGYLIWAAWCPNGTDEPNYVGEGFALISGTSMAAPHIAGIAALVKQ  611

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             ++P W P++I SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NP  AL
Sbjct  612   KYPQWSPASIKSALMTTSTVIDRAGRLLQAQQYSDTEAVTLVKATPFDYGSGHVNPHAAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGLVF+  ++ Y+ FLC  PG+D   +R    + C  + K   S+ N  S+ IS+LVG+
Sbjct  672   DPGLVFDAGYEDYLGFLCTTPGIDSHEIRNYTNMPCNYDMKH-PSNFNAASIAISHLVGT  730

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +T+ RRVTNV   +E Y +  R      + + P    +    SR   ++L     +  YS
Sbjct  731   QTITRRVTNVAEVEETYTITARMQPSTAIEVNPPAMTLRPGASRIFSVILTVRSVSGVYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H VR+P
Sbjct  791   FGEVKLKGSRGHKVRIP  807



>emb|CDY51088.1| BnaA07g36110D [Brassica napus]
Length=815

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/797 (44%), Positives = 472/797 (59%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A++Y+V ME  P +S                 +I  +S  VT Y + + ++HD+ LG L 
Sbjct  19    AEVYIVTMEGEPIISYQGGENGYEATAVESDEKIDTSSELVTSYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA H+  ++A + L +  GV+ + +D K+ ++TTHTP+FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHISPEQA-ETLRRTAGVKSVNKDWKVRRLTTHTPEFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGWERAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LPHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN +  YASP D DGHGSHTA+ AAGN   P+  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPNIDYASPMDGDGHGSHTAAIAAGNNGIPLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGNASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ +VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWIMTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     + L +A DV   +S+        CQ    F   LV GK+
Sbjct  375   LGNGKMLAGMGLSPSTRPHKMYTLVSANDVLL-DSSVSKYNPSDCQRPEVFNKKLVEGKI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V  TV   GAAGFVL ++    S   K   V   +PG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVATVKHLGAAGFVLVVENV--SPGTKFDPVPSAVPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R  +GR  +F A   I DG   +     P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNVSTSRDWTGRVKSFNAQGSIGDGLAPVLHKSSPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  552   SFQDADLLKPDILAPGYLIWAAWCPNGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  611

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NPS AL
Sbjct  612   KHPRWSPAAIKSALMTTSKVVDRAGRLLQAQHYSDTEAVTLVKATPFDYGSGHVNPSAAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGLVF+  ++ Y+ FLC  PG+D   +R      C    K   S+ N PS+ IS+LVG+
Sbjct  672   DPGLVFDAGYEDYVGFLCTTPGIDAHEIRNYTNTPCNYEMKH-PSNFNAPSIAISHLVGT  730

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRV NV   +E Y +  R    + + + P    +    SR   + L     +  YS
Sbjct  731   QTVTRRVKNVAEVEETYTITARMQPSIAIEVNPPAMTLRPGASRSFSVTLTVRSVSGVYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H VR+P
Sbjct  791   FGEVKLKGSRGHKVRIP  807



>ref|XP_010415086.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010415091.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010415095.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
Length=815

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/797 (43%), Positives = 475/797 (60%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A++Y+V M+  P +S                 RI  +S  VTMY + + ++HD+ LG L 
Sbjct  19    AEVYIVTMDGDPIISYKGGENGFEATAVESDERIDTSSELVTMYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  ++A + L +A GV+ + +D K+ ++TTHTP+FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPEQA-ETLRRAPGVKSVDKDWKVRRLTTHTPEFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LPHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN    +  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPDIDYASPLDGDGHGSHTAAIAAGNNGIQLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSPPT     + L ++ DV   +S++       CQ    F   LV+G +
Sbjct  375   LGNGKMLAGMGLSPPTRPHRLYTLVSSNDVLL-DSSSSKYNPSDCQRPEVFNKKLVKGNI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V  T    GAAGFVL ++    S   K   V   +PG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVATAKHLGAAGFVLVVENV--SPGTKFDPVPSAVPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R  +GR  +F A   I DG   +     P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNVSTSRDWTGRVKSFNAKGSIGDGLAPVLHKSAPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  552   SFQDADLLKPDILAPGYLIWAAWCPNGTDEPNYVGEGFALISGTSMAAPHIAGIAALVKQ  611

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NPS AL
Sbjct  612   KHPQWSPAAIKSALMTTSTVIDRAGRLLQAQQYSDTEAVTLVKATPFDYGSGHVNPSAAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+    +R      C  + K   S+ N PS+ +S+LVG+
Sbjct  672   DPGLIFDAGYEDYLGFLCTTPGISAHEIRNYTNTRCNYDMKH-PSNFNAPSIAVSHLVGT  730

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +T+ RRVTNV   +E Y +  R    + + + P    +    SR   + +     +  YS
Sbjct  731   QTITRRVTNVAEVEETYTITARMQPSIAIEVNPPAMTLRPGASRTFSVTMTVRSVSGEYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H VR+P
Sbjct  791   FGEVKLKGSRGHKVRLP  807



>ref|XP_011019996.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=817

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/798 (44%), Positives = 480/798 (60%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A++Y+V ME  P +S                 ++  TS  VT Y Q + ++HD+ L SL
Sbjct  21    KAEVYIVTMEGEPVISYTGGIPGFEATAVESDEKLDSTSQLVTSYAQHLEQKHDMLLDSL  80

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
               R  Y KLYSY HL+NGFAVH   ++A  + H A  V+ +  D K+ ++TTHTP FLG+
Sbjct  81    FDRGTYKKLYSYKHLINGFAVHASPEQAETLRH-APDVKSVERDWKVRRLTTHTPQFLGL  139

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE ++IG +D+GI P H SF SP     G      K+ GKC    +
Sbjct  140   PTGVWPTGGGFDKAGEDIIIGFVDSGIFPRHPSFGSPSSDPYGP---LPKYRGKCEVDPD  196

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                  CNGKI+GAQ+FA AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV  +
Sbjct  197   TKREFCNGKIIGAQHFAEAAIAAGAFNPSIDFASPMDGDGHGSHTAAIAAGNNGIPVRIH  256

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   +
Sbjct  257   GHEFGKASGMAPRARIAVYKALYRLFGGFIADVVAAIDQAVHDGVDILSLSVGPNSPPAT  316

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + +LN  +V LL A +AGV V QAAGN GP  ++++S+SPW+TSVAA+  DRRY N +
Sbjct  317   TKTTYLNPFDVTLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITSVAAAIDDRRYKNHL  376

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+   G GLSP T     + L AA D    +S+    +   CQ       +LV G 
Sbjct  377   YLGNGKVLPGIGLSPSTHPNQTYTLVAANDALL-DSSVMKYSPSDCQRPEVLNKNLVEGN  435

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + IPG++I 
Sbjct  436   ILLCGYSFNFVVGTASIKKVSETAKSLGAIGFVLAVENV--SPGTKFDPVPVGIPGILIT  493

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN++T R  +GR  +F+ T  I +G   I     P VA +S+RGP++ +
Sbjct  494   DVTKSMDLIDYYNTSTPRDWTGRVKSFKGTGSIGNGLMPILYKSAPQVALFSARGPNIKD  553

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K
Sbjct  554   FSFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAALVK  613

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP+W P+AI SA+MT++   DR      +   ++  S +L  ATPFD+GSG +NP  A
Sbjct  614   QKHPHWSPAAIKSALMTTSTNLDRAGRPLQAQQYSETESMKLVTATPFDYGSGHVNPRSA  673

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  +  Y+ FLC  PG+D   +R      C        S+LNTPS+TIS+LV 
Sbjct  674   LDPGLIFDAGYGDYLGFLCTTPGIDAHEIRNYTNTPCNYTMGH-PSNLNTPSITISHLVK  732

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++TV RRVTNV   +E Y +  R    V +   P    +    SR   + L     T +Y
Sbjct  733   TQTVTRRVTNV-AEEETYVITARMQPAVAIEANPPAMTLRPGASRKFTVSLTVRSVTGTY  791

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+++ G R H VR+P
Sbjct  792   SFGEILMKGSRGHQVRIP  809



>ref|XP_009102195.1| PREDICTED: subtilisin-like protease [Brassica rapa]
 ref|XP_009102196.1| PREDICTED: subtilisin-like protease [Brassica rapa]
 ref|XP_009102197.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=815

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/797 (44%), Positives = 471/797 (59%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A++Y+V ME  P +S                 +I  +S  VT Y + + ++HD+ LG L 
Sbjct  19    AQVYIVTMEGEPIISYQGGENGYEATAVESDEKIDTSSELVTSYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA H+  ++A + L +  GV+ + +D K+ ++TTHTP FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHISPEQA-ETLRRTPGVKSVNKDWKVRRLTTHTPQFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGWERAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LPHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN +  YASP D DGHGSHTA+ AAGN   P+  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPNIDYASPMDGDGHGSHTAAIAAGNNGIPLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGNASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ +VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWIMTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     + L +A DV   +S+        CQ    F   LV GK+
Sbjct  375   LGNGKMLAGMGLSPSTRPHKMYTLVSANDVLL-DSSVSKYNPSDCQRPEVFNKKLVEGKI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V  TV   GAAGFVL ++    S   K   V   +PG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVATVKHLGAAGFVLVVENV--SPGTKFDPVPSAVPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R  +GR  +F A   I DG   +     P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNVSTSRDWTGRVKSFNAQGSIGDGLAPVLHKSSPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  552   SFQDADLLKPDILAPGYLIWAAWCPNGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  611

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NPS AL
Sbjct  612   KHPRWSPAAIKSALMTTSKVVDRAGRLLQAQHYSDTEAVTLVKATPFDYGSGHVNPSAAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGLVF+  ++ Y+ FLC  PG+D   +R      C    K   S+ N PS+ IS+LVG+
Sbjct  672   DPGLVFDAGYEDYVGFLCTTPGIDAHEIRNYTNTPCNYEMKH-PSNFNAPSIAISHLVGT  730

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRV NV   +E Y +  R    + + + P    +    SR   + L     +  YS
Sbjct  731   QTVTRRVKNVAEVEETYTITARMQPSIAIEVNPPAMTLRPGASRSFSVTLTVRSVSGVYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H VR+P
Sbjct  791   FGEVKLKGSRGHKVRIP  807



>ref|XP_011077723.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
 ref|XP_011077724.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=821

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/802 (44%), Positives = 482/802 (60%), Gaps = 33/802 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVSTR------------------IKGTSGNVTMYKQRMTKQHDVF  222
             + +A+IY+V +E  P +S R                  I  TS  V  Y   + K+HD+ 
Sbjct  21    LGKAEIYIVTLEGEPVISYRGGVSGFEATAVDSDSDEKIDVTSELVISYAHHLEKRHDML  80

Query  223   LGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPD  402
             L  L  +  Y K+YSY HL+NGFAVH+  ++A +IL +A GV+ +  D K+ K+TTHTP 
Sbjct  81    LDMLFDQGTYRKIYSYRHLINGFAVHLSPEQA-EILGRAPGVKSVERDWKVRKLTTHTPQ  139

Query  403   FLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCI  582
             FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++      G      K+ GKC 
Sbjct  140   FLGLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFATHHSDPYGP---VPKYRGKCE  196

Query  583   TGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTP  762
                N     CNGKIVGAQ+FA AA AAG FN    + SP D DGHGSHTA+ AAGN   P
Sbjct  197   IDPNTKRDFCNGKIVGAQHFAEAAKAAGAFNPDIDFDSPLDGDGHGSHTAAIAAGNNGIP  256

Query  763   VITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gps  936
             V  + F +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDIL+LSV   S
Sbjct  257   VRMHGFEFGRASGMAPRARIAVYKALYRIFGGFVADVVAAIDQAVHDGVDILNLSVGPNS  316

Query  937   svpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRY  1116
                +  + +LN  +  LL A +AGV VVQAAGN GP  +++LS+SPW+ +VAA+  DRRY
Sbjct  317   PPATTKTTYLNPFDATLLSAVKAGVFVVQAAGNGGPFPKTLLSYSPWIATVAAAVDDRRY  376

Query  1117  TNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSL  1296
              N + LGNG+  +G  LSP T     F L AA DV   +S+A   +   CQ       +L
Sbjct  377   KNHLTLGNGKILAGICLSPATHANRTFTLVAANDVLL-DSSAAKYSPSDCQRPEVLNKNL  435

Query  1297  VRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPG  1476
             V+G +++C Y+++F    ASI  V++T    GAAGFVL ++    S   K   V + IPG
Sbjct  436   VQGNILLCGYSFNFVVGTASIKRVSETAKSLGAAGFVLAVEN--ASPGTKFDPVPVGIPG  493

Query  1477  LIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGP  1656
             +++ ++  ST L  YYN +T R  +GR  +F+A   I +G R I     P VA +S+RGP
Sbjct  494   ILVTDVSKSTELIDYYNVSTPRDWTGRVKSFKAVGSIGEGLRPILHKSAPQVALFSARGP  553

Query  1657  DVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIA  1836
             ++ +     AD+LKP+I+APGS IWAAW+PN   +    G+ FA++SGTSMA PHIAGIA
Sbjct  554   NIKDYSFQDADLLKPDILAPGSLIWAAWAPNGTDEPNYVGEGFAMISGTSMAAPHIAGIA  613

Query  1837  ALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFIN  2004
             AL+K ++P+W PSAI SA+MT++   DR      +   +   +  L PATPFD+GSG +N
Sbjct  614   ALMKQKNPHWSPSAIKSALMTTSTTIDRAERPLQAQQYSGSETMSLVPATPFDYGSGHVN  673

Query  2005  PSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTIS  2184
             P  AL+PGL+F+  ++ Y+ FLC  PGVD   +       C        S+LNTPS+ IS
Sbjct  674   PRAALDPGLIFDAGYEDYLGFLCTTPGVDAHEISNYTNSPCNYTLGH-PSNLNTPSIAIS  732

Query  2185  NLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKA  2364
             +LVG++TV R VTNV   +E Y +  R    + +   P    +    SR   + L     
Sbjct  733   HLVGTQTVSRTVTNV-AEEETYVITARMAPAIAIETNPPAMTLRPGASRKFSVTLTVRSV  791

Query  2365  TNSYSFGEMILLGDRNHIVRVP  2430
             T +YSFGE++L G R H VR+P
Sbjct  792   TGTYSFGEVLLKGSRGHKVRIP  813



>gb|EYU38752.1| hypothetical protein MIMGU_mgv1a001891mg [Erythranthe guttata]
Length=743

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/748 (47%), Positives = 463/748 (62%), Gaps = 23/748 (3%)
 Frame = +1

Query  217   VFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHT  396
             + L  L  +  YTKLYSY HL+NGFAVH+   +A +IL +A GV+ +  D K++K+TTHT
Sbjct  1     MLLDMLFDQGTYTKLYSYRHLINGFAVHISPQQA-EILGRAPGVKSVERDWKVKKLTTHT  59

Query  397   PDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGK  576
             P FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++   +N        K+TGK
Sbjct  60    PQFLGLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFAT---HNTDPYGPVPKYTGK  116

Query  577   C----ITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAA  744
             C    IT  NF    CNGKI+GAQ+FA AA  AG FN    + SP D DGHGSHTA+ AA
Sbjct  117   CEVDPITKRNF----CNGKIIGAQHFAEAAKIAGSFNPDIDFDSPLDGDGHGSHTAAIAA  172

Query  745   GNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlsl  921
             GN   PV  + F +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDIL+L
Sbjct  173   GNNGIPVRMHGFEFGRASGMAPRARIAVYKALYRMFGGFVADVVAAIDQAVHDGVDILNL  232

Query  922   sv-gpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAAS  1098
             SV   S   +  + +LN  ++ LL A +AGV V QAAGN GP  ++MLS+SPW+ +VAA+
Sbjct  233   SVGPNSPPAATKTTYLNPFDITLLSAVKAGVFVAQAAGNGGPFPKTMLSYSPWIATVAAA  292

Query  1099  TTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAM  1278
               DRRY N + LGNG+  +G GLSP T     F L AA DV   +S A   +   CQ   
Sbjct  293   VDDRRYKNHLTLGNGKILAGLGLSPATHANRTFTLVAANDVLLDSSVAKY-SPSDCQRPE  351

Query  1279  QFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATV  1458
                 +LV+G +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V
Sbjct  352   VLNKNLVQGNILLCGYSFNFVVGTASIKKVSETAKALGAVGFVLAVE--TASPGTKFDPV  409

Query  1459  TLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVAS  1638
              + IPG++I +   ST L  YYN++T R  +GR   F A   I DG R I     P VA 
Sbjct  410   PVGIPGILITDCIKSTDLIDYYNASTPRDWTGRVKRFEAVGSIGDGLRPILHRSAPQVAI  469

Query  1639  YSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATP  1818
             +S+RGP++ +     AD+LKP+I+APGS IWAAW+PN   +    G+ FA++SGTSMA P
Sbjct  470   FSARGPNIKDYSFQDADLLKPDILAPGSLIWAAWAPNGTDEANYVGEGFAMISGTSMAAP  529

Query  1819  HIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlap----aTPFDF  1986
             HIAGIAAL+K ++P W P+AI SA+MT++   DR   PL AQQ S +       ATPFD+
Sbjct  530   HIAGIAALVKQKYPRWSPAAIKSALMTTSTTLDRAERPLQAQQYSSEETLSFVPATPFDY  589

Query  1987  GSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNT  2166
             GSG +NP  AL+PGL+F+  ++ Y+ FLC  PG+D   ++    + C        S+LN 
Sbjct  590   GSGHVNPRAALDPGLIFDAGYEDYLGFLCTTPGIDAHEIKNYTNIPCNYTLGH-PSNLNM  648

Query  2167  PSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIV  2346
             PS+ IS+LVG++TV R VTNV G +E Y +  R    V +   P    +    SR + + 
Sbjct  649   PSIAISHLVGTQTVTRTVTNVAG-EETYVISARMAPAVAIETDPPAMTLRPGASRRITVT  707

Query  2347  LNATKATNSYSFGEMILLGDRNHIVRVP  2430
             L     T SYSFGE+ L G R H VR+P
Sbjct  708   LTVRSVTGSYSFGEVWLKGSRGHKVRLP  735



>ref|XP_003563504.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=819

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/798 (45%), Positives = 478/798 (60%), Gaps = 34/798 (4%)
 Frame = +1

Query  112   IYMVLMEDHPFVSTR--IKG--------------TSGNVTMYKQRMTKQHDVFLGSLLRR  243
             +Y+V ME  P VS R  ++G              TS +V  Y   + + H+  L SL   
Sbjct  24    VYIVTMEGDPVVSYRGGVEGFPATAVDLDEEMEITSESVVSYSLHLQRHHEKLLDSLFVA  83

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSY HL+NGFAVH+ S +A   L KA GV+ +  D K++K+T HTP FLG+   
Sbjct  84    GTYEKLYSYHHLINGFAVHMTSLQA-DFLRKAPGVKYVERDTKIQKLTIHTPQFLGLTTG  142

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPA  603
             VWP  GG   +GE VVIG +D+GI P H SFS+ +    G       + GKC        
Sbjct  143   VWPTGGGFDRAGEDVVIGFVDSGIYPQHPSFSTHKTDPYGP---VPHYKGKCEIDPVSRR  199

Query  604   TACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFN  783
             + CNGKIVGAQ+FA+AAIAAG F+    +ASP D DGHGSHTA+ AAGN   PV  + + 
Sbjct  200   SFCNGKIVGAQHFAKAAIAAGAFDPDVEFASPLDGDGHGSHTAAIAAGNNGIPVRMHGYE  259

Query  784   YGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsgDS  957
             +G ASGMAP A IAVYK LY  FGGY+SDVVAA+DQAV+DGVDIL+LSV   S   +  +
Sbjct  260   FGKASGMAPRARIAVYKVLYRLFGGYVSDVVAAIDQAVQDGVDILNLSVGPNSPPTATRT  319

Query  958   AFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLG  1137
              FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA   DRRY N ++LG
Sbjct  320   TFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAGVDDRRYKNHLILG  379

Query  1138  NGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVI  1317
             NG+   G G+SP T G   F L +A D    +ST     ++ CQ         V+GK+++
Sbjct  380   NGKLLPGLGVSPATHGNKSFGLISATDALLGSSTTKYSALD-CQRPELLNKRKVQGKILL  438

Query  1318  CTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNME  1497
             C Y+Y++ S  ASI  V+ T    GAAGFV+ ++      +     V + IPG++I ++ 
Sbjct  439   CGYSYNYISGTASIKKVSQTARSLGAAGFVVAVESSYPGTKFD--PVPVNIPGILITDVS  496

Query  1498  ASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALL  1677
              +  L  YYNS+T R  +GRA  F+AT  I DG         P VA +SSRGPDV +   
Sbjct  497   RTKDLIDYYNSSTTRDWAGRATVFQATVGIADGLAPTLFNSAPQVALFSSRGPDVKDFSF  556

Query  1678  DTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRH  1857
               ADVLKP+I+APG+ IWAAW+PN   +    G+ FA++SGTSMA PHIAGIAALIK ++
Sbjct  557   QDADVLKPDILAPGNLIWAAWAPNGTDEANYAGEGFAMMSGTSMAAPHIAGIAALIKQKN  616

Query  1858  PNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTPFDFGSGFINPSRALNP  2025
             P W PS I SA+MT+A+  D+    L +   +      L  ATPFD+GSG +NP  AL+P
Sbjct  617   PKWSPSVIKSALMTTANTMDKGNHPLRAQQFSTSEIMTLTRATPFDYGSGAVNPKAALDP  676

Query  2026  GLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC---PENKKFWCSDLNTPSVTISNLVG  2196
             GLV     Q YI FLC++P VD   V  + G  C   P+ ++ +  DLN PS+T+S L G
Sbjct  677   GLVLEATHQDYITFLCSIPDVDHSEVSNITGSHCNSIPKGQRPY--DLNIPSITVSQLKG  734

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++TV R VTNV    E Y ++ R    + + + P    +    SR +   L     T +Y
Sbjct  735   TQTVKRTVTNVATEAETYTIMTRMSSEIALQVSPPAVTVLPGSSREITATLTTRSVTGTY  794

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+ + GDR H+VR+P
Sbjct  795   SFGEITMKGDRGHLVRIP  812



>ref|XP_007026177.1| PA-domain containing subtilase family protein [Theobroma cacao]
 gb|EOY28799.1| PA-domain containing subtilase family protein [Theobroma cacao]
Length=822

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/796 (43%), Positives = 467/796 (59%), Gaps = 25/796 (3%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV----------STRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAY  252
             E  IY+VLME                 +    S    ++ +++   HD  L S L   +Y
Sbjct  29    ERAIYLVLMEGEAVAFNGDSLPRQHGRKFDPKSEASKVHAKKLVDSHDQVLQSTLETGSY  88

Query  253   TKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWP  432
              KLYS+T++LNGFAVH    +A K+ H A G++ +  D + + MTT+TP FLG+P+ VW 
Sbjct  89    NKLYSFTNVLNGFAVHTAPSQATKLKH-APGIKLVERDRRTKLMTTYTPQFLGLPEGVWA  147

Query  433   RLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR--KFTGKCITGDNFPAT  606
             + GG   +GEG+VIG +DTGINP H SF+    Y++  P  +    F+G C TG  FP  
Sbjct  148   QEGGERNAGEGIVIGFVDTGINPSHPSFA----YDLVNPFTSNISHFSGACETGPEFPPF  203

Query  607   ACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNY  786
             +CNGKIV A+ F+  A AA   N S    SP D  GHGSH ASTAAGN   PV+ N   Y
Sbjct  204   SCNGKIVSAKLFSAGAQAAASLNASVDILSPSDTVGHGSHVASTAAGNAGVPVVVNGLYY  263

Query  787   GYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFL  966
             G ASGMAP A IAVYKA+Y   G ++DVVAA+DQAV DGVDIL+LS+G    P     FL
Sbjct  264   GRASGMAPRARIAVYKAIYPTVGTLADVVAAIDQAVSDGVDILTLSIGLDEPPQDTVTFL  323

Query  967   NVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQ  1146
             ++ ++ +LFA RA + VVQAAGN GP   +++S+SPW    A+S  DRRY  S++LGNGQ
Sbjct  324   SMFDIAMLFARRAAIFVVQAAGNQGPGPSTVVSYSPWAVGAASSRIDRRYIGSLLLGNGQ  383

Query  1147  TFSGSGLSPPTAGKA--FFQLAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGKLV  1314
               SG GL+ P+ G     ++L  A D              VE CQ      P++VRG +V
Sbjct  384   NISGVGLTAPSLGNGSVLYKLVLAKDAVNLKGAFPRTPPYVEECQYPEALDPNIVRGSIV  443

Query  1315  ICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNM  1494
             ICT++  F +E +++  + DT    G  GFVL  +P  G        +   + G +I  +
Sbjct  444   ICTFSAGFSNETSTLTAIIDTARTLGFMGFVLVANPSYG--DFIAQPIPYSVSGTLIPKV  501

Query  1495  EASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNAL  1674
               +  + QYY   T R   G    F A A I DGR A + GQ P+V+ +SSRGPD  +  
Sbjct  502   ADAKIVSQYYEQQTYRDAGGFVREFNARAAIGDGRVASFCGQAPIVSRFSSRGPDFIDIN  561

Query  1675  LDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDR  1854
              D ADVLKP+I+APG  IWAAWSP S  D  + G +FAL+SGTSMA PH+AGIAALIK +
Sbjct  562   KDPADVLKPDILAPGHEIWAAWSPMSALDPILSGYNFALLSGTSMAAPHVAGIAALIKQK  621

Query  1855  HPNWKPSAITSAMMTSADVTDRl-gspllaqqasqqlapaTPFDFGSGFINPSRALNPGL  2031
             +P+W PS I SA+ T+A   D               L  +T FD G+GF++PSRA++PGL
Sbjct  622   YPSWTPSMIASAISTTASKFDNNGELIRAEGSDVGSLYSSTYFDSGAGFVSPSRAMDPGL  681

Query  2032  VFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVM  2211
             V ++ F+ YI FLC++P +D  ++R   GV C  +     ++LN PSVTIS L  S TV 
Sbjct  682   VLSSEFEDYISFLCSIPNIDRFAIRAATGVWCSRSLGL-PANLNLPSVTISALERSVTVR  740

Query  2212  RRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEM  2391
             R   NV    E Y  +   P G  +T+ P  F I+ + ++ L I +NA ++TN +SFGE+
Sbjct  741   RSFKNVATKPETYVSLAIPPNGTTITLNPPWFAIAPEETQDLDIEINAIQSTNQFSFGEI  800

Query  2392  ILLGDRNHIVRVPFAV  2439
             IL G  NHIVR+P ++
Sbjct  801   ILTGSLNHIVRIPLSI  816



>dbj|BAJ94838.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=819

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/797 (45%), Positives = 478/797 (60%), Gaps = 32/797 (4%)
 Frame = +1

Query  112   IYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLLRR  243
             +Y+V ME  P VS                  ++ TS  VT Y   + + H+  L SL   
Sbjct  24    VYIVTMEGDPVVSYTGGVEGFPRTAADLDEEMEVTSEAVTSYSLHLRRHHEKLLDSLFVA  83

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSY HL+NGFAVH+ S +A   L KA GV+ +  D K++K+TTHTP FLG+   
Sbjct  84    GTYEKLYSYHHLINGFAVHMSSLQA-DFLRKAPGVKYVERDTKIQKLTTHTPQFLGLTTA  142

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR-PRITRKFTGKCITGDNFP  600
             VWP  GG   +GE VVIG +D+GI P H SFS+      G  PR    + GKC       
Sbjct  143   VWPTGGGFDRAGEDVVIGFVDSGIYPEHPSFSTHRTDPYGPVPR----YKGKCEIDPVTQ  198

Query  601   ATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRF  780
              + CNGKIVGAQ+FA+AAIAAG FN    +ASP D DGHGSH A+ AAGN   PV  + +
Sbjct  199   RSFCNGKIVGAQHFAKAAIAAGAFNPDVEFASPLDGDGHGSHIAAIAAGNNGIPVRMHGY  258

Query  781   NYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsgD  954
              +G ASGMAP A IAVYK LY  FGGY+SDVVAA+DQAV+DGVDIL+LSV   S   +  
Sbjct  259   EFGKASGMAPRARIAVYKVLYRLFGGYVSDVVAAIDQAVQDGVDILNLSVGPNSPPTATR  318

Query  955   SAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVL  1134
             + FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA   DRRY N ++L
Sbjct  319   TTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAGVDDRRYKNHLIL  378

Query  1135  GNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLV  1314
             GNG+  +G G+SP T G   F L +A D    +S+     ++ CQ         V+GK++
Sbjct  379   GNGKRIAGLGVSPATHGNKSFGLISATDALLGSSSTKYSALD-CQRPELLNKRKVQGKIL  437

Query  1315  ICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNM  1494
             +C Y++++ S  ASI  V+ T    GAAGFV+ ++      +     V + IPG++I ++
Sbjct  438   LCGYSFNYISGTASIKKVSQTARSLGAAGFVVAVEDSYPGTKFD--PVPVNIPGILITDV  495

Query  1495  EASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNAL  1674
               +  L  YYNS+T R  +GRA AF+AT  I DG         P VA +SSRGPDV +  
Sbjct  496   SKTKDLIDYYNSSTTRDWAGRATAFQATVGIADGLAPTLFNSAPQVALFSSRGPDVKDFS  555

Query  1675  LDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDR  1854
                ADVLKP+I+APG+ IW+AW+PN   +    G+ FA++SGTSMA PHIAGIAALIK +
Sbjct  556   FQDADVLKPDILAPGNLIWSAWAPNGTDEANYAGEGFAMMSGTSMAAPHIAGIAALIKQK  615

Query  1855  HPNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRALN  2022
             +P W PSAI SA+MT+A+  D+      +   +      L  ATPFD+GSG +NP  AL+
Sbjct  616   YPKWSPSAIKSALMTTANTIDKGSHPLRAQQYSTSEMLTLTRATPFDYGSGAVNPKAALD  675

Query  2023  PGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKKFWCSDLNTPSVTISNLVGS  2199
              GLV +   Q YI FLC++P VD   V  + G  C P  K+    DLN PS+T+S L G+
Sbjct  676   AGLVLDATHQDYITFLCSIPDVDPSEVSNITGSRCSPSQKRQGPYDLNIPSITVSQLKGT  735

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV R VTNV    E Y ++ R    + + + P    +    SR + + L     T +YS
Sbjct  736   QTVKRTVTNVADEAETYTIMTRMSPEIALDVSPPALTVLPGSSREITVTLTTRTVTGTYS  795

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ + GDR H+VR+P
Sbjct  796   FGEITMKGDRRHLVRIP  812



>ref|XP_009128155.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=818

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/797 (44%), Positives = 473/797 (59%), Gaps = 28/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPF----------------VSTRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P                    +I  +S  VT Y + + ++HD+ LG L 
Sbjct  20    AEIYIVTMEGDPIKIYNGGVKGLEATAVESDEKIDTSSELVTSYARHLERKHDMLLGMLF  79

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA H+   +A ++L +A GV+ +  D K++K+TTHTP FLG+P
Sbjct  80    EEGSYKKLYSYKHLINGFAAHLSPAQA-EVLRRAPGVKHLSRDWKVKKLTTHTPQFLGLP  138

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S        P  + K  GKC      
Sbjct  139   TDVWPTGGGYDRAGEDIVIGFVDSGIFPHHPSFASHHTAVPYGPHPSYK--GKCEDDPRT  196

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  197   KVSFCNGKIIGAQHFAEAAKAAGAFNPEVDFASPMDGDGHGSHTAAIAAGNNGIPVRMHG  256

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG++SDVVAA+D AV DGVDILSLSV   S   + 
Sbjct  257   YEFGKASGMAPRARIAVYKALYRLFGGFVSDVVAAIDMAVHDGVDILSLSVGPNSPPATT  316

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  317   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  376

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T     +++ +A DV   +S         CQ        LV+G +
Sbjct  377   LGNGKMLAGIGLSPSTRPHRSYKMVSANDVLLDSSGGNKYNPSDCQKPEVLNKKLVQGNI  436

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  437   LLCGYSFNFVAGSASIKKVAETAKHLGAAGFVLVVENV--SPGTKFDPVPSCIPGILITD  494

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN  T R   GR   F+A   I DG   I     P VA +S+RGP+  + 
Sbjct  495   VSKSMDLIDYYNVTTSRDWMGRVKDFKAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  554

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APGS IW+AWS N   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  555   SFQDADLLKPDILAPGSLIWSAWSENGTDEANYVGEGFALISGTSMAAPHIAGIAALVKQ  614

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   ++  +  L  ATPFD+GSG ++PS AL
Sbjct  615   KHPQWSPAAIKSALMTTSTVMDRAGRPLQAQQYSETETVTLVKATPFDYGSGHVSPSSAL  674

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+D   +R      C   K    S+ N+PS+ IS+LV +
Sbjct  675   DPGLIFDAGYEDYLGFLCTTPGIDAHEIRNFTNTPC-NYKMRHPSNFNSPSIAISHLVRT  733

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +T+ RRVTNV   +E Y +  R    + + + P    + A  SR   + L     T  YS
Sbjct  734   QTITRRVTNVAEEEETYTITSRMEPSIVIEVSPPAMTLRAGASRSFTVTLTVRSVTGVYS  793

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H V +P
Sbjct  794   FGEVTLKGSRGHKVSIP  810



>ref|XP_010467868.1| PREDICTED: subtilisin-like protease [Camelina sativa]
 ref|XP_010467869.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=815

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/797 (43%), Positives = 475/797 (60%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A++Y+V M+  P +S                 RI  +S  VTMY + + ++HD+ LG L 
Sbjct  19    AEVYIVTMDGDPIISYKGGENGFEATAVESDERIDTSSELVTMYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  ++A + L +A GV+ + +D K+ ++TTHTP+FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPEQA-ETLRRAPGVKSVDKDWKVRRLTTHTPEFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LPHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN    +  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIQLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSPPT     + L ++ DV   +S++       CQ    F   LV+G +
Sbjct  375   LGNGKMLAGMGLSPPTRPHRLYTLVSSNDVLL-DSSSSKYNPSDCQRPEVFNKKLVKGNI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V  T    GAAGFVL ++    S   K   V   +PG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVATAKHLGAAGFVLVVENV--SPGTKFDPVPSAVPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R  +GR  +F A   I DG   +     P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNVSTSRDWTGRVKSFNAKGSIGDGLTPVLHKSAPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  552   SFQDADLLKPDILAPGYLIWAAWCPNGTDEPNYVGEGFALISGTSMAAPHIAGIAALVKQ  611

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NPS AL
Sbjct  612   KHPQWSPAAIKSALMTTSTVIDRAGRLLQAQQYSDTEAVTLVKATPFDYGSGHVNPSAAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+    +R      C  + K   S+ N PS+ +S+LVG+
Sbjct  672   DPGLIFDAGYEDYLGFLCTTPGISAHEIRNYTNTRCNYDMKH-PSNFNAPSIAVSHLVGT  730

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV R+VTNV   +E Y +  R    + + + P    +    SR   + +     +  YS
Sbjct  731   QTVTRKVTNVAEVEETYTITARMQPSIAIEVNPPAMTLRPGASRTFSVTMTVRSVSGVYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H VR+P
Sbjct  791   FGEVKLKGSRGHKVRLP  807



>ref|XP_010489462.1| PREDICTED: subtilisin-like protease [Camelina sativa]
 ref|XP_010489463.1| PREDICTED: subtilisin-like protease [Camelina sativa]
 ref|XP_010489464.1| PREDICTED: subtilisin-like protease [Camelina sativa]
 ref|XP_010489465.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=815

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/797 (43%), Positives = 475/797 (60%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A++Y+V M+  P +S                 RI  +S  VTMY + + ++HD+ LG L 
Sbjct  19    AEVYIVTMDGDPIISYKGGENGFEATAVESDERIDTSSELVTMYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  ++A + L +A GV+ + +D K+ ++TTHTP+FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPEQA-ETLRRAPGVKSVDKDWKVRRLTTHTPEFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LPHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN    +  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIQLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSPPT     + L ++ DV   +S++       CQ    F   LV+G +
Sbjct  375   LGNGKMLAGMGLSPPTRPHRLYTLVSSNDVLL-DSSSSKYNPSDCQRPEVFNKKLVKGNI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V  T    GAAGFVL ++    S   K   V   +PG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVATAKHLGAAGFVLVVENV--SPGTKFDPVPSAVPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R  +GR  +F A   I DG   +     P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNVSTSRDWTGRVQSFNAKGSIGDGLAPVLHKSAPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  552   SFQDADLLKPDILAPGYLIWAAWCPNGTDEPNYVGEGFALISGTSMAAPHIAGIAALVKQ  611

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             +HP W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NPS AL
Sbjct  612   KHPQWSPAAIKSALMTTSTVIDRAGRLLQAQQYSDTEAVTLVKATPFDYGSGHVNPSAAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+    +R      C  + K   S+ N PS+ +S+LVG+
Sbjct  672   DPGLIFDAGYEDYLGFLCTTPGISAHEIRNYTNTRCNYDMKH-PSNFNAPSIAVSHLVGT  730

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +TV RRVTNV   +E Y +  R    + + + P    +    SR   + +     +  YS
Sbjct  731   QTVTRRVTNVAEVEETYTISARMQPSIAIEVNPPAMTLRPGASRTFSVTMTVRSVSGVYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H VR+P
Sbjct  791   FGEVKLKGSRGHKVRLP  807



>emb|CDP04444.1| unnamed protein product [Coffea canephora]
Length=826

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/801 (43%), Positives = 477/801 (60%), Gaps = 32/801 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV-----------STRIKGTSGNVTMYK---QRMTKQHDVFLGSLLR  240
             E  IY+VLME  P V           + + +G+  N    K   + +   HD  L + L 
Sbjct  30    ERDIYIVLMEGEPVVFHHQKNSGTMPTEKGEGSDPNSEASKSHAKHLIDSHDQLLQTALD  89

Query  241   RSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPD  420
               +YTKLYS+ +++NGFAVH    +  +I  KA GV+ +  D + + MTT+TP FLG+P 
Sbjct  90    AGSYTKLYSFKNIVNGFAVHTSPSQVERI-KKAPGVKIVERDRRAKLMTTYTPQFLGLP-  147

Query  421   TVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR--KFTGKCITGDN  594
              VW + GG   +GEG VIG +D+GI+P H SF+     +   P I+   +F+G C +G  
Sbjct  148   AVWTQEGGDRNAGEGTVIGFVDSGIDPLHPSFAG----DPTNPYISELPRFSGTCESGPL  203

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
             FP T+CNGKIV A++F+  A AA   N S  + SPFDA GHGSH AS AAGN+  PV+ +
Sbjct  204   FPETSCNGKIVSARFFSAGAQAATALNASMDFLSPFDAAGHGSHVASIAAGNFGVPVVVD  263

Query  775   RFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgD  954
              F YG ASGMAP A IAVYKA+Y   G ++DV+AA+DQAV DGVDIL+LS+GP   P   
Sbjct  264   GFYYGKASGMAPRARIAVYKAIYPSVGVLTDVLAAIDQAVLDGVDILTLSIGPDQPPEDA  323

Query  955   SAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVL  1134
               FL   E+ +L A +AG+LV+QA GN GP   +++S+SPW   VAAS TDR Y  +++L
Sbjct  324   ITFLGTFEIFMLAANKAGILVIQAVGNGGPGPYTVVSYSPWTVGVAASDTDRSYPGTLIL  383

Query  1135  GNGQTFSGSGLSPPTAGKAFFQ--LAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVR  1302
             GNGQ   G GLS P++G+   Q  L  A D   RN     ++  +E CQ      P++V 
Sbjct  384   GNGQKIGGVGLSGPSSGQGLLQHRLILAKDAVIRNGNFPRISQYIEECQYPEALDPAVVL  443

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +VICT++  F +  +++  +  T    G  GFVL  +P  G        +   +PG++
Sbjct  444   GSVVICTFSDGFYNGTSNLTAIIKTAKVLGFVGFVLVANPRYG--DFIAEPIPFSVPGIM  501

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I     +  + QYY   T R + G  +++   A I +GR A   G+ P V+ +S+RGPD 
Sbjct  502   IPRTSDALLISQYYEEQTSRDKRGLVISYSGRAAIGEGRTAACMGRAPTVSRFSARGPDY  561

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +   +  DVLKP+I+APG  IWAAWSP S  D  + GQ+FAL+SGTSMATPHI+GIAAL
Sbjct  562   IDQRKNPTDVLKPDILAPGHQIWAAWSPLSASDPMLAGQNFALISGTSMATPHISGIAAL  621

Query  1843  IKDRHPNWKPSAITSAMMTSADVTD-RlgspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             IK  +P W PS I SAM T+A   D +    +        L  A PF FG+G +NPSRA+
Sbjct  622   IKQNNPKWTPSMIASAMSTTATKYDNQGDQIMAHGFEIDSLYTAAPFGFGAGHVNPSRAM  681

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWC-SDLNTPSVTISNLVG  2196
             +PGLVF+  ++ YI FLC++P +D  S+R   G  C     F   +DLN  SVTI+ L G
Sbjct  682   DPGLVFSAGYEDYISFLCSLPNLDPASIRTATGGPC--TSSFGSPADLNLASVTITALSG  739

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             SRTV RRVTNV    E Y   V  P+GV + I P  F ++  G + L I LN T+A + +
Sbjct  740   SRTVHRRVTNVASKPETYVCGVLPPVGVMIDIHPPWFRVAPQGIQDLEIRLNVTQALDDF  799

Query  2377  SFGEMILLGDRNHIVRVPFAV  2439
             SFGE++L G  +HI R+P +V
Sbjct  800   SFGEIVLTGSLDHIARIPLSV  820



>ref|XP_010087981.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB30991.1| Subtilisin-like protease [Morus notabilis]
Length=954

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/794 (43%), Positives = 481/794 (61%), Gaps = 33/794 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A++Y+V +E  P +S                 +I  +S  VT Y   +  +HD+ LG L
Sbjct  22    KAEVYIVTIEGEPIISYKGDIDGFEATAVESDEKIDTSSDLVTSYAHHLEMKHDMLLGLL  81

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
               R  Y K+YSY HL+NGF+VH+  ++A  + H A GV+ +  D K+ ++TTHTP FLG+
Sbjct  82    FERGTYEKIYSYRHLINGFSVHISPEQAETLRH-APGVKSVERDWKVRRLTTHTPQFLGL  140

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG +D+GI P H SF++      G      K+ GKC    +
Sbjct  141   PTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFAAHNTEPYGP---VPKYRGKCEINPD  197

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                + CNGKI+GAQ+FA+AA A+G FN +  +ASPFD DGHGSHTA+ AAGN   PV  +
Sbjct  198   TKKSFCNGKIIGAQHFAKAARASGSFNPAIDFASPFDGDGHGSHTAAIAAGNNGIPVRMH  257

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   +
Sbjct  258   GHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVYDGVDILSLSVGPNSPPAT  317

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N +
Sbjct  318   TKTTFLNPFDATLLAAVKAGVFVAQAAGNGGPFQKTLVSYSPWIASVAAAVDDRRYKNHL  377

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+  +G GLSP T     + L +A DV   +S+    +   CQ        LV G 
Sbjct  378   TLGNGKILAGLGLSPSTHLNQTYTLVSANDVLL-DSSITKYSPSDCQRPELLNKHLVEGN  436

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F S +ASI  V++T    GAAGFVL ++    S   K   V + +PG++I 
Sbjct  437   ILLCGYSFNFVSGSASIKKVSETTKALGAAGFVLCVENV--SPGTKFDPVPVGVPGIVIT  494

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN +T R  +GR  +F+A   I DG   I     P VA +S+RGP++ +
Sbjct  495   DVSKSQDLIDYYNVSTPRDWTGRVKSFQAKGSIGDGLMPILHKSAPQVAIFSARGPNIKD  554

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAALIK
Sbjct  555   FSFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAALIK  614

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG +NP  A
Sbjct  615   KKHPTWSPAAIKSALMTTSTTIDRAGRPIQAQQYSETEAMKLVSATPFDYGSGHVNPRAA  674

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF-WCSDLNTPSVTISNLV  2193
             L+PGL+F+  ++ Y+ FLC  PG+D   ++      C  +    W  +LNTPS+TI++LV
Sbjct  675   LDPGLIFDAGYEDYLGFLCTTPGIDVHEIKNYTTSPCNYSIGHPW--NLNTPSITIAHLV  732

Query  2194  GSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNS  2373
             G++TV+R VTNV   +E Y +  R    + +   P    +    SR   + L     T +
Sbjct  733   GTKTVIRTVTNV-AEEETYVIKTRMAPAIAIEANPPAMTLRPGSSRKFTVTLTVRSVTGT  791

Query  2374  YSFGEMILLGDRNH  2415
             YSFGE+++ G R H
Sbjct  792   YSFGEVLMKGSRGH  805



>emb|CDY46723.1| BnaC07g42280D [Brassica napus]
Length=817

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/798 (45%), Positives = 480/798 (60%), Gaps = 30/798 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A+IY+V ME  P +S                 +I  TS  VT Y + + ++HD+ LG L 
Sbjct  19    AEIYIVTMEGDPIISYKGGVNGFEATAVESDEKIDTTSDLVTSYGRHLERKHDMLLGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA H+   +A ++L ++ GV+ +  D K+ K+TTHTP FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHLSPAQA-EMLGRSPGVKSVSRDWKVRKLTTHTPQFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG ID+GI P H SF+S        P  + K  GKC      
Sbjct  138   TDVWPTGGGYDRAGEDIVIGFIDSGIFPHHPSFASHHTSVPYGPHPSYK--GKCEDDPRT  195

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CNGKI+GAQ+FA AA AAG FN    +ASP D DGHGSHTA+ AAGN   PV  + 
Sbjct  196   KLSFCNGKIIGAQHFAEAAKAAGAFNPDVDFASPMDGDGHGSHTAAIAAGNNGVPVRMHG  255

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssvpsgD  954
             + +G ASGMAP A IAVYKALY  FGG++SDVVAA+DQAV DGVDILSLSVGP+S P+  
Sbjct  256   YEFGKASGMAPRARIAVYKALYRLFGGFVSDVVAAIDQAVHDGVDILSLSVGPNSPPTTT  315

Query  955   S-AFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
                FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  316   KITFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  375

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSP T  +  +++ +A DV    S+        CQ        LV G +
Sbjct  376   LGNGKMLAGIGLSPSTRPRRSYKMVSANDVL-LGSSGVRYNPSDCQKPEVLNKKLVEGNI  434

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F + +ASI  VA+T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  435   LLCGYSFNFVAGSASIKKVAETARHLGAAGFVLVVENV--SPGTKFDPVPSGIPGILITD  492

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN  T R   GR  +F A   I DG   I     P VA +S+RGP+  + 
Sbjct  493   VSKSMDLIDYYNVTTSRDWMGRVKSFNAEGSIGDGLEPILHKSAPEVALFSARGPNTKDF  552

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGD-KYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                 AD+LKP+I+APGS IW+AWS N   +  Y+ G+ FAL+SGTSMA PHIAGIAAL+K
Sbjct  553   SFQDADLLKPDILAPGSLIWSAWSQNGTDEANYVAGEGFALISGTSMAAPHIAGIAALVK  612

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP W P+AI SA+MT++ V DR      +   ++  +  L  ATPFD+GSG +NPS A
Sbjct  613   QKHPQWSPAAIKSALMTTSTVMDRAGRPLQAQQYSETETMTLVKATPFDYGSGHVNPSAA  672

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGLVF+  ++ Y+ FLC  PG++   +R      C   K    S+ N+PS+ IS+LV 
Sbjct  673   LDPGLVFDAGYEDYLGFLCTTPGINAHEIRNFTNTPC-NYKMRHPSNFNSPSIAISHLVR  731

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++TV RRVTNV   +E Y +  R    + + + P    + A  SR   + L     +  Y
Sbjct  732   TQTVTRRVTNVAEEEETYTITSRMEPSIAIEVSPPAMTLRAGASREFSVTLTVRSVSGVY  791

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+ L G R H V +P
Sbjct  792   SFGEVTLKGSRGHKVSLP  809



>ref|NP_001288400.1| subtilisin-like protease precursor [Zea mays]
 gb|ACN28594.1| unknown [Zea mays]
 gb|AFW75874.1| putative subtilase family protein [Zea mays]
Length=822

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/798 (46%), Positives = 483/798 (61%), Gaps = 33/798 (4%)
 Frame = +1

Query  112   IYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSLLRR  243
             +Y+V ME  P VS R                I  TS  V  Y   +   HD  L SLL  
Sbjct  26    VYIVTMEGDPVVSYRGGVQGFPATAVDSDEEIDLTSEAVKSYALHLRGHHDKLLDSLLVE  85

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSY HL+NGFAVH+   +A + L KA GV+ +  D+K++K+TTHTP FLG+P  
Sbjct  86    GTYEKLYSYHHLINGFAVHMSPLQA-EFLKKAPGVKHVERDMKVQKLTTHTPQFLGLPTG  144

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIG-RPRITRKFTGKCITGDNFP  600
             VW   GG   +GE VVIG +D+GI P H SF++ +    G  PR    + GKC       
Sbjct  145   VWSTGGGLDRAGEDVVIGFVDSGIYPEHPSFAAHKTDPYGPAPR----YKGKCEMDPVTQ  200

Query  601   ATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRF  780
              + CNGKIVGAQ+FA+AA+AAG FN    +ASP D DGHGSHTA+ AAGN   PV  +  
Sbjct  201   RSFCNGKIVGAQHFAKAAMAAGAFNPDVEFASPLDGDGHGSHTAAIAAGNNGVPVRMHGH  260

Query  781   NYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-psgD  954
              +G ASGMAP A +AVYK LY  FGGY++DVVAA+DQAV+DGVDIL+LSVGP+S   +  
Sbjct  261   EFGKASGMAPRARVAVYKVLYRLFGGYIADVVAAIDQAVQDGVDILNLSVGPNSPPTATR  320

Query  955   SAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVL  1134
             + FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA   DRRY N + L
Sbjct  321   TTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAGVDDRRYKNHLTL  380

Query  1135  GNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLV  1314
             GNG+  SG G+SP T G   F L +A D     S+A   +   CQ         V+G+++
Sbjct  381   GNGKLLSGLGVSPATHGNMSFSLISAADALL-GSSATKYSALDCQRPELLNKRKVQGRIL  439

Query  1315  ICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNM  1494
             +C Y++++ S  ASI  V+ T    GAAGFV+ ++ +    +     V   IPG++I ++
Sbjct  440   LCGYSFNYISGTASIKKVSQTARNLGAAGFVVAVENNYPGTKFD--PVPFSIPGILITDV  497

Query  1495  EASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNAL  1674
               +  L  YYNS+T+R  +GRA AF+ATA I DG         P VA +SSRGPDV +  
Sbjct  498   SKTEDLIDYYNSSTIRDWAGRATAFKATAGIADGLAPTLYNSAPQVALFSSRGPDVKDFS  557

Query  1675  LDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDR  1854
                ADVLKP+I+APG+ IWAAW+PN   +    G+ FA+VSGTSMA PHIAGIAALIK +
Sbjct  558   FQDADVLKPDILAPGNLIWAAWAPNGTDESNYAGEGFAMVSGTSMAAPHIAGIAALIKQK  617

Query  1855  HPNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRALN  2022
             +P W PSAI SAMMT+A+  D+      +          L+ ATPFD GSG +NP  AL+
Sbjct  618   NPKWSPSAIKSAMMTTANTLDKGSRPLRAQQYTASEMMTLSRATPFDCGSGAVNPKAALD  677

Query  2023  PGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS--DLNTPSVTISNLVG  2196
             PGLV +   ++YI FLC++P V++  V  + G  C  + K      DLN PS+ IS L G
Sbjct  678   PGLVLDATHEEYIAFLCSIPDVNQSEVSNIAGSACNSSSKGRQRPFDLNLPSIAISQLRG  737

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             + TV R VT+V    E Y ++ R P  V + + P    +    SR L + L A   T +Y
Sbjct  738   TVTVTRTVTSVSEETETYTIMTRMPPEVALEVTPPAVTVLPGASRELAVTLTARSVTGTY  797

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+ + GDR H+VR+P
Sbjct  798   SFGEIAMKGDRGHLVRIP  815



>ref|XP_006297001.1| hypothetical protein CARUB_v10012994mg [Capsella rubella]
 ref|XP_006297002.1| hypothetical protein CARUB_v10012994mg [Capsella rubella]
 gb|EOA29899.1| hypothetical protein CARUB_v10012994mg [Capsella rubella]
 gb|EOA29900.1| hypothetical protein CARUB_v10012994mg [Capsella rubella]
Length=815

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/797 (43%), Positives = 474/797 (59%), Gaps = 30/797 (4%)
 Frame = +1

Query  106   AKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLL  237
             A +Y+V M+  P +S                 RI  +S  VT+Y + + ++HD+ LG L 
Sbjct  19    ADVYIVTMDGDPIISYKGGENGFEATAVESDERIDTSSELVTLYARHLERKHDMILGMLF  78

Query  238   RRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIP  417
                +Y KLYSY HL+NGFA HV  ++A + L +A GV+ + +D K+ ++TTHTP+FLG+P
Sbjct  79    EEGSYKKLYSYKHLINGFAAHVSPEQA-ETLRRAPGVKSVDKDWKVRRLTTHTPEFLGLP  137

Query  418   DTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNF  597
               VWP  GG   +GE +VIG +D+GI P H SF+S      G       + GKC    + 
Sbjct  138   TDVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LPHYKGKCEEDPHT  194

Query  598   PATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNR  777
               + CN KIVGAQ+FA AA AAG FN    YASP D DGHGSHTA+ AAGN    +  + 
Sbjct  195   KKSFCNRKIVGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAAIAAGNNGIQLRMHG  254

Query  778   FNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsg  951
             + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   + 
Sbjct  255   YEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTTT  314

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+  DRRY N + 
Sbjct  315   KTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAAIDDRRYKNHLT  374

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LGNG+  +G GLSPPT     + L +A DV   +S++       CQ    F   LV G +
Sbjct  375   LGNGKMLAGMGLSPPTRPHRLYTLVSANDVLL-DSSSSKYNPSDCQRPEVFNKKLVMGNI  433

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C Y+++F    ASI  V  T    GAAGFVL ++    S   K   V   IPG++I +
Sbjct  434   LLCGYSFNFVVGTASIKKVVATAKHLGAAGFVLVVENV--SPGTKFDPVPSAIPGILITD  491

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
             +  S  L  YYN +T R  +GR  +F+A   I DG   +     P VA +S+RGP+  + 
Sbjct  492   VSKSMDLIDYYNVSTSRDWTGRVKSFKAQGSIGDGLAPVLHKSAPQVALFSARGPNTKDF  551

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
                 AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA PHIAGIAAL+K 
Sbjct  552   SFQDADLLKPDILAPGFLIWAAWCPNGTDEPNYVGEGFALISGTSMAAPHIAGIAALVKQ  611

Query  1852  RHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRAL  2019
             ++P W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+GSG +NPS AL
Sbjct  612   KYPQWSPAAIKSALMTTSTVIDRAGRLLQAQQYSDTEAVTLVKATPFDYGSGHVNPSAAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGL+F+  ++ Y+ FLC  PG+    +R      C    K   S+ N+PS+ +S+LVGS
Sbjct  672   DPGLIFDAGYEDYLGFLCTTPGISSHEIRNYTNTRCNYEMKH-PSNFNSPSIAVSHLVGS  730

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             +T+ RRVTNV   +E Y +  R    + + + P    +    SR   + +     +  YS
Sbjct  731   QTITRRVTNVAEIEETYTITARMQPSIAIEVDPPAMTLRPGASRTFSVTMTVRSVSGVYS  790

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ L G R H VR+P
Sbjct  791   FGEVKLKGSRGHKVRLP  807



>ref|XP_007153989.1| hypothetical protein PHAVU_003G081700g [Phaseolus vulgaris]
 gb|ESW25983.1| hypothetical protein PHAVU_003G081700g [Phaseolus vulgaris]
Length=824

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/797 (43%), Positives = 482/797 (60%), Gaps = 28/797 (4%)
 Frame = +1

Query  103   EAKIYMVLMED--HPFVS-------TRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYT  255
             E  IY+VLME   H F         +     +   +   + +   HD+FL S L   +Y 
Sbjct  33    ERSIYLVLMEGDAHAFRQEPSMDQHSSTMHINSEASKTHEHLVSSHDLFLQSTLDTGSYN  92

Query  256   KLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPR  435
             KL+SY H++NGF+VH    +A + L    G++ + +D  ++ MTT+TPDFL +P  +W +
Sbjct  93    KLHSYKHIINGFSVHTTPSQAER-LRSGAGIKLVEKDRGVKMMTTYTPDFLSLPKGIWAQ  151

Query  436   LGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR--KFTGKCITGDNFPATA  609
              GG   +G+GVVIG +D+GINPFH SF+    Y+   P  +   +F   C+TG  FP ++
Sbjct  152   EGGEKNAGDGVVIGFVDSGINPFHPSFA----YDPMLPFTSNLSRFEAACMTGPLFPPSS  207

Query  610   CNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYG  789
             CNGKI+ A+YF+  A AA   + S+   SPFDADGHGSH AS AAGN   PV+ N F YG
Sbjct  208   CNGKILAARYFSAGAQAATTLDASKDILSPFDADGHGSHVASIAAGNAGVPVVVNGFCYG  267

Query  790   YASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLN  969
              ASGMAP A IAVYKA+Y   G ++DV+AA+D AV DGVDILSLSVGP   P     FLN
Sbjct  268   KASGMAPRARIAVYKAVYPSVGTLADVIAAIDHAVLDGVDILSLSVGPKEPPQDTLTFLN  327

Query  970   VLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQT  1149
             + ++ LLFA +AGVLVVQAAGN GP+S S++SFSPW   VAA+TT+R+Y +S++LGNG  
Sbjct  328   IFDISLLFARKAGVLVVQAAGNQGPASSSVVSFSPWSVGVAATTTNRKYPSSLLLGNGSI  387

Query  1150  FSGSGLSPPT--AGKAFFQLAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGKLVI  1317
              +G GLS P+   G  + +L  A D  +   T+      +E CQ      P +V G ++I
Sbjct  388   LNGVGLSGPSFGNGSVWHKLVLAKDAVKIKGTSPKTQEYIEECQHPEDLDPKIVLGSIII  447

Query  1318  CTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNME  1497
             CT++  F +  +++  + +TV   G  GFVL  +P  G        +     G++I  ++
Sbjct  448   CTFSAGFYNGTSTLGGIINTVKALGMEGFVLIANPSYG--DYIAEPMPFAFSGILIPRVD  505

Query  1498  ASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALL  1677
              +  + QY    T R+  G A  F A A + +GR A ++G+ P+V+ +SSRGPD+ +   
Sbjct  506   DAKVILQYCEEQTKRNEKGTATEFGALAAVGEGRLASFTGRSPIVSRFSSRGPDIIDIKK  565

Query  1678  DTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRH  1857
             + ADVLKP+I+APG  IWAAWSP S  +  +KG  FAL+SGTSM+TPH+AGIAALIK  +
Sbjct  566   NLADVLKPDILAPGHQIWAAWSPMSASEPLLKGDSFALLSGTSMSTPHVAGIAALIKQHN  625

Query  1858  PNWKPSAITSAMMTSADVTDRl-gspllaqqasqqlapaTPFDFGSGFINPSRALNPGLV  2034
             P W PS I SA+ T++   D L    +        L PATPF++GSGF+NP+RA++PGLV
Sbjct  626   PLWTPSMIASAISTTSSKYDNLGEPIMAEGLEVNSLFPATPFEYGSGFVNPNRAVDPGLV  685

Query  2035  FNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC--PENKKFWCSDLNTPSVTISNLVGSRTV  2208
              ++ +  +I FLC++P +D  +V    G +C  P    F    LN PSVT+S L GS +V
Sbjct  686   LSSEYADFISFLCSLPDIDTGAVAAATGEQCNHPFANPF---SLNLPSVTVSALRGSVSV  742

Query  2209  MRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGE  2388
              R + NVG   E Y   V  P G  V + P  F ++  G + L I  +  +   +++FGE
Sbjct  743   QRTLMNVGNTTETYLASVMPPNGTNVCLYPTWFTLTPQGVQDLEIQFSVVQPMQNFTFGE  802

Query  2389  MILLGDRNHIVRVPFAV  2439
             ++L G+ NHIVR+  +V
Sbjct  803   IVLTGNLNHIVRITLSV  819



>ref|XP_002974943.1| hypothetical protein SELMODRAFT_415166 [Selaginella moellendorffii]
 gb|EFJ23728.1| hypothetical protein SELMODRAFT_415166 [Selaginella moellendorffii]
Length=860

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/817 (44%), Positives = 492/817 (60%), Gaps = 45/817 (6%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTRIKGTSGNVTMYKQR---------------MTKQHDVFLGSLL  237
             E K+Y+V++   P V  +        T  KQR               +  +HD  L    
Sbjct  41    ERKVYLVVVRGRPVVHYQGGIPGFPATSSKQRINNALSDEDKNYASLLVARHDELLAKAF  100

Query  238   R-RSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
                 +Y KLYSY HL+NGFAV +   +A + L + + V  +  D +++ MTTHTP+++G+
Sbjct  101   PGEKSYRKLYSYHHLINGFAVELTETQAAR-LERMDDVVHVERDERVQTMTTHTPEYMGL  159

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P   WP+LGG + +G+GVVIG++DTGI+P H SF S             KFTGKC   + 
Sbjct  160   PGKCWPKLGGVANAGQGVVIGIVDTGIDPSHQSFKSSSSSTKSSSSSPVKFTGKCEVANE  219

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
             FP  +C+GKIVGA++FA+AAIA+G+FN S HYASP D DGHG+HTA+TAAGN    V+ N
Sbjct  220   FPQGSCSGKIVGARHFAQAAIASGEFNASVHYASPLDGDGHGTHTAATAAGNSGVSVVVN  279

Query  775   RFNYGYASGMAPGAGIAVYKALYSF-GGYMSdvvaavdqavedgvdIlslsvgpssvpsg  951
              FN+G +SGMAP A IAVYKALY + GG+ +DVVAA+DQAV DGVD+LSLSVGP+ +P  
Sbjct  280   GFNFGSSSGMAPAAKIAVYKALYRYIGGFFADVVAAIDQAVADGVDVLSLSVGPNGLPRR  339

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
             +  F++  ++ LL A +AGV V QA GN GP  R+ LSFSPW+ SVAA+T DR Y N+I 
Sbjct  340   NLTFMSTFDLALLSAVKAGVFVTQAVGNGGPYPRTSLSFSPWIFSVAAATHDRTYPNAIT  399

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKL  1311
             LG+  T +G+GL+  T G   F L  A D    N     + V+ CQDA  +  SLV G++
Sbjct  400   LGSNITITGTGLASGTNGS--FSLITAADAT--NGNVSRILVDECQDAGNYNRSLVSGRI  455

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINN  1491
             ++C+Y+  +    +++A          A+G V    PD+       + +    P +II +
Sbjct  456   LVCSYSLRYLFGVSTLADAVVAAQALRASGLVFLATPDLDGHSFPPSPIGF--PAIIIPS  513

Query  1492  MEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNA  1671
              + S  L  YYN++T R  SGR  +  A A I  GR A++S   P VA+YSSRGPDVN+ 
Sbjct  514   SKDSAVLLHYYNTSTRRDESGRLSSSAAMATIAGGREALFSFSAPKVATYSSRGPDVNSN  573

Query  1672  LLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKD  1851
              LD ADVLKPNI+APG+ IWAAWS     ++  +GQ FAL+SGTSMATPHIAGIAAL+K 
Sbjct  574   NLDVADVLKPNILAPGNLIWAAWSSIGSDEREFEGQEFALISGTSMATPHIAGIAALVKQ  633

Query  1852  RHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlap----aTPFDFGSGFINPSRAL  2019
             R P+  P+ I SAM T+A   D  G PLLAQ  S  +      ATPFDFG+GF+NP+ A+
Sbjct  634   RFPSLSPAGIASAMSTTALTLDSNGQPLLAQHPSSNVDSILGPATPFDFGAGFVNPAAAI  693

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVG-----------------VECPENKKFW  2148
             +PGL+F+  F+ YIQFLC++P +   +V    G                          +
Sbjct  694   DPGLIFDAGFRDYIQFLCSIPALSNSTVSAATGSSCLSSPSSPSSSSSNTTAAASISSSF  753

Query  2149  CSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGS  2328
              SDLNTP V+I++L G+R+V+R  T+V   DE Y   +  P GV VT+ P +F +     
Sbjct  754   ASDLNTPYVSIASLNGARSVVRIATSVSERDEAYNATLVVPAGVSVTVQPSSFSVRGGQL  813

Query  2329  RHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
               L + L A   +++ SFGE++L GDR H + +P  V
Sbjct  814   VKLTLTLKALVTSSAPSFGELLLDGDRGHRLHLPICV  850



>gb|KHG09526.1| Subtilisin-like protease [Gossypium arboreum]
Length=818

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/798 (44%), Positives = 481/798 (60%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A+IY+V +E  P +S                 ++  TS +VT Y   + K+HD+ LG L
Sbjct  22    KAEIYIVTVEGEPIISYKGGENGFEATAVESDEKLDTTSESVTSYASHLEKKHDMLLGML  81

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
                 +Y KLYSY HL+NGF+VH+   +A + L +A GV+ +  D K+ K+TTHTP FLG+
Sbjct  82    FEHGSYKKLYSYKHLINGFSVHLSPQQA-ETLKRAPGVKSVERDWKVRKLTTHTPQFLGL  140

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG +D+GI P H SF++  +   G      K+ GKC    +
Sbjct  141   PTGVWPAGGGFDRAGEDIVIGFVDSGIYPHHPSFAAHHDDPYGP---VPKYRGKCEIDPD  197

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                  CNGKI+GAQYFA AA AAG FN +  +ASP D DGHGSHTA+ AAGN   PV  +
Sbjct  198   TKRDFCNGKIIGAQYFAEAAKAAGAFNPTIDFASPMDGDGHGSHTAAIAAGNNGIPVRLH  257

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKA+Y  FGG+++DVVAA+DQAV DGVDILSLSV   S   +
Sbjct  258   GHEFGKASGMAPRARIAVYKAIYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPPTN  317

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N +
Sbjct  318   TKTTFLNPFDATLLAAVKAGVFVAQAAGNGGPFPKTLVSYSPWIASVAAAIDDRRYKNHL  377

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+  +G GLSP T     + + AA DV   +S+A   +   CQ        LV G 
Sbjct  378   NLGNGKALAGLGLSPSTHPNQTYTMVAANDVLL-DSSATKFSPSDCQRPEVLNKKLVEGN  436

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + IPG++I 
Sbjct  437   ILLCGYSFNFVVGTASIKKVSETAKALGAVGFVLAVENV--SPGTKFDPVPVGIPGILIT  494

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  +  L  YYN +T R  +GR  +F+A   I DG   I     P VA +S+RGP++ +
Sbjct  495   DVPKTMDLIDYYNVSTPRDWTGRVKSFKAIGSIGDGLMPILHKSAPEVALFSARGPNIRD  554

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAWSPN   +    G+ FAL+SGTSMA PHIAGIAAL+K
Sbjct  555   FSFQDADLLKPDILAPGSLIWAAWSPNGTDEPNFVGEGFALISGTSMAAPHIAGIAALLK  614

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP W P+AI SA+MT++   DR      +   ++  + +L PATPFD+GSG +NP  A
Sbjct  615   QKHPQWSPAAIKSALMTTSTKLDRAGRPLQAQQYSETEAMKLVPATPFDYGSGHVNPRAA  674

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ Y+ FLC  PG+D   +++     C  +     S+LNTPS+TIS+LVG
Sbjct  675   LDPGLIFDAGYEDYVGFLCTTPGIDIHEIKKYTNSPC-NSTIGRPSNLNTPSITISHLVG  733

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++TV R VTNV   +E Y +  R    + +   P    +    SR   + L     T SY
Sbjct  734   TQTVTRTVTNV-AEEETYVITARMHPSIAIETRPSAMTLRPGASRKFSVTLTTRSVTGSY  792

Query  2377  SFGEMILLGDRNHIVRVP  2430
              FGE+ + G R H V +P
Sbjct  793   CFGEITMKGSRGHKVTIP  810



>gb|ACG29348.1| SLP3 [Zea mays]
Length=822

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/797 (45%), Positives = 480/797 (60%), Gaps = 31/797 (4%)
 Frame = +1

Query  112   IYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSLLRR  243
             +Y+V ME  P VS R                I  TS  V  Y   +   HD  L SLL  
Sbjct  26    VYIVTMEGDPVVSYRGGVQGFPATAVDSDEEIDLTSEAVKSYALHLRGHHDKLLDSLLVE  85

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSY HL+NGFAVH+   +A + L KA GV+ +  D+K++K+TTHTP FLG+P  
Sbjct  86    GTYEKLYSYHHLINGFAVHMSPLQA-EFLKKAPGVKHVERDMKVQKLTTHTPQFLGLPTG  144

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPA  603
             VW   GG   +GE VVIG++D+GI P H SF++   +N        ++ GKC        
Sbjct  145   VWSTGGGLDRAGEDVVIGIVDSGIYPEHPSFAA---HNTDPYGPVPRYKGKCEMDPVTQR  201

Query  604   TACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFN  783
             + CNGKIVGAQ+FA+AA+AAG FN    +ASP D DGHGSHTA+ AAGN   PV  +   
Sbjct  202   SFCNGKIVGAQHFAKAAMAAGAFNPDVEFASPLDGDGHGSHTAAIAAGNNGVPVRMHGHE  261

Query  784   YGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsgDS  957
             +G ASGMAP A +AVYK LY  FGGY++DVVAA+DQAV+DGVDIL+LSV   S   +  +
Sbjct  262   FGKASGMAPRARVAVYKVLYRLFGGYIADVVAAIDQAVQDGVDILNLSVGPNSPPTATRT  321

Query  958   AFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLG  1137
              FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA   DRRY N + LG
Sbjct  322   TFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAGVDDRRYKNHLTLG  381

Query  1138  NGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVI  1317
             NG+  SG G+SP T G   F L +A D     S+A   +   CQ         V+G++++
Sbjct  382   NGKLLSGLGVSPATHGNMSFSLISAADALL-GSSATKYSALDCQRPELLNKRKVQGRILL  440

Query  1318  CTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNME  1497
             C Y++++ S  ASI  V+ T    GAAGFV+ ++      +     V + +PG++I ++ 
Sbjct  441   CGYSFNYISGTASIKKVSQTARNLGAAGFVVAVENSYPGTKFD--PVPVSVPGILITDVS  498

Query  1498  ASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALL  1677
              +  L  YYNS+T+R  +GRA AF+ATA I DG         P VA +SSRGPDV +   
Sbjct  499   KTEDLIDYYNSSTIRDWAGRATAFKATAGIADGLAPTLYNSAPQVALFSSRGPDVKDFSF  558

Query  1678  DTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRH  1857
               ADVLKP+I+APG+ IWAAW+PN   +    G+ FA+VSGTSMA PHIAGIAALIK ++
Sbjct  559   QDADVLKPDILAPGNLIWAAWTPNGTDESNYAGEGFAMVSGTSMAAPHIAGIAALIKQKN  618

Query  1858  PNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRALNP  2025
             P W PSAI SAMMT+A+  D+      +          L+ ATPFD GSG +NP  AL+P
Sbjct  619   PKWSPSAIKSAMMTTANTLDKGSRPLRAQQYTASEMMTLSRATPFDCGSGAVNPKAALDP  678

Query  2026  GLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS--DLNTPSVTISNLVGS  2199
             GLV +   ++YI FLC++P V++  V  + G  C  + K      DLN PS+ +S L G+
Sbjct  679   GLVLDATHEEYIAFLCSIPDVNQSEVSNIAGSACNSSSKGRQRPFDLNLPSIAVSQLRGT  738

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
              TV R VT+V    E Y ++ R P  V + + P    +    SR + + L A   T +YS
Sbjct  739   VTVTRTVTSVSEETETYTIMTRMPPEVALEVTPPAVTVLPGASREVAVTLTARSVTGTYS  798

Query  2380  FGEMILLGDRNHIVRVP  2430
             FGE+ + GDR H+VR+P
Sbjct  799   FGEIAMKGDRGHLVRIP  815



>ref|XP_004487980.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
Length=831

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/811 (44%), Positives = 485/811 (60%), Gaps = 44/811 (5%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTR--IKG--------------------------TSGNVTMYKQR  198
             EA++Y+V +E  P +S    I G                          +S +VT Y + 
Sbjct  22    EAEVYIVTVEGEPIISYTGGIDGFEATAVESDEKIDTSRYDSCRYYSQLSSESVTSYARH  81

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             +  +HD+ LG L  R  YTKLYSY HL+NGFAVH+ S + ++ L  A GV+ I  D K+ 
Sbjct  82    LENRHDMLLGMLFDRGTYTKLYSYRHLINGFAVHL-SPEQVETLRHAPGVKSIERDWKVR  140

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
             ++TTHTP+FLG+P +VWP  GG   +GE +VIG +D+GI P H SF++      G     
Sbjct  141   RLTTHTPEFLGLPTSVWPTGGGCDRAGEDIVIGFVDSGIYPHHPSFATHNTEPYGP---L  197

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
              K+ GKC        + CNGKI+GAQ+FA+AA A+G FN S  +ASP D DGHGSHTAS 
Sbjct  198   SKYRGKCEVDPETKKSFCNGKIIGAQHFAQAAKASGAFNPSIDFASPLDGDGHGSHTASI  257

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIl  915
             AAG    PV  +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDIL
Sbjct  258   AAGRNGIPVRLHGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAALDQAVHDGVDIL  317

Query  916   slsvgpssv-psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVA  1092
             SLSVGP+S   +  + FLN  +  LL A +AGV V QAAGN GP  +S++S+SPW+ SVA
Sbjct  318   SLSVGPNSPPAATKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKSLVSYSPWIVSVA  377

Query  1093  ASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQD  1272
             A+  DRRY N + LGNG+  +G GLSP T     + L AA D    +S      ++ CQ 
Sbjct  378   AAIDDRRYKNHLTLGNGKILAGLGLSPSTHLNQTYTLVAANDALLDSSVMKYSPLD-CQR  436

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
                   +L++GK+++C Y+++F    ASI  V++T    GA GFVL ++    S   K  
Sbjct  437   PEVLNKNLIKGKILLCGYSFNFVVGTASIKKVSETAKALGAVGFVLCVENV--SPGTKFD  494

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVV  1632
              V + +PG++I ++  S  L  YYN +T R  +GR   F+   +I DG R I     P V
Sbjct  495   PVPVGLPGILITDVSKSKELIDYYNISTSRDWTGRVKTFKGIGKIGDGLRPILHKSAPQV  554

Query  1633  ASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMA  1812
             AS+S+RGP++ +     AD+LKP+I+APGS IWAAWS N   D    G+ FA++SGTSMA
Sbjct  555   ASFSARGPNIKDFSFQDADLLKPDILAPGSLIWAAWSLNGTDDSNYDGEGFAMMSGTSMA  614

Query  1813  TPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPF  1980
              PHIAGIAAL+K +HP W P+AI SA++T++   DR      +   ++  + +L  ATPF
Sbjct  615   APHIAGIAALLKQKHPRWSPAAIKSALLTTSTTLDRAGSPILAQQYSETEAVKLVRATPF  674

Query  1981  DFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-D  2157
             D+GSG +NP  A++PGL+F+  +  Y+ FLC  PG+D   ++      C  NK      +
Sbjct  675   DYGSGHVNPRAAMDPGLIFDAGYNDYLGFLCTTPGIDVHEIKNYTNSPC--NKTMGQPYN  732

Query  2158  LNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHL  2337
             LNTPS+TIS+LV ++   R VTNV    E Y +  R    + + + P    I A  SR  
Sbjct  733   LNTPSITISHLVRTQIATRTVTNVAKEVETYVMTARMQPAIAIEVNPPAITIKAGASRRF  792

Query  2338  IIVLNATKATNSYSFGEMILLGDRNHIVRVP  2430
              + L     T +YSFGE+++ G R H VR+P
Sbjct  793   TVTLTVRTVTGTYSFGEVLMKGSRGHKVRIP  823



>ref|XP_011017651.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=817

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/799 (44%), Positives = 481/799 (60%), Gaps = 33/799 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A++Y+V M   P +S                  +  TS  VT Y Q + ++HD+ L SL
Sbjct  21    KAEVYIVTMMGEPVISYTGGIPGFEATAVESDETLDATSQLVTSYAQHLEQKHDILLDSL  80

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
               R  Y KLYSY HL+NGFAVH+  ++A + L +   V+ +  D K+ ++TTHTP FLG+
Sbjct  81    FDRGTYKKLYSYKHLINGFAVHISPEQA-ESLRRTADVKSVERDWKVRRLTTHTPQFLGL  139

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE ++IG +D+GI P H SF S   +N        K+ GKC    +
Sbjct  140   PTGVWPTGGGFDRAGEDIIIGFVDSGIFPRHPSFGS---HNADPYGPLPKYRGKCEVDPD  196

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                  CNGKI+GAQ+FA AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV  +
Sbjct  197   TKREFCNGKIIGAQHFAEAAIAAGAFNPSIDFASPMDGDGHGSHTAAIAAGNNGIPVRIH  256

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   +
Sbjct  257   GHEFGKASGMAPRARIAVYKALYRLFGGFIADVVAAIDQAVHDGVDILSLSVGPNSPPAT  316

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + +LN  +  LL A +AGV V QAAGN GP  ++++S+SPW+TSVAA+  DRRY N +
Sbjct  317   TTTTYLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITSVAAAIDDRRYKNHL  376

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+   G GLSP T     + L AA DV   +S+    +   CQ       +LV G 
Sbjct  377   FLGNGKILPGIGLSPCTHPNRTYNLVAANDVLL-DSSVMKYSPSDCQRPEVLNKNLVEGN  435

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + IPG++I 
Sbjct  436   ILLCGYSFNFVVGTASIKKVSETAKSLGAIGFVLAVENV--SPGTKFDPVPVNIPGILIT  493

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             +++ S  L  YYN++TLR  +GR  +F  T  I +G   I     P VA +S+RGP++ +
Sbjct  494   DVKKSMDLIDYYNTSTLRDWTGRVKSFNGTGSIGNGLEPILHKSAPQVALFSARGPNIKD  553

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K
Sbjct  554   FRFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAALVK  613

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG +NP  A
Sbjct  614   QKHPHWSPAAIKSALMTTSTNLDRAGRPLQAQQYSETEAMKLVMATPFDYGSGHVNPRAA  673

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF-WCSDLNTPSVTISNLV  2193
             L+PGL+F   ++ Y+ FLC  PG+D   +R      C  +    W  +LNTPS+T+S+LV
Sbjct  674   LDPGLIFEAGYEDYLGFLCTTPGIDVHEIRNYTNTPCNYSMGHPW--NLNTPSITVSHLV  731

Query  2194  GSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNS  2373
              ++TV RRVTNV   +E Y +  R    V +   P    +    SR   + L     T +
Sbjct  732   KTQTVTRRVTNV-AEEETYVITARMQPAVAIEANPPAMTLRPGASRKFTVSLTVRSVTGT  790

Query  2374  YSFGEMILLGDRNHIVRVP  2430
             YSFGE+++ G R H VR+P
Sbjct  791   YSFGEILMKGSRGHKVRIP  809



>ref|XP_002324698.2| hypothetical protein POPTR_0018s14020g [Populus trichocarpa]
 ref|XP_006372188.1| hypothetical protein POPTR_0018s14020g [Populus trichocarpa]
 gb|EEF03263.2| hypothetical protein POPTR_0018s14020g [Populus trichocarpa]
 gb|ERP49985.1| hypothetical protein POPTR_0018s14020g [Populus trichocarpa]
Length=817

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/798 (44%), Positives = 480/798 (60%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A++Y+V M   P +S                  +  TS  VT Y Q + ++HD+ L SL
Sbjct  21    KAEVYIVTMVGEPVISYTGGIPGFEATAVESDETLDATSQLVTSYAQHLEQKHDILLDSL  80

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
               R  Y KLYSY HL+NGFAVH+  D+A + L +   V+ +  D K+ ++TTHTP FLG+
Sbjct  81    FDRGTYKKLYSYKHLINGFAVHISPDQA-ETLRRTTDVKSVERDWKVRRLTTHTPQFLGL  139

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE ++IG +D+GI P H SF S   +N        K+ GKC    +
Sbjct  140   PTGVWPTGGGFDRAGEDIIIGFVDSGIFPRHPSFGS---HNADPYGPLPKYRGKCEVDPD  196

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                  CNGKI+GAQ+FA AAIAAG FN S  +ASP D DGHGSHTA+ AAGN   PV  +
Sbjct  197   TKREFCNGKIIGAQHFAEAAIAAGAFNPSIDFASPMDGDGHGSHTAAIAAGNNGIPVRIH  256

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   +
Sbjct  257   GHEFGKASGMAPRARIAVYKALYRLFGGFIADVVAAIDQAVHDGVDILSLSVGPNSPPAT  316

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV VVQAAGN GP  ++++S+SPW+TSVAA+  DRRY N +
Sbjct  317   TTTTFLNPFDATLLGAVKAGVFVVQAAGNGGPFPKTLVSYSPWITSVAAAIDDRRYKNHL  376

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+   G GLSP T     + L AA DV   +S+    +   CQ       +LV G 
Sbjct  377   FLGNGKILPGIGLSPCTHPNQTYTLVAANDVLL-DSSVMKYSPSDCQRPEVLNKNLVEGN  435

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  V++T    GA GFVL ++    S   K   V + IPG++I 
Sbjct  436   ILLCGYSFNFVVGTASIKKVSETARSLGAIGFVLAVENV--SPGTKFDPVPVGIPGILIT  493

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN++T R  +GR  +F  T  I +G   I     P VA +S+RGP++ +
Sbjct  494   DVTKSMDLIDYYNTSTPRDWTGRVKSFNGTGSIGNGLEPILHKSAPQVALFSARGPNIKD  553

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K
Sbjct  554   FRFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMMSGTSMAAPHIAGIAALVK  613

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG +NP  A
Sbjct  614   QKHPHWSPAAIKSALMTTSTNLDRAGRPLQAQQYSETEAMKLVTATPFDYGSGHVNPRAA  673

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+ +  ++ Y+ FLC  PG+D   +R      C  +     S+LNTPS+T+S+LV 
Sbjct  674   LDPGLILDAGYEDYLGFLCTTPGIDVHEIRNYTNTPCNYSMGH-PSNLNTPSITVSHLVK  732

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++TV RRVTNV   +E Y +  R    V +   P    +    SR   + L     T +Y
Sbjct  733   TQTVTRRVTNV-AEEETYVITARMQPAVAIEANPPAMTLRPGASRKFTVSLTVRSVTGTY  791

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+++ G R H VR+P
Sbjct  792   SFGEILMKGSRGHKVRIP  809



>ref|XP_007014396.1| Subtilisin-like serine protease 3 isoform 1 [Theobroma cacao]
 ref|XP_007014397.1| Subtilisin-like serine protease 3 isoform 1 [Theobroma cacao]
 gb|EOY32015.1| Subtilisin-like serine protease 3 isoform 1 [Theobroma cacao]
 gb|EOY32016.1| Subtilisin-like serine protease 3 isoform 1 [Theobroma cacao]
Length=818

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/798 (44%), Positives = 483/798 (61%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A+IY+V +E  P +S                 ++  TS  VT Y   + K+HD+ LG L
Sbjct  22    KAEIYIVTVEGEPIISYKGGENGFEATAVESDEKLDTTSELVTSYASHLEKKHDMLLGML  81

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
               R +Y KLYSY HL+NGF+VH+  ++A + L +A GV+ +  D K+ ++TTHTP FLG+
Sbjct  82    FERGSYKKLYSYKHLINGFSVHLSPEQA-ETLRRAPGVKSVERDWKVRRLTTHTPQFLGL  140

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG +D+GI P H SF++   Y+        K+ GKC    +
Sbjct  141   PTGVWPTGGGFDRAGEDIVIGFVDSGIYPLHPSFAA---YHTDPYGPVPKYRGKCEIDPD  197

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                  CNGKI+GAQ+FA AA AAG FN +  +ASP D DGHGSHTA+ AAGN   PV  +
Sbjct  198   TKRDFCNGKIIGAQHFAEAAKAAGAFNPAIDFASPMDGDGHGSHTAAIAAGNNGIPVRVH  257

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   +
Sbjct  258   GHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPQAT  317

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N +
Sbjct  318   TKTTFLNPFDATLLAAVKAGVFVAQAAGNGGPFPKTLVSYSPWIASVAAAIDDRRYKNHL  377

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+  +G GLSP T     + + AA DV   +S+    +   CQ       +LV G 
Sbjct  378   NLGNGKILAGMGLSPSTHPNQTYTMVAANDVLL-DSSVMKYSPSDCQRPEVLNKNLVEGN  436

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F    ASI  V++T     A GFVL ++    S   K   V + IPG++I 
Sbjct  437   ILLCGYSFNFVVGTASIKKVSETAKALRAVGFVLAVENV--SPGTKFDPVPVGIPGILIT  494

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN +T R  +GR  +F+A   I DG   I     P VA +S+RGP++ +
Sbjct  495   DVSKSMDLIDYYNVSTPRDWTGRVKSFKAIGSIGDGLMPILHKSAPQVALFSARGPNIKD  554

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL+K
Sbjct  555   YSFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAALLK  614

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG +NP  A
Sbjct  615   QKHPHWSPAAIKSALMTTSTKLDRAGRPLQAQQYSETEAMKLVTATPFDYGSGHVNPRAA  674

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ Y+ FLC+ PG+D   ++      C  +     S+LNTPS+TIS+LVG
Sbjct  675   LDPGLIFHAGYEDYLGFLCSTPGIDIHEIKNYTNSPC-NHTMGHPSNLNTPSITISHLVG  733

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++TV R VTNV   +E Y +  R    + +   P    +    SR   + L A   T +Y
Sbjct  734   TQTVTRTVTNV-AEEETYVITARMHPSIAIETNPSAMTLKPGASRKFSVTLTARSVTGTY  792

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+ + G R H V +P
Sbjct  793   SFGEITMKGSRGHKVSIP  810



>ref|XP_004163028.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN61172.1| hypothetical protein Csa_2G060530 [Cucumis sativus]
Length=816

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/801 (44%), Positives = 489/801 (61%), Gaps = 33/801 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A+IY+V +E  P VS                 +I  TS  VT Y + +  +HD+ LG
Sbjct  18    VGKAEIYIVTIEGEPIVSYKGDLDGFEATAMESDEKIDPTSEIVTSYARHLENKHDMLLG  77

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  R ++ KLYSY HL+NGFAV +  ++A + L +   V+ +  D K+ K+TTHTP+FL
Sbjct  78    MLFERGSFKKLYSYKHLINGFAVDITHEQA-ETLRRTPIVKSVERDWKVRKLTTHTPEFL  136

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SF++   YN        K+ GKC   
Sbjct  137   GLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFAT---YNTEPFGPCMKYKGKCEVD  193

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              N     CNGKIVGAQ+FA AA AAG FN   H+ASP D DGHGSHTA+ AAGN   PV 
Sbjct  194   PNTKKDFCNGKIVGAQHFAEAAKAAGAFNPDIHFASPLDGDGHGSHTAAIAAGNNGIPVR  253

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssvp  945
              + + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP+S P
Sbjct  254   MHGYEFGKASGMAPRARIAVYKALYRIFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPP  313

Query  946   sgDS-AFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
             +     +LN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ +VAA+  DRRY N
Sbjct  314   ATTKITYLNPFDATLLSAVKAGVFVAQAAGNGGPFPKTLVSYSPWIATVAAAIDDRRYKN  373

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+  +G GLSP T     + L AA DV   +S+    +   CQ        LV 
Sbjct  374   HLTLGNGKILAGLGLSPSTHLNRTYTLVAANDVLL-DSSVTKYSPSDCQKPEVLNKRLVE  432

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             GK+++C Y++ F    ASI  V+ T    GAAGFVL ++ +I S   K   V + IPG++
Sbjct  433   GKVLLCGYSFSFVVGTASIKKVSQTAKALGAAGFVLAVE-NI-SPGAKFDPVPVGIPGIL  490

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++  S  L  YYN++T R  +GR  +F A   I DG   +     P VA +S+RGP++
Sbjct  491   ITDVSKSMDLIDYYNTSTPRDWTGRVKSFDAVGSIGDGLMPLLYKSAPEVALFSARGPNI  550

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL
Sbjct  551   RDFSFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAAL  610

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTPFDFGSGFINPS  2010
             +K +HPNW P+AI SA+MT++   DR    L +   ++  + +L  ATPFD+GSG +NP 
Sbjct  611   VKQKHPNWSPAAIKSALMTTSTTMDRGGRPLKAQQFSETEAMKLVTATPFDYGSGHVNPR  670

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF-WCSDLNTPSVTISN  2187
              AL+PGL+F+  ++ Y+ FLC   G++   +       C       W  +LN+PS+TI++
Sbjct  671   AALDPGLIFDAGYEDYLGFLCTTAGINVHEIHNYTNSACNFTMGHPW--NLNSPSITIAH  728

Query  2188  LVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKAT  2367
             LVG++ V RRVTNV   +E Y +  R    V + + P    + +  SR   + L A   T
Sbjct  729   LVGTQIVTRRVTNV-AEEETYTITARMDPAVAIEVNPPAMTLLSGSSRKFSVTLTARSLT  787

Query  2368  NSYSFGEMILLGDRNHIVRVP  2430
              +YSFG+++L G R H VR+P
Sbjct  788   GTYSFGQVLLKGSRGHKVRIP  808



>gb|EPS72989.1| hypothetical protein M569_01766, partial [Genlisea aurea]
Length=810

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/803 (44%), Positives = 485/803 (60%), Gaps = 34/803 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVSTR------------------IKGTSGNVTMYKQRMTKQHDVF  222
               +++IY+V +E  P VS R                  +  TS +  +Y + + ++HD+ 
Sbjct  11    FGKSEIYIVTLEGEPVVSYRGGVDGFEATAADLDLDEELDVTSESAVLYARHLERRHDLL  70

Query  223   LGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPD  402
             L  L  + ++ KLYSY H++NGFAVH+  ++A  IL +A GV+ +  D K+ ++TTHTP+
Sbjct  71    LDMLFEQGSFKKLYSYRHVINGFAVHLTPEQA-DILVQAPGVKSVDRDWKVRRLTTHTPE  129

Query  403   FLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCI  582
             FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++    + G      +F GKC 
Sbjct  130   FLGLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHLSFATNNAEHYGP---VSRFRGKCE  186

Query  583   TGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTP  762
                +     CNGKIVGAQ+FA AA AAG FN    + SP D DGHGSHTA+ AAGN   P
Sbjct  187   VDRHTNRDFCNGKIVGAQHFAEAAKAAGAFNPDVDFDSPLDGDGHGSHTAAIAAGNNGIP  246

Query  763   VITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpss  939
             V  + F +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDIL+LS+GP+S
Sbjct  247   VRMHGFEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILNLSLGPNS  306

Query  940   v-psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRY  1116
                +  + FLN  +  LL A +AGV VVQAAGN GP  +S++S+SPW+T+VAA+  DRRY
Sbjct  307   PPATTKTTFLNPFDATLLSAVKAGVFVVQAAGNGGPFPKSLVSYSPWITTVAAAVDDRRY  366

Query  1117  TNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSL  1296
              N + LGNG+  +G GLSP T G   + L AA DV     +A       CQ       +L
Sbjct  367   KNHLTLGNGKILAGIGLSPSTHGNRSYTLVAANDVLL--DSAAKYGPFDCQRPEVLNKNL  424

Query  1297  VRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPG  1476
             V+GK+++C Y+++F S  +S+  VA T    GAAGFVL ++        K   V + +PG
Sbjct  425   VQGKILLCGYSFNFVSGTSSVKIVAQTARTLGAAGFVLAVEN--AYPGTKFDPVPVAVPG  482

Query  1477  LIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGP  1656
             ++I + + S  L  YYN++T R  +G   +F A   I DG R I     P+VA +S+RGP
Sbjct  483   IVITDSDKSMELINYYNTSTPRDWTGCVKSFDAVGYIGDGLRPILHKSAPIVALFSARGP  542

Query  1657  DVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIA  1836
             ++ +     AD+LKP+I+APGS IWAAWS N   +    G+ FA++SGTSMA PHIAGIA
Sbjct  543   NIKDYSFQDADLLKPDILAPGSLIWAAWSLNGTDEPNYLGEGFAMISGTSMAAPHIAGIA  602

Query  1837  ALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaq-----qasqqlapaTPFDFGSGFI  2001
             AL+K ++P+W P+AI SA+MT++   DR   PL A        +  L  ATPFD+GSG +
Sbjct  603   ALVKQKYPHWSPAAIKSALMTTSTTVDRAELPLRALQYAPGSENLSLVQATPFDYGSGHV  662

Query  2002  NPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTI  2181
             NP  AL+PGLVF++ ++ Y+ FLC   G+D   VR    V C        S+LN PSVTI
Sbjct  663   NPRAALDPGLVFDSGYEDYLGFLCTTRGIDTNEVRNYTHVPCNYTLGH-PSNLNVPSVTI  721

Query  2182  SNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATK  2361
             S LVGS+TV R VTNV   +E Y +  R    V +   P    +    S    + L    
Sbjct  722   SRLVGSQTVTRTVTNVAEEEETYTIQARMGPAVAIEASPAAMTLLPGASGKFTVTLTPRT  781

Query  2362  ATNSYSFGEMILLGDRNHIVRVP  2430
              T +YSFGE+ L G R H VR+P
Sbjct  782   ITGTYSFGEIWLKGSRGHKVRIP  804



>ref|XP_001769779.1| predicted protein [Physcomitrella patens]
 gb|EDQ65341.1| predicted protein [Physcomitrella patens]
Length=806

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/799 (44%), Positives = 486/799 (61%), Gaps = 28/799 (4%)
 Frame = +1

Query  100   AEAKIYMVLMEDHPFVSTR--IKGTSGN--------VTMYKQRMTKQHDVFLGSLLRRSA  249
             A+   YMVL+E  P V  +  I G  G         V+ YK  + ++HD  L  L +  +
Sbjct  12    ADIDTYMVLLEGPPIVIYKGDIPGLRGTAKAHVKDLVSKYKTHLIQKHDALLKDLFQEKS  71

Query  250   YTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVW  429
              TKLYS+TH+LNG AV + S +A  +L K   V  + +  K++  T HTP++LG+P  +W
Sbjct  72    CTKLYSFTHILNGAAVRLTSQQA-DVLAKHPSVVHVQKSFKVQTTTVHTPEYLGLPTGIW  130

Query  430   PRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRI-TRKFTGKCITGDNFPAT  606
              ++GG   +GE +VIG++DTGI+P H SFS+  +    +P +   K+ G C     FPA 
Sbjct  131   SKMGGALGAGEDIVIGIVDTGIDPTHPSFSTVGQ----KPYVPLSKYRGTCEVAKEFPAG  186

Query  607   ACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNY  786
             +CNGK++GAQ+F+ AA   G FN S H+ASP D DGHGSH ASTAAGNY  PVI N   Y
Sbjct  187   SCNGKLIGAQHFSAAASQDGAFNASLHFASPLDGDGHGSHVASTAAGNYGVPVILNNVTY  246

Query  787   GYASGMAPGAGIAVYKALYSF-GGYMSdvvaavdqavedgvdIlslsvgpssv-psgDSA  960
             G ASGMAP A IAVYKALY   GG++ DV+AA D+AV DGVDILSLS+GP+S   +  S 
Sbjct  247   GKASGMAPRARIAVYKALYRLIGGFIPDVIAACDKAVADGVDILSLSLGPNSPPGNSTST  306

Query  961   FLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGN  1140
             FLN+L++ LL A +A VLVVQAAGN GP  +++ SFSPWV SVAA   DR Y N I LG+
Sbjct  307   FLNILDLALLNAVKANVLVVQAAGNGGPYPKTVTSFSPWVLSVAAGVDDRTYPNVITLGD  366

Query  1141  GQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVIC  1320
                  G+GL+P T G+  + L  A D        G    + CQ+   F  +LV GKL+IC
Sbjct  367   KSVLKGTGLAPATKGEVLYPLILAKDATEGQGNPGFAPSD-CQEPSIFQKALVTGKLLIC  425

Query  1321  TYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEA  1500
             TY +++    +++  +  TV   GAAG VL ++ D    +     V L+IP + + +   
Sbjct  426   TYGFNYIFGGSTLQQLVKTVEAVGAAGVVLVVESDGSGSKFD--PVPLRIPAIALLSFAD  483

Query  1501  STALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLD  1680
             S     YY +NT R ++G+A++F ATA++ DG+  +Y+GQ   VA +SSRGPDV +   +
Sbjct  484   SATFLGYYEANTKRGQNGKALSFGATAKLGDGQVTVYTGQAQQVALFSSRGPDVRDFNFN  543

Query  1681  TADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHP  1860
              ADVLKPN+M PG  IW AW+P +  +   +G+HFA++SGTSMATPH+AG++AL+K ++P
Sbjct  544   DADVLKPNVMGPGFLIWGAWTPIAIDNAAYQGEHFAMISGTSMATPHVAGLSALLKAKYP  603

Query  1861  NWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRALNPG  2028
              W P+A++SAM+T+ADV D+      S  L+   +  L  ATPFD G G +N + A+NPG
Sbjct  604   AWSPAALSSAMVTTADVLDQQGRPIQSQQLSGGPTPLLQDATPFDMGGGALNINAAINPG  663

Query  2029  LVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTV  2208
             L+F   +  YI+FLC+        V       CP+      +DLNTPS+T +NLVG++TV
Sbjct  664   LIFEAVYLDYIKFLCSANMSTPGEVLAATKTACPQAPGI-PADLNTPSITFANLVGTKTV  722

Query  2209  MRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISA--DGSRHLIIVLNATKATNSYSF  2382
              R VTNV  A E Y V    P  V +T  P +F I      ++ +   L AT  + + SF
Sbjct  723   SRTVTNVMAAGETYTVTWTNPADVVLTASPTSFAIGTGLQNTQTVGFTLRATATSQTASF  782

Query  2383  GEMILLGDRNHIVRVPFAV  2439
             G +I  G   H V +P ++
Sbjct  783   GRIIFKGSLGHTVHIPVSI  801



>ref|XP_004148317.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=816

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/801 (44%), Positives = 488/801 (61%), Gaps = 33/801 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A+IY+V +E  P VS                 +I  TS  VT Y + +  +HD+ LG
Sbjct  18    VGKAEIYIVTIEGEPIVSYKGDLDGFEATAMESDEKIDPTSEIVTSYARHLENKHDMLLG  77

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  R ++ KLYSY HL+NGFAV +  ++A + L +   V+ +  D K+ K+TTHTP+FL
Sbjct  78    MLFERGSFKKLYSYKHLINGFAVDITHEQA-ETLRRTPIVKSVERDWKVRKLTTHTPEFL  136

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SF++   YN        K+ GKC   
Sbjct  137   GLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFAT---YNTEPFGPCMKYKGKCEVD  193

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              N     CNGKIVGAQ+FA AA AAG FN   H+ASP D DGHGSHTA+  AGN   PV 
Sbjct  194   PNTKKDFCNGKIVGAQHFAEAAKAAGAFNPDIHFASPLDGDGHGSHTAAIVAGNNGIPVR  253

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssvp  945
              + + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP+S P
Sbjct  254   MHGYEFGKASGMAPRARIAVYKALYRIFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPP  313

Query  946   sgDS-AFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
             +     +LN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ +VAA+  DRRY N
Sbjct  314   ATTKITYLNPFDATLLSAVKAGVFVAQAAGNGGPFPKTLVSYSPWIATVAAAIDDRRYKN  373

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+  +G GLSP T     + L AA DV   +S+    +   CQ        LV 
Sbjct  374   HLTLGNGKILAGLGLSPSTHLNRTYTLVAANDVLL-DSSVTKYSPSDCQKPEVLNKRLVE  432

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             GK+++C Y++ F    ASI  V+ T    GAAGFVL ++ +I S   K   V + IPG++
Sbjct  433   GKVLLCGYSFSFVVGTASIKKVSQTAKALGAAGFVLAVE-NI-SPGAKFDPVPVGIPGIL  490

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++  S  L  YYN++T R  +GR  +F A   I DG   +     P VA +S+RGP++
Sbjct  491   ITDVSKSMDLIDYYNTSTPRDWTGRVKSFDAVGSIGDGLMPLLYKSAPEVALFSARGPNI  550

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL
Sbjct  551   RDFSFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAAL  610

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTPFDFGSGFINPS  2010
             +K +HPNW P+AI SA+MT++   DR    L +   ++  + +L  ATPFD+GSG +NP 
Sbjct  611   VKQKHPNWSPAAIKSALMTTSTTMDRGGRPLKAQQFSETEAMKLVTATPFDYGSGHVNPR  670

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF-WCSDLNTPSVTISN  2187
              AL+PGL+F+  ++ Y+ FLC   G++   +       C       W  +LN+PS+TI++
Sbjct  671   AALDPGLIFDAGYEDYLGFLCTTAGINVHEIHNYTNSACNFTMGHPW--NLNSPSITIAH  728

Query  2188  LVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKAT  2367
             LVG++ V RRVTNV   +E Y +  R    V + + P    + +  SR   + L A   T
Sbjct  729   LVGTQIVTRRVTNV-AEEETYTITARMDPAVAIEVNPPAMTLLSGSSRKFSVTLTARSLT  787

Query  2368  NSYSFGEMILLGDRNHIVRVP  2430
              +YSFG+++L G R H VR+P
Sbjct  788   GTYSFGQVLLKGSRGHKVRIP  808



>gb|KHN35806.1| Subtilisin-like protease [Glycine soja]
Length=744

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/744 (46%), Positives = 463/744 (62%), Gaps = 14/744 (2%)
 Frame = +1

Query  217   VFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHT  396
             + LG L  R  Y KLYSY HL+NGFAVH+  ++A  + H A GV+ +  D K++++TTHT
Sbjct  1     MLLGLLFERGTYNKLYSYRHLINGFAVHLSPEQAETLRH-APGVKSVERDWKVKRLTTHT  59

Query  397   PDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGK  576
             P FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++      G      ++ GK
Sbjct  60    PQFLGLPTGVWPTGGGYERAGEDIVIGFVDSGIYPHHPSFTTHNTEPYGP---VSRYRGK  116

Query  577   CITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYH  756
             C    +   + CNGKIVGAQ+FA+AAIAAG FN S  + SP D DGHGSHTAS AAG   
Sbjct  117   CEVDPDTKKSFCNGKIVGAQHFAQAAIAAGAFNPSIDFDSPLDGDGHGSHTASIAAGRNG  176

Query  757   TPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-g  930
              PV  +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV  
Sbjct  177   IPVRMHGHEFGKASGMAPRARIAVYKALYRLFGGFIADVVAAIDQAVHDGVDILSLSVGP  236

Query  931   pssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDR  1110
              S   +  + FLN  +  LL A +AGV V QAAGN GP  +S++S+SPW+ +VAA+  DR
Sbjct  237   NSPPSNTKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKSLVSYSPWIATVAAAIDDR  296

Query  1111  RYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVP  1290
             RY N ++LGNG+  +G GLSP T     + L AA DV   +S+A   +   CQ       
Sbjct  297   RYKNHLILGNGKILAGLGLSPSTRLNQTYTLVAATDVLL-DSSATKYSPTDCQRPQLLNK  355

Query  1291  SLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQI  1470
             +L++G +++C Y+++F   +ASI  V++T    GAAGFVL ++    S   K   V + I
Sbjct  356   NLIKGNILLCGYSFNFVIGSASIKQVSETAKALGAAGFVLCVENV--SPGTKFDPVPVGI  413

Query  1471  PGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSR  1650
             PG++I +   S  L  YYN +T R  +GR   F  T +I DG   I     P VA +S+R
Sbjct  414   PGILITDASKSKELIDYYNISTPRDWTGRVKTFEGTGKIEDGLMPILHKSAPQVAIFSAR  473

Query  1651  GPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAG  1830
             GP++ + +   AD+LKP+I+APGS IWAAWS N   +    G+ FA++SGTSMA PHIAG
Sbjct  474   GPNIKDFIFQEADLLKPDILAPGSLIWAAWSLNGTDEPNYAGEGFAMISGTSMAAPHIAG  533

Query  1831  IAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGF  1998
             IAALIK +HP+W P+AI SA+MT++   DR      + L ++  + +L  ATPFD+GSG 
Sbjct  534   IAALIKQKHPHWSPAAIKSALMTTSTTLDRAGNPILAQLYSETEAMKLVKATPFDYGSGH  593

Query  1999  INPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVT  2178
             +NP  AL+PGL+F+  ++ Y+ FLC  PG+D   ++      C  N     S+LNTPS+T
Sbjct  594   VNPQAALDPGLIFDAGYEDYLGFLCTTPGIDVNEIKNYTNSPC-NNTMGHPSNLNTPSIT  652

Query  2179  ISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNAT  2358
             IS+LV ++ V R VTNV   +E Y +  R    V + + P    I A  SR   + L   
Sbjct  653   ISHLVRTQIVTRTVTNVADEEETYVISGRMQPAVAIEVNPPAMTIKAGASRRFTVTLTVR  712

Query  2359  KATNSYSFGEMILLGDRNHIVRVP  2430
               T +YSFGE+++ G R H VR+P
Sbjct  713   SVTGTYSFGEVLMKGSRGHKVRIP  736



>ref|XP_004296484.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=820

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/798 (44%), Positives = 484/798 (61%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSL  234
              A +Y+V +E  P +S R                I  TS +VT Y + +  +HD+ LG L
Sbjct  24    RADVYIVTIEGEPIISYRGDVDGFEATAVESDEKIDTTSESVTSYARHLENKHDMLLGML  83

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
               +  Y KLYSY HLLNGFAVH+  ++A +++ +A GV+ +  D K+ ++TTHTP FLG+
Sbjct  84    FEQGTYKKLYSYQHLLNGFAVHISHEQAERLM-RAPGVKSVERDWKVRRLTTHTPQFLGL  142

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG +D+GI P H SF+S      G      K+ G C    +
Sbjct  143   PTGVWPTGGGFDRAGENIVIGFVDSGIYPHHPSFASYHSDPYGP---VPKYRGTCEVDPD  199

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                + CNGKI+GA++FA++AIAAG FN +  +ASP D DGHGSHTA+ AAGN   PV  +
Sbjct  200   TKRSFCNGKIIGARHFAKSAIAAGVFNPAIDFASPMDGDGHGSHTAAIAAGNNGIPVRMH  259

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKALY  FGG++SDVVAA+DQAV DGVDILSLSV   S   +
Sbjct  260   GHEFGKASGMAPRARIAVYKALYRLFGGFVSDVVAAIDQAVYDGVDILSLSVGPNSPPAT  319

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + +LN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N +
Sbjct  320   TKTTYLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWIASVAAAIDDRRYKNHL  379

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
              LGNG+   G GLSP T     + L AA DV   +S     +   CQ       +LV G 
Sbjct  380   TLGNGKVLPGLGLSPSTHPNRTYTLVAANDVLLDSSVVKY-SPSDCQRPEVLNKNLVEGN  438

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F   +ASI  V+ T    GA GFVL ++    S   K   V   IPG++I 
Sbjct  439   ILLCGYSFNFVVGSASIKKVSQTAKSLGAIGFVLAVENV--SPGTKFDPVPSGIPGIVIT  496

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN +T R  +GR  +F+A   I DG   I     P VA +S+RGP++ +
Sbjct  497   DVSKSMDLINYYNISTSRDWTGRVKSFKAIGSIGDGLMPILHKSAPQVAIFSARGPNIKD  556

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  +D+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAALIK
Sbjct  557   FSFQDSDLLKPDILAPGSLIWAAWSPNGTDEPDYVGEGFAMISGTSMAAPHIAGIAALIK  616

Query  1849  DRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqql----apaTPFDFGSGFINPSRA  2016
              +HP+W P+AI S++MT++   DR G PL AQQ S+        ATPFD+GSG ++P  A
Sbjct  617   QKHPHWSPAAIKSSLMTTSTTMDRAGKPLQAQQTSETQGIKFVSATPFDYGSGHVDPRAA  676

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  FQ Y+ FLC  PG+D   ++      C        S+ N+PS+T+S+LV 
Sbjct  677   LDPGLIFDVGFQDYLGFLCTTPGIDAHEIKNYTNSPCNYTMGH-PSNFNSPSITVSHLVR  735

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             +RTV R VTNV   +E Y +  R    + +++ P    +    SR   + L A + T +Y
Sbjct  736   TRTVTRTVTNV-AQEETYVITARMAPAIAISVSPPAMTLKPGASRKFSVSLTARRLTGTY  794

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE++L G R H VR+P
Sbjct  795   SFGEVLLKGSRGHKVRIP  812



>ref|XP_008224714.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=818

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/794 (44%), Positives = 473/794 (60%), Gaps = 24/794 (3%)
 Frame = +1

Query  103   EAKIYMVLMEDHP---FVSTRIKGTSGNV-TMYKQRMTKQHDVFLGSLLRRSAYTKLYSY  270
             E  IY+VLME  P   +   R    +G V   + + +   HD  L S L   +Y+KLYS+
Sbjct  28    ERAIYIVLMEGDPVALYGDGRRLDVNGEVFKAHAKSLVDSHDQLLQSALETGSYSKLYSF  87

Query  271   THLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPS  450
              H+LNGFAVH    +A K L +A  V+ +  D   + MTT+TP FLG+P  VW + GG  
Sbjct  88    KHILNGFAVHTTPSQAEK-LKEAPRVKLVESDRGAKLMTTYTPQFLGLPQGVWTQGGGDD  146

Query  451   -VSGEGVVIGMIDTGINPFHASFS----SPEEYNIGRPRITRKFTGKCITGDNFPATACN  615
               +GEG+VIG +DTGINP H SF+    +P   NI        F+G C T   FPA++CN
Sbjct  147   HNAGEGIVIGFVDTGINPTHPSFAYDPLNPFTSNISH------FSGACKTDPQFPASSCN  200

Query  616   GKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYA  795
             GKIV A++F+  A A    N +  + SPFDA GHGSH AS AAGN   PV+ N F YG A
Sbjct  201   GKIVSAKFFSAGAQAVATLNSTVDFLSPFDAVGHGSHVASIAAGNAGVPVVVNGFYYGRA  260

Query  796   SGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVL  975
             SGMAP A IAVYKA+Y   G ++DVV+A+DQAV DGVDIL+LSVGP   P   + FL+  
Sbjct  261   SGMAPRARIAVYKAVYPTVGTLTDVVSAIDQAVLDGVDILTLSVGPDEPPEDTATFLSTF  320

Query  976   EVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFS  1155
             ++ +LF  RAG+ VVQAAGN GP+  S++S+SPW   VA+S+TDR Y  S++LGNG    
Sbjct  321   DIAMLFGRRAGIFVVQAAGNQGPAPSSVVSYSPWAVGVASSSTDRTYPGSVILGNGTKIE  380

Query  1156  GSGLSPPTAGKAFF--QLAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGKLVICT  1323
             G GLS PT G      +L  A DV + + +       VE CQ      P++V+G +VICT
Sbjct  381   GVGLSGPTFGYGLLLHKLVLAKDVLKASGSFPRTPPYVEECQYPEALDPNVVQGSVVICT  440

Query  1324  YTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEAS  1503
             ++  F +  ++I  + +T    G  GFVL  +P+ G        +   + G+++ N+   
Sbjct  441   FSEGFYNGTSTITAIINTAKVLGFMGFVLVANPNYG--DFIAEPIPFGVSGIMVPNVTNV  498

Query  1504  TALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDT  1683
               + QYY   T +   G A  F A A I +GR A ++G  PVV+  SSRGPD  N+    
Sbjct  499   QVILQYYEQETCKEEKGFATRFAAKAAIGEGRVASFTGHAPVVSRLSSRGPDFINSSRTP  558

Query  1684  ADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPN  1863
              DVLKP+I+APG  IWAAWSP S  +  + G +FAL+SGTSMATPH+AGIAALIK    +
Sbjct  559   CDVLKPDILAPGHQIWAAWSPISALEPTLTGYNFALLSGTSMATPHVAGIAALIKQYKSS  618

Query  1864  WKPSAITSAMMTSADVTD-RlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFN  2040
             W PS I SA+ T+A   D      +          P+TPFDFG+GF++PSRA++PGLV +
Sbjct  619   WTPSMIASAISTTATKYDGDGEFIMAEGSDIGSSYPSTPFDFGAGFVSPSRAMDPGLVLS  678

Query  2041  TYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRV  2220
             + ++ YI FLC++P ++  ++R   G  C  N     ++LN PSVT+S L GSR V R  
Sbjct  679   SGYEDYISFLCSLPEINPATIRNATGELC-NNTLDHPANLNIPSVTLSALKGSRIVRRTF  737

Query  2221  TNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILL  2400
             TNVG   E Y      P G  V + P  F I+  GS+ L I +   +A + ++FGE++L 
Sbjct  738   TNVGSKPETYLCSALSPNGTIVDLCPTWFRIAPQGSQELHIQVKVAQAMDGFTFGEIVLT  797

Query  2401  GDRNHIVRVPFAVY  2442
             G  NHIVR+P +V+
Sbjct  798   GSLNHIVRIPLSVF  811



>ref|XP_004235142.1| PREDICTED: subtilisin-like protease SBT3.5 [Solanum lycopersicum]
Length=817

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/804 (44%), Positives = 476/804 (59%), Gaps = 38/804 (5%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTRIKGTSGN----------VTMYKQRMTKQHDVFLGSLLRRSAY  252
             + KIY+VL+E  P     +K  S               Y   +TK HD FL S L R +Y
Sbjct  22    DKKIYLVLLEGDPIAFQHVKTISQEGKKLDPNSEASKAYANELTKSHDEFLQSYLERGSY  81

Query  253   TKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWP  432
              K+YS+ H++NG AVH    + +K L  A  V+ + ED ++++MTT+TP FLGIP  VW 
Sbjct  82    DKIYSFKHIINGVAVHTTPSQ-IKKLKNAARVKLLEEDRRVKQMTTYTPQFLGIP-AVWT  139

Query  433   RLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATAC  612
             + GG   +GEG+VIG ID+GI+P H SF+     N      T  F+G C  G  FP T+C
Sbjct  140   QQGGDRNAGEGIVIGFIDSGIDPDHPSFAYDPTTN---KTFTGSFSGACEEGPLFPQTSC  196

Query  613   NGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGY  792
             NGKIV A++F+  A      N S    SPFDA GHGSH ASTA GN+  PV+ N   YG 
Sbjct  197   NGKIVSARFFSAGAQTTTTLNDSMDILSPFDAVGHGSHVASTATGNFGVPVVVNGLYYGR  256

Query  793   ASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNV  972
             ASGMAP A IAVYKA+Y   G +SDV+AA+DQAV DGVDIL+LSVGP   P     FL++
Sbjct  257   ASGMAPRARIAVYKAIYPSIGTLSDVLAAIDQAVLDGVDILTLSVGPEEPPEDKLTFLSL  316

Query  973   LEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTF  1152
              E+ +L A +AG LV+QAAGN GPS  S++S+SPW   VA+  TDR Y  +++LGNG   
Sbjct  317   FEIFMLAAHKAGTLVIQAAGNEGPSPYSVISYSPWAVGVASCDTDRTYPATLILGNGLKI  376

Query  1153  SGSGLSPPTAGKAFF----QLAAAVDVCRRNSTAGLLTV---ESCQDAMQFVPSLVRGKL  1311
             +G GLS  TAG        +L  A D  + N+T   + +   E CQ    F P +V+G +
Sbjct  377   AGVGLSGATAGDGLMIQYNKLVLAKDAIKINTTLPRIAINNAEECQYPEAFDPLVVQGSV  436

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIG---SEQIKGATVTLQIPGLI  1482
             VICT++  F +  +++  +  T        FV   +P  G   +E I  AT     P ++
Sbjct  437   VICTFSAGFYNGTSTLTAIIQTARVLRFKAFVFVANPTYGDFIAEPIPFAT-----PAIM  491

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I     +  + QYY   T+R  +G  V +   A I +GR A Y G+ P+V+ +SSRGPD 
Sbjct  492   IPATTDTQNILQYYEKATVRDANGLVVRYGGRAAISEGRNASYKGRAPIVSRFSSRGPDY  551

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +      DVLKP+I+APG  IWAAWSP S  D  + G +FAL+SGTSMATPHIAGIAA+
Sbjct  552   IDQSKSPTDVLKPDILAPGHQIWAAWSPMSLLDPILSGHNFALMSGTSMATPHIAGIAAM  611

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlapaT-PFDFGSGFINPSRAL  2019
             IK  +P+W PS I SA+ T+A   D LG P++A          + PF FG+G +NPS AL
Sbjct  612   IKQYNPSWTPSMIASAISTTASTYDNLGDPIMAHGFDLYTLHTSAPFGFGAGLVNPSGAL  671

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECP---ENKKFWCSDLNTPSVTISNL  2190
             +PGLVF+  ++ YI FLC++P +D + V+   G  C    EN     SDLN PS+TI++L
Sbjct  672   HPGLVFSAGYEDYISFLCSLPNIDSRIVKTATGGICGQLFENP----SDLNLPSITITSL  727

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
              GSR V R VTNV    E Y   V  P GV V I P  F I+  G++ L I  N T+A +
Sbjct  728   NGSRIVHRAVTNVESKAETYLSAVLPPKGVTVNIEPSWFTIAPQGTQDLHITFNVTQALD  787

Query  2371  SYSFGEMILLGDRNHIVRVPFAVY  2442
              ++FGE++L G  NH+V++P +++
Sbjct  788   DFTFGEIVLTGSLNHVVKMPLSIF  811



>ref|XP_009799224.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=809

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/794 (44%), Positives = 477/794 (60%), Gaps = 24/794 (3%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTRIKGTSG-------NVTMYKQRMTKQHDVFLGSLLRRSAYTKL  261
             + KIY+VLME  P    ++K +S        N   Y   +TK HD FL S L R +Y KL
Sbjct  22    DRKIYLVLMEGDPVAFHQVKTSSEKGNKLDPNSEAYANELTKSHDEFLQSNLERGSYHKL  81

Query  262   YSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLG  441
             YS+ H++NG A+H    + ++ L  A  V+ + ED +++ MTT+TP FLGIP  VW + G
Sbjct  82    YSFKHIVNGVAIHTTPSQ-IENLKNAPRVKLVEEDRRVKLMTTYTPQFLGIP-AVWTQEG  139

Query  442   GPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGK  621
             G    GEG+VIG +D+GINP H SFS            ++ F+G C  G  FP T+CNGK
Sbjct  140   GDRNIGEGIVIGFVDSGINPDHPSFSYDPTTTTNY--TSQHFSGACEEGPLFPETSCNGK  197

Query  622   IVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASG  801
             IV A++F+  A A    N S    SPFDA GHGSH AS AAGN+  PV+ N   YG A+G
Sbjct  198   IVSARFFSNGAQATAILNASVDILSPFDAVGHGSHVASIAAGNFGVPVVVNGLYYGRATG  257

Query  802   MAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEV  981
             MAP A IAVYKA+Y   G +SDV+AA+DQAV DGVDIL+LS+GP   P G   FL++ E+
Sbjct  258   MAPRARIAVYKAIYPSIGTLSDVLAAIDQAVLDGVDILTLSIGPDEPPEGTLTFLSLFEI  317

Query  982   QLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGS  1161
              +L A +AG  VVQAAGN GPS  S++S+SPW   VAA   DR Y  +++LGNG    G 
Sbjct  318   FMLAAHKAGTFVVQAAGNQGPSPYSVISYSPWAVGVAACDIDRTYPATLILGNGLKIGGV  377

Query  1162  GLSPPTAGKAFFQ--LAAAVDVCRRNST-AGLLTVESCQDAMQFVPSLVRGKLVICTYTY  1332
             GLS PT G    Q  L  A D  ++NST   +   + CQ    F P +V+  +VICT++ 
Sbjct  378   GLSGPTFGGGLIQYKLVLAKDAVKKNSTFPRIFNADECQYPEAFDPLVVQDSVVICTFSA  437

Query  1333  DFESEAASIATVADTVHRAGAAGFVLTMDPDIG---SEQIKGATVTLQIPGLIINNMEAS  1503
              F +  +S+  +  T +      FV   +P  G   +E I  AT     PG++I     +
Sbjct  438   GFYNGNSSLMGIIHTANLLRFKAFVFVANPSYGDFIAEPIPFAT-----PGIMIPTTIDT  492

Query  1504  TALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDT  1683
               + QYY   T+R ++G  V +   A I +GR A Y G+ P+V+ +SSRGPD  +   + 
Sbjct  493   QNILQYYERVTVRDKNGFVVRYGGRAAISEGRIASYKGRAPIVSRFSSRGPDYIDQSKNP  552

Query  1684  ADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPN  1863
              DVLKP+I+APG  IWAAWSP S  +  + G +FAL+SGTSMATPHIAG+AALIK  +P+
Sbjct  553   TDVLKPDILAPGHQIWAAWSPMSVLNPILSGHNFALLSGTSMATPHIAGVAALIKQYNPS  612

Query  1864  WKPSAITSAMMTSADVTDRlgspllaqqasqqlapaT-PFDFGSGFINPSRALNPGLVFN  2040
             W PS + SAM T+A   D LG P++A          + PF FG+G +NPS AL+PGL+F+
Sbjct  613   WTPSMVASAMSTTATTYDNLGDPIMAHGFDLYTLYTSAPFGFGAGLVNPSHALDPGLIFS  672

Query  2041  TYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRV  2220
               ++ YI FLC++P +D   V+   G  C E      SDLN PS+TI++L GSR V R V
Sbjct  673   AGYEDYISFLCSLPNIDTAIVKSATGGVCGE-LFVNPSDLNLPSITITSLNGSRLVRRTV  731

Query  2221  TNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILL  2400
              NVG   E Y   V  P GV V I P  F I+   ++HL I LN T+  + ++FGE++L 
Sbjct  732   MNVGSKAETYVSAVLAPKGVMVDIQPSWFKIAPQETQHLHITLNVTQPLDEFTFGEIVLT  791

Query  2401  GDRNHIVRVPFAVY  2442
             G  +H+V++P +++
Sbjct  792   GSLDHVVKMPLSIF  805



>ref|XP_008451260.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008451267.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008451274.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008451284.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008451292.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008451297.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008451306.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008451316.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=816

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/801 (44%), Positives = 488/801 (61%), Gaps = 33/801 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLG  228
             + +A+IY+V ++  P VS                 +I  TS  VT Y + +  +HD+ LG
Sbjct  18    VGKAEIYIVTIDGEPIVSYKGDLDGFEATAMESDEKIDPTSEIVTSYARHLENKHDMLLG  77

Query  229   SLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFL  408
              L  R ++ KLYSY HL+NGFAV +  ++A + L +   V+ +  D K+ K+TTHTP+FL
Sbjct  78    MLFERGSFKKLYSYKHLINGFAVDITHEQA-ESLRRTPIVKSVERDWKVRKLTTHTPEFL  136

Query  409   GIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITG  588
             G+P  VWP  GG   +GE +VIG +D+GI P H SF++   YN        K+ GKC   
Sbjct  137   GLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFAT---YNTEPFGPCMKYKGKCEVD  193

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
              N     CNGKIVGA++FA AA AAG FN   H+ASP D DGHGSHTA+ AAGN   PV 
Sbjct  194   PNTKKDFCNGKIVGARHFAEAAKAAGAFNPDIHFASPLDGDGHGSHTAAIAAGNNGIPVR  253

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssvp  945
              + + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSVGP+S P
Sbjct  254   MHGYEFGKASGMAPRARIAVYKALYRIFGGFVADVVAAIDQAVHDGVDILSLSVGPNSPP  313

Query  946   sgDS-AFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
             +     +LN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ +VAA+  DRRY N
Sbjct  314   ATTKITYLNPFDATLLSAVKAGVFVAQAAGNGGPFPKTLVSYSPWIATVAAAIDDRRYKN  373

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVR  1302
              + LGNG+  +G GLSP T     + L AA DV   +S+    +   CQ        LV 
Sbjct  374   HLTLGNGKILAGLGLSPATHLNRTYTLVAANDVLL-DSSVTKYSPSDCQKPELLNKHLVE  432

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             GK+++C Y++ F    ASI  V+ T    GAAGFVL ++ +I S   K   V + IPG++
Sbjct  433   GKVLLCGYSFSFVVGTASIKKVSQTAKALGAAGFVLAVE-NI-SPGAKFDPVPVGIPGIL  490

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I ++  S  L  YYN++T R  +GR  +F A   I DG   +     P VA +S+RGP++
Sbjct  491   ITDVSKSMDLIDYYNTSTPRDWTGRVKSFDAVGSIGDGLMPLLYKSAPEVALFSARGPNI  550

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAGIAAL
Sbjct  551   RDFSFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAAL  610

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTPFDFGSGFINPS  2010
             +K +HPNW P+AI SA+MT++   DR    L +   ++  + +L  ATPFD+GSG +NP 
Sbjct  611   VKQKHPNWSPAAIKSALMTTSTTMDRGGRPLKAQQFSETEAMKLVTATPFDYGSGHVNPR  670

Query  2011  RALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF-WCSDLNTPSVTISN  2187
              AL+PGL+F+  ++ Y+ FLC   G++   +       C       W  +LN+PS+TI++
Sbjct  671   AALDPGLIFDAGYEDYLGFLCTTAGINVHEIHNYTNSPCNFTMGHPW--NLNSPSITIAH  728

Query  2188  LVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKAT  2367
             LVG++ V R VTNV   +E Y +  R    V + + P    + +  SR   + L A   T
Sbjct  729   LVGTKIVTRTVTNV-AEEETYTITARMDPAVAIEVNPPAMTLRSGSSRKFSVTLTARSLT  787

Query  2368  NSYSFGEMILLGDRNHIVRVP  2430
              +YSFG+++L G R H VR+P
Sbjct  788   GTYSFGQVLLKGSRGHKVRIP  808



>gb|EMS48472.1| Subtilisin-like protease [Triticum urartu]
Length=1197

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/799 (45%), Positives = 481/799 (60%), Gaps = 36/799 (5%)
 Frame = +1

Query  112   IYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSLLRR  243
             +Y+V ME  P VS                  +  TS  VT Y   + + H+  L SL   
Sbjct  36    VYIVTMEGDPVVSYAGGVEGFPATAADLDQEMDVTSEAVTSYSLHLRRHHEKLLDSLFVA  95

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSY HL+NGFAVH+ S +A   L KA GV+ +  D K++K+TTHTP FLG+   
Sbjct  96    GTYEKLYSYHHLINGFAVHMSSLQA-DFLRKAPGVKYVERDTKIQKLTTHTPQFLGLTTA  154

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR-PRITRKFTGKCITGDNFP  600
             VWP  GG   +GE VVIG +D+GI P H SFS+      G  PR    + GKC       
Sbjct  155   VWPTGGGFDRAGEDVVIGFVDSGIYPEHPSFSTHRTDPYGPVPR----YKGKCEIDPVTQ  210

Query  601   ATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRF  780
              + CNGKIVGAQ+FA+AAIAAG FN    +ASP D DGHGSH A+ AAGN    V  + +
Sbjct  211   RSFCNGKIVGAQHFAKAAIAAGAFNPDVEFASPLDGDGHGSHIAAIAAGNNGIAVRMHGY  270

Query  781   NYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv-psgD  954
              +G ASGMAP A IAVYK LY  FGGY+SDVVAA+DQAV+DGVDIL+LSVGP+S   +  
Sbjct  271   EFGKASGMAPRARIAVYKVLYRLFGGYVSDVVAAIDQAVQDGVDILNLSVGPNSPPTATR  330

Query  955   SAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVL  1134
             + FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA   DRRY N ++L
Sbjct  331   TTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAGVDDRRYKNHLIL  390

Query  1135  GNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLV  1314
             GNG+  +G G+SP T G   F L +A D    +S+     ++ CQ         V+GK++
Sbjct  391   GNGKRIAGLGVSPATHGNKSFGLISATDALLGSSSTKYSALD-CQRPELLNKRKVQGKIL  449

Query  1315  ICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNM  1494
             +C Y++++ S  ASI  V+ T    GAAGFV+ ++      +     V + IPG++I ++
Sbjct  450   LCGYSFNYISGTASIKKVSQTAKSLGAAGFVVAVEDSYPGTKFD--PVPVNIPGILITDV  507

Query  1495  EASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNAL  1674
               +  L  YYNS+T R  +GRA AF+AT  I DG         P VA +SSRGPDV +  
Sbjct  508   SKTKDLIDYYNSSTTRDWAGRATAFQATVGIADGLAPTLFNSAPQVALFSSRGPDVKDFS  567

Query  1675  LDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDR  1854
                ADVLKP+I+APG+ IW+AW+PN   +    G+ FA++SGTSMA PHI GIAALIK +
Sbjct  568   FQDADVLKPDILAPGNLIWSAWAPNGTDEANYAGEGFAMMSGTSMAAPHITGIAALIKQK  627

Query  1855  HPNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRALN  2022
             +P W PSAI SA+MT+A+  D+      +   +      LA ATPFD+GSG +NP  AL+
Sbjct  628   YPKWSPSAIKSALMTTANTIDKGSHPLRAQQYSTSEMMTLARATPFDYGSGAVNPKAALD  687

Query  2023  PGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC---PENKKFWCSDLNTPSVTISNLV  2193
             PGLV +   Q YI FLC++P VD   V  + G  C   P+ ++    DLN PS+T+S L 
Sbjct  688   PGLVLDATHQDYITFLCSIPDVDPSEVSNITGSRCGSGPKGQQ--PCDLNIPSITVSQLK  745

Query  2194  GSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNS  2373
             G++TV R VTNV    E Y ++ R    + + + P    +    SR + + L     T +
Sbjct  746   GTQTVKRTVTNVADEAETYTIMTRMSPEIALDVSPPALTVLPGSSREITVTLTTRSVTGT  805

Query  2374  YSFGEMILLGDRNHIVRVP  2430
             YSFGE+ + GDR H+VR+P
Sbjct  806   YSFGEITMKGDRRHLVRIP  824



>ref|XP_010415105.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
Length=766

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/748 (44%), Positives = 454/748 (61%), Gaps = 14/748 (2%)
 Frame = +1

Query  205   KQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKM  384
             ++HD+ LG L    +Y KLYSY HL+NGFA HV  ++A + L +A GV+ + +D K+ ++
Sbjct  19    RKHDMILGMLFEEGSYKKLYSYKHLINGFAAHVSPEQA-ETLRRAPGVKSVDKDWKVRRL  77

Query  385   TTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRK  564
             TTHTP+FLG+P  VWP  GG   +GE +VIG +D+GI P H SF+S      G       
Sbjct  78    TTHTPEFLGLPTDVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP---LPH  134

Query  565   FTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAA  744
             + GKC    +   + CN KIVGAQ+FA AA AAG FN    YASP D DGHGSHTA+ AA
Sbjct  135   YKGKCEEDPHTKKSFCNRKIVGAQHFAEAAKAAGAFNPDIDYASPLDGDGHGSHTAAIAA  194

Query  745   GNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlsl  921
             GN    +  + + +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSL
Sbjct  195   GNNGIQLRMHGYEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSL  254

Query  922   sv-gpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAAS  1098
             SV   S   +  + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+T+VAA+
Sbjct  255   SVGPNSPPTTTKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTVAAA  314

Query  1099  TTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAM  1278
               DRRY N + LGNG+  +G GLSPPT     + L ++ DV   +S++       CQ   
Sbjct  315   IDDRRYKNHLTLGNGKMLAGMGLSPPTRPHRLYTLVSSNDVLL-DSSSSKYNPSDCQRPE  373

Query  1279  QFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATV  1458
              F   LV+G +++C Y+++F    ASI  V  T    GAAGFVL ++    S   K   V
Sbjct  374   VFNKKLVKGNILLCGYSFNFVVGTASIKKVVATAKHLGAAGFVLVVENV--SPGTKFDPV  431

Query  1459  TLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVAS  1638
                +PG++I ++  S  L  YYN +T R  +GR  +F A   I DG   +     P VA 
Sbjct  432   PSAVPGILITDVSKSMDLIDYYNVSTSRDWTGRVKSFNAKGSIGDGLAPVLHKSAPQVAL  491

Query  1639  YSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATP  1818
             +S+RGP+  +     AD+LKP+I+APG  IWAAW PN   +    G+ FAL+SGTSMA P
Sbjct  492   FSARGPNTKDFSFQDADLLKPDILAPGYLIWAAWCPNGTDEPNYVGEGFALISGTSMAAP  551

Query  1819  HIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDF  1986
             HIAGIAAL+K +HP W P+AI SA+MT++ V DR      +   +   +  L  ATPFD+
Sbjct  552   HIAGIAALVKQKHPQWSPAAIKSALMTTSTVIDRAGRLLQAQQYSDTEAVTLVKATPFDY  611

Query  1987  GSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNT  2166
             GSG +NPS AL+PGL+F+  ++ Y+ FLC  PG+    +R      C  + K   S+ N 
Sbjct  612   GSGHVNPSAALDPGLIFDAGYEDYLGFLCTTPGISAHEIRNYTNTRCNYDMKH-PSNFNA  670

Query  2167  PSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIV  2346
             PS+ +S+LVG++T+ RRVTNV   +E Y +  R    + + + P    +    SR   + 
Sbjct  671   PSIAVSHLVGTQTITRRVTNVAEVEETYTITARMQPSIAIEVNPPAMTLRPGASRTFSVT  730

Query  2347  LNATKATNSYSFGEMILLGDRNHIVRVP  2430
             +     +  YSFGE+ L G R H VR+P
Sbjct  731   MTVRSVSGEYSFGEVKLKGSRGHKVRLP  758



>ref|XP_001769281.1| predicted protein [Physcomitrella patens]
 gb|EDQ65993.1| predicted protein [Physcomitrella patens]
Length=786

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/791 (43%), Positives = 482/791 (61%), Gaps = 26/791 (3%)
 Frame = +1

Query  127   MEDHPFVSTR-----IKGTSGN-----VTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTH  276
             MED P V  +     ++GT+ +     V  Y+  + ++H   L  L    ++TKLYS+TH
Sbjct  1     MEDLPIVGYKGGIPGLRGTAKDHVKDLVRKYQSHLIQKHHTLLEDLFEEHSFTKLYSFTH  60

Query  277   LLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVS  456
             +LNG AV + S +A  +L K   V  + +   ++K T HTPD+LG+P  +W  LGG + +
Sbjct  61    ILNGAAVRLTSHQA-AVLTKHPSVVRVEKSYTVKKATIHTPDYLGLPQGIWSELGGVAGA  119

Query  457   GEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQ  636
             GE V+IG++DTGI+P H SFS+  +   G     +K+ G C     FPA +CNGK++GAQ
Sbjct  120   GENVIIGIVDTGIDPKHPSFSTSGQKPYGP---LKKYQGVCEVAKEFPAGSCNGKVIGAQ  176

Query  637   YFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGA  816
             +FA AA   G FN S H+ASP D DGHGSH AS AAGN+  PVI N   YG  SGMAP A
Sbjct  177   HFAAAASQDGVFNASLHFASPLDGDGHGSHVASIAAGNWGVPVIVNNVTYGKISGMAPRA  236

Query  817   GIAVYKALYSF-GGYMSdvvaavdqavedgvdIlslsvgpssv-psgDSAFLNVLEVQLL  990
              IA+YKALY   GG++ DV+ A D+AVEDGVDILSLS+GP+S      S FLN+L+V LL
Sbjct  237   RIAIYKALYPLIGGFIPDVIKACDKAVEDGVDILSLSLGPNSPPGGSTSTFLNILDVALL  296

Query  991   FATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLS  1170
              A +A +LVVQAAGN GP ++++ SFSPWV SVAA   DR + NSI LG+ +   G+GL+
Sbjct  297   NAVKANILVVQAAGNGGPFAKTVTSFSPWVLSVAAGVDDRTFPNSITLGDKKVLKGTGLA  356

Query  1171  PPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEA  1350
             P T G  F++L  A D  +   +  L +   CQ+   F  ++V G L+ICTY + +    
Sbjct  357   PATKGPGFYRLVLAADATQGQGSP-LFSPSDCQEPSLFNRAVVSGSLLICTYGFSYIFGG  415

Query  1351  ASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNS  1530
             +++  +  T+   GAAG VL +D D    +     V L++P + + N+  STAL  YY +
Sbjct  416   STLQQLVKTIEAVGAAGVVLIVDSDGPGSKFD--PVPLRVPAIGLLNLADSTALLSYYQT  473

Query  1531  NTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIM  1710
             NT + ++G+ V+F A+A++ +G+   Y+G    VA +SSRGPDV +   + ADVLKPN++
Sbjct  474   NTKKDQTGKVVSFGASAKLGNGQIIGYTGVAQKVAIFSSRGPDVKDFDFNEADVLKPNVL  533

Query  1711  APGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSA  1890
             APG  IW AW+P        +GQ FA++SGTSMATPH+AG++AL+K+++P W P+A++SA
Sbjct  534   APGFLIWGAWTPIGIDQPAYQGQQFAMISGTSMATPHVAGLSALLKEKYPTWSPAALSSA  593

Query  1891  MMTSADVTDRlgspllaqqasqqla----paTPFDFGSGFINPSRALNPGLVFNTYFQQY  2058
             ++T+ADV D+ G  LL++Q S         ATPFD G G +N + A NPGL+F   +  Y
Sbjct  594   IITTADVQDKQGRSLLSEQLSGGSTPFLQDATPFDMGGGALNINAARNPGLIFEAGYLDY  653

Query  2059  IQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGA  2238
             ++FLC+    + K V       CP       SDLNTPS+T + LV ++TV R VTN+   
Sbjct  654   VRFLCSGNISNPKEVFAATKTPCPPAPGM-PSDLNTPSITFATLVEAKTVSRTVTNLMVT  712

Query  2239  DERYRVIVREPLGVRVTIIPQNFFISA--DGSRHLIIVLNATKATNSYSFGEMILLGDRN  2412
              E Y +    P  V +T+ P  F I       + + I+L  T A+   SFG++   G   
Sbjct  713   GETYTITWTNPADVVITVTPSQFTIGIGRQNKQTINILLRVTLASQMASFGQIRFKGSLG  772

Query  2413  HIVRVPFAVYV  2445
             H + +P +V V
Sbjct  773   HALHIPVSVGV  783



>ref|XP_003543346.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006593516.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
 ref|XP_006593517.1| PREDICTED: subtilisin-like protease-like isoform X3 [Glycine 
max]
 ref|XP_006593518.1| PREDICTED: subtilisin-like protease-like isoform X4 [Glycine 
max]
 ref|XP_006593519.1| PREDICTED: subtilisin-like protease-like isoform X5 [Glycine 
max]
 ref|XP_006593520.1| PREDICTED: subtilisin-like protease-like isoform X6 [Glycine 
max]
 ref|XP_006593521.1| PREDICTED: subtilisin-like protease-like isoform X7 [Glycine 
max]
 gb|KHN22667.1| Subtilisin-like protease [Glycine soja]
Length=817

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/798 (44%), Positives = 480/798 (60%), Gaps = 31/798 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVS----------------TRIKGTSGNVTMYKQRMTKQHDVFLGSL  234
             +A++Y+V +E  P +S                  I   S  V+ Y + + K+HD+ LG L
Sbjct  21    DAEVYIVTVEGEPIISYTGGIDGFEATAVESDEEIDTASELVSSYARHLEKKHDMLLGLL  80

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
                  Y KLYSY HL+NGFAVH+  ++A  + H A GV+ +  D K+ ++TTHTP FLG+
Sbjct  81    FEEGTYQKLYSYRHLINGFAVHISPEQAETLRH-APGVKSVERDWKVRRLTTHTPQFLGL  139

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDN  594
             P  VWP  GG   +GE +VIG +D+GI P H SF++      G      K+ GKC    +
Sbjct  140   PTGVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFAAHNAEPYGP---VPKYRGKCEADPD  196

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
                + CNGKIVGAQ+FA AAIAAG FN S  +ASP D DGHGSHTAS AAGN   PV  +
Sbjct  197   TKRSYCNGKIVGAQHFAHAAIAAGAFNPSIDFASPLDGDGHGSHTASIAAGNNGIPVRMH  256

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvps  948
                +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV   S   +
Sbjct  257   GHEFGRASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVYDGVDILSLSVGPNSPPAA  316

Query  949   gDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSI  1128
               + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DRRY N +
Sbjct  317   TKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWIASVAAAIDDRRYKNHL  376

Query  1129  VLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGK  1308
             +LGNG+T +G GLSP T     + L AA DV   +S+    +   CQ       +L++G 
Sbjct  377   ILGNGKTLAGIGLSPSTHLNETYTLVAANDVLL-DSSVMKYSPTDCQRPELLNKNLIKGN  435

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C Y+++F   +ASI  V++T    GA GFVL ++ +  S   K   V + +PG++I 
Sbjct  436   ILLCGYSFNFVVGSASIKKVSETAKALGAVGFVLCVENN--SPGTKFDPVPVGLPGILIT  493

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNN  1668
             ++  S  L  YYN  T R  +GR  +F    +I DG   I     P VA +S+RGP++ +
Sbjct  494   DVSNSKELIDYYNITTPRDWTGRVKSFEGKGKIGDGLMPILHKSAPQVALFSARGPNIKD  553

Query  1669  ALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIK  1848
                  AD+LKP+I+APGS IWAAW PN   +    G+ FA++SGTSMA PHIAGIAALIK
Sbjct  554   FSFQEADLLKPDILAPGSLIWAAWCPNGTDEPNYVGEGFAMISGTSMAAPHIAGIAALIK  613

Query  1849  DRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRA  2016
              +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG ++P+ A
Sbjct  614   QKHPHWSPAAIKSALMTTSTTLDRAGNPLLAQQTSESEAMRLVKATPFDYGSGHVDPTAA  673

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGL+F+  ++ Y+ FLC  P +D   +R      C        S+LNTPS+TIS LV 
Sbjct  674   LDPGLIFDAGYKDYVGFLCTTPSIDVHEIRHYTHTPC-NTTMGKPSNLNTPSITISYLVR  732

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             ++ V R VTNV   +E Y +  R    V + + P    I A  SR   + L     T  Y
Sbjct  733   TQVVTRTVTNV-AEEETYVITARMEPAVAIEVNPPAMTIKAGASRQFSVSLTVRSVTRRY  791

Query  2377  SFGEMILLGDRNHIVRVP  2430
             SFGE+++ G R H VR+P
Sbjct  792   SFGEVLMKGSRGHKVRIP  809



>ref|XP_011095996.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=822

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/799 (43%), Positives = 467/799 (58%), Gaps = 32/799 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHP--FVSTRIKGTSGNVTMYK--------QRMTKQHDVFLGSLLRRSAY  252
             E  IY+VL+E  P  F         G   +Y         + +   HD FL S L   +Y
Sbjct  31    ERDIYLVLLEGEPVAFYQGAAPDKDGRRPLYNSEASMAHAKHLVDSHDQFLQSTLDAGSY  90

Query  253   TKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWP  432
              KLYS+ H++NGFA+H    +  K L  A GV+ + +D   + MT++TP+FLG+P  VW 
Sbjct  91    DKLYSFKHIVNGFALHTTHSQVEK-LKGAPGVKLVEKDRGAKLMTSYTPEFLGLP-AVWS  148

Query  433   RLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRI--TRKFTGKCITGDNFPAT  606
             + GG   +GEG+VIG +D+GINP H SF+    Y+   P    T  F+G C +G  FP T
Sbjct  149   QQGGDRNAGEGIVIGFVDSGINPVHPSFA----YDPVNPLTSNTSHFSGACESGPLFPET  204

Query  607   ACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNY  786
             +CNGKI+ A++FA  A AA   N      SP+DA GHGSH ASTAAGN   PV+ N F Y
Sbjct  205   SCNGKIISARFFASGARAAATLNPYVDIQSPYDAVGHGSHVASTAAGNSGVPVVVNGFFY  264

Query  787   GYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFL  966
             G ASGMAP A IAVYKA+Y   G ++DV+AA+DQAV DGVDIL+LS+GP + P     FL
Sbjct  265   GRASGMAPRARIAVYKAIYPTVGSLADVLAAIDQAVLDGVDILTLSIGPDAPPEDTVTFL  324

Query  967   NVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQ  1146
             +  E+ +L A +AGV V QA GN GP   +++S+SPW   VAA  TDR Y  ++VLGNGQ
Sbjct  325   SAFEIFMLSAHKAGVFVAQAVGNQGPGPYTVVSYSPWTVGVAACGTDRTYPGTLVLGNGQ  384

Query  1147  TFSGSGLSPPTAGKAFFQ--LAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGKLV  1314
                G GLS P+ GK   Q  L  A D  + N T       +E CQ      P+ V+G +V
Sbjct  385   HIGGIGLSDPSFGKGLLQYKLVLAKDAIKVNGTFPRTPQYLEECQYPEALDPTAVQGSVV  444

Query  1315  ICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNM  1494
             ICT++  F +  +++  V +T    G  GFVL  +P  G        +   +PG+++  +
Sbjct  445   ICTFSAGFYNGTSNLTAVIETAKVLGFMGFVLVANPSYG--DFIAEPIPFSVPGIMVPRV  502

Query  1495  EASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNAL  1674
               +  + QYY   T R   G  + +   A I +GR A Y+ + P+V+ +SSRGPD  +  
Sbjct  503   RDAQIISQYYEEQTYRDEEGLVIRYSGRAAIGEGRIATYTERAPIVSRFSSRGPDYVDQN  562

Query  1675  LDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDR  1854
              + ADVLKP+I+APG  IWAAWSP S  +  + G  FAL+SGTSMATPHIAGIAALIK  
Sbjct  563   KNPADVLKPDILAPGHQIWAAWSPMSADNPILSGHSFALISGTSMATPHIAGIAALIKQI  622

Query  1855  HPNWKPSAITSAMMTSADVTD-RlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGL  2031
             +P+W PS + SAM T+A   D R    +    A+  L  A PF FG+G ++P RAL+PGL
Sbjct  623   NPSWSPSMMASAMSTTASKYDNRGEPIMAEGFAAYTLYQAAPFGFGAGLVDPIRALDPGL  682

Query  2032  VFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECP---ENKKFWCSDLNTPSVTISNLVGSR  2202
             VF+  ++ Y+ FLC++P  D + +R   G  C     N     SDLN PS+TI+ L G R
Sbjct  683   VFSAGYEDYLSFLCSLPNTDPERIRTATGGSCAALFSNP----SDLNQPSLTITALSGMR  738

Query  2203  TVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSF  2382
                R V NV    E Y   V  P GV VT+ P  F I+   S+ L I L+ T+A + +SF
Sbjct  739   MTKRVVKNVASKPETYLCAVLPPEGVTVTVDPPWFTIAPQESQSLEIRLHVTQALDDFSF  798

Query  2383  GEMILLGDRNHIVRVPFAV  2439
             GE++L G  NHIVR+P +V
Sbjct  799   GEIVLTGSLNHIVRMPLSV  817



>ref|XP_010907007.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=837

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/809 (43%), Positives = 484/809 (60%), Gaps = 38/809 (5%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV-----------STRIKGTSGNV-TMYKQR------------MTKQ  210
             +A +Y+V M+  P V           S    G SG + T+ KQR            + + 
Sbjct  26    DAAVYIVTMKQAPAVHYYDMLKTFGNSVVSNGASGTLNTINKQRNGSRTDKSYGSYLIRL  85

Query  211   HDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTT  390
              D  L   L+   Y KLYSY +L+NGFAV +   +A K+  + E V  +  D  +   TT
Sbjct  86    QDSLLKRALKGENYLKLYSYHYLINGFAVLITPQQAEKLSRRRE-VANVVLDFSVRTATT  144

Query  391   HTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFT  570
             HTP+FLG+P   W + GGP V+G+G+VIG IDTGI+P H SFS  +  ++    I   F+
Sbjct  145   HTPEFLGLPQGAWVQGGGPEVAGQGIVIGFIDTGIDPTHPSFS--DNLSLSLYPIPAHFS  202

Query  571   GKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGN  750
             G C    +FP+ +CN K+VGA++FA +AI  G FN S+ YASPFD DGHG+HTAS AAGN
Sbjct  203   GVCEVTRDFPSGSCNRKLVGARHFAASAINRGIFNASQDYASPFDGDGHGTHTASIAAGN  262

Query  751   YHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIlslsv  927
             +  PVI +   +G ASGMAP A I+VYKALY SFGG+ +DVVAA+DQA +DGVDI+SLS+
Sbjct  263   HGIPVIVSGHYFGNASGMAPHAHISVYKALYKSFGGFAADVVAAIDQAAQDGVDIISLSI  322

Query  928   gpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTD  1107
              P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM SFSPW+ +V AS  D
Sbjct  323   TPNRRPPGIATFFNPIDMSLLSAVKAGIFVVQAAGNTGPSPKSMSSFSPWIFTVGASAHD  382

Query  1108  RRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFV  1287
             R Y N I LGN  T SG GL+P T G + + L AA +  + ++T   + +  CQD+    
Sbjct  383   RIYNNYIQLGNNLTISGVGLAPGTDGDSMYTLIAATNALKNDTTENDMYLGECQDSSHLS  442

Query  1288  PSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQ  1467
               LV+G L+IC+Y+  F    +S+    +T     A G +  +DP +   Q+      + 
Sbjct  443   EELVKGNLLICSYSIRFVLGLSSVKQALETAKNVSAIGVIFYLDPFVLGFQLN--PTPMH  500

Query  1468  IPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGPVVASYS  1644
             +PGLII + + S    +YYNS+ +R   S   V F A A+IL G +A YS   P V  YS
Sbjct  501   MPGLIIPSPDDSKVFLEYYNSSLVRDEISKNIVKFGAAAKILGGLKANYSNPAPKVMYYS  560

Query  1645  SRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHI  1824
             +RGPD  +  L  ADV+KPN++APG+ IW AWS         +G++FAL+SGTSMA PHI
Sbjct  561   ARGPDPQDTSLADADVMKPNLIAPGNYIWGAWSSLGTDSAEFEGENFALISGTSMAAPHI  620

Query  1825  AGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGS  1992
             AG+AALIK R P++ PSAI SA+ T+A + D+      +           +PATPFD GS
Sbjct  621   AGLAALIKQRFPHFSPSAIGSALSTTATLYDKQGGPIMAQRSYSSPDSTQSPATPFDMGS  680

Query  1993  GFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPS  2172
             GF+N + AL+PG++F++ F  ++ FLC + G     V    G  C +      +DLN PS
Sbjct  681   GFVNATAALDPGVIFDSGFDDFVAFLCGING-SSPVVLNYTGQNC-KLSNMTGADLNLPS  738

Query  2173  VTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLN  2352
             +T++ L  SRTV R +TN+   DE Y V    P GV V++ P  FFI++   ++L +VLN
Sbjct  739   ITVALLNQSRTVTRTMTNIAN-DETYSVSWSAPFGVLVSVAPTRFFIASGQKQNLTVVLN  797

Query  2353  ATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             AT  + S SFG++ L G   H   VP +V
Sbjct  798   ATMNSTSPSFGKIGLYGSGGHRSMVPLSV  826



>ref|XP_011004882.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=847

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/756 (44%), Positives = 468/756 (62%), Gaps = 14/756 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD  L  +LR   Y KLYSY +L+NGFAV V  ++A K+  + E V  +  D  + 
Sbjct  89    IARVHDSLLRRVLRGEKYLKLYSYHYLINGFAVLVTPEQADKLSRRKE-VANVALDFSVR  147

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TTHTP FLG+P   WP+ GG   +GEG+VIG IDTGI+P H SFS  ++ ++    + 
Sbjct  148   TATTHTPQFLGLPQGAWPKAGGYETAGEGIVIGFIDTGIDPSHPSFS--DDSSLNSYPVP  205

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
               F+G C    +FP+ +CN K++GA++FA +AI  G FN S+ YASPFD DGHG+HTAS 
Sbjct  206   SHFSGICEVTRDFPSGSCNRKLIGARHFAASAITRGIFNSSQDYASPFDGDGHGTHTASV  265

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PV+  R ++G ASGMAP A +AVYKALY SFGG+ +DVVAA+DQA +DGVD++
Sbjct  266   AAGNHGIPVVVARHHFGNASGMAPRAHVAVYKALYKSFGGFAADVVAAIDQAAQDGVDVI  325

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ LL A +AG+  VQAAGN+GPS +SM SFSPW+ +V A
Sbjct  326   SLSITPNRRPPGIATFFNPIDMALLSAVKAGIFAVQAAGNTGPSPKSMSSFSPWIFTVGA  385

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVESCQD  1272
             ++ DR Y+NSI+LGN  T  G GL+P T       L +A+      +T A  + V  CQD
Sbjct  386   ASHDRAYSNSIILGNNVTIHGVGLAPGTHKNTMLTLISALHALNNETTVATDMYVGECQD  445

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
             +  F   LV+G L+IC+Y+  F    ++I     T     AAG V  MDP +   Q+   
Sbjct  446   SSNFNQDLVKGNLLICSYSIRFVLGLSTIQQAIATAKNLSAAGVVFYMDPFVIGFQLN--  503

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVA-FRATARILDGRRAIYSGQGPV  1629
              + +++PG+II + + S  L QYYNS+  R+ + + +  F + A IL G +A YS   P 
Sbjct  504   PIPMRVPGIIIPSPDDSKVLLQYYNSSLERNETTKKITRFGSVASILGGLKANYSNSAPK  563

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  +  LD AD+LKPN++APG+ IWAAWS         +G++FAL+SGTSM
Sbjct  564   VMFYSARGPDPEDNFLDDADILKPNLVAPGNLIWAAWSSLGTDSVEFQGENFALMSGTSM  623

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTP  1977
             A PHIAG+AALIK + P + P+AI SA+ T+A + D       +           +PATP
Sbjct  624   AAPHIAGLAALIKQKFPCFSPAAIASALSTTASLYDNNGGPIMAQRAYSNPDINQSPATP  683

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSD  2157
             FD GSGF N + AL+PGL+F++ +  Y+ FLC + G     V    G  C  N     +D
Sbjct  684   FDMGSGFANATAALDPGLIFDSSYDDYMSFLCGING-SSPVVLNYTGQNCLLNSTINGTD  742

Query  2158  LNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHL  2337
             LN PS+TI+ L  S+TV R VTN+ G  E YRV    P GV + + P  F I++   + L
Sbjct  743   LNLPSITIAKLYQSKTVQRSVTNIAGY-ETYRVGWSAPYGVTIKVAPTRFCIASGERQTL  801

Query  2338  IIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
              +  +A   +++ S+G + L GD+ H+V +P +V V
Sbjct  802   SVFFDAKMNSSTASYGRIGLFGDQGHVVNIPLSVIV  837



>ref|XP_004295296.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=819

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/825 (43%), Positives = 476/825 (58%), Gaps = 33/825 (4%)
 Frame = +1

Query  7     LKKTFCFPSIPST*LMEslfilitlsfilfMAEAKIYMVLMEDHPFV------STRIKGT  168
             L  +FCF ++ ++ L+                +  IY+VLME           S+ +   
Sbjct  9     LLHSFCFIAVLASVLLTGFAAE----------DPAIYLVLMEGESVAFHGGSPSSHLNLN  58

Query  169   SGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGV  348
             S  +  +  ++   HD  L S L   +Y+KLYS+ H+ NGFAVH    +A K L  + GV
Sbjct  59    SEVLKAHAMQLEDSHDQLLQSNLETGSYSKLYSFKHIANGFAVHTTPSQAEK-LKYSPGV  117

Query  349   RGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPE  528
             + +  D   + MTT+TP FL +P+ VW + GG   +GEG+VIG +DTGINP H SFS   
Sbjct  118   KMVERDRGAKLMTTYTPRFLELPEGVWTQEGGQRNAGEGIVIGFVDTGINPAHLSFS---  174

Query  529   EYNIGRPRITR--KFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPF  702
              YN  RP  +    F+G C TG  FPAT+CNGKIV A++F+  A A    N S    SPF
Sbjct  175   -YNPLRPFTSNISHFSGACETGPLFPATSCNGKIVSAKFFSAGARAVATLNASVDILSPF  233

Query  703   DADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaav  882
             DADGHGSH AS AAGN   PV+ N F YG ASGMAP A IAVYKA+Y   G ++DV++A+
Sbjct  234   DADGHGSHVASVAAGNAGVPVVVNGFCYGQASGMAPRARIAVYKAVYPTVGTLADVISAM  293

Query  883   dqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSML  1062
             DQA+ DGVD+L+LSVGP   P     FL++ +V +L+A RAGV VVQAAGN GP   S++
Sbjct  294   DQAIRDGVDVLTLSVGPDEPPEDRVTFLSMFDVFMLYARRAGVFVVQAAGNRGPDPSSVV  353

Query  1063  SFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQ--LAAAVDVCRRNS  1236
             S+SPW   VA+S TDR Y +SI LGNG+   G GLS PT G    Q  L  A D      
Sbjct  354   SYSPWAVGVASSGTDRIYPSSIALGNGERIEGVGLSGPTFGYRLLQHRLVLAKDAINPIG  413

Query  1237  TAGLLT--VESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVL  1410
             +       VE CQ        LV G +VICT++  F +  +++  + +T    G  GFVL
Sbjct  414   SFPRTPPYVEECQTPQALDARLVIGSIVICTFSEGFYNGTSTLNAIINTARALGFMGFVL  473

Query  1411  TMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARIL  1590
               +P  G        V   + G+++ N+  S  + QYY   T +   G      A A I 
Sbjct  474   VANPAYG--DFIAEPVPFAVSGILVPNVTNSQVILQYYEQQTFKDARGFPTRLAARASIG  531

Query  1591  DGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYI  1770
             +GR A + GQ P+V+ +SSRGP++ +     ADVLKP+I+APG  IW AWSP S  +  +
Sbjct  532   EGRAASFRGQAPIVSRFSSRGPNIIDRARKPADVLKPDILAPGHQIWGAWSPISALEPSL  591

Query  1771  KGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl-gspllaqq  1947
              G  FAL+SGTSMATPHIAGIAALIK  +P+W PS I SA+ T+A   D+     +    
Sbjct  592   AGHSFALLSGTSMATPHIAGIAALIKQYNPSWNPSMIASAISTTAAKYDKNGELIMAEGS  651

Query  1948  asqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC  2127
                   P+TPFD G+G ++PS A++PGLV ++ ++ YI FLC++   +  +++ V G  C
Sbjct  652   DIGSQYPSTPFDSGAGLVSPSNAMDPGLVLSSGYEDYISFLCSLHDTNPGTIKTVTGELC  711

Query  2128  PENKKF-WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQN  2304
               NK     ++LN PSVT+S L GS  V R   NVG   E Y      P G  + I P +
Sbjct  712   --NKPLDHPANLNLPSVTLSALNGSEIVRRVFMNVGSKPESYSSSALPPNGTTIDISPPS  769

Query  2305  FFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             F I+  G++ L+I  N T+A N ++FGE+IL G  NHIVR+P +V
Sbjct  770   FTIAPQGTQELVIQFNVTQAMNQFTFGELILTGSLNHIVRLPLSV  814



>ref|XP_006370478.1| hypothetical protein POPTR_0001s43080g [Populus trichocarpa]
 gb|ERP67047.1| hypothetical protein POPTR_0001s43080g [Populus trichocarpa]
Length=848

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/757 (44%), Positives = 470/757 (62%), Gaps = 15/757 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD  L  +LR   Y KLYSY +L+NGFAV V  ++A K+  + E V  +  D  + 
Sbjct  89    IARVHDSLLRRVLRGEKYLKLYSYHYLINGFAVLVTPEQANKLSRRKE-VANVALDFSVR  147

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TTHTP FLG+P   WP+ GG   +GEG+VIG IDTGI+P H SFS  ++ ++    + 
Sbjct  148   TATTHTPQFLGLPQGAWPKAGGYETAGEGIVIGFIDTGIDPSHPSFS--DDSSLNSYPVP  205

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
               F+G C    +FP+ +CN K++GA++FA +AI  G FN S+ YASPFD DGHG+HTAS 
Sbjct  206   SHFSGICEVTRDFPSGSCNRKLIGARHFAASAITRGIFNSSQDYASPFDGDGHGTHTASV  265

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI  R ++G ASGMAP A +AVYKALY SFGG+ +DVVAA+DQA +DGVD+L
Sbjct  266   AAGNHGIPVIVARHHFGNASGMAPRAHVAVYKALYKSFGGFAADVVAAIDQAAQDGVDVL  325

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ LL A +AG+  VQAAGN+GPS +SM SFSPW+ +V A
Sbjct  326   SLSITPNRRPPGIATFFNPIDMALLSAVKAGIFAVQAAGNTGPSPKSMSSFSPWIFTVGA  385

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVESCQD  1272
             ++ DR Y+NSI+LGN  T  G GL+P T       L +A+      +T A  + V  CQD
Sbjct  386   ASHDRAYSNSIILGNNVTIHGVGLAPGTHKNTMLTLISALHALNNETTVATDMYVGECQD  445

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
             +  F   LV+G L+IC+Y+  F    ++I     T     AAG V  MDP +   Q+   
Sbjct  446   SSNFNQDLVKGNLLICSYSIRFVLGLSTIKQAIATAKNLSAAGVVFYMDPFVIGFQLN--  503

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVA-FRATARILDGRRAIYSGQGPV  1629
              + +++PG+II + + S  L QYYNS+  R+ + + +  F + A IL G +A YS   P 
Sbjct  504   PIPMRVPGIIIPSPDDSKVLLQYYNSSLERNETTKKITRFGSVASILGGLKANYSNSAPK  563

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  +  LD AD+LKPN++APG+ IWAAWS         +G++FAL+SGTSM
Sbjct  564   VMFYSARGPDPEDNFLDDADILKPNLIAPGNLIWAAWSSLGTDSVEFQGENFALMSGTSM  623

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTP  1977
             A PHIAG+AALIK + P++ P+AI SA+ T+A + D       +           +PATP
Sbjct  624   AAPHIAGLAALIKQKFPSFSPAAIASALSTTASLYDNNGGPIMAQRAYSNPDINQSPATP  683

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPE-NKKFWCS  2154
             FD GSGF+N + AL+PGL+F++ +  Y+ FLC + G     V    G  C   N     +
Sbjct  684   FDMGSGFVNATAALDPGLIFDSGYDDYMSFLCGING-SSPVVLNYTGQNCLSYNSTINGT  742

Query  2155  DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRH  2334
             DLN PS+TI+ L  S+TV R VTN+ G  E Y+V    P GV + + P  F I++   + 
Sbjct  743   DLNLPSITIAKLYQSKTVQRSVTNIAGG-ETYKVGWSAPYGVTIKVAPTRFCIASGERQT  801

Query  2335  LIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
             L +  +A   +++ S+G + L GD+ H+V +P +V V
Sbjct  802   LSVFFDAKMNSSTASYGRIGLFGDQGHVVNIPLSVIV  838



>dbj|BAB70678.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=832

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/789 (44%), Positives = 467/789 (59%), Gaps = 18/789 (2%)
 Frame = +1

Query  109   KIYMVLMEDHPFV---STRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHL  279
             KIY VL+E  P     ST I   S  + +  +++ + H+  LGS L + +YTKLYS+ H+
Sbjct  47    KIYSVLVEGEPLAFRASTNIN--SKAMALEAKKIEEIHEEILGSTLEKGSYTKLYSFKHV  104

Query  280   LNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLG--GPSV  453
             +N FAV   + +A K L K +GV+ + ED  ++ MTT+TPDFL +P  VWP++   G   
Sbjct  105   INAFAVRTTASQAKK-LRKTKGVKAVEEDKGVKLMTTYTPDFLELPQQVWPKISNEGDRR  163

Query  454   SGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR-KFTGKCITGDNFPATACNGKIVG  630
             +GE +VIG +DTGINP H SF++ +  N     I+R  F+G C  G  FP  +CNGKI+ 
Sbjct  164   AGEDIVIGFVDTGINPTHPSFAALDLTNPYSSNISRLHFSGDCEIGPLFPPGSCNGKIIS  223

Query  631   AQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAP  810
             A++F+  A A+G  + S    SPFDA GHGSH AS AAGN   PVI + F YG ASGMAP
Sbjct  224   ARFFSAGARASGALSSSLDILSPFDASGHGSHVASIAAGNAGVPVIIDGFFYGRASGMAP  283

Query  811   GAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLL  990
              A IAVYKA+Y   G + DV+AA+DQA+ DGVD+L+LSVGP   P      L + ++ +L
Sbjct  284   RARIAVYKAIYPSIGTLVDVIAAIDQAIMDGVDVLTLSVGPDEPPVDKPTVLGIFDLAML  343

Query  991   FATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLS  1170
              A +AGV VVQA GN+GPS  S+LS+SPWV  VAA  TDR Y  S++L  GQT  G GLS
Sbjct  344   LARKAGVFVVQAVGNNGPSPSSVLSYSPWVVGVAAGNTDRSYPASLILDGGQTVQGVGLS  403

Query  1171  PPTAGKAFFQ--LAAAVDVCRRN-STAGLLT--VESCQDAMQFVPSLVRGKLVICTYTYD  1335
              PT G    Q  L  A D  R N S    LT  +E CQ    F P+ V G +VICT++  
Sbjct  404   GPTLGAPLVQHRLVLAKDAVRTNGSVLQPLTRDIEECQRPENFDPAAVFGSIVICTFSDG  463

Query  1336  FESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALR  1515
             F ++ +++  +  T    G  GF+L  +P  G        V    PG++I  + A+  + 
Sbjct  464   FYNQMSTVLAITQTARTLGFMGFILIANPRFG--DYVAEPVIFSAPGILIPTVSAAQIIL  521

Query  1516  QYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVL  1695
             +YY   T R   G A  F A ARI +GR +I++GQ PVV+ +SSRGP   +A     DVL
Sbjct  522   RYYEEKTFRDTRGVATQFGARARIDEGRNSIFAGQAPVVSRFSSRGPAFIDANRSPLDVL  581

Query  1696  KPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPS  1875
             KP+I+APG  IW AWS  S  D  + G+ FA++SGTSMATPHIAGI ALIK  +P+W P+
Sbjct  582   KPDILAPGHQIWGAWSLPSAFDPILTGRSFAILSGTSMATPHIAGIGALIKQLNPSWTPA  641

Query  1876  AITSAMMTSADVTDRlgspllaqqasqqlapaTP-FDFGSGFINPSRALNPGLVFNTYFQ  2052
              I SA+ T+A+  D  G  + A+         +  FD G+G +NP+RAL+PGLV    F+
Sbjct  642   MIASAISTTANEYDSTGEIISAEYYELSRLFPSNHFDHGAGHVNPARALDPGLVLPAGFE  701

Query  2053  QYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVG  2232
              YI FLC++P +   ++R   GV C        ++LN PSVTIS L  S  V R   NV 
Sbjct  702   DYISFLCSLPNISPATIRDATGVLCTTTLSH-PANLNHPSVTISALKESLVVRRSFQNVS  760

Query  2233  GADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRN  2412
                E Y   V  P G  V + P  F +    ++ L I  N T+  N ++FGE++L G  N
Sbjct  761   NKTETYLGSVLPPNGTTVRLTPTWFTVPPQKTQDLDIEFNVTQVLNKFTFGEVVLTGSLN  820

Query  2413  HIVRVPFAV  2439
             HI+R+P +V
Sbjct  821   HIIRIPLSV  829



>gb|ADW11232.1| subtilisin-like protease 1 [Phaseolus vulgaris]
Length=821

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/803 (43%), Positives = 473/803 (59%), Gaps = 33/803 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFVS------------------TRIKGTSGNVTMYKQRMTKQHDVF  222
               +A+IY+V +E  P VS                   ++  TS  V  Y + + K+HD+ 
Sbjct  19    FGKAEIYIVTVEGEPIVSYTGGVDGFEATAVESDDDHKLDSTSEVVVSYARHLEKRHDML  78

Query  223   LGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPD  402
             LG L     Y KLYSY HL+NGFAVH+  ++A  + H A GV+ +  D K++++TTHTP 
Sbjct  79    LGLLFESGTYKKLYSYRHLINGFAVHLSPEQAETLRH-APGVKSVERDWKVKRLTTHTPQ  137

Query  403   FLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCI  582
             FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++   YN        ++ GKC 
Sbjct  138   FLGLPTGVWPTGGGYERAGEDIVIGFVDSGIYPHHPSFTT---YNTEPYGPVSRYRGKCE  194

Query  583   TGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTP  762
                +   + CNGKI+GAQ+FA+AAIAAG FN S  + SP D DGHGSHTAS AAG     
Sbjct  195   VDPDTKRSFCNGKIIGAQHFAKAAIAAGVFNPSIDFDSPLDGDGHGSHTASIAAGRTGIA  254

Query  763   VITNRFNYGYASGMAPGAGIAVYKA-LYS-FGGYMSdvvaavdqavedgvdIlslsvgps  936
             V      +G ASGMAP A IAV    LY  FGG+++DVVAA+DQAV DGVDIL+LSVGP 
Sbjct  255   VRMYGHEFGKASGMAPRARIAVCCCRLYRLFGGFVADVVAAIDQAVHDGVDILNLSVGPD  314

Query  937   sv-psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRR  1113
             S   +  + FLN     LL A +AGV V QAAGN GP  +S++S+SPW+ +VAA+  DRR
Sbjct  315   SPPSNTKTTFLNPFNATLLGAVKAGVFVAQAAGNGGPFPKSLVSYSPWIATVAAAIDDRR  374

Query  1114  YTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPS  1293
             Y N ++L NG+  +G GLSP T     + L AA DV   +S       +  Q    F  +
Sbjct  375   YKNHLILENGKILAGIGLSPSTRLNQTYTLVAANDVLLDSSVTKYSPTDR-QRPDVFNKN  433

Query  1294  LVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIP  1473
             L++G +++C Y+Y+F   +ASI  V++T    GA GFVL ++     E+     V + IP
Sbjct  434   LIKGNILLCGYSYNFVDGSASIKQVSETAKALGAVGFVLCVENVSPGEKFD--PVPVGIP  491

Query  1474  GLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRG  1653
             G++I +   S  L  YYN +T R  +GR   F    +I DG   I     P VA +S+RG
Sbjct  492   GILITDASKSKELIDYYNISTPRDWTGRVKTFTGKGKIEDGLMPILHKSAPQVAVFSARG  551

Query  1654  PDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGI  1833
             P++ +     AD+LKP+I+APGS IWAAWS N   +    G+ FA++SGTSMA PHIAGI
Sbjct  552   PNIKDFSFQEADLLKPDILAPGSLIWAAWSLNGTDEPNFLGEGFAVISGTSMAAPHIAGI  611

Query  1834  AALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFI  2001
             AAL+K +HP+W P+AI SA+MT++   DR      +    +  +  L  ATPFD+GSG +
Sbjct  612   AALLKQKHPHWSPAAIKSALMTTSTTLDRAGNPILAQQYRESKAMNLVRATPFDYGSGHV  671

Query  2002  NPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTI  2181
             +P  AL+PGLVF+  ++ Y+ FLC  PG D   ++      C        S+LNTPS+TI
Sbjct  672   HPRAALDPGLVFDAGYEDYLGFLCTTPGTDVNEIKNYTNSPCNYTLGH-PSNLNTPSITI  730

Query  2182  SNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATK  2361
             S+LV ++ V R VTNV   +E Y +  R    V + + P    I A  SR   + L+   
Sbjct  731   SHLVRTQIVTRTVTNVAHEEETYTMTARMQPAVAIDVNPPAMTIRAGSSRKFTVTLSVRS  790

Query  2362  ATNSYSFGEMILLGDRNHIVRVP  2430
              T +YSFGE+++ G R H VR+P
Sbjct  791   VTGTYSFGEVLMKGSRGHKVRIP  813



>ref|XP_006355166.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=905

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/804 (44%), Positives = 476/804 (59%), Gaps = 41/804 (5%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTRIKGTS--GN--------VTMYKQRMTKQHDVFLGSLLRRSAY  252
             + KIY+VL+E  P     +K  S  GN           Y   +TK HD FL S L R +Y
Sbjct  114   DKKIYLVLLEGDPIAFHHVKTVSQEGNKLDPNSEAAKAYANELTKSHDEFLQSYLERGSY  173

Query  253   TKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWP  432
              K+YS+ H++NG AVH    +  K L  A  V+ + ED ++++MTT+TP FLGIP  VW 
Sbjct  174   DKIYSFKHIINGVAVHTTPSQIEK-LKNAPRVKLLEEDRRVKQMTTYTPQFLGIP-AVWT  231

Query  433   RLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGK-CITGDNFPATA  609
             + GG   +GEG+VIG ID+GINP H SF+     N      +  FT + C  G  FP T+
Sbjct  232   QEGGDKNAGEGIVIGFIDSGINPDHPSFAYDPMTN------SNSFTDRACEEGPLFPQTS  285

Query  610   CNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYG  789
             CNGKIV A++F+  A      N S    SPFDA GHGSH ASTAAGN+  PV+ N   YG
Sbjct  286   CNGKIVSARFFSAGAQTTTTLNESIDILSPFDAVGHGSHVASTAAGNFGVPVVVNGLYYG  345

Query  790   YASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLN  969
              ASGMAP A IAVYKA+Y   G +SDV+AA+DQAV DGVDIL+LSVGP   P     FL+
Sbjct  346   RASGMAPRARIAVYKAIYPSIGTLSDVLAAIDQAVLDGVDILTLSVGPEEPPEDKLTFLS  405

Query  970   VLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQT  1149
             + E+ +L A +AG LVVQAAGN GPS  S++S+SPW   VA+  TDR Y  +++LGNG  
Sbjct  406   LFEIFMLAAHKAGTLVVQAAGNEGPSPYSVISYSPWAVGVASCDTDRTYPATLILGNGLK  465

Query  1150  FSGSGLSPPTAGKAFF----QLAAAVDVCRRNSTAGLL--TVESCQDAMQFVPSLVRGKL  1311
              +G GLS  T G        +L  A D  + N+T   +    E CQ    F P +V+  +
Sbjct  466   IAGVGLSGATVGDGLMIQYNKLVLAKDAIKINTTLPRIANNAEECQYPEAFDPLVVQDSV  525

Query  1312  VICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIG---SEQIKGATVTLQIPGLI  1482
             VICT++  F +  +++  +  T        FV   +P  G   +E I  AT     P ++
Sbjct  526   VICTFSAGFYNGTSTLTAIIQTAIVLRFKAFVFVANPTYGDFIAEPIPFAT-----PAIM  580

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             I     +  + QYY   T+R  +G  V +   A I +GR A Y G+ P+V+ +SSRGPD 
Sbjct  581   IPATTDTQNILQYYEKETVRDTNGLVVRYGGRAGISEGRNASYKGRAPIVSRFSSRGPDY  640

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              +   +  DVLKP+I+APG  IWAAWSP S  D  + G +FAL+SGTSMATPHIAG+AA+
Sbjct  641   IDQSKNPTDVLKPDILAPGHQIWAAWSPMSVLDPILSGHNFALMSGTSMATPHIAGVAAM  700

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlapaT-PFDFGSGFINPSRAL  2019
             IK  +P+W PS I SA+ T+A   D LG P++A          + PF FG+G +NPS AL
Sbjct  701   IKQYNPSWTPSMIASAISTTASTYDNLGEPIMAHGFDLYTLHTSAPFGFGAGLVNPSGAL  760

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECP---ENKKFWCSDLNTPSVTISNL  2190
             +PGLVF+  ++ YI FLC++P +D K V+   G  C    EN     SDLN PS+TI++L
Sbjct  761   HPGLVFSAGYEDYISFLCSLPNIDSKIVKTATGGICGQLFENP----SDLNLPSITITSL  816

Query  2191  VGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATN  2370
              GSR V R VTNV    E Y   V  P GV V I P  F I+  G++ L I  N T+A +
Sbjct  817   NGSRIVHRTVTNVESKAETYLSAVLPPKGVTVNIEPSWFIIAPQGTQDLHITFNVTQALD  876

Query  2371  SYSFGEMILLGDRNHIVRVPFAVY  2442
              ++FGE++L G  NH+V++P +++
Sbjct  877   DFTFGEIVLTGSLNHVVKMPLSIF  900



>ref|XP_010098500.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB75160.1| Subtilisin-like protease [Morus notabilis]
Length=841

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/766 (44%), Positives = 471/766 (61%), Gaps = 14/766 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   + + HD  L   LR   Y KLYSY +L+NGFAV V   +A ++  + E V  +  D
Sbjct  80    YSSYIARAHDSLLRRALRGQNYLKLYSYHYLINGFAVLVTPQQADRLSRRRE-VANVVLD  138

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP FLG+P   W   GG   +GEG+VIG IDTGI+P H SF+  ++ +  +
Sbjct  139   FSVRTATTHTPQFLGLPQGAWAEQGGYESAGEGIVIGFIDTGIDPNHPSFA--DDTSARQ  196

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
               + R+F+G C    +FP+ +CN K+VGA++FA +AI+ G FN S+ +ASPFD DGHG+H
Sbjct  197   YPVPRRFSGICEVTPDFPSGSCNRKLVGARHFAASAISRGIFNSSQDFASPFDGDGHGTH  256

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PVI +  ++G ASGMAP + IAVYKALY SFGG+ +DVVAA+DQA  DG
Sbjct  257   TASVAAGNHGVPVIVSGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVAAIDQAAHDG  316

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM SFSPW+ 
Sbjct  317   VDIISLSITPNRRPPGLATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSMSSFSPWIF  376

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRN-STAGLLTVE  1260
             SV A++ DR Y+NSIVLGN  T  G GL+P T     + L +AV V   + S +  + V 
Sbjct  377   SVGAASHDRSYSNSIVLGNNITIPGVGLAPGTKKDTKYTLVSAVHVLNNDTSVSDDMYVG  436

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD+ +F   LV+G L+IC+Y+  F    ++I     T     A G V  MDP +   Q
Sbjct  437   ECQDSSKFDYDLVQGNLLICSYSIRFILGISTIQRALQTAKNLSAVGLVFYMDPFVLGFQ  496

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQ  1620
             +    V +++PG+I+ + E S  L QYYNS+  R    +   F  +ARI  G +A YS  
Sbjct  497   LN--PVPMKMPGIIVPSPENSKILLQYYNSSLERDGKNKIFKFGGSARICGGLKANYSNS  554

Query  1621  GPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSG  1800
              P +  YS+RGPD  ++ LD AD++KPN++APG+ +WAAWS          G+ FA++SG
Sbjct  555   APRIMYYSARGPDPEDSSLDDADIMKPNLVAPGNFVWAAWSSAGGDSVEFLGEKFAMMSG  614

Query  1801  TSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlap  1968
             TSMA PH+AG+AALIK + P++ P+AI SA+ T+A + D+      +           +P
Sbjct  615   TSMAAPHVAGLAALIKQKFPSFSPAAIASALSTTASLYDKNGGPILAQRAYADPDVNQSP  674

Query  1969  aTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKKF  2145
             ATPFD GSGF+N + ALNPGL+F+  +  Y+ FLC + G     VR   G +C   N   
Sbjct  675   ATPFDMGSGFVNATAALNPGLIFDASYNDYMSFLCGING-SVPVVRNYTGQDCWVYNSTI  733

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
               +DLN PS+T++ L  S+TV R VTN+   D+ Y V    P GV   + P +F+I++  
Sbjct  734   NGADLNLPSITLTKLNQSQTVQRTVTNI-AEDDTYSVGWSAPYGVSAKVSPTHFYIASGQ  792

Query  2326  SRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
              + L IVLNA    +  SFG + L G + H++ +P AV V  +  +
Sbjct  793   KQVLTIVLNAILNNSVASFGRIGLFGSKGHVINIPLAVIVKTTFNT  838



>ref|XP_004508227.1| PREDICTED: cucumisin-like [Cicer arietinum]
Length=821

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/794 (43%), Positives = 473/794 (60%), Gaps = 24/794 (3%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV---------STRIK-GTSGNVTMYKQRMTKQHDVFLGSLLRRSAY  252
             E  IY+VL+   P           S+RI       +  +++ +   HD+ L + L   +Y
Sbjct  32    ERSIYLVLLRGDPIAFHEDSQNEDSSRIHVSRKALIKAHEKHLLAYHDMLLQTTLENGSY  91

Query  253   TKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWP  432
              KL+S+ +++NGF+VH    +A K L    GV+ + +D  ++ MTT+TP+FL +P  +W 
Sbjct  92    NKLHSFKYIINGFSVHTTPSQAKK-LRGTPGVKLVEKDRGVKMMTTYTPEFLHLPKGIWA  150

Query  433   RLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATAC  612
             + GG   +G+G+VIG+ID+GINP H SF+    Y   +  ++  F+G C TG NFP  +C
Sbjct  151   QEGGEENAGDGIVIGVIDSGINPHHPSFA----YQSFKSNLSH-FSGACETGPNFPPGSC  205

Query  613   NGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGY  792
             NGKIV A+YF+  A A    N S  + SPFDADGHGSH AS AAGN   PV+ N F YG 
Sbjct  206   NGKIVSAKYFSAGAEAMATLNASVDFLSPFDADGHGSHVASIAAGNAGVPVVVNGFFYGR  265

Query  793   ASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNV  972
             ASGMAP A IAVYKA+Y   G ++DVVAA+DQAV DGVDI+SLSVGP+        FLN+
Sbjct  266   ASGMAPRARIAVYKAIYPSVGTLADVVAAIDQAVLDGVDIISLSVGPNEPTEDTLTFLNM  325

Query  973   LEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTF  1152
              ++ LLFA +AGV VVQAAGN GP+S +++SFSPW   VAA  T+RRY  SI+L NGQ  
Sbjct  326   FDISLLFARKAGVFVVQAAGNKGPTSSTVVSFSPWSVGVAACNTNRRYRASILLLNGQIV  385

Query  1153  SGSGLSPPTAGKA--FFQLAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGKLVIC  1320
              G GLS P+ G    F +L  A D  + N T       +E CQ      P+ V G ++IC
Sbjct  386   DGVGLSGPSFGNGTVFHKLVLAKDAVKTNGTFPNTPEYIEECQHPEALDPTKVFGSVIIC  445

Query  1321  TYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEA  1500
              ++  F +  +++  +  T       GF+LT +P+ G        +   I  ++I ++  
Sbjct  446   NFSEGFSNGTSTLDAIIATAKALRFEGFILTANPNYG--DYIAEPIPFAISSILIPSVAD  503

Query  1501  STALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLD  1680
             S A+ +YY   T R  +G    F A A I +GR A + G+ PVV+ +SSRGPD  +    
Sbjct  504   SKAILKYYEEWTKRDENGTVKEFGAAAAIGEGRVASFKGRSPVVSRFSSRGPDFIDTKRS  563

Query  1681  TADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHP  1860
              ADVLKP+I+APG  IW AWSPNS     + G  FAL+SGTSMA PH+AGIAALIK  +P
Sbjct  564   PADVLKPDILAPGHQIWGAWSPNSALQPMLTGHSFALLSGTSMAAPHVAGIAALIKQHNP  623

Query  1861  NWKPSAITSAMMTSADVTDRl-gspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVF  2037
             +W PS I SA+ T++   D L    +        L P+TPF++G+G +NP+RA+ PGLV 
Sbjct  624   SWTPSMIASAISTTSTKYDNLGDPMMAEGFEVNTLHPSTPFEYGAGIVNPNRAIRPGLVL  683

Query  2038  NTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRR  2217
             ++ ++ +I FLC++P +D  ++   +G  C  +  +  S+LN PSVTIS L GS  V R 
Sbjct  684   SSDYEDFISFLCSLPNIDASTITTAIGENCSSSFDY-PSNLNLPSVTISALKGSICVKRS  742

Query  2218  VTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMIL  2397
             V NVG   E Y   V  P G  V + P  F IS  G++ L I +N T+    +SFGE++L
Sbjct  743   VMNVGNNTETYLGSVLSPNGTTVNLNPTWFTISPLGTQDLEIQINVTQPMEDFSFGEIVL  802

Query  2398  LGDRNHIVRVPFAV  2439
              G  +HIVR+  +V
Sbjct  803   TGSLDHIVRITLSV  816



>ref|XP_009624089.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=780

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/787 (45%), Positives = 473/787 (60%), Gaps = 26/787 (3%)
 Frame = +1

Query  127   MEDHPFVSTRIKGTSG-------NVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLN  285
             ME  P    +IK +S        N   Y   +TK HD FL S L   +Y KLYS+ H++N
Sbjct  1     MEGDPVAFHQIKTSSEKGNKLDPNSEAYANELTKFHDEFLQSNLETGSYHKLYSFKHIVN  60

Query  286   GFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEG  465
             G A+H    + ++ L  A  V+ + ED +++ MTT+TP FLGIP  VW + GG    GEG
Sbjct  61    GVAIHTTPSQ-IENLKNAPRVKLVEEDRRVKLMTTYTPQFLGIP-AVWTQEGGDRNIGEG  118

Query  466   VVIGMIDTGINPFHASFS-SPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQYF  642
             +VIG +D+GINP H SF+  P       P+    F+G C  G  FP T+CNGKIV A++F
Sbjct  119   IVIGFVDSGINPDHPSFAYDPTTTTNYTPQ---HFSGACEEGPLFPETSCNGKIVSARFF  175

Query  643   ARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGI  822
             +  A A    N S    SPFDA GHGSH AS AAGN+  PV+ N   YG A+GMAP A I
Sbjct  176   SAGAQANAILNASVDILSPFDAVGHGSHVASIAAGNFGVPVVVNGLYYGRATGMAPRARI  235

Query  823   AVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATR  1002
             AVYKA+Y   G +SDV+AA+DQAV DGVDIL+LSVGP   P G   FL++ E+ +L A +
Sbjct  236   AVYKAIYPSIGTLSDVLAAIDQAVLDGVDILTLSVGPDEPPEGTLTFLSLFEIFMLAAHK  295

Query  1003  AGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTA  1182
             AG  VVQAAGN GPS  S++S+SPW   VAA   DR Y  +++LGNG    G GLS PT 
Sbjct  296   AGTFVVQAAGNQGPSPYSVISYSPWAVGVAACDIDRTYPATLILGNGLKIGGVGLSGPTF  355

Query  1183  GKAFFQ--LAAAVDVCRRNST-AGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAA  1353
             G    Q  L  A D  + NST + +   + CQ    F P +V   +VICT++  F +  +
Sbjct  356   GGGLIQYKLVLAKDAVKTNSTFSRIFNADECQYPEAFDPLVVEDSVVICTFSAGFYNGNS  415

Query  1354  SIATVADTVHRAGAAGFVLTMDPDIG---SEQIKGATVTLQIPGLIINNMEASTALRQYY  1524
             S+  +  T +  G   FV   +P  G   +E I  AT     PG++I     +  + QYY
Sbjct  416   SLMGIIHTANLIGFKAFVFVANPTYGDFIAEPIPFAT-----PGIMIPKTTDTQNILQYY  470

Query  1525  NSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPN  1704
                T+R ++G  V +   A I +GR A Y G+ P+V+ +SSRGPD  +   +  DVLKP+
Sbjct  471   ERETVRDKNGFVVRYGGRAAISEGRIASYKGRVPIVSRFSSRGPDYIDQSKNPTDVLKPD  530

Query  1705  IMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAIT  1884
             I+APG  IWAAWSP S  +  + G +FAL+SGTSMATPHIAGIAALIK  +P+W PS + 
Sbjct  531   ILAPGHQIWAAWSPMSVLNPILSGHNFALMSGTSMATPHIAGIAALIKQYNPSWTPSMVA  590

Query  1885  SAMMTSADVTDRlgspllaqqasqqlapaT-PFDFGSGFINPSRALNPGLVFNTYFQQYI  2061
             SAM T+A   D LG P++A          + PF FG+G +NPSRAL+PGL+F+  ++ YI
Sbjct  591   SAMSTTATTYDNLGDPIMAHGFDLYTLYTSAPFGFGAGLVNPSRALHPGLIFSAGYEDYI  650

Query  2062  QFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGAD  2241
              FLC++P +D   V+   G  C E  +   SDLN PS+TI++L GSR V R V NVG   
Sbjct  651   SFLCSLPNIDSAIVKSATGGVCGELFEN-PSDLNLPSITITSLNGSRLVRRTVMNVGSKA  709

Query  2242  ERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIV  2421
             E Y   V  P GV V I P  F I+  G++HL I LN T+  + ++FG+++L G  +H+V
Sbjct  710   ETYVSAVLPPKGVMVDIQPSWFKIAPQGTQHLHITLNVTQPLDDFTFGQIVLTGSLHHLV  769

Query  2422  RVPFAVY  2442
             ++P +++
Sbjct  770   KMPLSIF  776



>ref|XP_008384255.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=825

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/801 (43%), Positives = 470/801 (59%), Gaps = 32/801 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPF-------VSTRIKG--TSGNVTMYK---QRMTKQHDVFLGSLLRRS  246
             E  +YMVLME  P        +S+R  G     N  ++K   +R+   HD  L S L   
Sbjct  28    ERDLYMVLMEGDPVAFHGGSRISSREDGRRLDPNSEVFKAHAKRLVDSHDQLLQSALETG  87

Query  247   AYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTV  426
             +Y+KLYS+ H++NGFAVH    +A K L  A GV+ +  D   + MTT+TP+FLG+P   
Sbjct  88    SYSKLYSFKHIVNGFAVHTTPSQAEK-LKAAAGVKLVERDRGAKLMTTYTPEFLGLPQGA  146

Query  427   WPRLGGPSVS-GEGVVIGMIDTGINPFHASFSS----PEEYNIGRPRITRKFTGKCITGD  591
             W   GG   S GEG+VIG +D+GINP H SF++    P   NI        F G C TG 
Sbjct  147   WTHDGGDDRSAGEGIVIGFVDSGINPTHPSFANDPLHPFTGNISH------FLGSCETGP  200

Query  592   NFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVIT  771
              FPA++CNGKIV A++F+  A  A   N +  + SPFDA GHGSH ASTAAGN   PV+ 
Sbjct  201   RFPASSCNGKIVSAKFFSAGAETAATLNSTVDFLSPFDAVGHGSHVASTAAGNAGVPVVV  260

Query  772   NRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsg  951
             N + YG ASGMAP A IAVYKA+Y   G ++DVV+A+DQA+ DGVDIL+LSVGP   P  
Sbjct  261   NGYYYGEASGMAPRARIAVYKAVYPTVGTLTDVVSAIDQAILDGVDILTLSVGPDEPPED  320

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
                FL+  ++ +L A RAGV VVQA GN GP   S++S+SPW   VA+S TDR Y  SI+
Sbjct  321   TVTFLSAYDIAMLSARRAGVFVVQATGNQGPGISSVVSYSPWAVGVASSGTDRTYPGSIL  380

Query  1132  LGNGQTFSGSGLSPPTAGKAFF--QLAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLV  1299
             LGNG    G GLS PT G      +L  A D  + + T       VE CQ       ++V
Sbjct  381   LGNGTKIEGVGLSGPTFGYGLLLHKLVLAKDAVKADGTFPRTPPYVEECQYPEALDHNVV  440

Query  1300  RGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGL  1479
              G +VICT++  F +  +++  + +T    G  GF+   +P  G        +   +PG+
Sbjct  441   LGSIVICTFSEGFYNGTSTLTAIINTAKGLGFMGFIFVANPAYG--DFIAEPIPFVVPGI  498

Query  1480  IINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPD  1659
             ++ N+  S  + QYY   T +   G A  F A A I +GR A + GQ PVV+ +SSRGPD
Sbjct  499   LVPNLTNSQVILQYYEQETHKEEKGFATRFAAEAAIGEGRVASFMGQAPVVSRFSSRGPD  558

Query  1660  VNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAA  1839
               N      DVLKP+I+APG  IWAAWSP S  +  + G +FAL SGTSMATPH+AGIAA
Sbjct  559   FVNTSRTPCDVLKPDILAPGHQIWAAWSPVSASEPALTGYNFALQSGTSMATPHVAGIAA  618

Query  1840  LIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlapaTP-FDFGSGFINPSRA  2016
             L+K  +P+W PS I SA+ T+A   D+ G  ++A+ +       +  FDFG+G ++PSRA
Sbjct  619   LVKQYNPSWTPSMIASAISTTATKYDKNGELIMAEGSGIGSTYPSSHFDFGAGLVSPSRA  678

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             L+PGLV  T ++ YI FLC++P +   +VR   G  C  N     ++LN PS+T+S L G
Sbjct  679   LDPGLVLPTGYEDYISFLCSLPEISPAAVRNATGEPC-NNTLDHPANLNLPSITLSALRG  737

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSY  2376
             S+   R   NVG   E Y      P G  V + P  F I+ +G + L+I +  T+A + +
Sbjct  738   SQIXRRIFNNVGSKPETYVCSAVSPNGTIVDLCPTWFRIAPEGIQELLIQVKVTQAMDDF  797

Query  2377  SFGEMILLGDRNHIVRVPFAV  2439
             +FGE++L G  NHIVR+P +V
Sbjct  798   TFGEIVLTGSLNHIVRIPISV  818



>ref|XP_009123389.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=842

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/787 (44%), Positives = 470/787 (60%), Gaps = 14/787 (2%)
 Frame = +1

Query  109   KIYMVLMEDHPFVSTRIKGTSGNVTMYK-QRMTKQHDVFLGSLLRRSAYTKLYSYTHLLN  285
             +IY VL+E  P         +     Y+  ++ + H+  LGS L + +YTKLYS+ H++N
Sbjct  55    RIYSVLVEGEPLAFHAATNINSKAMAYEANKIEETHEEILGSTLEKGSYTKLYSFKHIIN  114

Query  286   GFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLG--GPSVSG  459
               AV     +A K L KA+GV+ + ED  ++ MTT+TPDFL +P  VWP++   G  ++G
Sbjct  115   ALAVRTTPSQAQK-LKKAKGVKAVEEDKGVKLMTTYTPDFLELPRQVWPKISNQGDRLAG  173

Query  460   EGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR-KFTGKCITGDNFPATACNGKIVGAQ  636
             E +VIG +DTGINP H SF++ +  N     ++R  F+G C TG  FPA +CNGKI+ A+
Sbjct  174   EDIVIGFVDTGINPTHPSFAAHDLTNPYSTNLSRLNFSGDCETGPLFPAGSCNGKIISAR  233

Query  637   YFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGA  816
             +F+  A A+  FN S    SPFDA GHGSH AS AAGN   PVI   F+YG ASGMAP A
Sbjct  234   FFSAGARASVAFNGSLDILSPFDASGHGSHVASIAAGNSGVPVIVEGFSYGRASGMAPRA  293

Query  817   GIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFA  996
              IAVYKA+Y   G + DV+AA+DQA+ DGVD+L+LSVGP   P      L + ++ +L A
Sbjct  294   RIAVYKAVYPSIGTLVDVIAAIDQAIIDGVDVLTLSVGPDKPPVDKPTVLGIFDLAMLLA  353

Query  997   TRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPP  1176
              +AGV+VVQAAGN GP   S+LS+SPWV  VAA +TDR Y  S++L  GQT  G GLS P
Sbjct  354   RKAGVIVVQAAGNHGPFPSSVLSYSPWVVGVAAGSTDRSYPASLILDGGQTVQGVGLSGP  413

Query  1177  TAGKAFFQ--LAAAVDVCRRN-STAGLLT--VESCQDAMQFVPSLVRGKLVICTYTYDFE  1341
             T G  F +  L  A D  R N S    +T  VE CQ    F P+ V G +VICT++  F 
Sbjct  414   TLGAPFLRHRLVLARDAVRTNGSVPRTITGDVEECQRPDNFDPAKVLGSIVICTFSEGFF  473

Query  1342  SEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQY  1521
             ++ ++I  +  T       GF+L  +P+ G + +   T+    PG++I  +  S  + +Y
Sbjct  474   NQISTIRAITQTATTLDFMGFILMANPNFG-DYVAEPTI-FSSPGILIPKVLDSQLIMRY  531

Query  1522  YNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKP  1701
             Y   T R R G    F A ARI +GR ++++G+ PVV+ +SSRGP   +A  +  DVLKP
Sbjct  532   YEEKTYRDRGGVVTQFGARARINEGRNSVFAGEAPVVSRFSSRGPAFIDANQNPLDVLKP  591

Query  1702  NIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAI  1881
             +I+APG  IW AWS  S  D    G+ FA++SGTSMA PHIAGI+ALIK  +P+W P+ I
Sbjct  592   DILAPGHQIWGAWSLTSAFDPNFTGRRFAILSGTSMAAPHIAGISALIKQLNPSWTPAMI  651

Query  1882  TSAMMTSADVTDRlgspllaqqasqqlapaTP-FDFGSGFINPSRALNPGLVFNTYFQQY  2058
              SA+ T+A   D  G  + A+         +  FD G+G +NP+RAL+PGLV  T F+ Y
Sbjct  652   ASAISTTATGYDSSGEVMSAESYGIGELFPSNHFDHGAGHVNPARALDPGLVLPTGFEDY  711

Query  2059  IQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGA  2238
             I FLC++P ++  +VR   G  C   K    ++LN PSVTIS L G   V R   NV   
Sbjct  712   ISFLCSLPNINPDAVRSATGAWC-TTKLSHPANLNHPSVTISALKGPLVVRRSFQNVSNK  770

Query  2239  DERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHI  2418
              ERY   V  P G  V + P  F I A   + + I  N T+  N ++FGE++L G  NHI
Sbjct  771   TERYLGSVVPPNGTIVRLSPSWFTIRAQRIQDVDIEFNVTEVLNQFTFGEIVLTGSLNHI  830

Query  2419  VRVPFAV  2439
             VR+P  V
Sbjct  831   VRIPLTV  837



>ref|XP_010473453.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=837

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/789 (43%), Positives = 466/789 (59%), Gaps = 18/789 (2%)
 Frame = +1

Query  109   KIYMVLMEDHPFVSTRIKGTSGNVTMYK-QRMTKQHDVFLGSLLRRSAYTKLYSYTHLLN  285
             +IY VL+E  P         +     Y+ ++M   H+  LGS L   +YTKLYS+ H++N
Sbjct  52    RIYSVLVEGEPLAFRASTNINSKAMAYEAKKMEAIHEEILGSTLENGSYTKLYSFKHVIN  111

Query  286   GFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLG--GPSVSG  459
              FAV   S +A K L KA+GV+ + ED  ++ MTT+TPDFL +P  VWP++   G   +G
Sbjct  112   AFAVRTTSYQAKK-LTKAKGVKAVEEDKGVKLMTTYTPDFLELPQQVWPKISNDGDRRAG  170

Query  460   EGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR-KFTGKCITGDNFPATACNGKIVGAQ  636
             E +VIG++DTGINP H SF+  +  N     ++R  F+G C TG  FPA +CNGK++ A+
Sbjct  171   EDIVIGLVDTGINPTHPSFAGLDLTNPYSSNLSRLNFSGDCETGPLFPAGSCNGKLISAR  230

Query  637   YFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGA  816
             +F+  A A+G  N S    SPFDA GHGSH AS AAGN   PVI + F YG ASGMAP A
Sbjct  231   FFSAGARASGALNSSLDILSPFDASGHGSHVASIAAGNAGVPVIVDGFFYGRASGMAPRA  290

Query  817   GIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFA  996
              IAVYKA+Y   G + DV+AA+DQA+ DGVD+L+LS+GP   P      L + ++ +L A
Sbjct  291   RIAVYKAIYPSIGTLVDVIAAIDQAIMDGVDVLTLSIGPDQPPVDKPTVLGIFDLAMLLA  350

Query  997   TRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPP  1176
              +AGV VVQAAGN GPS  S+LS+SPWV  VAA  TDR Y  S++L  GQT  G GLS P
Sbjct  351   RKAGVFVVQAAGNHGPSPSSVLSYSPWVVGVAAGNTDRSYPASLILDGGQTVQGVGLSGP  410

Query  1177  TAGKAFFQ--LAAAVDVCRRN-STAGLLT--VESCQDAMQFVPSLVRGKLVICTYTYDFE  1341
             T G  F Q  L  A D  R N S    LT  +E CQ    F P++V G +VICT++  F 
Sbjct  411   TLGAPFLQHKLVLARDAVRTNGSVLQTLTRDIEECQRPEYFDPAVVLGSIVICTFSDGFY  470

Query  1342  SEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQY  1521
             ++ +++  +  T    G  GF+L   P  G        V    PG++I  +  +  + +Y
Sbjct  471   NQMSTVRAITQTARTLGFMGFILIAHPRYG--DYVAEPVIFSAPGILIPKVSDAQIILRY  528

Query  1522  YNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKP  1701
             Y   T R + G    F A ARI DGR ++++G  P V+ +SSRGP   +A  +  DVLKP
Sbjct  529   YEEKTFRDKRGLVTQFGARARIGDGRNSVFAGTAPAVSRFSSRGPAFIDANRNLLDVLKP  588

Query  1702  NIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAI  1881
             +I+APG  IW AWS  S  D  + G+ FA++SGTSMA PHIAGI A+IK  +P+W P+ I
Sbjct  589   DILAPGHQIWGAWSLPSAFDPILTGRSFAILSGTSMAAPHIAGIGAMIKQLNPSWTPAMI  648

Query  1882  TSAMMTSADVTDRlgspllaqqasqqlapaTP-FDFGSGFINPSRALNPGLVFNTYFQQY  2058
              SA+ T+A   D  G  + A+         +  FD G+G +NP+RA++PGLV    F+ Y
Sbjct  649   ASAISTTATEYDSSGEVISAESYEINGLFPSNHFDHGAGHVNPARAIDPGLVLPAGFEDY  708

Query  2059  IQFLCAVPGVDEKSVRRVVGVEC--PENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVG  2232
             I FLC++P ++  ++R   GV C  P + +   ++LN PSVTIS L  S  V R   NV 
Sbjct  709   ISFLCSLPNINPVTIRAATGVWCTTPLSHQ---ANLNHPSVTISALKESLVVKRSFQNVS  765

Query  2233  GADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRN  2412
                E Y   +  P G  V +IP  F +     + L I  N T+  N ++FGE++L G  N
Sbjct  766   NKTETYLGSILPPNGTAVRLIPSWFTVPPQRIQGLDIEFNVTQVLNQFTFGEVVLTGSLN  825

Query  2413  HIVRVPFAV  2439
             HI+R+P +V
Sbjct  826   HIIRIPLSV  834



>ref|XP_010686861.1| PREDICTED: subtilisin-like protease SBT3.5 [Beta vulgaris subsp. 
vulgaris]
Length=807

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/795 (42%), Positives = 462/795 (58%), Gaps = 23/795 (3%)
 Frame = +1

Query  112   IYMVLMEDHPFV----------STRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKL  261
             +Y+VL+E                +R+   S     +   + K H   L S L    Y KL
Sbjct  11    LYIVLVEGDSLAFLHGVQSSHQESRVHLNSEAYQEHANLLEKSHSELLESTLDTGTYQKL  70

Query  262   YSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLG  441
             +S+THL NGFAVH    +A K L K+  V+ +  D   + MTT+TP FL +P+T+W + G
Sbjct  71    HSFTHLANGFAVHTTLSQAEK-LKKSPRVKLMERDRGAKLMTTYTPKFLKLPETIWAQQG  129

Query  442   GPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRI----TRKFTGKCITGDNFPATA  609
             G   +G+G+VIG +D+GINPFH SF++ ++  +    +    + +F G C TG  FPA++
Sbjct  130   GDENAGKGIVIGFVDSGINPFHPSFAADDDLLMINTSLVCSNSTRFCGVCHTGPRFPASS  189

Query  610   CNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYG  789
             CNGKIV A++FA  A A    N S  + SPFDADGHGSH ASTAAGN   PV+ + F YG
Sbjct  190   CNGKIVSARFFANGAQAVSLLNASVDFLSPFDADGHGSHVASTAAGNSRVPVVVDGFFYG  249

Query  790   YASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLN  969
              ASGMAP A IAVYKA+Y   G ++DV+AA+DQAV+DGVDIL+LSV P     G   FL+
Sbjct  250   TASGMAPHARIAVYKAIYPTVGTLTDVLAAIDQAVKDGVDILTLSVEPDEPGEGTVTFLD  309

Query  970   VLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQT  1149
             V E+  L A RAGV VVQAAGN GP   +++S SPW   VAA +TDR Y  ++ LGNGQ 
Sbjct  310   VFEIFTLLARRAGVFVVQAAGNKGPGPSTVVSLSPWSVGVAACSTDRSYPATLFLGNGQK  369

Query  1150  FSGSGLSPPTAGKAF--FQLAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGKLVI  1317
               G GLS PT G     ++L  A D    N +       +E CQ      P +V G +VI
Sbjct  370   IVGVGLSGPTFGNGILKYKLVLAKDAVHINGSFPRTPPYIEECQFPEALNPMIVAGSIVI  429

Query  1318  CTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNME  1497
             C ++  F ++ +S+ ++ +T    G  GF+L   P  G        V   +PG++I    
Sbjct  430   CNFSAGFYNQTSSLTSIINTAKILGFMGFILVASPTYG--DFVAEPVPFPVPGIMIPKTA  487

Query  1498  ASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALL  1677
              +  + QYY   T R+  G  + +   A I +GR A++  Q P V+ +SSRGPD+ ++  
Sbjct  488   EAKIISQYYEEQTKRTERGCVIRYGGRASIGEGRTAVFDRQMPTVSRFSSRGPDIIDSHR  547

Query  1678  DTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRH  1857
             + ADVLKP+ +APG  IWAAWSP S  +   +G +FA++SGTSMA PHIAGIAALIK R+
Sbjct  548   NPADVLKPDFVAPGQQIWAAWSPLSASEPIFEGNNFAMMSGTSMAVPHIAGIAALIKQRN  607

Query  1858  PNWKPSAITSAMMTSADVTDRl-gspllaqqasqqlapaTPFDFGSGFINPSRALNPGLV  2034
             P+W PS I SA+ T+A   D      L        L  +TPFD G+G +NP+RA +PGLV
Sbjct  608   PSWTPSMIASAISTTATKYDNSGEVILSEGYDIGSLKVSTPFDIGAGLVNPARAADPGLV  667

Query  2035  FNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMR  2214
                   +Y+ FLC++  ++ + V    G  C    +   +DLN PSVTI++LVGS+ V R
Sbjct  668   IMPGEGEYVAFLCSLSNINREQVEAATGGSCNHPLEH-PADLNLPSVTITSLVGSQVVKR  726

Query  2215  RVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMI  2394
             +V NV    E Y   V  P GV V + P  F I+   ++ L I LN       +SFGE++
Sbjct  727   KVINVASKQETYLCAVLPPNGVTVDVSPTWFTIAPTETQGLEIKLNVVTQAKEFSFGEIV  786

Query  2395  LLGDRNHIVRVPFAV  2439
             L G  +HIVR+P +V
Sbjct  787   LTGSLDHIVRIPLSV  801



>emb|CDY08646.1| BnaC04g19550D [Brassica napus]
Length=833

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/791 (44%), Positives = 476/791 (60%), Gaps = 15/791 (2%)
 Frame = +1

Query  109   KIYMVLMEDHPFVSTRIKGTSGNVTMYK-QRMTKQHDVFLGSLLRRSAYTKLYSYTHLLN  285
             +IY VL+E  P         +     Y+ +++ + H+  LGS L + +YTKLYS+ H++N
Sbjct  45    RIYSVLVEGEPLAFHAATNINSKAMAYEAKKIEEIHEEILGSTLEKGSYTKLYSFKHIIN  104

Query  286   GFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLG--GPSVSG  459
               AV     +A K L KA+GV+ + ED  ++ MTT+TPDFL +P  VWP++   G  ++G
Sbjct  105   ALAVRTTPSQAQK-LKKAKGVKAVEEDKGVKLMTTYTPDFLELPRQVWPKISNQGDRLAG  163

Query  460   EGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR-KFTGKCITGDNFPATACNGKIVGAQ  636
             E +VIG +DTGI+P H SF++ +  N     ++R  F+G C TG  FPA +CNGKI+ A+
Sbjct  164   EDIVIGFVDTGISPTHPSFAALDLTNPYSTNLSRLNFSGDCETGPLFPAGSCNGKIISAR  223

Query  637   YFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGA  816
             +F+  A A+  FN S    SPFDA GHGSH AS AAGN   PVI + F+YG ASGMAP A
Sbjct  224   FFSAGARASVAFNGSLDILSPFDASGHGSHVASIAAGNSGVPVIVDGFSYGRASGMAPRA  283

Query  817   GIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFA  996
              IAVYKA+Y   G + DV+AA+DQA+ DGVD+L+LSVGP   P      L + ++ +L A
Sbjct  284   RIAVYKAVYPSIGTLVDVIAAIDQAIIDGVDVLTLSVGPDKPPVDKPTVLGIFDLAMLLA  343

Query  997   TRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPP  1176
              +AGV+VVQAAGN GP   S+LS+SPWV  VAA +TDR Y  S++L  GQT  G GLS P
Sbjct  344   RKAGVIVVQAAGNHGPFPSSVLSYSPWVVGVAAGSTDRSYPASLILDGGQTVQGVGLSGP  403

Query  1177  TAGKAFF--QLAAAVDVCRRN-STAGLLT--VESCQDAMQFVPSLVRGKLVICTYTYDFE  1341
             T G  F   +L  A D  R N S    +T  VE CQ +  F P+ V G +VICT++  F 
Sbjct  404   TLGAPFLRHRLVLARDAVRTNGSVPRTITGDVEECQRSDNFDPAKVLGSIVICTFSEGFF  463

Query  1342  SEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQY  1521
             ++ ++I  +  T    G  GF+L  +P+ G + +   T+    PG++I  +  S  + +Y
Sbjct  464   NQISTIRAITQTATTLGFMGFILMANPNFG-DYVAEPTI-FSSPGILIPKVLDSQLIMRY  521

Query  1522  YNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKP  1701
             Y   T R R G    F A ARI +GR ++++G+ PVV+ +SSRGP   +A  +  DVLKP
Sbjct  522   YEEKTYRDRGGVVTQFGARARINEGRNSVFAGEAPVVSRFSSRGPAFIDANQNPLDVLKP  581

Query  1702  NIMAPGSSIWAAWSPNSEGD-KYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSA  1878
             +I+APG  IW AWS  S  D  +  G+ FA++SGTSMA PHIAGI+ALIK  +P+W P+ 
Sbjct  582   DILAPGHQIWGAWSLTSAFDPNFTAGRRFAILSGTSMAAPHIAGISALIKQLNPSWTPAM  641

Query  1879  ITSAMMTSADVTDRlgspllaqqasqqlapaTP-FDFGSGFINPSRALNPGLVFNTYFQQ  2055
             I SA+ T+A   D  G  + A+         +  FD G+G +NP+RA++PGLV  T F+ 
Sbjct  642   IASAISTTATGYDSSGEVMSAESYGISELFPSNHFDNGAGHVNPARAIDPGLVLPTGFED  701

Query  2056  YIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGG  2235
             YI FLC++P ++  +VR   G  C   K    ++LN PSVTIS L G   V R   NV  
Sbjct  702   YISFLCSLPSINPDTVRSATGAWC-TTKFSHPANLNHPSVTISALKGPLVVRRSFQNVSN  760

Query  2236  ADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNH  2415
               ERY   V  P G  V + P  F I A   + + I  N T+  N ++FGE++L G  NH
Sbjct  761   KTERYLGSVLPPNGTIVRLNPSWFTIRAQRIQDVDIEFNVTEVLNQFTFGEIVLTGSLNH  820

Query  2416  IVRVPFAVYVT  2448
             IVR+P  V  T
Sbjct  821   IVRIPLTVKTT  831



>ref|XP_010430283.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=788

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/787 (43%), Positives = 463/787 (59%), Gaps = 14/787 (2%)
 Frame = +1

Query  109   KIYMVLMEDHPFVSTRIKGTSGNVTMYK-QRMTKQHDVFLGSLLRRSAYTKLYSYTHLLN  285
             +IY VL+E  P         +     Y+ ++M   H+  LG  L   +YTKLYS+ H++N
Sbjct  3     RIYSVLVEGEPLAFRASTNINSKAMAYEAKKMEAIHEEILGRTLENGSYTKLYSFKHVIN  62

Query  286   GFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLG--GPSVSG  459
              FAV     +A K L KA+GV+ + ED  ++ MTT+TPDFL +P  VWP++   G   +G
Sbjct  63    AFAVSTTPYQAKK-LTKAKGVKVVEEDKGVKIMTTYTPDFLELPQQVWPKISNDGDRRAG  121

Query  460   EGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR-KFTGKCITGDNFPATACNGKIVGAQ  636
             E +VIG +DTGINP H SF+  +  N     ++R  F+G C TG  FP  +CNGKI+ A+
Sbjct  122   EDIVIGFVDTGINPTHPSFAGLDLTNPYSSNLSRLNFSGDCETGPLFPVGSCNGKIISAR  181

Query  637   YFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGA  816
             +F+  A A+G  N S    SPFDA GHGSH AS AAGN   PVI + F YG ASGMAP A
Sbjct  182   FFSAGARASGALNSSLDILSPFDASGHGSHVASIAAGNAGVPVIVDGFFYGRASGMAPRA  241

Query  817   GIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFA  996
              IAVYKA+Y   G + DVVAA+DQA+ DGVD+L+LS+GP   P      L + ++ +L A
Sbjct  242   RIAVYKAIYPSIGALVDVVAAIDQAIMDGVDVLTLSIGPDQPPVDKPTVLGIFDLAMLLA  301

Query  997   TRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPP  1176
              +AGV VVQAAGN GPS  S+LS+SPWV  VAA  TDR Y  S++L  GQT  G GLS P
Sbjct  302   RKAGVFVVQAAGNHGPSPSSVLSYSPWVVGVAAGNTDRSYPASLILDGGQTVQGVGLSGP  361

Query  1177  TAGKAFFQ--LAAAVDVCRRN-STAGLLT--VESCQDAMQFVPSLVRGKLVICTYTYDFE  1341
             T G  F Q  L  A D  R N S    LT  +E CQ    F P++V G +VICT++  F 
Sbjct  362   TLGAPFLQHKLVLARDAVRTNGSVLQTLTRDIEECQRPDNFDPAVVLGSIVICTFSDGFY  421

Query  1342  SEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQY  1521
             ++ +++  +  T    G  GF+L   P  G    +   V   +PG++I  +  +  + +Y
Sbjct  422   NQMSTVRAITQTARTLGFMGFILIAHPRYGDYVAE--PVIFSVPGILIPKVSDAQIILRY  479

Query  1522  YNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKP  1701
             Y   T R + G    F A ARI DGR ++++G+ P V+ +SSRGP   +A  +  DVLKP
Sbjct  480   YEEKTFRDKRGIVTQFGARARIGDGRNSVFAGKAPAVSRFSSRGPAFIDANRNLLDVLKP  539

Query  1702  NIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAI  1881
             +I+APG  IW AWS  S  D  + G+ FA++SGTSMA PHIAGI A+IK  +P+W P+ I
Sbjct  540   DILAPGHQIWGAWSLPSAFDPILTGRSFAILSGTSMAAPHIAGIGAMIKQLNPSWTPAMI  599

Query  1882  TSAMMTSADVTDRlgspllaqqasqqlapaTP-FDFGSGFINPSRALNPGLVFNTYFQQY  2058
              SA+ T+A   D  G  + A+         +  FD G+G +NP+RA++PGLV    F+ Y
Sbjct  600   ASAISTTATEYDSSGEVISAESYEISGLFPSNHFDHGAGHVNPARAIDPGLVLPAGFEDY  659

Query  2059  IQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGA  2238
             I FLC++P ++  ++R   GV C        ++LN PSVTIS L+ S  V R   NV   
Sbjct  660   ISFLCSLPNINPVTIRAATGVWC-TTPLSHPANLNHPSVTISALIESLVVKRSFQNVSNK  718

Query  2239  DERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHI  2418
              E Y   +  P G  V +IP  F +     + L I  N T+  N ++FGE++L G  NHI
Sbjct  719   TETYLGSILPPNGTAVRLIPSWFTVPPQRIQGLDIEFNVTQVLNQFTFGEVVLTGSLNHI  778

Query  2419  VRVPFAV  2439
             +R+P +V
Sbjct  779   IRIPLSV  785



>ref|XP_006467378.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 gb|KDO78363.1| hypothetical protein CISIN_1g003446mg [Citrus sinensis]
Length=819

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/791 (44%), Positives = 472/791 (60%), Gaps = 20/791 (3%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV---STRIKGTSGNVTMYK---QRMTKQHDVFLGSLLRRSAYTKLY  264
             E  IY+VL+E  P     S   +    N   YK   +R+   HD  L S L   +Y KLY
Sbjct  31    ERDIYLVLIEGEPLAFHGSDDKRRFDLNSDAYKGQTKRLMDSHDRILQSTLEIGSYNKLY  90

Query  265   SYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGG  444
             S+ + +NGFAVH+   +A K L  A  V+ +  D + + MT++TP FLG+P  VW + GG
Sbjct  91    SFKYTVNGFAVHLTPTQAKK-LENAPQVKLVERDRRAKLMTSYTPQFLGLPQGVWTQRGG  149

Query  445   PSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKI  624
                +GEG+VIG +DTGINP H SF++   YN   P I+  F+G C TG  FP ++CNGKI
Sbjct  150   DKNAGEGIVIGFVDTGINPSHPSFAN---YNPFEPNISH-FSGDCETGPRFPLSSCNGKI  205

Query  625   VGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGM  804
             V A++F+  A A    N S  + SPFDA GHGSH ASTAAGN   PV+ + F YG ASGM
Sbjct  206   VSARFFSAGAQAVATLNTSVDFLSPFDAVGHGSHVASTAAGNAGVPVVVDGFFYGLASGM  265

Query  805   APGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQ  984
             AP A IAVYKA+Y   G ++DV+AA+DQA  DGVDIL+LS+GP   P      L + +V 
Sbjct  266   APCARIAVYKAMYPTVGTLADVIAAIDQATMDGVDILTLSIGPDEPPRDTITMLGIFDVL  325

Query  985   LLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSG  1164
             +LFA RAGV VVQAAGN GP+  +++S+SPW  + AA TTDR Y  S++LGNG    G G
Sbjct  326   MLFARRAGVFVVQAAGNQGPAPSTVVSYSPWAVAAAACTTDRIYPGSLLLGNGLKLGGVG  385

Query  1165  LSPPTAGKAFF--QLAAAVDVCRRNSTAGLLT---VESCQDAMQFVPSLVRGKLVICTYT  1329
             LS PT G+  F  +L  A DV  R +     T   +E CQ    F PSLV+G +VICT++
Sbjct  386   LSGPTCGRPLFLSKLVLARDVILRVNGTFPRTPQYIEECQYPEAFEPSLVQGSVVICTFS  445

Query  1330  YDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTA  1509
               F ++ +++  V +T    G  GF+L  +   G        +   +PG++I  +  S  
Sbjct  446   DGFYNQTSTLTAVINTAITLGFMGFILIANSHYG--DFVAEPIPFAVPGILIPKVSTSEI  503

Query  1510  LRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTAD  1689
             + QYY   T R   G A+ F A A I +GR A + G+ P+V+ +SSRGPD  +   +  D
Sbjct  504   ILQYYEQQTHRDERGVAIKFNAQAGIGEGRVASFEGRAPIVSRFSSRGPDFTDLSRNPTD  563

Query  1690  VLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWK  1869
             VLKP+++APG  IWAAWSP S  D  + G +FAL+SGTSMATPHIAGIAALIK  +P+W 
Sbjct  564   VLKPDVIAPGHQIWAAWSPVSALDPMLTGCNFALLSGTSMATPHIAGIAALIKQHNPSWT  623

Query  1870  PSAITSAMMTSADVTDRl-gspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTY  2046
             P+ I SA+ ++A   D      +           +T FDFGSG ++ +RAL+PGLV +  
Sbjct  624   PTMIASAISSTATKYDNYGQLIMAEGFEITSTYNSTHFDFGSGLVSATRALDPGLVLSVE  683

Query  2047  FQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTN  2226
             F+ YI FLC++   D  S++   G+ C  +     ++LN PSVT+S +  S  + R + N
Sbjct  684   FEDYISFLCSLADSDPVSIKAATGIWCNHSLSH-PANLNLPSVTVSAVAKSLILQRSLKN  742

Query  2227  VGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGD  2406
             VG   E Y   V  P G  V++ P  F I+  G++ L I  N T+A   +SFGE++L G 
Sbjct  743   VGNKTETYLTSVVHPNGTTVSLYPPWFTIAPQGTQDLAIQFNVTQAIGDFSFGEIVLTGS  802

Query  2407  RNHIVRVPFAV  2439
              NHIVR+P +V
Sbjct  803   LNHIVRIPLSV  813



>ref|XP_010246696.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=840

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/763 (44%), Positives = 470/763 (62%), Gaps = 15/763 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   +T+ HD  L  +LR   Y KLYSY +L+NGFAV V   +A K+  + E V  +  D
Sbjct  80    YGSYLTRVHDSLLRRVLRGENYLKLYSYHYLINGFAVLVTPQQAEKLSRRRE-VANVVMD  138

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP+FLG+P   W + GGP+ +GEG+VIG IDTGI+P H SFS     N   
Sbjct  139   FSVRTATTHTPEFLGLPRGAWVQEGGPAYAGEGIVIGFIDTGIDPTHPSFSDDILEN-AY  197

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
             P +   F+G C    +FP+ +CN K++GA++FA +AI  G FN ++ YASPFD DGHG+H
Sbjct  198   P-VPSHFSGVCEVTRDFPSGSCNRKLIGARHFAASAITRGIFNATQDYASPFDGDGHGTH  256

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PVI    ++G ASGMAP + IAVYKALY SFGG+ +DVVAA+DQA +DG
Sbjct  257   TASIAAGNHGIPVIVAGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVAAIDQAAQDG  316

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +S+ SFSPW+ 
Sbjct  317   VDIISLSITPNRRPPGLATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSISSFSPWIF  376

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVE  1260
             +V AS  DR Y+NSIVLGN  T SG GL+P T     + L  A+      +T    + + 
Sbjct  377   TVGASAHDRIYSNSIVLGNNITISGVGLAPGTRNTTTYTLVLALHALNNETTDTNGMYLG  436

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQ+       L++G L++C+Y+  F    ++I    +T     AAG V  MDP +   Q
Sbjct  437   ECQEPTSLNRDLIQGNLLVCSYSIRFVLGLSTIKQALETAKNLSAAGLVFYMDPFVIGFQ  496

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLR-SRSGRAVAFRATARILDGRRAIYSG  1617
             +    + +++PG+II + + S  L QYYNS+  R + S + V F A A IL G +A Y+ 
Sbjct  497   LN--PIPMKLPGVIIPSPDDSKILLQYYNSSLERDAVSKKIVKFGAVASILGGLKANYNN  554

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  ++ LD AD+LKPN++APG+ IW AWS         +G++FA++S
Sbjct  555   SAPKVMYYSARGPDPEDSFLDDADILKPNLIAPGNFIWGAWSSVGADSVEFEGENFAMMS  614

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqla  1965
             GTSMA PH+AG+A+LIK + PN+ PSAI SA+ T+A + D       +        Q  +
Sbjct  615   GTSMAAPHVAGLASLIKQKFPNFSPSAIGSALSTTASLYDNNGSPIMAQRSYSNPDQNQS  674

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF  2145
             PATPFD GSGF+N + AL+PGL+F++ +  ++ FLC + G     V    G  C      
Sbjct  675   PATPFDMGSGFVNATSALDPGLIFDSSYDDFLSFLCGING-SSPIVLNYTGKSC-GIYNI  732

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
               SDLN PS+TI+ L  SRTV R VTN+ G +E Y V    P GV V + P  FFI+   
Sbjct  733   NASDLNLPSITIAKLNQSRTVQRVVTNIAG-NETYNVGWSAPYGVSVLVSPTRFFIAGGQ  791

Query  2326  SRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTAS  2454
              + L +  NAT  ++  SFG + L G++ HIV +P +V +  S
Sbjct  792   KQDLTVQFNATMNSSFASFGRIGLFGNQGHIVNIPLSVILKIS  834



>ref|XP_007014399.1| Subtilisin-like serine protease 3 isoform 4 [Theobroma cacao]
 gb|EOY32018.1| Subtilisin-like serine protease 3 isoform 4 [Theobroma cacao]
Length=743

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/744 (45%), Positives = 459/744 (62%), Gaps = 15/744 (2%)
 Frame = +1

Query  217   VFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHT  396
             + LG L  R +Y KLYSY HL+NGF+VH+  ++A + L +A GV+ +  D K+ ++TTHT
Sbjct  1     MLLGMLFERGSYKKLYSYKHLINGFSVHLSPEQA-ETLRRAPGVKSVERDWKVRRLTTHT  59

Query  397   PDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGK  576
             P FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++   Y+        K+ GK
Sbjct  60    PQFLGLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPLHPSFAA---YHTDPYGPVPKYRGK  116

Query  577   CITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYH  756
             C    +     CNGKI+GAQ+FA AA AAG FN +  +ASP D DGHGSHTA+ AAGN  
Sbjct  117   CEIDPDTKRDFCNGKIIGAQHFAEAAKAAGAFNPAIDFASPMDGDGHGSHTAAIAAGNNG  176

Query  757   TPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-g  930
              PV  +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV  
Sbjct  177   IPVRVHGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGP  236

Query  931   pssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDR  1110
              S   +  + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DR
Sbjct  237   NSPQATTKTTFLNPFDATLLAAVKAGVFVAQAAGNGGPFPKTLVSYSPWIASVAAAIDDR  296

Query  1111  RYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVP  1290
             RY N + LGNG+  +G GLSP T     + + AA DV   +S+    +   CQ       
Sbjct  297   RYKNHLNLGNGKILAGMGLSPSTHPNQTYTMVAANDVLL-DSSVMKYSPSDCQRPEVLNK  355

Query  1291  SLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQI  1470
             +LV G +++C Y+++F    ASI  V++T     A GFVL ++    S   K   V + I
Sbjct  356   NLVEGNILLCGYSFNFVVGTASIKKVSETAKALRAVGFVLAVENV--SPGTKFDPVPVGI  413

Query  1471  PGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSR  1650
             PG++I ++  S  L  YYN +T R  +GR  +F+A   I DG   I     P VA +S+R
Sbjct  414   PGILITDVSKSMDLIDYYNVSTPRDWTGRVKSFKAIGSIGDGLMPILHKSAPQVALFSAR  473

Query  1651  GPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAG  1830
             GP++ +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIAG
Sbjct  474   GPNIKDYSFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIAG  533

Query  1831  IAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGF  1998
             IAAL+K +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG 
Sbjct  534   IAALLKQKHPHWSPAAIKSALMTTSTKLDRAGRPLQAQQYSETEAMKLVTATPFDYGSGH  593

Query  1999  INPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVT  2178
             +NP  AL+PGL+F+  ++ Y+ FLC+ PG+D   ++      C  +     S+LNTPS+T
Sbjct  594   VNPRAALDPGLIFHAGYEDYLGFLCSTPGIDIHEIKNYTNSPC-NHTMGHPSNLNTPSIT  652

Query  2179  ISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNAT  2358
             IS+LVG++TV R VTNV   +E Y +  R    + +   P    +    SR   + L A 
Sbjct  653   ISHLVGTQTVTRTVTNV-AEEETYVITARMHPSIAIETNPSAMTLKPGASRKFSVTLTAR  711

Query  2359  KATNSYSFGEMILLGDRNHIVRVP  2430
               T +YSFGE+ + G R H V +P
Sbjct  712   SVTGTYSFGEITMKGSRGHKVSIP  735



>ref|XP_009419011.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=841

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/760 (44%), Positives = 465/760 (61%), Gaps = 15/760 (2%)
 Frame = +1

Query  181   TMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIY  360
             T Y   + +  +  L    R   Y KLYSY +L+NGF+V + S +A K+  + E V  + 
Sbjct  75    TNYSSYLIRLQNSLLRRAFRGERYLKLYSYHYLINGFSVLITSQQAEKLSRRHE-VANVL  133

Query  361   EDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNI  540
              D  +   TTHTP+FLG+P   W + GGP V+GEG+VIG IDTGI+P H SFS  +  ++
Sbjct  134   LDFSVRTATTHTPEFLGLPQGAWVQEGGPEVAGEGIVIGFIDTGIDPTHPSFS--DYLSV  191

Query  541   GRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHG  720
              R  I   F+G C    +FPA +CN K+VGA++FA +AI  G FN +  +ASP D DGHG
Sbjct  192   NRYPIPHHFSGICEVTKDFPAGSCNRKLVGARHFAASAITRGIFNATLDHASPLDGDGHG  251

Query  721   SHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqave  897
             +HTAS AAGN+  PV+ +  ++G ASGMAP A IAVYKALY SFGG+ +DVVAA+DQA +
Sbjct  252   THTASIAAGNHGIPVVVSGHHFGNASGMAPRAHIAVYKALYKSFGGFAADVVAAIDQAAQ  311

Query  898   dgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPW  1077
             DGVDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +S+ SFSPW
Sbjct  312   DGVDIISLSITPNRRPLGVATFFNPIDMSLLNAVKAGIFVVQAAGNTGPSPKSVSSFSPW  371

Query  1078  VTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLT  1254
             + +V AS  DR Y+N +VLGN    SG GL+P T G   + L AA       +T A  + 
Sbjct  372   IFTVGASAHDRIYSNHLVLGNNLKISGVGLAPGTDGDLMYPLIAATHALTNETTDANDMY  431

Query  1255  VESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGS  1434
             +  CQD+      L +GKL++C+Y+  F    +SI     +     A G +  MDP +  
Sbjct  432   LAECQDSSLLNKDLTKGKLLVCSYSIRFVLGLSSIKQALQSAKNVSAVGVIFYMDPFVIG  491

Query  1435  EQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAV-AFRATARILDGRRAIY  1611
              Q+      + +PGLII + + S    +YYNS+ +R +  + +  FR  A+IL G +A Y
Sbjct  492   FQLN--PTPMHMPGLIIPSPDDSKIFLKYYNSSLMRDKDSKTIIKFRGVAKILGGLKANY  549

Query  1612  SGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFAL  1791
             S   P V  YS+RGPD  +  L  AD+LKPN++APG+ IW+AWS         +G+ FA+
Sbjct  550   SISAPKVMYYSARGPDPEDNSLVDADILKPNLIAPGNFIWSAWSSLGTDSAEFEGEKFAM  609

Query  1792  VSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqq  1959
             +SGTSMA PH+AG+AALIK ++PN+ PSAI SA+ T+A V  +      +          
Sbjct  610   ISGTSMAAPHVAGLAALIKQKYPNFSPSAIGSALSTTATVYGKQGSPIMAQRAYSNPDSN  669

Query  1960  lapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENK  2139
             ++PATPFD GSGF+N + ALNPGL+ ++ +  ++ FLC + G     V    G  C +  
Sbjct  670   MSPATPFDMGSGFVNATAALNPGLILDSGYDNFLSFLCGING-SAPVVLNYTGHNC-KIS  727

Query  2140  KFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISA  2319
                 SDLN PSVTIS L  SR +MRRVTN+   DE Y V    P GV V++ P  FFI++
Sbjct  728   TMMGSDLNLPSVTISLLNQSRIIMRRVTNIAN-DEHYSVSWSAPYGVSVSVSPTRFFIAS  786

Query  2320  DGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
                ++L IVL +T  + S SFG + L G+  H + +P +V
Sbjct  787   GQQQNLTIVLGSTMNSTSASFGGIGLYGNLGHKLFIPLSV  826



>ref|XP_006836419.1| hypothetical protein AMTR_s00092p00154570 [Amborella trichopoda]
 gb|ERM99272.1| hypothetical protein AMTR_s00092p00154570 [Amborella trichopoda]
Length=845

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/764 (44%), Positives = 465/764 (61%), Gaps = 15/764 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   + +  D  L  +L+   Y KLYSY +L+NGFAV +   +A K++ + E V  I  D
Sbjct  85    YGSYLVRLQDSLLKRVLKGENYLKLYSYHYLINGFAVLLTQPQADKLIKRKE-VANIALD  143

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP+FLG+P   W   GGP ++GEGVVIG IDTGI+P H SFS  +  +   
Sbjct  144   FSVRTATTHTPEFLGLPKGAWIEEGGPELAGEGVVIGFIDTGIDPTHPSFS--DNLSDTP  201

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
               I   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ YASPFD DGHG+H
Sbjct  202   YPIPPHFSGVCEVTRDFPSGSCNRKLVGARHFAASAITRGIFNATQDYASPFDGDGHGTH  261

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PV+    ++G ASGMAP A IAVYK+LY SFGG+ +DVVAA+DQA +DG
Sbjct  262   TASIAAGNHGIPVVVAGHHFGNASGMAPRAHIAVYKSLYKSFGGFAADVVAAIDQAAQDG  321

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A ++G+ VVQAAGN+GPS +S+ SFSPW+ 
Sbjct  322   VDIVSLSITPNRRPPGLATFFNPIDMALLSAVKSGIFVVQAAGNTGPSPKSISSFSPWIF  381

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVE  1260
             +V A+  DR Y+NS++LGN  T  G GL+P T G  F  L +A      +S     + + 
Sbjct  382   TVGAAVHDRIYSNSVLLGNNLTIQGVGLAPRTVGDTFNTLVSATHALSNDSIGTRDMYLS  441

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD+ Q  P L+RG L+IC+Y+  F    +SI     T     A G V  MDP +   Q
Sbjct  442   ECQDSSQLNPDLIRGNLLICSYSIRFVLGLSSIKQALQTAKNVSAVGVVFYMDPFVLGFQ  501

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAV-AFRATARILDGRRAIYSG  1617
             +      + +PGLII +   S    +YYN++ +R+ S  ++  F   ARIL G +A YS 
Sbjct  502   LN--PTPMNMPGLIIPSPSDSQVFLKYYNNSLVRNESSNSILKFGGMARILGGLKANYSN  559

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  + +LD AD +KPN++APG+ IWAAWS         +G+ FA++S
Sbjct  560   SAPKVVYYSARGPDPEDNMLDDADFMKPNLIAPGNLIWAAWSSLGTDSMEFEGESFAMIS  619

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqla  1965
             GTSMA PH+AG+AALIK + P + PSAI SA+ T+A + D+    + +           +
Sbjct  620   GTSMAAPHVAGLAALIKQKFPTFGPSAIGSALSTTASLLDKWGGPIMAQRSYSNPDSNQS  679

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF  2145
             PATPFD GSGF+N + ALNPGL+F++ F  ++ FLC + G     V    G  C  N   
Sbjct  680   PATPFDMGSGFVNATAALNPGLIFDSSFADFLAFLCGING-SSPVVLNYTGEACGPN-TI  737

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
                DLN PS+TI+ L  SRTV R VTN+G  +E + V    P GV +++ P  F ++   
Sbjct  738   GGPDLNLPSITIAKLNQSRTVYRTVTNIGD-NETFTVTWSNPFGVSLSLTPTTFSLAQRQ  796

Query  2326  SRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASL  2457
             ++ L + + AT  + S SFG + L G + H V VP +V  T S+
Sbjct  797   TQSLTVSMVATINSTSPSFGRIGLYGSQGHAVSVPVSVISTVSM  840



>ref|XP_009357595.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=803

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/801 (43%), Positives = 464/801 (58%), Gaps = 28/801 (3%)
 Frame = +1

Query  100   AEAKIYMVLMEDHPFV------------STRIKGTSGNVTMYKQRMTKQHDVFLGSLLRR  243
             A+  +YMVLME  P                R+   S     + +R+   HD  L S L  
Sbjct  5     AKRALYMVLMEGDPVAFHGGSRISSREDRRRLDPNSEVFKAHAKRLVDSHDQLLQSALET  64

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
              +Y+KLYS+ H++NGFAVH    +A K L  A GV+ +  D   + MTT+TP+FLG+P  
Sbjct  65    GSYSKLYSFKHIVNGFAVHTTPSQAEK-LKAAAGVKLVERDRGAKLMTTYTPEFLGLPQG  123

Query  424   VWPRLGGPSVS-GEGVVIGMIDTGINPFHASFSSPEEYNIGRPRI--TRKFTGKCITGDN  594
              W   GG   S GEG+VIG +D+GINP H SF+    Y+   P       F G C TG  
Sbjct  124   AWTHDGGDDRSAGEGIVIGFVDSGINPTHPSFA----YDPLHPFTGNISHFLGSCETGPR  179

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
             FPA++CN KIV A++F+  A AA   N +  + SPFDA GHGSH ASTAAGN   PV+ N
Sbjct  180   FPASSCNEKIVSAKFFSAGAEAAATLNSTVDFLSPFDAVGHGSHVASTAAGNAGVPVVMN  239

Query  775   RFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgD  954
              + YG ASGMAP A IAVYKA+Y   G ++DVV+A+DQA+ DGVDIL+LSVGP   P   
Sbjct  240   GYYYGEASGMAPRARIAVYKAVYPTVGTLTDVVSAIDQAILDGVDILTLSVGPDEPPEDT  299

Query  955   SAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVL  1134
               FL+  ++ +L A RAGV VVQA GN GP   S++S+SPW   VA+S TDR Y  SI+L
Sbjct  300   VTFLSAYDIAMLSARRAGVFVVQATGNQGPGISSVVSYSPWAVGVASSGTDRTYPGSILL  359

Query  1135  GNGQTFSGSGLSPPTAGKAFF--QLAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVR  1302
             GNG    G GLS PT G      +L  A D  + + T       VE CQ       ++V 
Sbjct  360   GNGTKIEGVGLSGPTFGYGLLLHKLVLAKDAVKADGTFPRTPPYVEECQYPEALDHNVVL  419

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             G +VICT++  F +  +++  + +T    G  GF+L   P  G        +   +PG++
Sbjct  420   GSIVICTFSEGFYNGTSTLTAIINTAKGLGFVGFILVASPVYG--DFIAEPIPFVVPGIL  477

Query  1483  INNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDV  1662
             + N+  S  + QYY   T +   G A  F A A I +GR A + GQ PVV+ +SSRGPD 
Sbjct  478   VPNLTNSQVILQYYERETHKEEKGFATRFAAKAAIGEGRVASFMGQAPVVSRFSSRGPDF  537

Query  1663  NNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAAL  1842
              N      DVLKP+I+APG  IWAAWSP S  +  + G  FAL SGTSMATPH+AGIAAL
Sbjct  538   VNTSRTPCDVLKPDILAPGHQIWAAWSPVSASEPTLTGYSFALQSGTSMATPHVAGIAAL  597

Query  1843  IKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasqqlapaTP-FDFGSGFINPSRAL  2019
             +K  +P+W PS I SA+ T+A   D+ G  ++A+ +       +  FDFG+G ++PSRAL
Sbjct  598   VKQYNPSWTPSMIASAISTTATKYDKNGELIMAEGSGIGSRYPSSHFDFGAGLVSPSRAL  657

Query  2020  NPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGS  2199
             +PGLV  + ++ YI FLC++P +   +VR   G  C  N     ++LN PS+TIS L GS
Sbjct  658   DPGLVLPSGYEDYINFLCSLPEISPAAVRNATGEPC-NNTLDHPANLNLPSITISALRGS  716

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
             + V R   NVG   E Y      P G  V + P  F I+ +G + L I +  T+A   ++
Sbjct  717   QIVRRIFNNVGSKPETYVCSAVSPNGTIVDLCPTWFRIAPEGIQELHIQVKVTQAMYDFT  776

Query  2380  FGEMILLGDRNHIVRVPFAVY  2442
             FGE++L G  NHIVR+P +V+
Sbjct  777   FGEIVLTGSLNHIVRIPLSVF  797



>ref|XP_007022969.1| Subtilase family protein isoform 2 [Theobroma cacao]
 gb|EOY25591.1| Subtilase family protein isoform 2 [Theobroma cacao]
Length=843

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/765 (44%), Positives = 469/765 (61%), Gaps = 21/765 (3%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
              ++ HD  L   LRR  Y KLYSY +L+NGFAV V +++A K+  + E V  +  D  + 
Sbjct  85    FSRVHDSILRRALRREKYLKLYSYHYLINGFAVLVTTEQAGKLSRRRE-VANVVLDFSVR  143

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS---SPEEYNIGRP  549
               TTHTP FLG+P   W + GG   +GEG+VIG IDTGI+P H SF+   S   Y     
Sbjct  144   TATTHTPQFLGLPKGAWSQEGGYETAGEGIVIGFIDTGIDPTHPSFADHVSDHSY-----  198

Query  550   RITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHT  729
              +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN S+ YASPFD DGHG+HT
Sbjct  199   PVPAHFSGICEVTRDFPSGSCNRKLVGARHFAASAITRGIFNSSQDYASPFDGDGHGTHT  258

Query  730   ASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgv  906
             AS AAGN+  PV+    ++G ASGMAP + IAVYKALY SFGG+ +DVVA +DQA +DGV
Sbjct  259   ASVAAGNHGIPVVVAGHHFGNASGMAPHSHIAVYKALYKSFGGFAADVVAGIDQAAQDGV  318

Query  907   dIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTS  1086
             DI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM SFSPW+ +
Sbjct  319   DIISLSITPNRRPPGIATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSMSSFSPWIFT  378

Query  1087  VAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVD-VCRRNSTAGLLTVES  1263
             + A++ DR Y+NSI+LGN  T  G GL+  T     + L +A+  +C   + A  + V  
Sbjct  379   IGAASHDRAYSNSIILGNNVTIPGVGLASGTDKDETYTLISALHALCNDTTLADDMYVGE  438

Query  1264  CQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQI  1443
             CQD+  F P L+ G L+IC+Y+  F    ++I     T     AAG V  MDP +   Q+
Sbjct  439   CQDSSNFNPELIEGNLLICSYSIRFVLGLSTIKLAVQTAKNLSAAGVVFYMDPFVIGFQL  498

Query  1444  KGATVTLQIPGLIINNMEASTALRQYYNSNTLRS-RSGRAVAFRATARILDGRRAIYSGQ  1620
                   L++PG+II + + S  L QYYNS+  R   + + + F A A I  G +A YS  
Sbjct  499   N--PTPLEMPGIIIPSPDDSKILLQYYNSSLERDGLTKKIIRFGAVASISGGLKANYSVS  556

Query  1621  GPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSG  1800
              P V  YS+RGPD  ++ LD AD++KPN++APG+ IWAAWS +       +G++FA++SG
Sbjct  557   APKVMYYSARGPDPEDSFLDDADIMKPNLIAPGNLIWAAWSSHGTDSVEFQGENFAMMSG  616

Query  1801  TSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlap  1968
             TSMA PHIAG+AALIK + P + P+AI SA+ T+A + D+      +           +P
Sbjct  617   TSMAAPHIAGLAALIKQKFPYFSPAAIASALSTTASLYDKSGGPIMAQRAYTNPDLNQSP  676

Query  1969  aTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKKF  2145
             ATPFD GSGF+N + AL+PGL+ ++ +  Y+ FLC + G     V    G  C   N   
Sbjct  677   ATPFDMGSGFVNATSALDPGLILDSTYDDYMSFLCGING-SGPVVLNYTGQNCWVYNSTI  735

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
               +DLN PS+TI+ L  S+TV+R VTN+ G +E Y+V    P GV + + P +FFI    
Sbjct  736   GSADLNLPSITIAKLNQSKTVLRSVTNIAG-NETYKVGWSAPYGVSMKVSPTHFFIGTGE  794

Query  2326  SRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQ  2460
              + L I+ NAT    S SFG + L G++ H + +P +V V  S +
Sbjct  795   KQVLTIIFNATMNNISASFGRIGLFGNQGHNISIPLSVIVKFSYK  839



>gb|KHG07654.1| Subtilisin-like protease [Gossypium arboreum]
Length=847

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/761 (45%), Positives = 465/761 (61%), Gaps = 17/761 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             +++ HD  L   LR   Y KLYSY +L+NGFAV V  ++A K+  + E V  +  D  + 
Sbjct  95    ISRVHDSLLRRALRGEKYLKLYSYHYLINGFAVLVTPEQANKLSKRRE-VANVVLDFSVR  153

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSP-EEYNIGRPRI  555
               TTHTP FLG+P   W + GG   +GEG+VIG IDTGI+P H SF+    E++   P  
Sbjct  154   TATTHTPQFLGLPKGAWSQQGGYETAGEGIVIGFIDTGIDPTHPSFADDISEHSYPVPA-  212

Query  556   TRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAS  735
                F+G C     FP+ +CN K+VGA++FA +AI  G FN S+ YASPFD DGHG+HTAS
Sbjct  213   --HFSGVCEVTREFPSGSCNRKLVGARHFAASAITRGIFNSSQDYASPFDGDGHGTHTAS  270

Query  736   TAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdI  912
              AAGN+  PV+    ++G ASGMAP + IAVYKALY SFGG+ +DVVA +DQA +DGVDI
Sbjct  271   VAAGNHGIPVVVAGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVAGIDQAAQDGVDI  330

Query  913   lslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVA  1092
             +SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM SFSPW+ +V 
Sbjct  331   ISLSITPNRRPPGIATFFNPIDMALLSAVKAGMFVVQAAGNTGPSPKSMSSFSPWIFTVG  390

Query  1093  ASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVD-VCRRNSTAGLLTVESCQ  1269
             A++ DR Y NSI+LGN  T  G GL+P T     + L +AV  +C     A  + V  CQ
Sbjct  391   AASHDRAYANSIILGNNVTIPGVGLAPGTDTDQMYTLISAVHALCNETILANDMYVGECQ  450

Query  1270  DAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKG  1449
             D+  F   L++G L+IC+Y+  F    ++I    +T     AAG V  MDP +   Q+  
Sbjct  451   DSSNFNEELIQGNLLICSYSIRFVLGLSTIKQALETAKNLSAAGVVFYMDPYVIGFQLN-  509

Query  1450  ATVTLQIPGLIINNMEASTALRQYYNSNTLRS-RSGRAVAFRATARILDGRRAIYSGQGP  1626
                 L+IPG+II + + S  L QYYNS+  R   S + V F A A I  G +A YS   P
Sbjct  510   -PTPLEIPGIIIPSPDDSKILLQYYNSSLERDGLSRKIVRFGAVASISGGLKANYSITAP  568

Query  1627  VVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTS  1806
              V  YS+RGPD  ++ LD ADV+KPN++APG+ IWAAWS         +G+ FA++SGTS
Sbjct  569   KVMYYSARGPDPEDSSLDDADVMKPNLVAPGNLIWAAWSSLGTDSVEFQGESFAMMSGTS  628

Query  1807  MATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaT  1974
             MA PHIAG+AALIK + P++ P+AI SA+ T+A + D+      +           +PAT
Sbjct  629   MAAPHIAGLAALIKQKFPHFSPAAIASALSTTASLYDKSGGPIMAQRAYANPDVNQSPAT  688

Query  1975  PFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKKFWC  2151
             PFD GSGF+N + AL+PGL+ ++ ++ Y+ FLC + G     V    G  C   N     
Sbjct  689   PFDMGSGFVNATAALDPGLILDSTYEDYMSFLCGING-SGPVVLNYTGQNCWVYNSTIGS  747

Query  2152  SDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
             +DLN PS+TIS L  S+TV R VTN+ G +E Y+V    P GV V + P  FFI     +
Sbjct  748   ADLNLPSITISRLQQSKTVERTVTNIAG-NETYKVGWSAPYGVSVKVTPTRFFIGTGEKQ  806

Query  2332  HLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTAS  2454
              L I+ NAT   +  SFG + L GD+ H + +P +V +  S
Sbjct  807   ILTIMFNATMNNSVASFGRIGLFGDQGHKLNIPLSVILKFS  847



>ref|XP_006398065.1| hypothetical protein EUTSA_v10000774mg [Eutrema salsugineum]
 gb|ESQ39518.1| hypothetical protein EUTSA_v10000774mg [Eutrema salsugineum]
Length=859

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/757 (44%), Positives = 469/757 (62%), Gaps = 16/757 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD FL   L+   Y KLYSY +L+NGFAV V S +A K+  ++E V  I  D  + 
Sbjct  102   IAQTHDSFLRKTLKGEKYIKLYSYNYLINGFAVFVSSQQAEKLSKRSE-VANIVLDFSVR  160

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPE--EYNIGRPR  552
               TT+TP F+G+P+  W + GG  ++GEG+VIG IDTGI+P H SF+  +   ++   P 
Sbjct  161   TATTYTPQFMGLPEGAWAKEGGFKIAGEGIVIGFIDTGIDPNHPSFNDNDINSHHSSYPT  220

Query  553   ITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTA  732
               + F+G C    +FP+ +CN K++GA++FA++AI  G FN S  YASPFD DGHG+HTA
Sbjct  221   -PKHFSGVCEVTPDFPSGSCNKKLIGARHFAQSAITRGIFNSSEDYASPFDGDGHGTHTA  279

Query  733   STAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvd  909
             S AAGN+  PVI +  N+G ASG+AP A I+VYKALY SFGG+ +DVVAA+DQA +DGVD
Sbjct  280   SIAAGNHGVPVIVSNHNFGNASGIAPRAYISVYKALYKSFGGFAADVVAAIDQAAQDGVD  339

Query  910   IlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSV  1089
             ILSLS+ P+  P G + F N +++ +L A ++G+ VVQAAGN+GPS +SM SFSPW+ +V
Sbjct  340   ILSLSITPNRKPPGVATFFNPIDMAILSAVKSGIFVVQAAGNTGPSPKSMSSFSPWIFTV  399

Query  1090  AASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVESC  1266
              AS+ DR Y+NSI+LGN  T  G G + PT     +++ +A      +++    + V  C
Sbjct  400   GASSHDRVYSNSIILGNNVTIPGLGFAIPTDDGKMYKMVSAFHALNNSTSVDKDMYVGEC  459

Query  1267  QDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIK  1446
             QD   F   LV G L++C+Y+  F    ++I    D      A G V  MDP +   QI 
Sbjct  460   QDYENFDQKLVSGSLLMCSYSVRFILGLSTIKQALDVAKNLSAVGVVFYMDPYVLGFQIN  519

Query  1447  GATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIYSGQG  1623
                  + +PG+II + E S  L +YYNS+  R  + +  V F A A I  G +A +S + 
Sbjct  520   --PTPMDMPGIIIPSAEDSKILLKYYNSSVQRDVTTKEIVGFGAFAAIEGGLKASFSDRA  577

Query  1624  PVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGT  1803
             P V  YS+RGPD  +   + AD+LKPN++APG+SIW AWS  S      KG+ FA++SGT
Sbjct  578   PKVMYYSARGPDPEDNSFNDADILKPNLVAPGNSIWGAWSSASIDSPEFKGERFAMMSGT  637

Query  1804  SMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTD----Rlgspllaqqasqqlapa  1971
             SMA PH+AG+AALIK  +P + PSAI SA+ T+A + D     +          Q L+ A
Sbjct  638   SMAAPHVAGVAALIKQTYPQFSPSAIASALSTTALLNDIKGGPIMVQRTFSNPDQSLSNA  697

Query  1972  TPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWC  2151
             TPFD GSGF+N + AL+PGL+F+T F+ Y+ FLC + G D   V    G+ C +N K   
Sbjct  698   TPFDMGSGFVNATAALDPGLIFDTSFEDYMSFLCGINGSDS-VVFNYTGISCSDNNKTMS  756

Query  2152  S-DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGS  2328
               DLN PS+T+S L G++ V R + N+GG +E Y V    P GV + + P  F I+   +
Sbjct  757   GFDLNLPSITVSTLNGTQFVQRSMRNIGG-NETYNVGWSPPYGVSMKVDPTQFSIAMGDT  815

Query  2329  RHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             + L + L A K ++S SFG + L G+  HIV +P +V
Sbjct  816   QVLSVTLKAIKNSSSSSFGRIGLFGNTGHIVNIPVSV  852



>ref|XP_003528700.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=819

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/800 (42%), Positives = 479/800 (60%), Gaps = 33/800 (4%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFVSTRIKGTSGNVT-------------MYKQRMTKQHDVFLGSLLRR  243
             E  IY+VL+E         +G+    +              +   +   HD+ L S L  
Sbjct  27    ERSIYLVLLEGDALAFHDHEGSQDQDSSTIHPNTNREASKAHTNHLLASHDLLLQSSLEN  86

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
              +Y KL+SY H++NGF+VH    +A + L ++ GV+ + +D   +  TT+TP+FL +   
Sbjct  87    GSYNKLHSYKHIINGFSVHTTPSQAAR-LRRSPGVKLVEKDRGAKMRTTYTPEFLSLRKG  145

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFS----SPEEYNIGRPRITRKFTGKCITGD  591
             +W + GG   +GEGVVIG +D+GIN  H SF+     P   N+ R      F G C TG 
Sbjct  146   IWAQEGGERNAGEGVVIGFVDSGINALHPSFAYDPMHPFSSNLSR------FEGACETGP  199

Query  592   NFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVIT  771
              FP ++CNGKIV A++F+  A A    N S  + SPFDADGHGSH AS AAGN    V+ 
Sbjct  200   LFPPSSCNGKIVAARFFSAGAEATVTLNASMDFLSPFDADGHGSHVASVAAGNAGVSVVV  259

Query  772   NRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsg  951
             N F YG ASGMAP A IAVYKA++   G ++DV+AA+DQAV DGVDILSLSVGP+  P  
Sbjct  260   NGFFYGKASGMAPRARIAVYKAIFPSVGTLADVIAAIDQAVLDGVDILSLSVGPNEPPES  319

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
                FL++ ++ LLFA +AGV VVQAAGN GP+S S++SFSPW   VAA TTDRRY  S++
Sbjct  320   TVTFLSMFDISLLFARKAGVFVVQAAGNKGPASSSVVSFSPWSVGVAACTTDRRYPASLL  379

Query  1132  LGNGQTFSGSGLSPPT--AGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRG  1305
             LGNG   +G+GLS PT   G    +L  A D  + N T     +E CQ      P++V G
Sbjct  380   LGNGSVLNGAGLSGPTFGNGSVLHKLVLAKDAVKINGTTQEY-IEECQHPEVLDPNIVLG  438

Query  1306  KLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLII  1485
              ++ICT++  F +  +++  +  T    G  GF+L  +P+ G        +   + G++I
Sbjct  439   SIIICTFSTGFNNGTSTLNAIIGTSKALGLEGFILVANPNYG--DYIAEPIPFAVSGIMI  496

Query  1486  NNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVN  1665
               ++ +  + QYY     R R G A  F A A + +GR A ++G+ P+V+ +SSRGPD+ 
Sbjct  497   PRVDDAKVILQYYEEQIKRDRKGTATEFGAMAAVGEGRVASFTGRSPIVSRFSSRGPDII  556

Query  1666  NALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALI  1845
             +   + ADVLKP+I+APG  IWAAW+P S  +  +KG  FAL+SGTSM+TPH+AGIAALI
Sbjct  557   DMHNNLADVLKPDILAPGHQIWAAWTPISALEPMLKGHDFALLSGTSMSTPHVAGIAALI  616

Query  1846  KDRHPNWKPSAITSAMMTSADVTDRl-gspllaqqasqqlapaTPFDFGSGFINPSRALN  2022
             K  +P W P+ I SA+ T++   D L    +     +  L P+TPF++G+GF++P+ A++
Sbjct  617   KQYNPLWTPAMIASAISTTSSKYDNLGEHMMAEGFEASSLLPSTPFEYGAGFVSPNCAID  676

Query  2023  PGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF-WCSDLNTPSVTISNLVGS  2199
             PGLV ++  Q +I FLC++P +D  ++    G +C  N  F +   LN PSVTIS L GS
Sbjct  677   PGLVLSSEHQDFISFLCSLPNMDTDAIIAATGEQC--NHPFAYPFSLNIPSVTISALRGS  734

Query  2200  RTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYS  2379
              +V R   +VG   E Y   V+ P G +V + P  F IS  G++ L I L+  +  ++++
Sbjct  735   VSVWRTFMSVGNNTETYLASVQPPNGTKVYLYPTWFTISPQGTQDLEIQLSVIQPMSNFT  794

Query  2380  FGEMILLGDRNHIVRVPFAV  2439
             FGE++L G+ NHIVR+  +V
Sbjct  795   FGEIVLTGNLNHIVRITLSV  814



>gb|KHN35712.1| Subtilisin-like protease, partial [Glycine soja]
Length=757

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/759 (43%), Positives = 467/759 (62%), Gaps = 20/759 (3%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             +   +   HD+ L S L   +Y KL+SY H++NGF+VH    +A + L ++ GV+ + +D
Sbjct  6     HTNHLLASHDLLLQSSLENGSYNKLHSYKHIINGFSVHTTPSQAAR-LRRSPGVKLVEKD  64

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS----SPEEY  534
                +  TT+TP+FL +   +W + GG   +GEGVVIG +D+GIN  H SF+     P   
Sbjct  65    RGAKMRTTYTPEFLSLRKGIWAQEGGERNAGEGVVIGFVDSGINALHPSFAYDPMHPFSS  124

Query  535   NIGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADG  714
             N+ R      F G C TG  FP ++CNGKIV A++F+  A A    N S  + SPFDADG
Sbjct  125   NLSR------FEGACETGPLFPPSSCNGKIVAARFFSAGAEATVTLNASMDFLSPFDADG  178

Query  715   HGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqav  894
             HGSH AS AAGN    V+ N F YG ASGMAP A IAVYKA++   G ++DV+AA+DQAV
Sbjct  179   HGSHVASVAAGNAGVSVVVNGFFYGKASGMAPRARIAVYKAIFPSVGTLADVIAAIDQAV  238

Query  895   edgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSP  1074
              DGVDILSLSVGP+  P     FL++ ++ LLFA +AGV VVQAAGN GP+S S++SFSP
Sbjct  239   LDGVDILSLSVGPNEPPESTVTFLSMFDISLLFARKAGVFVVQAAGNKGPASSSVVSFSP  298

Query  1075  WVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPT--AGKAFFQLAAAVDVCRRNSTAGL  1248
             W   VAA TTDRRY  S++LGNG   +G+GLS PT   G    +L  A D  + N T   
Sbjct  299   WSVGVAACTTDRRYPASLLLGNGSVLNGAGLSGPTFGNGSVLHKLVLAKDAVKINGTTQE  358

Query  1249  LTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDI  1428
               +E CQ      P++V G ++ICT++  F +  +++  +  T    G  GF+L  +P+ 
Sbjct  359   Y-IEECQHPEVLDPNIVLGSIIICTFSTGFNNGTSTLNAIIGTSKALGLEGFILVANPNY  417

Query  1429  GSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAI  1608
             G        +   + G++I  ++ +  + QYY     R R G A  F A A + +GR A 
Sbjct  418   G--DYIAEPIPFAVSGIMIPRVDDAKVILQYYEEQIKRDRKGTATEFGAMAAVGEGRVAS  475

Query  1609  YSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFA  1788
             ++G+ P+V+ +SSRGPD+ +   + ADVLKP+I+APG  IWAAW+P S  +  +KG  FA
Sbjct  476   FTGRSPIVSRFSSRGPDIIDMHNNLADVLKPDILAPGHQIWAAWTPISALEPMLKGHDFA  535

Query  1789  LVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl-gspllaqqasqqla  1965
             L+SGTSM+TPH+AGIAALIK  +P W P+ I SA+ T++   D L    +     +  L 
Sbjct  536   LLSGTSMSTPHVAGIAALIKQYNPLWTPAMIASAISTTSSKYDNLGEHMMAEGFEASSLL  595

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF  2145
             P+TPF++G+GF++P+ A++PGLV ++  + +I FLC++P +D  ++    G +C  N  F
Sbjct  596   PSTPFEYGAGFVSPNCAIDPGLVLSSEHEDFISFLCSLPNMDTDAIIAATGEQC--NHPF  653

Query  2146  -WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISAD  2322
              +   LN PSVTIS L GS +V R   +VG   E Y   V+ P G +V + P  F IS  
Sbjct  654   AYPFSLNIPSVTISALRGSVSVWRTFMSVGNNTETYLASVQPPNGTKVYLYPTWFTISPQ  713

Query  2323  GSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             G++ L I L+  +  ++++FGE++L G+ NHIVR+  +V
Sbjct  714   GTQDLEIQLSVIQPMSNFTFGEIVLTGNLNHIVRITLSV  752



>ref|XP_010036631.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW48241.1| hypothetical protein EUGRSUZ_K01967 [Eucalyptus grandis]
Length=845

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/759 (45%), Positives = 472/759 (62%), Gaps = 19/759 (3%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD  L  +L+   Y KLYSY +L+NGFAV V   +A K+  + E V  +  D  + 
Sbjct  87    IARVHDSLLKKVLKGEKYLKLYSYHYLINGFAVLVTPQQADKLSQRTE-VANVVLDFSVR  145

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPR-I  555
               TTHTP FLG+P+  W + GG   +GEGVVIG IDTGI+P H SF+        RP  +
Sbjct  146   TATTHTPQFLGLPNGAWAQRGGYDSAGEGVVIGFIDTGIDPTHPSFADDVS---DRPYPV  202

Query  556   TRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAS  735
                ++G C    +FP+ +CN K+VGA++FA +AI  G FN S+ YASPFD DGHG+HTAS
Sbjct  203   PAHYSGICEVTPDFPSGSCNRKLVGARHFAASAITRGIFNASQDYASPFDGDGHGTHTAS  262

Query  736   TAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdI  912
              AAGN+  PVI +  ++G ASGMAP + IAVYK+LY SFGG+ +DVVAA+DQA +DGVDI
Sbjct  263   VAAGNHGIPVIVSGHHFGNASGMAPRSHIAVYKSLYKSFGGFAADVVAAIDQAAQDGVDI  322

Query  913   lslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVA  1092
             +SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GP+ +S+ SFSPW+ +V 
Sbjct  323   ISLSITPNRRPPGIATFFNPIDMALLSAVKAGIFVVQAAGNTGPAPKSVSSFSPWIFTVG  382

Query  1093  ASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRN-STAGLLTVESCQ  1269
             A+  DR Y NSIVLGN ++ +G GL+P T     ++L +A+DV   + S +  + V  CQ
Sbjct  383   AAAHDRVYQNSIVLGNNRSIAGVGLAPGTDKDTMYKLVSALDVLNNDTSISKDMYVGECQ  442

Query  1270  DAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKG  1449
             D+  F P  V+G L+IC+Y+  F    ++I    +T +   AAG V  MDP +   Q+  
Sbjct  443   DSTNFDPDHVQGNLLICSYSIRFVLGLSTIQQALETANNLSAAGIVFYMDPFVIGFQLN-  501

Query  1450  ATVTLQIPGLIINNMEASTALRQYYNSNTLRS-RSGRAVAFRATARILDGRRAIYSGQGP  1626
                 L++PG+II   + S  L QYYNS+  R  ++ + V F ATA IL G +A YS   P
Sbjct  502   -PTPLKMPGIIIPTSDDSKILLQYYNSSVERDGQTKQVVTFGATASILGGLKANYSFSAP  560

Query  1627  VVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTS  1806
              V  YS+RGPD  ++ L  AD+LKPN++APG+ IWAAWS         +G++FA++SGTS
Sbjct  561   KVMYYSARGPDPEDSSLTNADILKPNLVAPGNFIWAAWSSVGTDSMEFEGENFAMMSGTS  620

Query  1807  MATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaT  1974
             MA PHIAG+AALIK   P++ PSAI SA+ T+A + D+      +        Q  +PAT
Sbjct  621   MAAPHIAGLAALIKQNFPSFSPSAIASALSTTASLYDKNGGPIMAQRAYANPDQNQSPAT  680

Query  1975  PFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKKFWC  2151
             PFD GSGF+N + ALNPGL+ ++ +  Y+ FLC + G     V    G  C   N     
Sbjct  681   PFDMGSGFVNATAALNPGLILDSSYDDYMSFLCGING-SAPIVWNYTGQSCWAYNNTISG  739

Query  2152  SDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
             +DLN PS+TI  L  SRTV R VTN+ G +E Y V    P GV + + P  F I A+G R
Sbjct  740   ADLNLPSITIVTLNSSRTVQRTVTNIAG-NETYSVGWSAPYGVSMKVAPTRFTI-ANGQR  797

Query  2332  HLIIV-LNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
              ++ V  NAT  ++S +FG + L G + H   +P +V V
Sbjct  798   QVLSVSFNATINSSSATFGRIGLFGTQGHAANIPLSVMV  836



>ref|XP_009115124.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=836

 Score =   554 bits (1427),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 339/807 (42%), Positives = 483/807 (60%), Gaps = 36/807 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFV---------STRIKGTSGNVTMYKQR-----MTKQHDVFLGSL  234
             ++ + +Y+V ++D P V         +++   TS +   Y+       + + HD  L  +
Sbjct  34    LSSSAVYIVTLKDPPSVHSSSGRETDASKHSLTSTSSQTYRTSNRSAYLIRVHDSLLRKV  93

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
             LR+  Y KLYSY +L+NGF+  +   +A ++  + E V  +  D  ++K TTHTP FLG+
Sbjct  94    LRKENYIKLYSYHYLINGFSAVITQQQAERLAARKE-VHNVVLDYPVKKATTHTPQFLGL  152

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSS--PEEYNIGRPRITRKFTGKCITG  588
             P   WPR GG   +GEGVVIG IDTGI+P H SFS   P       PR    FTG C   
Sbjct  153   PRGAWPREGGSEYAGEGVVIGFIDTGIDPTHPSFSDKVPGHSYPVPPR----FTGVCEVT  208

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
               FP+ +CN K+VGA++FA +A++ G  N S+  ASPFD +GHG+HTAS AAGN+  PV+
Sbjct  209   TGFPSGSCNRKLVGARHFAESALSRGVLNSSQDDASPFDGEGHGTHTASVAAGNHGVPVV  268

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssvp  945
                   G ASGMAP A +A+YKALY  FGG+ +D++AA+DQA +DGVDI++LS+ P+  P
Sbjct  269   VCGHRLGNASGMAPRAHVAIYKALYKRFGGFAADIIAAIDQAAQDGVDIINLSITPNRRP  328

Query  946   sgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNS  1125
              G + F N +++ LL A +AG+ VVQAAGN+GP+ +SM SFSPW+ +V A++ DR YTNS
Sbjct  329   PGIATFFNPIDMALLSAVKAGIFVVQAAGNTGPAPKSMSSFSPWIFTVGATSHDRVYTNS  388

Query  1126  IVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVESCQDAMQFVPSLVR  1302
             I+LGN  T SG GL+  T  +   +L  A    R  +T    + V  CQD+  +   LV+
Sbjct  389   IILGNNVTISGVGLASGT--RTMHKLVLAAHALRNGTTIMDAIYVGECQDSSSYDQKLVQ  446

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             GK+++C+YT  F    +++     T     AAG V  MDP   S   +  +  + IPG++
Sbjct  447   GKILVCSYTVRFILGVSTVKQALITAKNLTAAGLVFYMDPS--STGFQMTSTPMDIPGIL  504

Query  1483  INNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPD  1659
             I++ + S AL QYYN++  R   SG+ V   + ARI+ G +  Y    P V  +S+RGPD
Sbjct  505   ISSPQDSLALLQYYNTSLSRDNASGKIVGSASVARIVGGMKPTYGITAPKVMYFSARGPD  564

Query  1660  VNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAA  1839
               +     ADV+KPN++APG+SIW AWSP   G    +G+ FA+ SGTSM+ PH+ GIAA
Sbjct  565   PEDDSFQDADVMKPNLVAPGNSIWGAWSPLGIGTADFQGERFAMESGTSMSAPHVTGIAA  624

Query  1840  LIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINP  2007
             LIK + P++ P+AI SA+ T+A +TDR      +            PATPFD GSGF+N 
Sbjct  625   LIKQKFPHFTPAAIASALSTTASLTDRKGGPIMAQRTVLNPDATQTPATPFDMGSGFVNA  684

Query  2008  SRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPE-NKKFWCSDLNTPSVTIS  2184
             + AL+PGL+F+  + +Y++FLC + G     V    G  C   N     SDLN PSVTI+
Sbjct  685   TAALDPGLIFDIGYNEYMKFLCGING-SSPVVLNYTGESCSAYNSSLAASDLNLPSVTIA  743

Query  2185  NLVGSRTVMRRVTNVGG--ADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNAT  2358
              LVG+RTV+R VTN+    A+E Y V  + P  V V + P  F I    +R L +V  A 
Sbjct  744   KLVGTRTVLRWVTNIAATVANETYTVGWKAPDSVSVKVSPAKFTIGNGQTRVLSLVFGAI  803

Query  2359  KATNSYSFGEMILLGDRNHIVRVPFAV  2439
             K  +  SFG++ ++GDR H+V +P  V
Sbjct  804   KNGSVASFGKIGMVGDRGHVVNIPVTV  830



>ref|XP_006449795.1| hypothetical protein CICLE_v10014290mg [Citrus clementina]
 gb|ESR63035.1| hypothetical protein CICLE_v10014290mg [Citrus clementina]
Length=819

 Score =   553 bits (1424),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 344/791 (43%), Positives = 469/791 (59%), Gaps = 20/791 (3%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV---STRIKGTSGNVTMYK---QRMTKQHDVFLGSLLRRSAYTKLY  264
             E  IY+VL+E  P     S   +    N   YK   +R+   HD  L S L   +Y KLY
Sbjct  31    ERDIYLVLIEGEPLAFHGSDDKRRFDLNSDAYKGQAKRLMDSHDRILQSTLEIGSYNKLY  90

Query  265   SYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGG  444
             S+ + +NGFAVH+   +A K L  A  V+ +  D + + MT++TP FLG+P  VW + GG
Sbjct  91    SFKYTVNGFAVHLTPTQAKK-LENAPQVKLVERDRRAKLMTSYTPQFLGLPQGVWTQRGG  149

Query  445   PSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKI  624
                +GEG+VIG +DTGINP H SF++   YN   P I+  F+G C TG  FP ++CNGKI
Sbjct  150   DKNAGEGIVIGFVDTGINPSHPSFAN---YNPFEPNISH-FSGDCETGPRFPLSSCNGKI  205

Query  625   VGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGM  804
             V A++F+  A A    N S  + SPFDA GHGSH ASTAAGN   PV+ + F YG ASGM
Sbjct  206   VSARFFSAGAQAVATLNTSVDFLSPFDAVGHGSHVASTAAGNAGVPVVVDGFFYGLASGM  265

Query  805   APGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQ  984
             AP A IAVYKA+Y   G ++DV+AA+DQA  DGVDIL+LS+GP   P      L + +V 
Sbjct  266   APCARIAVYKAMYPTVGTLADVIAAIDQATMDGVDILTLSIGPDEPPRDTITMLGIFDVL  325

Query  985   LLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSG  1164
             +LFA RAGV VVQAAGN GP+  +++S+SPW  + AA TTDR Y  S++LGNG    G G
Sbjct  326   MLFARRAGVFVVQAAGNQGPAPSTVVSYSPWAVAAAACTTDRIYPGSLLLGNGLKLGGVG  385

Query  1165  LSPPTAGKAFF--QLAAAVDVCRRNSTAGLLT---VESCQDAMQFVPSLVRGKLVICTYT  1329
             LS PT G+  F  +L  A DV  R +     T   +E CQ    F PSL +G +VICT++
Sbjct  386   LSGPTCGRPLFLSKLVLARDVILRVNGTFPRTPQYIEECQYPEAFEPSLAQGSVVICTFS  445

Query  1330  YDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTA  1509
               F ++ +++  V +T    G  GF+L  +   G        +   +PG++I  +  S  
Sbjct  446   DGFYNQTSTLTAVINTAITLGFMGFILIANSHYG--DFVAEPIPFAVPGILIPKVSTSEI  503

Query  1510  LRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTAD  1689
             + QYY   T R   G A+ F A A I +GR A + G+ P+V+ +SSRGPD  +   +  D
Sbjct  504   ILQYYEQQTHRDERGVAIKFNAQAGIGEGRVASFEGRAPIVSRFSSRGPDFTDLSRNPTD  563

Query  1690  VLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWK  1869
             VLKP++ APG  IWAAWSP S  D  + G +FAL+SGTSMATPHIAGIAALIK  +P+W 
Sbjct  564   VLKPDVTAPGHQIWAAWSPVSALDPMLTGCNFALLSGTSMATPHIAGIAALIKQHNPSWT  623

Query  1870  PSAITSAMMTSADVTDRl-gspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTY  2046
             P+ I SA+ ++A   D      +           +T FDFGSG ++ +RAL+PGLV +  
Sbjct  624   PTMIASAISSTATKYDNYGQLIMAEGFEITSTYNSTHFDFGSGLVSATRALDPGLVLSVE  683

Query  2047  FQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTN  2226
             F+ YI FLC++   D  S++   G+ C  +     ++LN PSVT+S +  S  + R + N
Sbjct  684   FEDYISFLCSLADTDPVSIKAATGIWCNHSLSH-PANLNLPSVTVSAVAKSLILQRSLKN  742

Query  2227  VGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGD  2406
             VG   E Y   V  P G  V++ P  F I+  G++ L I  N T+A   +SFGE++L G 
Sbjct  743   VGNKTETYLTSVVHPNGTTVSLYPPWFTIAPQGTQDLAIQFNVTQAIGDFSFGEIVLTGS  802

Query  2407  RNHIVRVPFAV  2439
              NH VR+P +V
Sbjct  803   LNHTVRIPLSV  813



>ref|XP_006468393.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=858

 Score =   553 bits (1426),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 336/756 (44%), Positives = 470/756 (62%), Gaps = 19/756 (3%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             +++ HD  L    +   Y KLYSY +L+NGF+V V   +A K+  + E V  +  D  + 
Sbjct  101   ISRVHDSILRRAFKGEKYLKLYSYHYLINGFSVFVTPQQAEKLSRRRE-VANVVSDFSVR  159

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSS-PEEYNIGRPRI  555
               TTHTP FLG+P   W + GG   +GEGVVIG IDTGI+P H SF+    E++   P  
Sbjct  160   TATTHTPQFLGLPQGAWIQEGGYETAGEGVVIGFIDTGIDPTHPSFADDASEHSYPVPS-  218

Query  556   TRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAS  735
                F+G C    +FP+ +CN K++GA++FA +AI  G FN S+ YASPFD DGHGSHTAS
Sbjct  219   --HFSGICEVTRDFPSGSCNRKLIGARHFAASAITRGIFNSSQDYASPFDGDGHGSHTAS  276

Query  736   TAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdI  912
              AAGN+  PV+    ++G ASGMAP + IAVYKALY SFGG+ +DVVAA+DQA +DGVDI
Sbjct  277   VAAGNHGIPVVVTGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVAAIDQAAQDGVDI  336

Query  913   lslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVA  1092
             +SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM SFSPW+ +V 
Sbjct  337   ISLSITPNRRPPGIATFFNPIDMALLSAAKAGIFVVQAAGNTGPSPKSMSSFSPWIFTVG  396

Query  1093  ASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA-GLLTVESCQ  1269
             A++ DR YTNSI+LGN  T SG GL+P T     + L +A+     N+T    + V  CQ
Sbjct  397   AASHDRIYTNSIILGNSLTISGVGLAPGT--DKMYTLISALHALNNNTTTTDDMYVGECQ  454

Query  1270  DAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKG  1449
             D+  F   LV+G L+IC+Y+  F    ++I    +T     AAG V  MDP +   Q+  
Sbjct  455   DSSNFNQDLVQGNLLICSYSIRFVLGLSTIKQAFETAKNLSAAGIVFYMDPFVIGFQLN-  513

Query  1450  ATVTLQIPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGP  1626
                 +++PG+II + + S  L QYYNS+  R   + + + F A A IL G +A +S   P
Sbjct  514   -PTPMKMPGIIIPSPDDSKILLQYYNSSLERDEVTKKIIKFGAVACILGGLKANFSNSAP  572

Query  1627  VVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTS  1806
              +  YS+RGPD  ++ LD AD++KPN++APG+SIWAAWS         +G+ FA++SGTS
Sbjct  573   KIMYYSARGPDPEDSFLDDADIMKPNLVAPGNSIWAAWSSLGTDSVEFQGESFAMMSGTS  632

Query  1807  MATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaT  1974
             MA PHIAG+AALIK + P++ PSAI SA+ TSA + D+      +     +  +  +PAT
Sbjct  633   MAAPHIAGLAALIKQKFPSFSPSAIASALSTSATLYDKNGGPIMAQRAYAKPDENQSPAT  692

Query  1975  PFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKKFWC  2151
             PFD GSGF+N + +L+PGLVF+  +  Y+ FLC + G     V    G  C   N     
Sbjct  693   PFDMGSGFVNATASLDPGLVFDASYNDYMSFLCGING-SSPVVLNYTGQNCWAYNSTISG  751

Query  2152  SDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
             +DLN PS+TI+ L  SRTV R +TN+ G +E Y V    P GV + + P +F I++   +
Sbjct  752   ADLNLPSITIARLNQSRTVQRTLTNIAG-NETYSVGWSAPFGVSMKVSPTHFSIASGEKQ  810

Query  2332  HLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              L +  NAT +  + SFG + L G++ HIV +P +V
Sbjct  811   VLNVFFNATTSGTAASFGRIGLFGNQGHIVNIPLSV  846



>gb|EEC81259.1| hypothetical protein OsI_24350 [Oryza sativa Indica Group]
Length=883

 Score =   554 bits (1427),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 350/795 (44%), Positives = 469/795 (59%), Gaps = 39/795 (5%)
 Frame = +1

Query  112   IYMVLMEDHPFVSTR----------------IKGTSGNVTMYKQRMTKQHDVFLGSLLRR  243
             +Y+V ME  P VS R                ++ TS  VT Y   + + HD  L SLL  
Sbjct  99    VYIVTMEGEPVVSYRGGVEGFPATAIDLDEDMEITSEAVTSYSLHLRRYHDKLLDSLLVE  158

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
               Y KLYSY HL+NGFAVH+   +A + L KA GV+ +  D+K++K+TTHTP FLG+P  
Sbjct  159   GTYEKLYSYHHLINGFAVHMSPLQA-EFLRKAPGVKHVERDMKIQKLTTHTPQFLGLPTG  217

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPA  603
             VWP  GG   +GE VVIG +D+GI P H SFS+ +    G       + GKC        
Sbjct  218   VWPTGGGFDRAGEDVVIGFVDSGIYPQHPSFSAHKTDPFGP---VPHYKGKCEMDPVTRR  274

Query  604   TACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFN  783
             + CNGKIVGAQ+FA+AAIAAG FN    +ASP D DGHGSHTA+ AAGN   PV  +   
Sbjct  275   SFCNGKIVGAQHFAKAAIAAGAFNPDVDFASPLDGDGHGSHTAAIAAGNNGIPVRMHGHE  334

Query  784   YGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-gpssvpsgDS  957
             +G ASGMAP A IAVYK LY  FGGY+SDVVAA+DQAV+DGVDIL+LSV   S   +  +
Sbjct  335   FGKASGMAPRARIAVYKVLYRLFGGYVSDVVAAIDQAVQDGVDILNLSVGPNSPPTATRT  394

Query  958   AFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLG  1137
              FLN  +  LL A +AGV V QAAGN GP  ++++SFSPW+T+VAA   DRRY N +VLG
Sbjct  395   TFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAGVDDRRYKNHLVLG  454

Query  1138  NGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVI  1317
             NG+   G G+SP T     F L +A D     S+A   +   CQ         ++GK+++
Sbjct  455   NGKLLPGLGVSPATHENKSFSLISAADALL-GSSATKYSALDCQRPELLNKRKIQGKILL  513

Query  1318  CTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNME  1497
             C Y++++ S  ASI  V++T    GAAGF++ ++      +     V + +PG++I ++ 
Sbjct  514   CGYSFNYISGTASIKKVSETARSLGAAGFIVAVENSYPGTKFD--PVPVSMPGILITDVS  571

Query  1498  ASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALL  1677
              +  L  YYNS+T+R  +GRA  F+ATA I DG         P VA +SSRGPDV +   
Sbjct  572   RTKDLIDYYNSSTIRDWAGRATTFQATAAIADGLAPTLYNSAPQVALFSSRGPDVKDFSF  631

Query  1678  DTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRH  1857
               ADVLKP+I+APG+ IWAAW+PN   +    G+ FA+VSGTSMA PHIAGIAALIK ++
Sbjct  632   QDADVLKPDILAPGNLIWAAWAPNGTDEANYAGEGFAMVSGTSMAAPHIAGIAALIKQKN  691

Query  1858  PNWKPSAITSAMMTSADVTDRlg----spllaqqasqqlapaTPFDFGSGFINPSRALNP  2025
             P W PSAI SA+MT+++  D+      +   +      L  ATPFD+GSG +NP  AL+P
Sbjct  692   PKWSPSAIKSALMTTSNTLDKGSHPLRAQQYSTSEIMTLTRATPFDYGSGAVNPKAALDP  751

Query  2026  GLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRT  2205
              L    ++ Q I+            VR +         +    DLN PS+TIS L G++T
Sbjct  752   AL----FWMQLIKI------TSHFCVRSLTWNTVNSKVQQRPYDLNIPSITISQLRGTQT  801

Query  2206  VMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFG  2385
             V R VT+V    E Y ++ R    + + + P    +    SR +   L A   T +YSFG
Sbjct  802   VKRTVTSVAAEAETYTIMTRMSPEIALEVSPPALTVLPGASREITATLTARSVTGTYSFG  861

Query  2386  EMILLGDRNHIVRVP  2430
             E+ + GDR H+VR+P
Sbjct  862   EITMKGDRGHLVRIP  876



>ref|XP_002317684.2| subtilase family protein [Populus trichocarpa]
 gb|EEE98296.2| subtilase family protein [Populus trichocarpa]
Length=840

 Score =   553 bits (1424),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 327/757 (43%), Positives = 466/757 (62%), Gaps = 15/757 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD  L  +LR   Y KLYSY +L+NGFAV V  ++A K+  + E V  +  D  + 
Sbjct  81    VARVHDSLLRRVLRGEKYLKLYSYHYLINGFAVLVTPEQAFKLSRRRE-VANVALDFSVR  139

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TTHTP FLG+P   W + GG   +GEG+VIG +DTGI+P H SF+  ++ ++    + 
Sbjct  140   TATTHTPQFLGLPQGAWVKAGGYETAGEGIVIGFVDTGIDPTHPSFA--DDISLNSYPVP  197

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
               F+G C    +FP+ +CN K++GA++FA +AI  G FN S  YASPFD DGHG+HTAS 
Sbjct  198   SHFSGICEVTRDFPSGSCNRKLIGARHFAASAITRGIFNSSLDYASPFDGDGHGTHTASV  257

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI     +G ASGMAP A ++VYKALY SFGG+ +DVVAA+DQA +DGVD+L
Sbjct  258   AAGNHGIPVIVAGHCFGNASGMAPRAHVSVYKALYKSFGGFAADVVAAIDQAAQDGVDVL  317

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ LL A +AG+ +VQAAGN+GPS +SM SFSPW+ +V A
Sbjct  318   SLSITPNRRPPGIATFFNPIDMALLSAVKAGIFIVQAAGNTGPSPKSMSSFSPWIFTVGA  377

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVESCQD  1272
             ++ DR Y+NSI+LGN  T  G GL+P T       L +A+      +T    + V  CQD
Sbjct  378   ASHDRVYSNSIILGNNVTIHGVGLAPGTDEDTMLTLVSALHAVNNETTVTTDMYVGECQD  437

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
             +  F    + G L+IC+Y+  F    ++I    +T     AAG V  MDP +   Q+   
Sbjct  438   SSTFNQDFIEGNLLICSYSIRFVLGLSTIKQAVETAKNLSAAGVVFYMDPFVIGYQLN--  495

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVA-FRATARILDGRRAIYSGQGPV  1629
              + + +PG+II + + S  L QYYNS+  R+ + + +  F A A IL G +A YS   P 
Sbjct  496   PIPMSVPGIIIPSPDDSKVLLQYYNSSLERNGTTKQITKFGAVASILGGLKANYSNSAPK  555

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  ++ LD AD+LKPN++APG+SIWAAWS         +G++FA++SGTSM
Sbjct  556   VVYYSARGPDPEDSFLDDADILKPNLVAPGNSIWAAWSSLGTDSVEFQGENFAMMSGTSM  615

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTP  1977
             A PHIAG+AALIK + P++ PSAI SA+ ++A + D       +           +PATP
Sbjct  616   AAPHIAGLAALIKQKFPSFSPSAIASALSSTASLYDNNGGPIMAQRAYANPDLNQSPATP  675

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPE-NKKFWCS  2154
             FD GSGF+N + AL+PGL+F++ +  Y+ FLC + G     V    G  C   N     +
Sbjct  676   FDMGSGFVNATAALDPGLIFDSSYDDYMSFLCGING-SSPVVLNYTGQNCLSYNSTINGT  734

Query  2155  DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRH  2334
             DLN PS+TI+ L  SR V R VTN+ G +E Y+V    P GV V ++P  F I++   + 
Sbjct  735   DLNLPSITIAKLYQSRMVQRSVTNIAG-NETYKVGWSAPYGVTVKVVPACFSIASGERQV  793

Query  2335  LIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
             L +  +A   +++ S G + L GD+ H++ +P +V V
Sbjct  794   LSVFFDAIMNSSTASHGRIGLFGDQGHVLNIPLSVIV  830



>ref|NP_564793.2| subtilisin-like serine protease ALE1 [Arabidopsis thaliana]
 gb|AEE33956.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=832

 Score =   552 bits (1422),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 338/789 (43%), Positives = 464/789 (59%), Gaps = 18/789 (2%)
 Frame = +1

Query  109   KIYMVLMEDHPFV---STRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHL  279
             KIY +L+E  P     ST I   S  + +  +++ + HD  LGS L + +YTKLYS+ H+
Sbjct  47    KIYSILVEGEPLAFRASTNIN--SKAMALEAKKIEEIHDEILGSTLEKGSYTKLYSFKHV  104

Query  280   LNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLG--GPSV  453
             +N  AV   + +A K L K +GV+ + ED  ++ MTT+TPDFL +P  VW ++   G   
Sbjct  105   INAIAVRTTASQAKK-LGKTKGVKAVEEDKGVKLMTTYTPDFLELPQQVWQKISNEGDRR  163

Query  454   SGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR-KFTGKCITGDNFPATACNGKIVG  630
             +GE +VIG +DTGINP H SF++ +  N     ++R  F+G C  G  FP  +CNGKI+ 
Sbjct  164   AGEDIVIGFVDTGINPTHPSFAALDLTNPYSSNLSRLHFSGDCEIGPFFPPGSCNGKIIS  223

Query  631   AQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAP  810
             A++F+  A A+G  N S    SPFDA GHGSH AS AAGN   PVI + F YG ASGMAP
Sbjct  224   ARFFSAGARASGALNSSLDILSPFDASGHGSHVASIAAGNAGVPVIVDGFFYGRASGMAP  283

Query  811   GAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLL  990
              + IAVYKA+Y   G + DV+AA+DQA+ DGVD+L+LSVGP   P      L + ++ +L
Sbjct  284   RSRIAVYKAIYPSIGTLVDVIAAIDQAIMDGVDVLTLSVGPDEPPVDKPTVLGIFDLAML  343

Query  991   FATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLS  1170
              A +AGV VVQA GN+GPS  S+LS+SPWV  VAA  TDR Y   ++L  GQT  G GLS
Sbjct  344   LARKAGVFVVQAVGNNGPSPSSVLSYSPWVVGVAAGNTDRSYPAPLILDGGQTVQGVGLS  403

Query  1171  PPTAGKAFFQ--LAAAVDVCRRN-STAGLLT--VESCQDAMQFVPSLVRGKLVICTYTYD  1335
              PT G    Q  L  A D  R N S    LT  +E CQ    F P+ V G +VICT++  
Sbjct  404   GPTLGAPLVQHRLVLAKDAVRTNGSVLQPLTRDIEECQRPENFDPAAVFGSIVICTFSDG  463

Query  1336  FESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALR  1515
             F ++ +++  +  T    G  GF+L  +P  G        V    PG++I  + A+  + 
Sbjct  464   FYNQMSTVLAITQTARTLGFMGFILIANPRFG--DYVAEPVIFSAPGILIPTVSAAQIIL  521

Query  1516  QYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVL  1695
             +YY   T R   G A  F A ARI +GR ++++G+ PVV+ +SSRGP   +A     DVL
Sbjct  522   RYYEEKTFRDTRGVATQFGARARIGEGRNSVFAGKAPVVSRFSSRGPAFIDATRSPLDVL  581

Query  1696  KPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPS  1875
             KP+I+APG  IW AWS  S  D  + G+ FA++SGTSMATPHIAGI ALIK  +P+W P+
Sbjct  582   KPDILAPGHQIWGAWSLPSAFDPILTGRSFAILSGTSMATPHIAGIGALIKQLNPSWTPA  641

Query  1876  AITSAMMTSADVTDRlgspllaqqasqqlapaTP-FDFGSGFINPSRALNPGLVFNTYFQ  2052
              I SA+ T+A+  D  G  + A+         +  FD G+G +NP+RAL+PGLV    F+
Sbjct  642   MIASAISTTANEYDSNGEIISAEYYELSRLFPSNHFDHGAGHVNPARALDPGLVLPAGFE  701

Query  2053  QYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVG  2232
              YI FLC++P +   ++R   GV C        ++LN PSVTIS L  S  V R   +V 
Sbjct  702   DYISFLCSLPNISPATIRDATGVLCTTTLSH-PANLNHPSVTISALKESLVVRRSFQDVS  760

Query  2233  GADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRN  2412
                E Y   V  P G  V + P  F +    ++ L I  N T+  N ++FGE++L G  N
Sbjct  761   NKTETYLGSVLPPNGTTVRLTPTWFTVPPQKTQDLDIEFNVTQVLNKFTFGEVVLTGSLN  820

Query  2413  HIVRVPFAV  2439
             HI+R+P +V
Sbjct  821   HIIRIPLSV  829



>gb|KDO77536.1| hypothetical protein CISIN_1g003005mg [Citrus sinensis]
Length=858

 Score =   553 bits (1424),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 336/756 (44%), Positives = 470/756 (62%), Gaps = 19/756 (3%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             +++ HD  L    +   Y KLYSY +L+NGF+V V   +A K+  + E V  +  D  + 
Sbjct  101   ISRVHDSILRRAFKGEKYLKLYSYHYLINGFSVFVTPQQAEKLSRRRE-VANVVSDFSVR  159

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSS-PEEYNIGRPRI  555
               TTHTP FLG+P   W + GG   +GEGVVIG IDTGI+P H SF+    E++   P  
Sbjct  160   TATTHTPQFLGLPQGAWIQEGGYETAGEGVVIGFIDTGIDPTHPSFADDASEHSYPVPS-  218

Query  556   TRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAS  735
                F+G C    +FP+ +CN K++GA++FA +AI  G FN S+ YASPFD DGHGSHTAS
Sbjct  219   --HFSGICEVTRDFPSGSCNRKLIGARHFAASAITRGIFNSSQDYASPFDGDGHGSHTAS  276

Query  736   TAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdI  912
              AAGN+  PV+    ++G ASGMAP + IAVYKALY SFGG+ +DVVAA+DQA +DGVDI
Sbjct  277   VAAGNHGIPVVVTGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVAAIDQAAQDGVDI  336

Query  913   lslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVA  1092
             +SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM SFSPW+ +V 
Sbjct  337   ISLSITPNRRPPGIATFFNPIDMALLSAAKAGIFVVQAAGNTGPSPKSMSSFSPWIFTVG  396

Query  1093  ASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA-GLLTVESCQ  1269
             A++ DR YTNSI+LGN  T SG GL+P T     + L +A+     N+T    + V  CQ
Sbjct  397   AASHDRIYTNSIILGNSLTISGVGLAPGT--DKMYTLISALHALNNNTTTTDDMYVGECQ  454

Query  1270  DAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKG  1449
             D+  F   LV+G L+IC+Y+  F    ++I    +T     AAG V  MDP +   Q+  
Sbjct  455   DSSNFNQDLVQGNLLICSYSIRFVLGLSTIKQAFETAKNLSAAGIVFYMDPFVIGFQLN-  513

Query  1450  ATVTLQIPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGP  1626
                 +++PG+II + + S  L QYYNS+  R   + + + F A A IL G +A +S   P
Sbjct  514   -PTPMKMPGIIIPSPDDSKILLQYYNSSLERDEVTKKIIKFGAVACILGGLKANFSNSAP  572

Query  1627  VVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTS  1806
              +  YS+RGPD  ++ LD AD++KPN++APG+SIWAAWS         +G+ FA++SGTS
Sbjct  573   KIMYYSARGPDPEDSFLDDADIMKPNLVAPGNSIWAAWSSLGTDSVEFQGESFAMMSGTS  632

Query  1807  MATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaT  1974
             MA PHIAG+AALIK + P++ PSAI SA+ TSA + D+      +     +  +  +PAT
Sbjct  633   MAAPHIAGLAALIKQKFPSFSPSAIASALSTSATLYDKNGGPIMAQRAYAKPDENQSPAT  692

Query  1975  PFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKKFWC  2151
             PFD GSGF+N + +L+PGLVF+  +  Y+ FLC + G     V    G  C   N     
Sbjct  693   PFDMGSGFVNATASLDPGLVFDASYNDYMSFLCGING-SSPVVLNYTGQNCWAYNSTISG  751

Query  2152  SDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
             +DLN PS+TI+ L  SRTV R +TN+ G +E Y V    P GV + + P +F I++   +
Sbjct  752   ADLNLPSITIARLNQSRTVQRTLTNIAG-NETYSVGWSAPYGVSMKVSPTHFSIASGEKQ  810

Query  2332  HLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              L +  NAT +  + SFG + L G++ HIV +P +V
Sbjct  811   VLNVFFNATTSGTAASFGRIGLFGNQGHIVNIPLSV  846



>emb|CDY02310.1| BnaA09g25920D [Brassica napus]
Length=836

 Score =   552 bits (1422),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 337/807 (42%), Positives = 482/807 (60%), Gaps = 36/807 (4%)
 Frame = +1

Query  97    MAEAKIYMVLMEDHPFV---------STRIKGTSGNVTMYKQR-----MTKQHDVFLGSL  234
             ++ + +Y+V ++D P V         +++   TS +   Y+       + + HD  L  +
Sbjct  34    LSSSAVYIVTLKDPPSVHSSSGRETDASKHSLTSTSSQTYRTSNRSAYLIRVHDSLLRKV  93

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
             LR+  Y KLYSY +L+NGF+  +   +A ++  + E V  +  D  ++K TTHTP FLG+
Sbjct  94    LRKENYIKLYSYHYLINGFSAVITQQQAERLAARKE-VHNVVLDYPVKKATTHTPQFLGL  152

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSS--PEEYNIGRPRITRKFTGKCITG  588
             P   WPR GG   +GEGVVIG IDTGI+P H SFS   P       PR    FTG C   
Sbjct  153   PRGAWPREGGSEYAGEGVVIGFIDTGIDPTHPSFSDKVPGHSYPVPPR----FTGVCEVT  208

Query  589   DNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVI  768
               FP+ +CN K+VGA++FA +A++ G  N S+  ASPFD +GHG+HTAS AAGN+  PV+
Sbjct  209   TGFPSGSCNRKLVGARHFAESALSRGVLNSSQDDASPFDGEGHGTHTASVAAGNHGVPVV  268

Query  769   TNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssvp  945
                 + G ASGMAP A +A+YKALY  FGG+ +D++AA+DQA +DGVDI++LS+ P+  P
Sbjct  269   VCGHHLGNASGMAPRAHVAIYKALYKRFGGFAADIIAAIDQAAQDGVDIINLSITPNRRP  328

Query  946   sgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNS  1125
              G + F N +++ LL A +AG+ VVQAAGN+GP+ +SM SFSPW+ +V A++ DR YTNS
Sbjct  329   PGIATFFNPIDMALLSAVKAGIFVVQAAGNTGPAPKSMSSFSPWIFTVGATSHDRVYTNS  388

Query  1126  IVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVESCQDAMQFVPSLVR  1302
             I+LGN  T SG GL+  T  +   +L  A    R  +T    + V  CQD+  +   LV+
Sbjct  389   IILGNNVTISGVGLASGT--RTMHKLVLAAHALRNGTTIMDAIYVGECQDSSSYDQKLVQ  446

Query  1303  GKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLI  1482
             GK+++C+YT  F    +++     T     AAG V  MDP   S   +  +  + IPG++
Sbjct  447   GKILVCSYTVRFILGVSTVKQALITAKNLTAAGLVFYMDPS--STGFQMTSTPMDIPGIL  504

Query  1483  INNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPD  1659
             I++ + S AL QYYN++  R   SG+ V   + ARI+ G +  Y    P V  +S+RGPD
Sbjct  505   ISSPQDSLALLQYYNTSLSRDNASGKIVGSASVARIVGGMKPTYGITAPKVMYFSARGPD  564

Query  1660  VNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAA  1839
               +     ADV+KPN++APG+SIW AWSP   G    +G+ FA+ SGTSM+ PH+ GIAA
Sbjct  565   PEDDSFQDADVMKPNLVAPGNSIWGAWSPLGIGTADFQGERFAMESGTSMSAPHVTGIAA  624

Query  1840  LIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINP  2007
             LIK + P++ P+AI SA+ T+A +TDR      +            PATPFD GSGF+N 
Sbjct  625   LIKQKFPHFTPAAIASALSTTASLTDRKGGPIMAQRTVLNPDATQTPATPFDMGSGFVNA  684

Query  2008  SRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPE-NKKFWCSDLNTPSVTIS  2184
             + AL+PGL+F+  + +Y++FLC + G     V    G  C   N     SDLN PSVTI+
Sbjct  685   TAALDPGLIFDIGYNEYMKFLCGING-SSPVVLNYTGESCSAYNSSLAASDLNLPSVTIA  743

Query  2185  NLVGSRTVMRRVTNVGG--ADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNAT  2358
              LVG+RTV+R VTN+     +E Y V  + P  V V + P  F I    +R + +V  A 
Sbjct  744   KLVGTRTVLRWVTNIAATVTNETYTVGWKAPDSVSVKVSPAKFTIGNGETRVMSLVFRAI  803

Query  2359  KATNSYSFGEMILLGDRNHIVRVPFAV  2439
             K  +  SFG + ++GDR H+V +P  V
Sbjct  804   KNGSVASFGRIEMVGDRGHVVNIPVTV  830



>ref|XP_011040564.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=848

 Score =   552 bits (1423),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 329/757 (43%), Positives = 465/757 (61%), Gaps = 15/757 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD  L  +LR   Y KLYSY +L+NGFAV V  ++A K+  + E V  +  D  + 
Sbjct  89    VARVHDSLLRRVLRGEKYLKLYSYHYLINGFAVLVTPEQASKLSRRRE-VANVALDFSVR  147

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TTHTP FLG+P   W + GG   +GEG+VIG +DTGI+P H SFS  ++ ++    + 
Sbjct  148   TATTHTPQFLGLPQGAWVKAGGYETAGEGIVIGFVDTGIDPTHPSFS--DDISLKSYPVP  205

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
               F+G C    +FP+ +CN K++GA++FA +AI  G FN S+ YASPFD DGHG+HTAS 
Sbjct  206   SHFSGICEVTRDFPSGSCNRKLIGARHFAASAITRGIFNSSQDYASPFDGDGHGTHTASV  265

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI     +G ASGMAP A I+VYKALY SFGG+ +DVVAA+DQA +DGVD+L
Sbjct  266   AAGNHGIPVIVAGHCFGNASGMAPRAHISVYKALYKSFGGFAADVVAAIDQAAQDGVDVL  325

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ LL A +AG+  VQAAGN+GPS +SM SFSPW+ +V A
Sbjct  326   SLSITPNRRPPGIATFFNPIDMALLSAVKAGLFTVQAAGNTGPSPKSMSSFSPWIFTVGA  385

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA-GLLTVESCQD  1272
             ++ DR Y+NSI+LGN  T  G GL+P T       L +A+      +T    + V  CQD
Sbjct  386   ASHDRVYSNSIILGNNVTIHGVGLAPGTDEDTMLTLVSALHAVNNETTVTADMYVGECQD  445

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
             +  F    + G L+IC+Y+  F    ++I    +T     AAG V  MDP +   Q    
Sbjct  446   SSSFNQDFIEGNLLICSYSIRFVLGLSTIKQAVETAKNLSAAGVVFYMDPFVIGFQFN--  503

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVA-FRATARILDGRRAIYSGQGPV  1629
              + + +PG+II + + S  L QYYNS+  R+ + + +  F A A IL G +A YS   P 
Sbjct  504   PIPMSVPGIIIPSPDDSKVLLQYYNSSLERNETTKQITKFGAVASILGGLKANYSNSAPK  563

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  ++ LD AD+LKPN++APG+SIWAAWS         +G++FA++SGTSM
Sbjct  564   VMYYSARGPDPEDSFLDDADILKPNLVAPGNSIWAAWSSLGTDSVEFQGENFAMISGTSM  623

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTP  1977
             A PHIAG+AALIK + P++ PSAI SA+ ++A + D       +           +PATP
Sbjct  624   AAPHIAGLAALIKQKFPSFSPSAIASALSSTASLYDNNGGPIMAQRAYANPDLNQSPATP  683

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPE-NKKFWCS  2154
             FD GSGF+N + A++PGL+F + +  Y+ FLC + G     V    G  C   N     +
Sbjct  684   FDMGSGFVNATAAIDPGLIFESNYDDYMSFLCGING-SSPVVLNYTGQNCLSYNSTINGT  742

Query  2155  DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRH  2334
             DLN PS+TI+ L  SRTV R VTN+ G +E Y+V    P GV V ++P  F I++   + 
Sbjct  743   DLNLPSITIAKLYQSRTVRRSVTNIAG-NETYKVGWSAPYGVTVKVVPARFSIASGERQV  801

Query  2335  LIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
             L +  +A   +++ S G + L GD+ H++ +P +V V
Sbjct  802   LSVFFDAIMNSSTASHGRIGLFGDQGHVLNIPLSVIV  838



>emb|CDY09557.1| BnaC05g23620D [Brassica napus]
Length=836

 Score =   552 bits (1422),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 340/802 (42%), Positives = 477/802 (59%), Gaps = 36/802 (4%)
 Frame = +1

Query  112   IYMVLMEDHPFVSTR-----------IKGTSGNVTMYKQR---MTKQHDVFLGSLLRRSA  249
             +Y+V ++D P V +            +  TS        R   + + HD  L  +LR+  
Sbjct  39    VYIVTLKDPPSVHSSSDRETSVSKHSLTSTSSQTYRTSNRSASIVRVHDSLLRKVLRKEN  98

Query  250   YTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVW  429
             Y KLYSY +L+NGF+  +   +A ++  + E V  +  D  ++K TTHTP FLG+P   W
Sbjct  99    YIKLYSYHYLINGFSAVITQQQADRLAAREE-VHNVVLDYPVKKATTHTPQFLGLPRGAW  157

Query  430   PRLGGPSVSGEGVVIGMIDTGINPFHASFSS--PEEYNIGRPRITRKFTGKCITGDNFPA  603
             PR GG   +GEGVVIG IDTGI+P H SFS   P       PR    FTG C     FP+
Sbjct  158   PREGGSEYAGEGVVIGFIDTGIDPTHPSFSDKVPGHSYPVPPR----FTGVCEVTTGFPS  213

Query  604   TACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFN  783
              +CN K+VGA++FA +A++ G  N S+  ASPFD +GHG+HTAS AAGN+  PV+    +
Sbjct  214   GSCNRKLVGARHFAESALSRGVLNSSQDDASPFDGEGHGTHTASVAAGNHGVPVVVCGHH  273

Query  784   YGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSA  960
              G ASGMAP A +A+YKALY  FGG+ +D++AA+DQA +DGVDI++LS+ P+  P G + 
Sbjct  274   LGNASGMAPRAHVAIYKALYKRFGGFAADIIAAIDQAAQDGVDIINLSITPNRRPPGIAT  333

Query  961   FLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGN  1140
             F N +++ LL A +AG+ VVQAAGN+GP+ +SM SFSPW+ +V A++ DR YTNSI+LGN
Sbjct  334   FFNPIDMALLSAVKAGIFVVQAAGNTGPAPKSMSSFSPWIFTVGATSHDRVYTNSIILGN  393

Query  1141  GQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVESCQDAMQFVPSLVRGKLVI  1317
               T SG GL+  T  +   +L  A    R  +T    + V  CQD+  +   LV GK+++
Sbjct  394   NVTISGVGLASGT--RTMHKLVLAAHALRNGTTIMDAIYVGECQDSSSYELKLVNGKILV  451

Query  1318  CTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNME  1497
             C+YT  F    ++I     T     AAG V  MDP   S   +  +  + IPG++I++ +
Sbjct  452   CSYTVRFILGVSTIKQALLTAKNLTAAGLVFYMDPS--STGFQMTSTPMDIPGILISSPQ  509

Query  1498  ASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNAL  1674
              S AL QYYN++  R   SG+ V   + ARI+ G +  Y    P V  +S+RGPD  +  
Sbjct  510   DSLALLQYYNTSLSRDNASGKIVGSASVARIVGGMKPTYGITAPKVMYFSARGPDPEDDS  569

Query  1675  LDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDR  1854
                ADV+KPN++APG+SIW AWSP   G    +G+ FA+ SGTSM+ PH+ GIAALIK +
Sbjct  570   FQDADVMKPNLVAPGNSIWGAWSPLGIGTADFQGERFAMESGTSMSAPHVTGIAALIKQK  629

Query  1855  HPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSGFINPSRALN  2022
              P++ P+AI SA+ T+A +TDR      +            PATPFD GSGF+N + AL+
Sbjct  630   FPHFTPAAIASALSTTASLTDRKGGPIMAQRTVLNPDATQTPATPFDMGSGFVNATAALD  689

Query  2023  PGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPE-NKKFWCSDLNTPSVTISNLVGS  2199
             PGL+F+  + +Y++FLC + G     V    G  C   N     SDLN PSVTI+ LVG+
Sbjct  690   PGLIFDIGYNEYMKFLCRING-SSPVVLNYTGESCSAYNSSLAASDLNLPSVTIAKLVGT  748

Query  2200  RTVMRRVTNVGG--ADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNS  2373
             RTV+R VTN+    A+E Y V  + P  V V + P  F I    +R L +V  A K  + 
Sbjct  749   RTVLRWVTNIAATVANETYTVGWKAPDSVSVKVSPAKFTIGNGQTRVLSLVFRAMKNGSV  808

Query  2374  YSFGEMILLGDRNHIVRVPFAV  2439
              SFG++ ++GDR H+V +P  V
Sbjct  809   ASFGKIGIIGDRGHVVNIPVTV  830



>ref|XP_006363641.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=838

 Score =   552 bits (1422),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 336/768 (44%), Positives = 480/768 (63%), Gaps = 21/768 (3%)
 Frame = +1

Query  184   MYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYE  363
             M    +++ HD  L  +LR   Y K+YSY +L+NGFAV V   +A K+  + E V  +  
Sbjct  81    MNGSYVSQMHDSLLRRVLRGEKYLKVYSYHYLINGFAVLVTPQQAFKLARRRE-VSNMVL  139

Query  364   DIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS--SPEEYN  537
             D  ++  TTHTP FLG+P   W + GG   +G G+VIG IDTGI+P H SF+  SPE+  
Sbjct  140   DFSVKTATTHTPQFLGLPHGAWAQEGGYETAGVGIVIGFIDTGIDPTHPSFNDKSPEQTY  199

Query  538   IGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGH  717
                  +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ +ASPFD DGH
Sbjct  200   ----PVPEHFSGICEVTLDFPSGSCNRKLVGARHFAASAITRGIFNATKDFASPFDGDGH  255

Query  718   GSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqav  894
             G+HTAS AAGN+  PVI    ++G ASGMAP + IAVYKALY SFGG+ +DVVAA+DQA 
Sbjct  256   GTHTASIAAGNHGVPVIVAGHDFGNASGMAPHSHIAVYKALYKSFGGFAADVVAAIDQAA  315

Query  895   edgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSP  1074
             +DGVDI++LS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +S+ SFSP
Sbjct  316   QDGVDIINLSITPNRRPPGLATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSVASFSP  375

Query  1075  WVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLT  1254
             W+ SV AST DR Y+NSI+LGN  T SG GL+P T     + L +A+     ++ A  + 
Sbjct  376   WIFSVGASTHDRVYSNSILLGNNITISGVGLAPGT--DNMYMLVSAIHALN-DTAAKDMY  432

Query  1255  VESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGS  1434
             V  CQDA +F  +LV+G L+IC+Y+  F    ++I   ++T     AAG V  MDP + +
Sbjct  433   VSECQDASKFNHTLVQGNLLICSYSIRFVLGLSTIKQASETAMNLSAAGVVFAMDPFVIT  492

Query  1435  EQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIY  1611
              Q+    V +++PG+II + + +  L QYYNS+  +  + R  V F A A IL G +  +
Sbjct  493   YQLN--PVPMRLPGIIIPSPDDAKILLQYYNSSLEKDETTRKIVKFGAVACILGGIKPNF  550

Query  1612  SGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFAL  1791
             S   P V  YS+RGPD  +  +D AD+LKPN++APG+SIWAAWS         +G++FA+
Sbjct  551   SLSAPKVMYYSARGPDPEDNSVDNADILKPNLVAPGNSIWAAWSSRGAESIEFQGENFAM  610

Query  1792  VSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqq  1959
             +SGTSMA PHIAG+AALIK + P + P+AI SA+ T+A   ++    + +          
Sbjct  611   MSGTSMAAPHIAGLAALIKQKFPTFTPAAIGSALSTTASQHNKYGGPILAQRAYANPDSN  670

Query  1960  lapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENK  2139
              +PATPFD GSGF+N + AL+PGL+ +T +  Y+ FLC + G     +    G  C  + 
Sbjct  671   QSPATPFDMGSGFVNATAALDPGLILDTSYNDYMAFLCGING-SAPVLLNYTGESCGVS-  728

Query  2140  KFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISA  2319
                 +DLN PS+TIS L  SR V R +TN+ G +E Y V    P GV + + P+ FF+++
Sbjct  729   TMNGADLNMPSITISKLNQSRKVQRMLTNIAG-NETYIVGWSAPNGVSIKVTPKRFFVAS  787

Query  2320  DGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
                + L + LNAT  + + SFG + L+G++ H+V +P +V V  S  S
Sbjct  788   GQQQILNVFLNATMNSTTPSFGRIGLVGNKGHVVNIPLSVIVKISYHS  835



>ref|XP_006448798.1| hypothetical protein CICLE_v10014244mg [Citrus clementina]
 gb|ESR62038.1| hypothetical protein CICLE_v10014244mg [Citrus clementina]
Length=858

 Score =   552 bits (1422),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 335/756 (44%), Positives = 470/756 (62%), Gaps = 19/756 (3%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             +++ HD  L    +   Y KLYSY +L+NGF+V V   +A K+  + E V  +  D  + 
Sbjct  101   ISRVHDSILRRAFKGEKYLKLYSYHYLINGFSVLVTPQQAEKLSRRRE-VANVVSDFSVR  159

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSS-PEEYNIGRPRI  555
               TTHTP FLG+P   W + GG   +GEGVVIG IDTGI+P H SF+    E++   P  
Sbjct  160   TATTHTPQFLGLPQGAWIQEGGYETAGEGVVIGFIDTGIDPTHPSFADDASEHSYPVPS-  218

Query  556   TRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAS  735
                F+G C    +FP+ +CN K++GA++FA +AI  G FN S+ YASPFD DGHGSHTAS
Sbjct  219   --HFSGICEVTRDFPSGSCNRKLIGARHFAASAITRGIFNSSQDYASPFDGDGHGSHTAS  276

Query  736   TAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdI  912
              AAGN+  PV+    ++G ASGMAP + IAVYKALY SFGG+ +DVVAA+DQA +DGVDI
Sbjct  277   VAAGNHGIPVVVTGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVAAIDQAAQDGVDI  336

Query  913   lslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVA  1092
             +SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM SFSPW+ +V 
Sbjct  337   ISLSITPNRRPPGIATFFNPIDMALLSAAKAGIFVVQAAGNTGPSPKSMSSFSPWIFTVG  396

Query  1093  ASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA-GLLTVESCQ  1269
             A++ DR YTNSI+LGN  T SG GL+P T     + L +A+     N+T    + V  CQ
Sbjct  397   AASHDRIYTNSIILGNSLTISGVGLAPGT--DKMYTLISALHALNNNTTTTDDMYVGECQ  454

Query  1270  DAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKG  1449
             D+  F   LV+G L+IC+Y+  F    ++I    +T     AAG V  MDP +   Q+  
Sbjct  455   DSSNFNQDLVQGNLLICSYSIRFVLGLSTIKQAFETAKNLSAAGIVFYMDPFVIGFQLN-  513

Query  1450  ATVTLQIPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGP  1626
                 +++PG+II + + S  L QYYNS+  R   + + + F A A IL G +A +S   P
Sbjct  514   -PTPMKMPGIIIPSPDDSKILLQYYNSSLERDEVTKKIIKFGAVACILGGLKANFSNSAP  572

Query  1627  VVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTS  1806
              +  YS+RGPD  ++ LD AD++KPN++APG+SIWAAWS         +G+ FA++SGTS
Sbjct  573   KIMYYSARGPDPEDSFLDDADIMKPNLVAPGNSIWAAWSSLGTDSVEFQGESFAMMSGTS  632

Query  1807  MATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaT  1974
             MA PHIAG+AALIK + P++ PSAI SA+ TSA + D+      +     +  +  +PAT
Sbjct  633   MAAPHIAGLAALIKQKFPSFSPSAIASALSTSATLYDKNGGPIMAQRAYAKPDENQSPAT  692

Query  1975  PFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKKFWC  2151
             PFD GSGF+N + +L+PGL+F+  +  Y+ FLC + G     V    G  C   N     
Sbjct  693   PFDMGSGFVNATASLDPGLIFDASYNDYMSFLCGING-SSPVVLNYTGQNCWAYNSTISG  751

Query  2152  SDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
             +DLN PS+TI+ L  SRTV R +TN+ G +E Y V    P GV + + P +F I++   +
Sbjct  752   ADLNLPSITIARLNQSRTVQRTLTNIAG-NETYSVGWSAPYGVSMKVSPTHFSIASGEKQ  810

Query  2332  HLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              L +  NAT +  + SFG + L G++ HIV +P +V
Sbjct  811   VLNVFFNATTSGTAASFGRIGLFGNQGHIVNIPLSV  846



>ref|XP_010418222.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=788

 Score =   550 bits (1416),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 333/787 (42%), Positives = 461/787 (59%), Gaps = 16/787 (2%)
 Frame = +1

Query  112   IYMVLMEDHPFVSTRIKGTSGNVTMYK-QRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNG  288
             IY VL+E  P      K  +     Y+ +++   H+  LGS L   +YTKLYS+ H++N 
Sbjct  4     IYSVLVEGEPLAFRTSKNINSKAMAYEAKKIEAIHEEILGSTLENGSYTKLYSFKHVINA  63

Query  289   FAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLG--GPSVSGE  462
             FAV     +A K L KA+GV+ + ED  ++ MTT+TPDFL +P  VWP++   G   +GE
Sbjct  64    FAVSTTPYQAKK-LTKAKGVKAVEEDKGVKLMTTYTPDFLELPQQVWPKISNDGNRRAGE  122

Query  463   GVVIGMIDTGINPFHASFSSPEEYNIGRPRITR-KFTGKCITGDNFPATACNGKIVGAQY  639
              +VIG +DTGINP H SF+  +  N     ++R  F+G C TG  FP+ +CNGK++ A++
Sbjct  123   DIVIGFVDTGINPTHPSFAGLDLTNPYSSNLSRLNFSGDCETGPLFPSGSCNGKLLSARF  182

Query  640   FARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAG  819
             F+  A A+G  N S    SPFDA GHGSH AS AAGN   PVI + F YG ASGMAP A 
Sbjct  183   FSAGARASGALNSSLDILSPFDASGHGSHVASIAAGNAGVPVIVDGFFYGRASGMAPRAR  242

Query  820   IAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFAT  999
             IAVYKA+Y   G + DV+AA+DQA+ DGVD+L+LS+GP   P      L + ++ +L A 
Sbjct  243   IAVYKAIYPSIGTLVDVIAAIDQAIMDGVDVLTLSIGPDQPPVDKPTVLGIFDLAMLSAR  302

Query  1000  RAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPT  1179
             +AGV VVQAAGN GPS  S+LS+SPWV  VAA  TDR Y  S++L  GQT  G GLS PT
Sbjct  303   KAGVFVVQAAGNHGPSPSSVLSYSPWVVGVAAGNTDRSYPASLILDGGQTVQGVGLSGPT  362

Query  1180  AGKAFFQ--LAAAVDVCRRNSTAGLLT----VESCQDAMQFVPSLVRGKLVICTYTYDFE  1341
              G  F Q  L  A D  R N +  L T    +E CQ    F P++V G +VICT++  F 
Sbjct  363   LGAPFLQHKLVLARDAVRTNGSV-LQTLNREIEECQRPENFDPAVVLGSIVICTFSDGFY  421

Query  1342  SEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQY  1521
             ++ +++  +  T    G  GF+L   P  G        V    PG++I  +  +  + +Y
Sbjct  422   NQMSTVRAITQTARTLGFMGFILIAHPRYG--DYVAEPVIFSAPGILIPKVSDAQIILRY  479

Query  1522  YNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKP  1701
             Y   T R + G    F A ARI +GR ++++G+ P V+ +SSRGP   +A  +  DVLKP
Sbjct  480   YEEKTFRDKRGLVTQFGARARIGEGRNSVFAGKAPAVSRFSSRGPAFIDANRNLLDVLKP  539

Query  1702  NIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAI  1881
             +I+APG  IW AWS  S  D  + G+ FA++SGTSMA PHIAGI A+IK  +P+W P+ I
Sbjct  540   DILAPGHQIWGAWSLPSAFDPILTGRSFAILSGTSMAAPHIAGIGAMIKQLNPSWTPAMI  599

Query  1882  TSAMMTSADVTDRlgspllaqqasqqlapaTP-FDFGSGFINPSRALNPGLVFNTYFQQY  2058
              SA+ T+A   D  G  +  +        ++  FD G+G +NP+RA++PGLV    F+ Y
Sbjct  600   ASAISTTATEYDSSGEVISTESYDINGLFSSNHFDHGAGHVNPARAIDPGLVLPAGFEDY  659

Query  2059  IQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGA  2238
             I FLC++P ++  ++R   GV C        ++LN PSVTI  L  S  V R   NV   
Sbjct  660   ISFLCSLPNINPVTIRAATGVWCTTTLSH-PANLNHPSVTIVALKESLVVKRSFQNVSNK  718

Query  2239  DERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHI  2418
              E Y   +  P G  V +IP  F +     + L I  N T+  N ++FGE++L G  NHI
Sbjct  719   TETYLGSILPPNGTAVRLIPSWFTVPPQRIQDLDIEFNVTQVLNQFTFGEVVLTGSLNHI  778

Query  2419  VRVPFAV  2439
             +R+P +V
Sbjct  779   IRIPLSV  785



>ref|XP_008225702.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=846

 Score =   551 bits (1420),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 335/773 (43%), Positives = 474/773 (61%), Gaps = 17/773 (2%)
 Frame = +1

Query  154   RIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILH  333
             R +  S     Y   + + HD  L  +LR   Y KLYSY +L+NGFAV V  D+  K+  
Sbjct  73    RFRNISRTDKRYSSYIARVHDSLLRRVLRGEKYLKLYSYHYLINGFAVLVTPDQVDKLSR  132

Query  334   KAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHAS  513
             + E V  +  D  +   TTHTP FLG+P   W + GG   +GEG+VIG IDTGI+P H+S
Sbjct  133   RRE-VANVVLDFSVRTATTHTPQFLGLPQGAWVQGGGYESAGEGMVIGFIDTGIDPTHSS  191

Query  514   FS-SPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHY  690
             F+ +  E+    P     F+G C    +FP+ +CN K++GA++FA +AI  G FN S+ +
Sbjct  192   FADNTSEHPYPVPA---HFSGICEVTRDFPSGSCNRKLIGARHFAASAITRGVFNSSQDF  248

Query  691   ASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSd  867
             ASPFD DGHG+HTAS AAGN+  PV+    ++G ASGMAP + IAVYKALY  FGG+ +D
Sbjct  249   ASPFDGDGHGTHTASIAAGNHGIPVVVAGHHFGNASGMAPRSHIAVYKALYKGFGGFAAD  308

Query  868   vvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPS  1047
             VVAA+DQA +DGVDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS
Sbjct  309   VVAAIDQAAQDGVDIISLSITPNRRPPGVATFFNPIDMALLSAVKAGIFVVQAAGNTGPS  368

Query  1048  SRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCR  1227
              +SM SFSPW+ +V +++ DR Y+NSI+LGN  T  G GL+P T     + L +AV    
Sbjct  369   PKSMSSFSPWIFTVGSASHDRVYSNSIILGNNVTIPGVGLAPGTENDTMYTLISAVHALN  428

Query  1228  RNST-AGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGF  1404
               +T A  + V  CQD+ +F   L++G L+IC+Y+  F    +++    +T     A G 
Sbjct  429   NGTTVADDMYVGECQDSSKFNQDLIQGNLLICSYSIRFVLGISTVNHALETAKNLSAVGV  488

Query  1405  VLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRS-RSGRAVAFRATA  1581
             V  MD  +   Q+      ++IPG+II + E S  L +YYN +  R   + R V F A A
Sbjct  489   VFYMDAFVIGFQLN--PTPMKIPGIIIPSPEDSKVLLKYYNYSLERDIMTKRIVKFGALA  546

Query  1582  RILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGD  1761
              I  G +A YS   P +  YS+RGPD  +  LD A+++KPN++APG+SIWAAWS      
Sbjct  547   TICGGFKANYSSSAPKIMYYSARGPDPEDNFLDDAEIMKPNLVAPGNSIWAAWSSVGADS  606

Query  1762  KYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gs  1929
                +G++FA++SGTSMA PHIAG+AAL++ + PN+ PSAI SA+ T+A + D+      +
Sbjct  607   VEFQGENFAMMSGTSMAAPHIAGLAALVRQKFPNFSPSAIASALSTTASLYDKNGGPIMA  666

Query  1930  pllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRR  2109
                     Q  +PATPFD GSGF+N + ALNPGL+F + +  Y+ FLC + G     V  
Sbjct  667   QRAYAFPDQNQSPATPFDMGSGFVNATAALNPGLIFYSSYDNYMSFLCGING-SAPVVLN  725

Query  2110  VVGVEC-PENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRV  2286
               G  C   N     +DLN PS+TI+ L  SRTV+R VTNVGG +E Y V    P GV V
Sbjct  726   YTGESCWVYNSTIAGADLNLPSITIAKLNQSRTVLRSVTNVGG-NETYSVGWSAPFGVSV  784

Query  2287  TIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
              + P +F+I++   + L +  N+T  + + S+G + L G++ H+V +P +V V
Sbjct  785   KVSPAHFYIASGEKQVLSVFFNSTANSTTASYGRIGLFGNQGHVVNIPLSVIV  837



>gb|EYU19074.1| hypothetical protein MIMGU_mgv1a001321mg [Erythranthe guttata]
Length=840

 Score =   551 bits (1419),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 332/764 (43%), Positives = 471/764 (62%), Gaps = 20/764 (3%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + H+  L   L+   Y KLYSY +L+NGFAV V   +A K+  ++E V  +  D  + 
Sbjct  85    IDRVHNSLLKKTLKGEKYLKLYSYRYLINGFAVLVTPQQADKLSKRSE-VSNVVMDFSVR  143

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS--SPEEYNIGRPR  552
               TTHTP FLG+P+  W + GG   +GEG+VIG IDTGI+P H SFS  +PE     +P 
Sbjct  144   TATTHTPQFLGLPEGAWAQEGGFETAGEGIVIGFIDTGIDPTHPSFSDSTPE-----KPY  198

Query  553   -ITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHT  729
              +  KF+G C    +FP+ +CN K++GA++FA +AI  G FN ++ +ASP+DADGHG+HT
Sbjct  199   PVPEKFSGICEVTRDFPSGSCNRKLIGARHFAASAITRGIFNATQDFASPYDADGHGTHT  258

Query  730   ASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgv  906
             A+ AAGN+   V+ +  ++G ASGMAP + +AVYKALY SFGG+ +DVVAA+DQA +DGV
Sbjct  259   AAIAAGNHGIAVVVSGHHFGNASGMAPRSHVAVYKALYKSFGGFAADVVAAIDQAAQDGV  318

Query  907   dIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTS  1086
             DI+SLS+ P+  P G + F N +++ LL A ++G+ VVQAAGN+GPS +S+ SFSPW+ +
Sbjct  319   DIISLSITPNRRPPGIATFFNPIDMALLSAVKSGIFVVQAAGNTGPSPKSISSFSPWIFT  378

Query  1087  VAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESC  1266
             V A+  DR Y+NSIVLGN  T SG GL+P T     + L +A+      S    + V  C
Sbjct  379   VGAAAHDRVYSNSIVLGNNVTISGVGLAPGTDKDGMYMLVSAIHALNDTSATNDMYVSEC  438

Query  1267  QDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIK  1446
             QD+  F   +V+G L+IC+Y+  F    ++I    DT     AAG V  MDP +   Q+ 
Sbjct  439   QDSANFNRDVVQGNLLICSYSIRFVLGLSTIKQALDTAQNLSAAGVVFYMDPYVIGFQLN  498

Query  1447  GATVTLQIPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQG  1623
                + ++IPG+II + E S  L QYYNS  +R   + + + F   A I  G +A +S   
Sbjct  499   --PIPMRIPGIIIPSPEDSKVLLQYYNSTLVRDEDTKKIIKFGGAACISGGIKANFSHSA  556

Query  1624  PVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGT  1803
             P V  YS+RGPD  +  LD AD+LKPNI+APG+ IWAAWS +       +G++FA++SGT
Sbjct  557   PKVMYYSARGPDPEDNFLDDADILKPNIVAPGNFIWAAWSSHGTDSVEFQGENFAMMSGT  616

Query  1804  SMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapa  1971
             SMA PHIAG+AALIK + P + PSAI SA+ T+A + DR      +           +PA
Sbjct  617   SMAAPHIAGLAALIKQKFPFFTPSAIGSALSTTASLNDRNGGPIMAQRAYANPDLNQSPA  676

Query  1972  TPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWC  2151
             TPFD GSGF+N + AL+PGL+F++ +  Y+ FLC + G     V    G  C   K    
Sbjct  677   TPFDMGSGFVNATAALDPGLIFDSSYDDYMSFLCGING-SSPVVLNYTGQSCGIAKT-TA  734

Query  2152  SDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
             SDLN PS+T+S L  S  V R VTNV G++E Y +    P G  V + P  F I++   +
Sbjct  735   SDLNLPSITVSKLNQSLIVQRIVTNV-GSNETYTIGWSAPYGATVRVSPSRFSIASGEKQ  793

Query  2332  HLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
              L ++LNAT  ++  S+G + + G + H+V +P +V V  S  +
Sbjct  794   VLTVLLNATMNSSIASYGRIGVFGTQGHLVNIPLSVIVKISFNN  837



>ref|XP_006587105.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=849

 Score =   551 bits (1420),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 343/773 (44%), Positives = 472/773 (61%), Gaps = 19/773 (2%)
 Frame = +1

Query  172   GNVTMYKQR----MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKA  339
             GN+T   +R    +++ HD  L  +L    Y KLYSY +L+NGFAV V   +A K+   +
Sbjct  78    GNITKTDKRYGSYISRVHDSLLKKVLNGEKYLKLYSYHYLINGFAVLVTQQQAEKLSRSS  137

Query  340   EGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS  519
             E V  +  D  +   TTHTP FLG+P   W + GG   +GEGVVIG +DTGI+P H SF 
Sbjct  138   E-VSNVVLDFSVRTATTHTPQFLGLPQGAWFQDGGFETAGEGVVIGFVDTGIDPTHPSFD  196

Query  520   SPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASP  699
                +Y    P +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ YASP
Sbjct  197   D-NKYEKPYP-VPAHFSGICEVTRDFPSGSCNRKLVGARHFAASAITRGIFNSTQDYASP  254

Query  700   FDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvva  876
             FD DGHG+HTAS AAGN+  PVI    ++G ASGMAP + IAVYKALY SFGG+ +DVVA
Sbjct  255   FDGDGHGTHTASVAAGNHGIPVIVAGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVA  314

Query  877   avdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRS  1056
             A+DQA +DGVDI+SLS+ P+  P G + F N +++ LL A + G+ VVQAAGN+GPS  S
Sbjct  315   AIDQAAQDGVDIISLSITPNRRPPGVATFFNPIDMALLSAVKQGIFVVQAAGNTGPSPTS  374

Query  1057  MLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNS  1236
             M SFSPW+ +V A++ DR Y+NSI LGN  T  G GL+P T     ++L  A      ++
Sbjct  375   MFSFSPWIYTVGAASHDRVYSNSIFLGNNVTIPGVGLAPGTDESKLYKLIHAHHALSNDT  434

Query  1237  T-AGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLT  1413
             T A  + V  CQDA +F  SL++G L++C+Y+  F    ++I   ++T     AAG V  
Sbjct  435   TVADDMYVGECQDAYKFNKSLIKGNLLMCSYSIRFVLGLSTIKRASETAKNLSAAGVVFY  494

Query  1414  MDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSN-TLRSRSGRAVAFRATARIL  1590
             MDP +   Q+    V +++PG+II +   S  L QYYNS+  + + S + V F A A I 
Sbjct  495   MDPFVIGFQLN--PVPMKMPGIIIASTNDSKVLTQYYNSSLEIDAVSKKIVKFGAVATIC  552

Query  1591  DGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYI  1770
              G +  YS   P V  YS+RGPD  ++L   AD+LKPN++APG+ IWAAWS         
Sbjct  553   GGLKPNYSNVAPKVMYYSARGPDPEDSLPHEADILKPNLLAPGNFIWAAWSSVGTDSVEF  612

Query  1771  KGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspll  1938
              G++FAL+SGTSMA PH+AG+AALI+ + PN+ P+AI SA+ T+A + D+      +   
Sbjct  613   LGENFALMSGTSMAAPHVAGLAALIRQKFPNFSPAAIGSALSTTASLYDKSGGPIMAQRS  672

Query  1939  aqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVG  2118
                  Q   PATPFD GSGF+N S ALNPGLVF++ +  Y+ FLC + G     V    G
Sbjct  673   YASPDQNQPPATPFDMGSGFVNASGALNPGLVFDSGYDDYMSFLCGING-SAPVVLNYTG  731

Query  2119  VECP-ENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTII  2295
               C   N   +  DLN PS+TIS L  SR V R V N+   +E Y V    P GV V + 
Sbjct  732   QNCALYNLTVYGPDLNLPSITISKLNQSRIVQRTVQNI-AQNESYSVGWTAPNGVSVKVS  790

Query  2296  PQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTAS  2454
             P +F I +   + L ++LNAT +++  SFG + L G++ H+V +P +V V  S
Sbjct  791   PTHFCIGSGERQVLSVLLNATLSSSVASFGRIGLFGNQGHVVNIPLSVMVKIS  843



>ref|XP_008793537.1| PREDICTED: subtilisin-like protease isoform X1 [Phoenix dactylifera]
Length=837

 Score =   550 bits (1418),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 346/809 (43%), Positives = 487/809 (60%), Gaps = 38/809 (5%)
 Frame = +1

Query  103   EAKIYMVLMEDHPFV-----------STRIKGTSGNVTMYKQ-----RMTKQHDVFL---  225
             +A +Y+V M+  P V           S    GTSG     K+     R  K +  +L   
Sbjct  26    DAAVYIVTMKQAPAVHYCDTLKRFGNSVVSNGTSGAFNTIKKPRNGSRTDKSYSSYLIHL  85

Query  226   -GSLLRRSA----YTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTT  390
               SLLRR+     Y KLYSY +L+NGFAV + + +A K+  + E V  +  D  +   TT
Sbjct  86    QDSLLRRALKGENYLKLYSYHYLINGFAVLITNQQAEKLSRRRE-VANVVLDFSVRTATT  144

Query  391   HTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFT  570
             HTP+FLG+P   W + GGP V+G+G+VIG IDTGI+P H SFS  ++ ++    I   F+
Sbjct  145   HTPEFLGLPQGAWVQEGGPEVAGQGIVIGFIDTGIDPTHPSFS--DDLSLNLYPIPAHFS  202

Query  571   GKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGN  750
             G C    +FP+ +CN K+VGA++FA +AI  G FN S+ YASPFD DGHG+HTAS AAGN
Sbjct  203   GVCEVTKDFPSGSCNRKLVGARHFAASAITRGIFNASQDYASPFDGDGHGTHTASIAAGN  262

Query  751   YHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIlslsv  927
             +  PVI +   +G ASGMAP A I++YKALY SFGG+ +DVVAA+DQA +DGVDI+SLS+
Sbjct  263   HGIPVIVSGHCFGNASGMAPHAHISIYKALYKSFGGFAADVVAAIDQAAQDGVDIISLSI  322

Query  928   gpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTD  1107
              P+  P G + F N +++ LL A +AG+ VVQAAGN+GPSS+SM SFSPW+ +V AST D
Sbjct  323   TPNRRPPGIATFFNPIDMSLLSAVKAGIFVVQAAGNTGPSSKSMSSFSPWIFTVGASTHD  382

Query  1108  RRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFV  1287
             R Y N I LGN  T  G GL+P T G + + L  A    + ++T   + +  CQD+    
Sbjct  383   RIYNNYIQLGNNLTIPGVGLAPGTDGDSMYTLIGATQALKNDTTENDMYLGECQDSSHLS  442

Query  1288  PSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQ  1467
               L++G L+IC+Y+  F    +S+    +T     A G +  +DP +   Q+      + 
Sbjct  443   EELIKGNLLICSYSIRFVLGLSSVKQALETAKNVSAIGVIFYLDPFVLGFQLN--PTPMH  500

Query  1468  IPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIYSGQGPVVASYS  1644
             +PGLII + + S    +YYNS+ +R+ + ++ V F A A+IL G +A YS   P V  YS
Sbjct  501   MPGLIIPSPDDSKVFLKYYNSSLVRNETSKSIVKFGAVAKILGGLKANYSNSAPKVMYYS  560

Query  1645  SRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHI  1824
             +RGPD  +  L  AD++KPN++APG+ IW AWS         +G++FAL+SGTSMA PH+
Sbjct  561   ARGPDPQDNSLADADIMKPNLIAPGNFIWGAWSSLGTDSAEFEGENFALISGTSMAAPHV  620

Query  1825  AGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGS  1992
             AG+AALIK R P++ PSAI SA+ ++A + D+      +           +PATPFD GS
Sbjct  621   AGLAALIKQRFPHFSPSAIGSALSSTATLYDKQGGPIMAQRAYSNPDLNQSPATPFDMGS  680

Query  1993  GFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPS  2172
             GF+N + AL+PGL+F++ F  +  FLC + G     V    G  C +       DLN PS
Sbjct  681   GFVNATAALDPGLIFDSGFDDFFAFLCGING-STPVVLNYTGQSC-KISTMTGGDLNLPS  738

Query  2173  VTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLN  2352
             +T++ L  SRT+ R VTN+   DE Y V    P GV V++ P  FFI++   ++L +VLN
Sbjct  739   ITVALLNQSRTIARTVTNIAN-DETYSVSWSAPFGVSVSVAPTRFFIASGQKQNLTVVLN  797

Query  2353  ATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             AT  + S  FG++ L G   H   VP +V
Sbjct  798   ATMNSTSAGFGKIGLYGSEGHRSLVPLSV  826



>ref|XP_010315640.1| PREDICTED: subtilisin-like protease isoform X2 [Solanum lycopersicum]
Length=773

 Score =   548 bits (1412),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 339/768 (44%), Positives = 476/768 (62%), Gaps = 21/768 (3%)
 Frame = +1

Query  184   MYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYE  363
             M    +++ HD  L  +LR   Y K+YSY +L+NGFAV V   +A K+  + E V  I  
Sbjct  16    MNGSYVSQMHDSLLRRVLRGEKYLKVYSYHYLINGFAVLVTPQQAFKLARRRE-VSNIVL  74

Query  364   DIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS--SPEEYN  537
             D  ++  TTHTP FLG+P   W + GG   +G G+VIG IDTGI+P H SF+  SPE+  
Sbjct  75    DFSVKTATTHTPQFLGLPRGAWAQEGGYETAGVGIVIGFIDTGIDPTHPSFNDKSPEQTY  134

Query  538   IGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGH  717
                  +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ +ASPFD DGH
Sbjct  135   ----PVPEHFSGICEVTLDFPSGSCNRKLVGARHFAASAITRGIFNATKDFASPFDGDGH  190

Query  718   GSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqav  894
             G+HTAS AAGN+  PVI     +G ASGMAP   IAVYKALY SFGG+ +DVVAA+DQA 
Sbjct  191   GTHTASIAAGNHGVPVIVAGHYFGNASGMAPHTHIAVYKALYKSFGGFAADVVAAIDQAA  250

Query  895   edgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSP  1074
             +DGVDI++LS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +S+ SFSP
Sbjct  251   QDGVDIINLSITPNRRPPGLATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSVASFSP  310

Query  1075  WVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLT  1254
             W+ SV AST DR Y+NSI+LGN  T SG GL+P T     + L +A+     ++ A  + 
Sbjct  311   WIFSVGASTHDRAYSNSILLGNNITISGVGLAPGT--DDMYMLVSAIH-SLNDTAAKDMY  367

Query  1255  VESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGS  1434
             V  CQDA +F  +LV+G L+IC+Y+  F    ++I   ++T     AAG V  MDP + S
Sbjct  368   VSECQDASKFNHTLVQGNLLICSYSIRFVLGLSTIKQASETAMNLSAAGVVFAMDPFVIS  427

Query  1435  EQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIY  1611
              Q+    V +++PG+II + + S  L QYYNS+  +  + R  V F A A IL G    +
Sbjct  428   YQLN--PVPMRLPGIIIPSPDDSKILLQYYNSSLEKDETTRKIVKFGAVACILGGVTPNF  485

Query  1612  SGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFAL  1791
             S   P V  YS+RGPD  +  +D AD+LKPN++APG+SIWAAWS         +G++FA+
Sbjct  486   SLSAPKVMYYSARGPDPEDNSVDNADILKPNLVAPGNSIWAAWSSRGAESIEFQGENFAM  545

Query  1792  VSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqq  1959
             +SGTSMA PHIAG+AALIK + P + P+AI SA+ T+A   ++    + +          
Sbjct  546   MSGTSMAAPHIAGLAALIKQKFPTFSPAAIGSALSTTASQHNKYGGPILAQRAYANPDLN  605

Query  1960  lapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENK  2139
              +PAT FD GSGF+N + AL+PGL+ +T +  Y+ FLC + G     +    G  C  + 
Sbjct  606   QSPATSFDMGSGFVNATAALDPGLILDTSYNDYMAFLCGING-SAPVLLNYTGESCGVS-  663

Query  2140  KFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISA  2319
                 +DLN PS+TIS L  SR V R +TN+ G +E Y V    P GV V + P+ FF+++
Sbjct  664   TMNGADLNMPSITISKLNQSRKVQRMLTNIAG-NETYIVGWSAPNGVSVKVNPKRFFVAS  722

Query  2320  DGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
                + L + LNAT  + + SFG + L+G++ H+V +P +V V  S  S
Sbjct  723   AQQQILNVFLNATMNSTTPSFGRIGLVGNKGHVVNIPLSVVVKISYHS  770



>gb|KHN29777.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=849

 Score =   550 bits (1418),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 340/764 (45%), Positives = 468/764 (61%), Gaps = 15/764 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   +++ HD  L  +L    Y KLYSY +L+NGFAV V   +A K+   +E V  +  D
Sbjct  87    YDSYISRVHDSLLKKVLNGEKYLKLYSYHYLINGFAVLVTQQQAEKLSRSSE-VSNVVLD  145

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP FLG+P   W + GG   +GEGVVIG +DTGI+P H SF    +Y    
Sbjct  146   FSVRTATTHTPQFLGLPQGAWFQDGGFETAGEGVVIGFVDTGIDPTHPSFDD-NKYEKPY  204

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
             P +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ YASPFD DGHG+H
Sbjct  205   P-VPAHFSGICEVTRDFPSGSCNRKLVGARHFAASAITRGIFNSTQDYASPFDGDGHGTH  263

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PVI    ++G ASGMAP + IAVYKALY SFGG+ +DVVAA+DQA +DG
Sbjct  264   TASVAAGNHGIPVIVAGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVAAIDQAAQDG  323

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A + G+ VVQAAGN+GPS  SM SFSPW+ 
Sbjct  324   VDIISLSITPNRRPPGVATFFNPIDMALLSAVKQGIFVVQAAGNTGPSPTSMFSFSPWIY  383

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVE  1260
             +V A++ DR Y+NSI LGN  T  G GL+P T     ++L  A      ++T A  + V 
Sbjct  384   TVGAASHDRVYSNSIFLGNNVTIPGVGLAPGTDESKLYKLIHAHHALSNDTTVADDMYVG  443

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQDA +F  SL++G L++C+Y+  F    ++I   ++T     AAG V  MDP +   Q
Sbjct  444   ECQDAYKFNKSLIKGNLLMCSYSIRFVLGLSTIKRASETAKNLSAAGVVFYMDPFVIGFQ  503

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSN-TLRSRSGRAVAFRATARILDGRRAIYSG  1617
             +    V +++PG+II +   S  L QYYNS+  + + S + V F A A I  G +  YS 
Sbjct  504   LN--PVPMKMPGIIIASTNDSKVLTQYYNSSLEIDAVSKKIVKFGAVATICGGLKPNYSN  561

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  ++L   AD+LKPN++APG+ IWAAWS          G++FAL+S
Sbjct  562   VAPKVMYYSARGPDPEDSLPHEADILKPNLLAPGNFIWAAWSSVGTDSVEFLGENFALMS  621

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqla  1965
             GTSMA PH+AG+AALI+ + PN+ P+AI SA+ T+A + D+      +        Q  +
Sbjct  622   GTSMAAPHVAGLAALIRQKFPNFSPAAIGSALSTTASLYDKSGGPIMAQRSYASPDQNQS  681

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECP-ENKK  2142
             PATPFD GSGF+N S ALNPGLVF++ +  Y+ FLC + G     V    G  C   N  
Sbjct  682   PATPFDMGSGFVNASGALNPGLVFDSGYDDYMSFLCGING-SAPVVLNYTGQNCALYNLT  740

Query  2143  FWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISAD  2322
              +  DLN PS+TIS L  SR V R V N+   +E Y V    P GV V + P +F I + 
Sbjct  741   VYGPDLNLPSITISKLNQSRIVQRTVQNI-AQNESYSVGWTAPNGVSVKVSPTHFCIGSG  799

Query  2323  GSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTAS  2454
               + L ++LNAT +++  SFG + L G++ H+V +P +V V  S
Sbjct  800   ERQVLSVLLNATLSSSVASFGRIGLFGNQGHVVNIPLSVMVKIS  843



>ref|XP_010494483.1| PREDICTED: subtilisin-like protease [Camelina sativa]
 ref|XP_010494484.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=845

 Score =   550 bits (1418),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 336/755 (45%), Positives = 458/755 (61%), Gaps = 13/755 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD FL   L+   + KLYSY +L+NGFA+ V S +A K+  + E V  I  D  + 
Sbjct  89    VAQSHDSFLRKALKGETFIKLYSYHYLINGFALFVSSQQAEKLSMRRE-VANIVLDYSVR  147

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TT+TP F+G+P   W + GG  ++GEGVVIG IDTGI+P H SF   + Y+       
Sbjct  148   TATTYTPQFMGLPQGAWVKEGGFEIAGEGVVIGFIDTGIDPKHPSFDDKDSYSQRSYPTP  207

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
             + F+G C    +FP+ +CN K++GA++FA++A+  G FN S  YASPFD DGHG+HTAS 
Sbjct  208   KHFSGICEVTPDFPSGSCNKKLIGARHFAQSAVTRGIFNTSEDYASPFDGDGHGTHTASM  267

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI +  N+G ASG+AP A I+VYKALY  FGG+ +DVVAA+DQA +DGVDIL
Sbjct  268   AAGNHGIPVIVSNHNFGNASGIAPRAFISVYKALYKGFGGFAADVVAAIDQAAQDGVDIL  327

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GP+ +SM SFSPW+ +V A
Sbjct  328   SLSITPNRKPPGVATFFNPIDMALLSAVKAGIFVVQAAGNTGPAPKSMSSFSPWIFTVGA  387

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPT-AGKAFFQLAAAVDVCRRNSTAGLLTVESCQD  1272
             S+ DR Y+NS+ LGN  T  G G + PT  GK +  ++A   +    S    + V  CQD
Sbjct  388   SSHDRVYSNSLTLGNNVTIPGIGFAIPTDDGKMYKMISAFHALNNSTSVDKDMYVGECQD  447

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
                F   LV G L+IC+Y+  F    ++I    D      A G V  MDP +   QI   
Sbjct  448   YENFDQDLVSGNLLICSYSARFVIGLSTIKQALDVAKNLSAVGVVFYMDPYVLGFQIN--  505

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGR-AVAFRATARILDGRRAIYSGQGPV  1629
                + +PG+II + E S  L +YYN++  R  S +  V+F A A I  G  A +S + P 
Sbjct  506   PTPMDMPGIIIPSAEDSKTLLKYYNTSLQRDGSTKDIVSFGAVASIEGGLNANFSDRAPK  565

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  +   + AD+LKPNI+APG+SIW AWS  S       G+ FA++SGTSM
Sbjct  566   VMYYSARGPDPEDNSFNDADILKPNIVAPGNSIWGAWSSASTDSTEFIGEKFAMMSGTSM  625

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTP  1977
             A PH+AG+AALIK  +  + PS I SA+ T+A + D       +        Q L  ATP
Sbjct  626   AAPHVAGVAALIKQTYTQFTPSLIASALSTTALLYDNKGSPIMAQRSFSNPDQSLYTATP  685

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-  2154
             FD GSGF+N + ALNPGL+F+T F+ Y+ FLC + G D   V    G++C  N       
Sbjct  686   FDMGSGFVNATAALNPGLIFDTSFEDYMSFLCGINGSDA-VVFNYTGLQCSANNATISGF  744

Query  2155  DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRH  2334
             DLN PS+T+S L G++   R V N+ G +E Y V    P GV + + P  F I    ++ 
Sbjct  745   DLNMPSITVSTLNGTQIFQRSVRNIAG-NETYNVGWSPPYGVSMKVSPGLFSIGLGETQV  803

Query  2335  LIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             LII LNATK ++SYSFG + L G+  HIV +P  V
Sbjct  804   LIITLNATKNSSSYSFGRIGLFGNTGHIVNIPVTV  838



>ref|XP_004295458.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=868

 Score =   551 bits (1419),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 330/761 (43%), Positives = 465/761 (61%), Gaps = 16/761 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   + + HD  L   L+   Y KLYSY +L+NGFAV V  D+  K+  + E V  +  D
Sbjct  106   YGSYIARVHDSLLRRALKGEKYLKLYSYHYLINGFAVLVTPDQVNKLSRRRE-VANVVLD  164

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP FLG+P   W + GG   +GEGVVIG IDTGI+P H+SF+   ++    
Sbjct  165   FSVRTATTHTPQFLGLPQGAWVQEGGFKSAGEGVVIGFIDTGIDPTHSSFADNSKHPYPV  224

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
             P     F+G C    +FP+ +CN K++ A++FA +AI  G FN+S+ YASPFD DGHG+H
Sbjct  225   PA---HFSGVCEVTRDFPSGSCNRKLIAARHFAASAITRGVFNISQDYASPFDGDGHGTH  281

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PV+     +G+ASGMAP + IAVYKALY SFGG+ +DVVAA+DQA +DG
Sbjct  282   TASIAAGNHGIPVVVAGHQFGHASGMAPRSHIAVYKALYKSFGGFAADVVAAIDQAAQDG  341

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++  L A + G+ VVQAAGN+GPS +SM SFSPW+ 
Sbjct  342   VDIISLSITPNRRPPGVATFFNPIDMASLSAVKVGIFVVQAAGNTGPSPKSMSSFSPWIF  401

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA-GLLTVE  1260
             +V +++ DR Y+NSI LGN  T  G GL+P T     + L +A+     ++T    + V 
Sbjct  402   TVGSASHDRTYSNSITLGNNVTIPGVGLAPATQNDTVYTLISAMHALNNDTTVTDDMYVS  461

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD+  F   LV+G ++IC+Y+  F    ++I     T     A G V  MD  +   Q
Sbjct  462   ECQDSSNFNQDLVQGNVLICSYSIRFVLGMSTIQQALQTAQNLSAVGVVFYMDSFMIGFQ  521

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRS-RSGRAVAFRATARILDGRRAIYSG  1617
             +      +++PG+II++ E S A  QYYN +  R   +G+ + F A A I  G +A YS 
Sbjct  522   LN--PTPMKMPGIIISSPEDSKAFIQYYNRSLERDITTGKIIKFGAVAAICGGTKANYSN  579

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  +   D AD++KPN++APG+SIWAAWS         +G+ FA++S
Sbjct  580   ISPKVMYYSARGPDPEDNSFDIADIMKPNLVAPGNSIWAAWSSVGADSVEFQGESFAMLS  639

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqla  1965
             GTSMA PH+AG+AAL+K + PN+ PSAI SA+ TSA + D+      +        Q  +
Sbjct  640   GTSMAAPHVAGLAALVKQKFPNFSPSAIASALSTSASLYDKTGGPIMAQRAYAFPDQNQS  699

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKK  2142
             PATPFD GSGF+N + ALNPGL+F++ +  Y+ FLC + G     V    G  C   N  
Sbjct  700   PATPFDMGSGFVNATGALNPGLIFDSSYDNYMSFLCGING-SAPVVLNYTGHSCWVYNST  758

Query  2143  FWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISAD  2322
                 DLN PS+TI+NL  SRTV+R V NV G +E Y V    P GV + + P +F+I++ 
Sbjct  759   INAGDLNLPSITIANLNQSRTVLRTVINVAG-NESYSVGWSAPFGVSLKVSPSHFYIASG  817

Query  2323  GSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
              ++ L +  NAT  + + S+G + L G++ H+V +P +V V
Sbjct  818   ETQVLSVFFNATSNSAAASYGRIGLFGNQGHVVNIPLSVIV  858



>ref|XP_009796976.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=854

 Score =   550 bits (1416),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 331/764 (43%), Positives = 471/764 (62%), Gaps = 21/764 (3%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             +   +++ HD  L  + R   Y KL+SY +L+NGFAV V   +A K+  + E V  +  D
Sbjct  98    HASSISRMHDSLLRKIFRGEKYLKLHSYHYLINGFAVLVTPQQAFKLASRRE-VSNVVLD  156

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS--SPEEYNI  540
               +   TTHTP FLG+P   W + GG   +GEG+VIG+IDTGI+P H SFS  +PE +  
Sbjct  157   FSVRTATTHTPQFLGLPLGAWAQEGGYETAGEGIVIGLIDTGIDPTHPSFSDNTPERHY-  215

Query  541   GRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHG  720
                 +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ YASPFD DGHG
Sbjct  216   ---PVPEHFSGICEVTRDFPSGSCNRKLVGARHFAASAITRGIFNATQDYASPFDGDGHG  272

Query  721   SHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqave  897
             +HTAS AAGN+  PV+    ++GYASGMAP + +AVYKALY SFGG+ +DVVAA+DQA +
Sbjct  273   THTASIAAGNHGIPVVVAGHHFGYASGMAPRSHVAVYKALYKSFGGFAADVVAAIDQAAQ  332

Query  898   dgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPW  1077
             DGVDI++LS+ P+  P G + F N +++ LL A +AG+ VVQA GN+GPS +S+ SFSPW
Sbjct  333   DGVDIINLSITPNRRPPGVATFFNPIDMALLSAVKAGIFVVQAVGNTGPSPKSISSFSPW  392

Query  1078  VTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTV  1257
             + +V AST DR Y NSIVLGN  T  G GL+P T   + + L  A+     ++ A  + V
Sbjct  393   IFAVGASTHDRVYGNSIVLGNNITIPGVGLAPGT--DSMYTLVLAIHALN-DTAASDMYV  449

Query  1258  ESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSE  1437
               CQDA  F  +LV+G L++C+Y+  F    ++I    +T     AAG V  +DP +   
Sbjct  450   GECQDASSFNQTLVQGNLLVCSYSVRFVLGLSTIKQALETAKNLSAAGIVFYLDPFVIGF  509

Query  1438  QIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYS  1614
             QI    + +++PG+II +   S  L QYYNS+  +   + + + F A A I  G +A +S
Sbjct  510   QIN--PIPMRLPGIIIPSANDSEILLQYYNSSLDQDEVTKKIIRFGAVACISGGLKANFS  567

Query  1615  GQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALV  1794
                P V  YS+RGPD  ++ LD AD+LKPN++APG+SIWAAWS         +G+ FA++
Sbjct  568   LSAPKVMFYSARGPDPEDSFLDDADILKPNLVAPGNSIWAAWSSGGMESVEFEGEGFAMM  627

Query  1795  SGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqql  1962
             SGTSMA PHIAG+AALIK + P+  P+AI SA+ T+A + D       +           
Sbjct  628   SGTSMAAPHIAGLAALIKQKFPSLSPAAIGSALSTTASLYDNNGGPILAQRAYANPDLNQ  687

Query  1963  apaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKK  2142
             +PATPFD GSGF+N + AL+PGL+F+T +  Y+ FLC + G     V    G  C  +  
Sbjct  688   SPATPFDMGSGFVNATAALDPGLIFDTSYSDYMSFLCGING-SAPVVLNYTGESCGAS-T  745

Query  2143  FWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISAD  2322
                ++LN PS+TIS L  SRTV R + N+ G +E Y V    P G  + + P +FFI++ 
Sbjct  746   MNGTELNLPSITISKLNQSRTVQRTLINIAG-NETYAVGWSAPYGASINVTPAHFFIASG  804

Query  2323  GSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTAS  2454
               + L +V NATK   + S+G + L G++ H++ +P +V V  S
Sbjct  805   QQQVLNVVFNATKNNTAPSYGRIGLFGNQGHVINIPLSVIVKIS  848



>ref|XP_010655857.1| PREDICTED: subtilisin-like protease SDD1 [Vitis vinifera]
 emb|CBI39006.3| unnamed protein product [Vitis vinifera]
Length=842

 Score =   549 bits (1414),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 336/762 (44%), Positives = 468/762 (61%), Gaps = 15/762 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   +++ HD  L   LR   Y KLYSY +L+NGFAV V S +A K+  + E V  +  D
Sbjct  82    YNSYISRVHDSLLRRALRGEQYLKLYSYHYLINGFAVFVTSQQAEKLAKRRE-VANVVLD  140

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP FLG+P   W + GG   +GEG+VIG IDTGI+P H SF+  +   +  
Sbjct  141   FSVRTATTHTPQFLGLPQGAWVQEGGYDSAGEGIVIGFIDTGIDPTHPSFAV-DRSEVAY  199

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
             P +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN S+ YASPFD DGHG+H
Sbjct  200   P-VPAHFSGICEVTPDFPSGSCNRKLVGARHFAASAITRGIFNASQDYASPFDGDGHGTH  258

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PV+    ++G ASGMAP A IAVYKALY SFGG+ +DVVAA+DQA +DG
Sbjct  259   TASIAAGNHGIPVVVAGHHFGNASGMAPRAHIAVYKALYKSFGGFAADVVAAIDQAAQDG  318

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +S+ SFSPW+ 
Sbjct  319   VDIVSLSITPNRRPPGIATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSVSSFSPWIF  378

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVE  1260
             +V A+  DR Y+NSIVLGN  T  G GL+P T     + L +A+     ++T A  + V 
Sbjct  379   TVGAAAHDRAYSNSIVLGNNVTIPGVGLAPGTHRGRMYTLVSALHALNNDTTIANDMYVG  438

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD+      LV+G L+IC+Y+  F    ++I     T     AAG V  MDP +   Q
Sbjct  439   ECQDSSSLKQDLVQGNLLICSYSIRFVLGLSTIKQALQTAKNLSAAGVVFYMDPFVIGFQ  498

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIYSG  1617
             +    + +++PG+II++ + S    QYYN +  R  S +  V F A A I  G +  YS 
Sbjct  499   LN--PIPMKMPGIIISSPDDSKIFLQYYNHSLERQGSTKEIVKFGAAASISGGLKPNYSN  556

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  ++ LD AD++KPN++APG+ IWAAWS          G++FA++S
Sbjct  557   SAPKVMYYSARGPDPEDSFLDDADIMKPNLVAPGNFIWAAWSSLGTDSVEFLGENFAMMS  616

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqla  1965
             GTSMA PH++G+AALIK + P + PSAI SA+ T+A + +R      +           +
Sbjct  617   GTSMAAPHVSGLAALIKQKFPKFSPSAIGSALSTTASLYNRNGGPIMAQRAYANPDLNQS  676

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF  2145
             PATPFD GSGF+N + AL+PGL+F+  +  Y+ FLC + G     V    G  C  +   
Sbjct  677   PATPFDMGSGFVNATAALDPGLIFDASYDDYMSFLCGING-SAPMVLNYTGEMCGVS-TM  734

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
               +D+N PS+TI+ L  +RTV RRVTNV  ++E Y V    P GV V ++P +FFI+   
Sbjct  735   NGTDINLPSITIARLEQTRTVQRRVTNV-DSNETYIVGWSAPYGVSVNVVPTHFFIACGE  793

Query  2326  SRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTA  2451
             ++ L + L+AT  + + SFG + L+G   HIV +P AV   A
Sbjct  794   TQTLTVTLSATMNSTAASFGRIGLVGKGGHIVNIPVAVIFKA  835



>ref|XP_006644772.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=845

 Score =   549 bits (1414),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 334/759 (44%), Positives = 471/759 (62%), Gaps = 17/759 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   + +  + FL   LR   Y KLYSY +L+NGFAV +   +A K+  + E V  +  D
Sbjct  88    YGSYLVRLQNSFLKRTLRGERYVKLYSYRYLINGFAVVITPQQAEKLSRRKE-VANVMLD  146

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP+FLG+P+  W + GGP  +G+GVV+G+IDTGI+P H SF+  ++     
Sbjct  147   FSVRTATTHTPEFLGLPEGAWVQEGGPQCAGQGVVVGLIDTGIDPTHPSFA--DDLITDS  204

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
               +   ++G C   ++FP+ +CN K+VGA++FA +AI  G FN S+ +ASP D+DGHG+H
Sbjct  205   YPVPAHYSGICEVTNDFPSGSCNRKLVGARHFAASAITRGVFNASQDHASPSDSDGHGTH  264

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PV+    ++G ASGMAP A IAVYKALY SFGG+ +DVVAA+DQA ED 
Sbjct  265   TASIAAGNHGIPVVVAGHHFGDASGMAPRAHIAVYKALYKSFGGFAADVVAAIDQAAEDN  324

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM S+SPW+ 
Sbjct  325   VDIISLSITPNRRPPGLATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSMSSYSPWIF  384

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVE  1260
             +V AS  DR Y N +VLGN  T +G GL+P T G + + L AA    + N+ +   +++ 
Sbjct  385   TVGASAHDREYNNYVVLGNNLTITGVGLAPGTDGDSMYTLVAAPHALKNNAASPTEMSLG  444

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD+      L+RGK+++C+Y+  F    +S+    DT     AAG +  +DP +   Q
Sbjct  445   ECQDSSHLDEDLIRGKILVCSYSIRFVLGLSSVKLALDTAKNVSAAGVIFYLDPFVIGFQ  504

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSG  1617
             +      + +PGLII + + S     YYN + +R   S + V+F A A+IL G +  Y  
Sbjct  505   LN--PTPMDMPGLIIPSSDDSKVFLNYYNESLVRDETSNKIVSFGAVAKILGGLKPNYGF  562

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  +  L  AD+LKPN++APGSSIW AWS          G+ FA++S
Sbjct  563   SAPKVMFYSARGPDPEDNSLANADILKPNLIAPGSSIWGAWSSLGLDSAEFAGESFAMIS  622

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqa----sqqla  1965
             GTSMA PHIAG+AALIK + P + P+AI SA+ T+  ++DR G+P++AQ+     +   +
Sbjct  623   GTSMAAPHIAGLAALIKQKFPYFSPAAIGSALSTTTSLSDRQGNPIMAQRTYGNPNSTQS  682

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF  2145
             PATPFD G+GF+N + AL+PGL+F+  +  +  FLC + G     V    G  C  +   
Sbjct  683   PATPFDMGNGFVNATAALDPGLIFDCSYDDFFSFLCGING-SAPVVMNYTGSSCGAS-TM  740

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
               +DLN PS+TI+ L  SRT+ R VTNV G DE Y V    P GV V+  P  FFI   G
Sbjct  741   AGADLNLPSITIAVLNQSRTITRTVTNVAG-DESYTVSYSAPYGVAVSASPAQFFIPG-G  798

Query  2326  SRHLI-IVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              R L+  V++AT  + S SFG +   GD+ H V VPF+V
Sbjct  799   QRQLVTFVVSATMNSTSASFGNVGFYGDKGHRVMVPFSV  837



>ref|XP_009602760.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=853

 Score =   549 bits (1414),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 332/764 (43%), Positives = 470/764 (62%), Gaps = 21/764 (3%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             +   +++ HD  L  + R   Y KL+SY +L+NGFAV V   +A K+  + E V  +  D
Sbjct  97    HASSISRMHDSLLRKIFRGEKYLKLHSYHYLINGFAVLVTPQQAFKLASRRE-VSNVILD  155

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS--SPEEYNI  540
               +   TTHTP FLG+P   W + GG   +GEG+VIG+IDTGI+P H SFS  +PE +  
Sbjct  156   FSVRTATTHTPQFLGLPLGAWAQEGGFETAGEGIVIGLIDTGIDPTHPSFSDNTPERHY-  214

Query  541   GRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHG  720
                 +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ YASPFD DGHG
Sbjct  215   ---PVPEHFSGICEVTRDFPSGSCNRKLVGARHFAASAITRGIFNATQDYASPFDGDGHG  271

Query  721   SHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqave  897
             +HTAS AAGN+  PV+    ++GYASGMAP + +AVYKALY SFGG+ +DVVAA+DQA +
Sbjct  272   THTASIAAGNHGIPVVVAGHHFGYASGMAPRSHVAVYKALYKSFGGFAADVVAAIDQAAQ  331

Query  898   dgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPW  1077
             DGVDI++LS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +S+ SFSPW
Sbjct  332   DGVDIINLSITPNRRPPGVATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSISSFSPW  391

Query  1078  VTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTV  1257
             + +V AST DR Y NSIVLGN  T  G GL+P T   + + L  A+     ++ A  + V
Sbjct  392   IFTVGASTHDRVYGNSIVLGNNITIRGVGLAPGT--DSMYTLVMAIHALN-DTAANDMYV  448

Query  1258  ESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSE  1437
               CQDA  F  +LV+G L++C+Y+  F    ++I    +T     AAG V  +DP +   
Sbjct  449   GECQDASSFNQTLVQGNLLVCSYSVRFVLGLSTIKQALETAKNLSAAGVVFYLDPFVIGF  508

Query  1438  QIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYS  1614
             QI      +++PG+II +   S  L QYYNS+  +   + + + F A A I  G +A +S
Sbjct  509   QIN--PTPMRLPGIIIPSANDSEILLQYYNSSLDQDEVTKKIIRFGAVACISGGLKANFS  566

Query  1615  GQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALV  1794
                P V  YS+RGPD  ++ LD AD+LKPN++APG+SIWAAWS         +G+ FA++
Sbjct  567   LSAPKVMFYSARGPDPEDSFLDDADILKPNLVAPGNSIWAAWSSGGMESVEFEGEDFAMM  626

Query  1795  SGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqql  1962
             SGTSMA PHIAG+AALIK + P+  P+AI SA+ T+A + D       +           
Sbjct  627   SGTSMAAPHIAGLAALIKQKFPSLSPAAIGSALSTTASLYDNNGGPILAQRAYANPDSNQ  686

Query  1963  apaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKK  2142
             +PATPFD GSGF+N + AL+PGL+F+T +  Y+ FLC + G     V    G  C  +  
Sbjct  687   SPATPFDMGSGFVNATAALDPGLIFDTSYSDYMSFLCGING-SAPVVLNYTGESCGAS-T  744

Query  2143  FWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISAD  2322
                ++LN PS+TIS L  S+TV R + N+ G +E Y V    P GV + + P  FFI++ 
Sbjct  745   MNGTELNLPSITISKLNQSKTVQRTLINIAG-NETYAVGWSAPYGVSINVTPARFFIASG  803

Query  2323  GSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTAS  2454
               + L  V NATK   + S+G + L G++ H++ +P +V V  S
Sbjct  804   QQQVLNFVFNATKNNTAPSYGRIGLFGNQGHVINIPLSVIVKIS  847



>ref|XP_010529345.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=856

 Score =   549 bits (1414),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 333/761 (44%), Positives = 469/761 (62%), Gaps = 19/761 (2%)
 Frame = +1

Query  190   KQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDI  369
             +  + + HD  L   L+   Y KLYSY +L+NGFAV V   +A ++  + E V  I  D 
Sbjct  97    RPSIAQAHDSLLKRALKGEKYLKLYSYHYLINGFAVLVNPQQAERLSRRRE-VANIVLDF  155

Query  370   KMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRP  549
              +   TT+TP F+G+P   W + GG   +GEG+VIG IDTG++P H SF+   +  I +P
Sbjct  156   SVRTATTYTPQFMGLPQGAWVQEGGYETAGEGIVIGFIDTGVDPTHPSFN---DTGISQP  212

Query  550   R--ITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGS  723
                I + F+G C    +FPA +CN K+VGA++FA +AI  G FN S  YASPFD DGHG+
Sbjct  213   PYPIPKHFSGVCEVTPDFPAGSCNRKLVGARHFAESAITRGIFNSSEDYASPFDGDGHGT  272

Query  724   HTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqaved  900
             HTAS AAGN+  PVI    ++G ASG+AP A ++VYKALY SFGG+ +DVVAA+DQA +D
Sbjct  273   HTASVAAGNHGIPVIVAGHDFGNASGIAPRAHVSVYKALYKSFGGFAADVVAAIDQAAQD  332

Query  901   gvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWV  1080
             GVDI+SLS+ P+  P G + F N +++ +L A +AG+ VVQAAGN+GPS +SM SFSPW+
Sbjct  333   GVDIISLSITPNRRPPGVATFFNPIDMAILSAVKAGIFVVQAAGNTGPSPKSMSSFSPWI  392

Query  1081  TSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPT-AGKAFFQLAAAVDVCRRNSTAGLLTV  1257
              +V A++ DR Y+NSIVLGN  T  G GL+PPT  GK +  ++A   +  R S    + V
Sbjct  393   FTVGAASHDRVYSNSIVLGNNVTIPGVGLAPPTDKGKMYRMVSALHALNNRTSVDKDIYV  452

Query  1258  ESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSE  1437
               CQD   F   LV G L+IC+Y+  F    ++I    D      A G V  MDP +   
Sbjct  453   GECQDQDSFNQDLVNGNLLICSYSIRFVLGLSTIKQALDVAKNLSATGVVFYMDPYVFGF  512

Query  1438  QIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIYS  1614
             Q+      + + G+II + E S  L +YYNS+  R  + +  V F A   I  G +A +S
Sbjct  513   QLN--PTPMDMSGIIIPSPEDSKVLLEYYNSSLERDGTTKEIVKFGAVGSIEGGLQANFS  570

Query  1615  GQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALV  1794
              + P V  YS+RGPD  ++ L+ AD+LKPN++APG+SIWAAWS         +G+ FA++
Sbjct  571   DRAPKVMYYSARGPDPEDSSLNDADILKPNLVAPGNSIWAAWSSAGTDSVEFEGEKFAIM  630

Query  1795  SGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqql  1962
             SGTSMA PH+AG+AALIK + PN+ PSAI SA+ TSA + D       +        Q  
Sbjct  631   SGTSMAAPHVAGVAALIKQKFPNFSPSAIASALSTSAILLDNKGGPIMAQRAYSNPDQNQ  690

Query  1963  apaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC--PEN  2136
             +PATPFD G+GF+N + AL+PGL+F+T F+ Y+ FLC + G     V    G  C    N
Sbjct  691   SPATPFDMGNGFVNATAALDPGLIFDTSFEDYMSFLCGING-SAPVVFNYTGQNCWSSSN  749

Query  2137  KKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFIS  2316
                  SDLN PS+TIS L G++T++R + NV   +E Y V    P GV + + P  F I+
Sbjct  750   STITGSDLNLPSITISKLNGTKTILRLMANV-AVNETYSVGWSPPYGVSMKVSPTRFSIA  808

Query  2317  ADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             + G++ L + L+A+K +++ SFG + L G+  H++ +P +V
Sbjct  809   SGGTQLLNVTLDASKNSSNASFGRIGLFGNMGHVINIPVSV  849



>ref|XP_008793538.1| PREDICTED: subtilisin-like protease isoform X2 [Phoenix dactylifera]
Length=771

 Score =   546 bits (1406),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 330/757 (44%), Positives = 465/757 (61%), Gaps = 14/757 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   +    D  L   L+   Y KLYSY +L+NGFAV + + +A K+  + E V  +  D
Sbjct  12    YSSYLIHLQDSLLRRALKGENYLKLYSYHYLINGFAVLITNQQAEKLSRRRE-VANVVLD  70

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP+FLG+P   W + GGP V+G+G+VIG IDTGI+P H SFS  ++ ++  
Sbjct  71    FSVRTATTHTPEFLGLPQGAWVQEGGPEVAGQGIVIGFIDTGIDPTHPSFS--DDLSLNL  128

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
               I   F+G C    +FP+ +CN K+VGA++FA +AI  G FN S+ YASPFD DGHG+H
Sbjct  129   YPIPAHFSGVCEVTKDFPSGSCNRKLVGARHFAASAITRGIFNASQDYASPFDGDGHGTH  188

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PVI +   +G ASGMAP A I++YKALY SFGG+ +DVVAA+DQA +DG
Sbjct  189   TASIAAGNHGIPVIVSGHCFGNASGMAPHAHISIYKALYKSFGGFAADVVAAIDQAAQDG  248

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPSS+SM SFSPW+ 
Sbjct  249   VDIISLSITPNRRPPGIATFFNPIDMSLLSAVKAGIFVVQAAGNTGPSSKSMSSFSPWIF  308

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVES  1263
             +V AST DR Y N I LGN  T  G GL+P T G + + L  A    + ++T   + +  
Sbjct  309   TVGASTHDRIYNNYIQLGNNLTIPGVGLAPGTDGDSMYTLIGATQALKNDTTENDMYLGE  368

Query  1264  CQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQI  1443
             CQD+      L++G L+IC+Y+  F    +S+    +T     A G +  +DP +   Q+
Sbjct  369   CQDSSHLSEELIKGNLLICSYSIRFVLGLSSVKQALETAKNVSAIGVIFYLDPFVLGFQL  428

Query  1444  KGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIYSGQ  1620
                   + +PGLII + + S    +YYNS+ +R+ + ++ V F A A+IL G +A YS  
Sbjct  429   N--PTPMHMPGLIIPSPDDSKVFLKYYNSSLVRNETSKSIVKFGAVAKILGGLKANYSNS  486

Query  1621  GPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSG  1800
              P V  YS+RGPD  +  L  AD++KPN++APG+ IW AWS         +G++FAL+SG
Sbjct  487   APKVMYYSARGPDPQDNSLADADIMKPNLIAPGNFIWGAWSSLGTDSAEFEGENFALISG  546

Query  1801  TSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlap  1968
             TSMA PH+AG+AALIK R P++ PSAI SA+ ++A + D+      +           +P
Sbjct  547   TSMAAPHVAGLAALIKQRFPHFSPSAIGSALSSTATLYDKQGGPIMAQRAYSNPDLNQSP  606

Query  1969  aTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFW  2148
             ATPFD GSGF+N + AL+PGL+F++ F  +  FLC + G     V    G  C +     
Sbjct  607   ATPFDMGSGFVNATAALDPGLIFDSGFDDFFAFLCGING-STPVVLNYTGQSC-KISTMT  664

Query  2149  CSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGS  2328
               DLN PS+T++ L  SRT+ R VTN+   DE Y V    P GV V++ P  FFI++   
Sbjct  665   GGDLNLPSITVALLNQSRTIARTVTNIAN-DETYSVSWSAPFGVSVSVAPTRFFIASGQK  723

Query  2329  RHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             ++L +VLNAT  + S  FG++ L G   H   VP +V
Sbjct  724   QNLTVVLNATMNSTSAGFGKIGLYGSEGHRSLVPLSV  760



>ref|XP_004145469.1| PREDICTED: subtilisin-like protease SDD1-like, partial [Cucumis 
sativus]
Length=790

 Score =   546 bits (1407),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 339/793 (43%), Positives = 475/793 (60%), Gaps = 34/793 (4%)
 Frame = +1

Query  109   KIYMVLMEDHPFVSTRIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNG  288
             +I++V+MED      R      N  M    +   H   L + ++   Y KL+S+  +LNG
Sbjct  20    EIFLVVMEDDGGDELR-----SNKEML--LIEDSHKKVLENSIKN--YRKLHSFKKILNG  70

Query  289   FAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI----PDTVWPRLGGPSVS  456
             FAVH    +A K L +A GV+ +  D  + KMTT+TP+FLG+     D  +   GG    
Sbjct  71    FAVHTTPSEASK-LREANGVKLVELDRGVRKMTTYTPEFLGLVKNNNDYKYNYSGG----  125

Query  457   GEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQ  636
             G+G++IG +D+GI P H SFS+    N G+          C  G  FP   CNGKIV A+
Sbjct  126   GDGILIGFVDSGIYPTHPSFSN----NFGKEDDDELV---CEEGPLFPKGCCNGKIVSAR  178

Query  637   YFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGA  816
             +F+  A AA   N S  + SPFDA+GHGSH AS AAGN   PVI + F YG A+G+AP A
Sbjct  179   FFSAGAQAAAVLNSSIDFLSPFDAEGHGSHVASIAAGNAEVPVIVDGFFYGLATGIAPHA  238

Query  817   GIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFA  996
              IAVYKA+Y     ++DV++A+DQAV DGVDIL+LSVGP+        FL++ ++ +L A
Sbjct  239   RIAVYKAVYPTVATLTDVISAIDQAVIDGVDILALSVGPNEPSDVGFTFLSIYDIAILSA  298

Query  997   TRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPP  1176
             TRAG+LVVQAAGN+GP+  +++S+SPW   VAAS TDR Y+ S++LGNGQ   G G+S P
Sbjct  299   TRAGILVVQAAGNNGPARATVVSYSPWAIGVAASGTDRVYSTSLLLGNGQKVGGVGMSGP  358

Query  1177  TAGKAFF--QLAAAVDVCRRNSTAGLLT---VESCQDAMQFVPSLVRGKLVICTYTYDFE  1341
             + G  FF  +L  A D  ++N T        +E CQ    F P++V+  +V+C+++  F 
Sbjct  359   SLGSEFFLHKLVLAKDATKQNETNYNDIPSYIEECQHPEAFDPNIVQNSIVLCSFSQGFL  418

Query  1342  SEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQY  1521
             +  +S+A +  T  +    GFVL  +P+ G        +  ++PG+++ ++  +  + +Y
Sbjct  419   NGTSSLAAIIHTAKQLKFMGFVLIANPNYG--DFIAEPIPFRVPGILVPSVSDTQVILKY  476

Query  1522  YNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKP  1701
             Y  NT +   G    F+  A I +GR A +  Q P V+ +SSRGPD  N     ADVLKP
Sbjct  477   YEENTCKDERGMVREFKGKAGIGEGRIASFGNQAPTVSRFSSRGPDYININRSLADVLKP  536

Query  1702  NIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAI  1881
             +I+APG  IWAAWSP S  +  +KG HFAL+SGTSMA PHI GIAALIK ++P+W PS I
Sbjct  537   DILAPGHQIWAAWSPLSASEPLLKGYHFALMSGTSMAAPHIVGIAALIKQKYPSWTPSMI  596

Query  1882  TSAMMTSADVTD-RlgspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQY  2058
              SAM T+A   D               L P+TPFDFG+G ++PS AL+PGLVF T ++  
Sbjct  597   ASAMSTTATKYDMNGDLIQAEGFNLHALYPSTPFDFGAGLVSPSNALDPGLVFPTEYEDN  656

Query  2059  IQFLCAVPGVDEKSVRRVVGVECPEN-KKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGG  2235
             I FLC++PGVD   V+   G +C  +      +DLN PS+TIS+LVG + V RRV NVGG
Sbjct  657   INFLCSLPGVDPAVVKSATGGQCNASISHSHPADLNLPSITISSLVGHQVVQRRVKNVGG  716

Query  2236  ADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNH  2415
               E Y   V  P G  V I P  F ++A+  ++L I + AT  T+ ++FGE+IL G  NH
Sbjct  717   KVETYVWSVIPPNGTTVNINPPVFTVAAEEVQNLEIQIIATHKTDHFTFGEIILTGSLNH  776

Query  2416  IVRVPFAVYVTAS  2454
             I R+P ++ V ++
Sbjct  777   IARIPLSILVVSA  789



>ref|XP_007211343.1| hypothetical protein PRUPE_ppa001355mg [Prunus persica]
 gb|EMJ12542.1| hypothetical protein PRUPE_ppa001355mg [Prunus persica]
Length=846

 Score =   548 bits (1412),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 331/773 (43%), Positives = 474/773 (61%), Gaps = 17/773 (2%)
 Frame = +1

Query  154   RIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILH  333
             R +  S     Y   + + HD  L  +LR   Y KLYSY +L++GFAV V  D+  K+  
Sbjct  73    RYRNISRTDKRYSSYIARVHDSLLRRVLRGEKYLKLYSYHYLISGFAVLVTPDQVDKLSR  132

Query  334   KAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHAS  513
             + E V  +  D  +   TTHTP FLG+P   W + GG   +GEG+VIG IDTGI+P H+S
Sbjct  133   RRE-VANVVLDFSVRTATTHTPQFLGLPQGAWVQGGGYESAGEGMVIGFIDTGIDPTHSS  191

Query  514   FSSPEEYNIGRPR-ITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHY  690
             F+   ++    P  +   F+G C    +FP+ +CN K++GA++FA +AI  G FN S+ +
Sbjct  192   FA---DHTSEHPYPVPAHFSGICEVTRDFPSGSCNRKLIGARHFAASAITRGVFNSSQDF  248

Query  691   ASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSd  867
             ASPFD DGHG+HTAS AAGN+  PV+    ++G ASGMAP + IAVYKALY  FGG+ +D
Sbjct  249   ASPFDGDGHGTHTASIAAGNHGIPVVVAGHHFGNASGMAPRSHIAVYKALYKGFGGFAAD  308

Query  868   vvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPS  1047
             VVAA+DQA +DGVDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS
Sbjct  309   VVAAIDQAAQDGVDIISLSITPNRRPPGVATFFNPIDMALLSAVKAGIFVVQAAGNTGPS  368

Query  1048  SRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCR  1227
              +SM SFSPW+ +V +++ DR Y+NSI+LGN  T  G GL+P T     + L +AV    
Sbjct  369   PKSMSSFSPWIFTVGSASHDRVYSNSIILGNNVTIPGVGLAPGTENDTMYTLISAVHALN  428

Query  1228  RNST-AGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGF  1404
               +T A  + V  CQD+ +F   L++G L+IC+Y+  F    +++    +T     A G 
Sbjct  429   NGTTVADDMYVGECQDSSKFNQDLIQGNLLICSYSIRFVLGISTVNHALETAKNLSAVGV  488

Query  1405  VLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRS-RSGRAVAFRATA  1581
             V  MD  +   Q+      ++IPG+II + E S  L +YYN +  R   + + V F A A
Sbjct  489   VFYMDAFVIGFQLN--PTPMKIPGIIIPSPEDSKVLLKYYNYSLERDIMTKKIVKFGALA  546

Query  1582  RILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGD  1761
              I  G +A YS   P +  YS+RGPD  +  LD A+++KPN++APG+SIWAAWS      
Sbjct  547   TICGGFKANYSSSAPKIMYYSARGPDPEDNFLDDAEIMKPNLVAPGNSIWAAWSSVGADS  606

Query  1762  KYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gs  1929
                +G++FA++SGTSMA PHIAG+AAL++ + PN+ PSAI SA+ T+A + D+      +
Sbjct  607   VEFQGENFAMMSGTSMAAPHIAGLAALVRQKFPNFSPSAIASALSTTASLYDKNGGPIMA  666

Query  1930  pllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRR  2109
                     Q  +PATPFD GSGF+N + ALNPGL+F++ +  Y+ FLC + G     V  
Sbjct  667   QRAYAFPDQNQSPATPFDMGSGFVNATAALNPGLIFDSSYDNYMSFLCGING-SAPVVLN  725

Query  2110  VVGVEC-PENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRV  2286
               G  C   N     +DLN PS+TI+ L  SRTV+R V NVGG +E Y V    P GV V
Sbjct  726   YTGESCWVYNSTIAGADLNLPSITIAKLNQSRTVLRSVMNVGG-NETYSVGWSAPFGVSV  784

Query  2287  TIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
              + P +F+I++   + L +  N+T  + + S+G + L G++ H+V +P +V V
Sbjct  785   KVSPAHFYIASGEKQVLSVFFNSTANSTTASYGRIGLFGNQGHVVNIPLSVIV  837



>ref|XP_006281657.1| hypothetical protein CARUB_v10027793mg [Capsella rubella]
 gb|EOA14555.1| hypothetical protein CARUB_v10027793mg [Capsella rubella]
Length=845

 Score =   548 bits (1412),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 334/755 (44%), Positives = 459/755 (61%), Gaps = 13/755 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD FL   L+   Y KLYSY +L+NGFA+ V S +A K+  + E V  I  D  + 
Sbjct  89    VAQSHDSFLRKTLKGEKYIKLYSYHYLINGFALFVSSQQAEKLSMRRE-VANIVLDYSVR  147

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TT+TP F+G+P   W + GG  ++GEGVVIG IDTGI+P H SF   +  +       
Sbjct  148   TATTYTPQFMGLPQGAWVKEGGFEIAGEGVVIGFIDTGIDPKHPSFDDNDSNSRRSYPTP  207

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
             + F+G C    +FP+ +CN K++GA++FA++A+  G FN S  YASP+D DGHG+HTAS 
Sbjct  208   KHFSGICEVTPDFPSGSCNRKLIGARHFAQSAVTRGVFNSSEDYASPYDGDGHGTHTASI  267

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI +  N+G ASG+AP A I+VYKALY  FGG+ +DVVAA+DQA +DGVDIL
Sbjct  268   AAGNHGVPVIVSNHNFGNASGIAPRAFISVYKALYKGFGGFAADVVAAIDQAAQDGVDIL  327

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GP+++SM SFSPW+ +V A
Sbjct  328   SLSITPNRKPPGVATFFNPIDMALLSAVKAGIFVVQAAGNTGPAAKSMSSFSPWIFTVGA  387

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPT-AGKAFFQLAAAVDVCRRNSTAGLLTVESCQD  1272
             S+ DR Y+NS++LGN  T  G G S PT  GK +  ++A   V    S    + V  CQD
Sbjct  388   SSHDRVYSNSLILGNNVTIPGIGFSIPTDDGKMYKMISAFHAVNNSTSVDNDMYVGDCQD  447

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
                F   LV G L+IC+Y+  F    ++I    D      A G V  MDP +   QI   
Sbjct  448   YENFDQDLVSGNLLICSYSARFVIGLSTIKQALDVAKNLSAIGVVFYMDPYVLGFQIN--  505

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIYSGQGPV  1629
                + +PG+II + E S  L +YYN++  R  S +  V+F A A I  G  A +S + P 
Sbjct  506   PTPMDMPGIIIPSAEDSKTLLKYYNTSLQRDGSTKEIVSFGAVAAIEGGLNANFSDRAPK  565

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  +   + AD+LKPN++APG+SIW AWS  S      +G+ FA++SGTSM
Sbjct  566   VMYYSARGPDPEDNSFNDADILKPNLVAPGNSIWGAWSSASTDSTEFEGEKFAMMSGTSM  625

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTP  1977
             A PH+AG+AALIK  +P + PS I SA+ T+A + D       +        Q L  ATP
Sbjct  626   AAPHVAGVAALIKQTYPQFTPSQIASALSTTALLDDNKGGPIMAQRSFSNPDQSLYTATP  685

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-  2154
             FD GSGF+N + AL+PGL+F+T F  Y+ FLC + G D   V    G+ C  N       
Sbjct  686   FDMGSGFVNATAALDPGLIFDTSFDDYMSFLCGINGSD-PVVFNYTGLHCSANNATISGF  744

Query  2155  DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRH  2334
             DLN PSVT+S L G++T  R + ++ G +E Y V    P GV + + P  F I    ++ 
Sbjct  745   DLNLPSVTVSTLSGTQTFQRSIRSIAG-NETYNVGWSPPYGVSMKVSPNMFSIGMGETQL  803

Query  2335  LIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             L + LNATK ++S SFG + L G+R HIV +P  V
Sbjct  804   LSVTLNATKNSSSSSFGRIGLFGNRGHIVNIPVTV  838



>ref|XP_009101698.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
 ref|XP_009101699.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
 ref|XP_009101700.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
Length=859

 Score =   548 bits (1413),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 331/756 (44%), Positives = 457/756 (60%), Gaps = 14/756 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD FL   L+   Y KLYSY +L+NGFAV V S +A K+  + E V  I  D  + 
Sbjct  102   IAQTHDSFLRKTLKGEKYIKLYSYNYLINGFAVFVSSQQAEKLSMRRE-VANIVLDFSVR  160

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TT+TP F+G+P+  W + GG   +GEG+VIG IDTGI+P H SFS  +  +       
Sbjct  161   TATTYTPQFMGLPEGAWVKEGGFETAGEGIVIGFIDTGIDPNHPSFSDKDINSQHSYPTP  220

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
             + F+G C    +FP+ +CN K+VGA++FA++AI  G FN S  YASPFD DGHG+HTAS 
Sbjct  221   KHFSGVCEITPDFPSGSCNKKLVGARHFAQSAITRGTFNSSEDYASPFDGDGHGTHTASI  280

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI +  ++G ASG+AP A I+VYKALY SFGG+ +DVVAA+DQA +DGVDIL
Sbjct  281   AAGNHGVPVIVSNHSFGNASGIAPRAHISVYKALYKSFGGFAADVVAAIDQAAQDGVDIL  340

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ +L A + G+ VVQAAGN+GPS +SM SFSPW+ +V A
Sbjct  341   SLSITPNRKPPGVATFFNPIDMAILSAVKTGIFVVQAAGNTGPSPKSMSSFSPWIFTVGA  400

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVESCQD  1272
             S+ DR Y+NSI LGN  T  G G S PT     +++ +A       ++    + +  CQD
Sbjct  401   SSHDRLYSNSITLGNNVTIPGVGFSSPTDDGKMYKMVSAFHALNNTTSVDTDMYLGECQD  460

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
                +   LV G L++C+Y+  F    ++I    D      A G V  MDP +   Q    
Sbjct  461   YENYNQELVSGNLLMCSYSVRFVLGLSTIKQALDVAKNLSAVGVVFYMDPYVLGFQFN--  518

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGR-AVAFRATARILDGRRAIYSGQGPV  1629
                + +PG+II + E S  L +YYNS+  R  + +  V F A A I  G  A +S + P+
Sbjct  519   PTPMDMPGIIIPSAEDSKILLKYYNSSIERDATTKDVVEFGAVAAIEGGLNANFSNKAPM  578

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  +   + AD+LKPN++APG+SIW AWS  S      +G+ FA++SGTSM
Sbjct  579   VMYYSARGPDPEDNSFNDADILKPNLVAPGNSIWGAWSSGSIDSTEFEGEKFAMMSGTSM  638

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTP  1977
             A PH+AG+AALIK  +PN+ PSAI SA+ T+A + D       +      A Q L  ATP
Sbjct  639   AAPHVAGVAALIKQTYPNFSPSAIASALSTTALLNDNKGGPIMAQRTYANADQSLINATP  698

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-  2154
             FD GSGF+N + AL+PGL+F+T F+ Y+ FLC + G D   V    G++C  N     S 
Sbjct  699   FDMGSGFVNATAALDPGLIFDTSFEDYMSFLCGINGSDS-VVFNYTGIDCSSNNSSRISG  757

Query  2155  -DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
              DLN PS+T+S L G +   R V N+ G +E Y V    P GV + + P  F I    ++
Sbjct  758   FDLNLPSITVSTLNGKQVFKRWVRNIAG-NETYNVGWSPPYGVSMKVSPAQFSIGTGETQ  816

Query  2332  HLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              L I L  TK ++S SFG + L G   H+V +P +V
Sbjct  817   VLSITLEPTKNSSSSSFGRIGLFGKAGHVVNIPVSV  852



>ref|XP_009101701.1| PREDICTED: subtilisin-like protease isoform X2 [Brassica rapa]
Length=855

 Score =   548 bits (1412),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 331/756 (44%), Positives = 457/756 (60%), Gaps = 14/756 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD FL   L+   Y KLYSY +L+NGFAV V S +A K+  + E V  I  D  + 
Sbjct  98    IAQTHDSFLRKTLKGEKYIKLYSYNYLINGFAVFVSSQQAEKLSMRRE-VANIVLDFSVR  156

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TT+TP F+G+P+  W + GG   +GEG+VIG IDTGI+P H SFS  +  +       
Sbjct  157   TATTYTPQFMGLPEGAWVKEGGFETAGEGIVIGFIDTGIDPNHPSFSDKDINSQHSYPTP  216

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
             + F+G C    +FP+ +CN K+VGA++FA++AI  G FN S  YASPFD DGHG+HTAS 
Sbjct  217   KHFSGVCEITPDFPSGSCNKKLVGARHFAQSAITRGTFNSSEDYASPFDGDGHGTHTASI  276

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI +  ++G ASG+AP A I+VYKALY SFGG+ +DVVAA+DQA +DGVDIL
Sbjct  277   AAGNHGVPVIVSNHSFGNASGIAPRAHISVYKALYKSFGGFAADVVAAIDQAAQDGVDIL  336

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ +L A + G+ VVQAAGN+GPS +SM SFSPW+ +V A
Sbjct  337   SLSITPNRKPPGVATFFNPIDMAILSAVKTGIFVVQAAGNTGPSPKSMSSFSPWIFTVGA  396

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVESCQD  1272
             S+ DR Y+NSI LGN  T  G G S PT     +++ +A       ++    + +  CQD
Sbjct  397   SSHDRLYSNSITLGNNVTIPGVGFSSPTDDGKMYKMVSAFHALNNTTSVDTDMYLGECQD  456

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
                +   LV G L++C+Y+  F    ++I    D      A G V  MDP +   Q    
Sbjct  457   YENYNQELVSGNLLMCSYSVRFVLGLSTIKQALDVAKNLSAVGVVFYMDPYVLGFQFN--  514

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGR-AVAFRATARILDGRRAIYSGQGPV  1629
                + +PG+II + E S  L +YYNS+  R  + +  V F A A I  G  A +S + P+
Sbjct  515   PTPMDMPGIIIPSAEDSKILLKYYNSSIERDATTKDVVEFGAVAAIEGGLNANFSNKAPM  574

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  +   + AD+LKPN++APG+SIW AWS  S      +G+ FA++SGTSM
Sbjct  575   VMYYSARGPDPEDNSFNDADILKPNLVAPGNSIWGAWSSGSIDSTEFEGEKFAMMSGTSM  634

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTP  1977
             A PH+AG+AALIK  +PN+ PSAI SA+ T+A + D       +      A Q L  ATP
Sbjct  635   AAPHVAGVAALIKQTYPNFSPSAIASALSTTALLNDNKGGPIMAQRTYANADQSLINATP  694

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-  2154
             FD GSGF+N + AL+PGL+F+T F+ Y+ FLC + G D   V    G++C  N     S 
Sbjct  695   FDMGSGFVNATAALDPGLIFDTSFEDYMSFLCGINGSDS-VVFNYTGIDCSSNNSSRISG  753

Query  2155  -DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
              DLN PS+T+S L G +   R V N+ G +E Y V    P GV + + P  F I    ++
Sbjct  754   FDLNLPSITVSTLNGKQVFKRWVRNIAG-NETYNVGWSPPYGVSMKVSPAQFSIGTGETQ  812

Query  2332  HLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              L I L  TK ++S SFG + L G   H+V +P +V
Sbjct  813   VLSITLEPTKNSSSSSFGRIGLFGKAGHVVNIPVSV  848



>ref|XP_004231572.1| PREDICTED: subtilisin-like protease isoform X1 [Solanum lycopersicum]
Length=838

 Score =   548 bits (1411),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 339/768 (44%), Positives = 476/768 (62%), Gaps = 21/768 (3%)
 Frame = +1

Query  184   MYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYE  363
             M    +++ HD  L  +LR   Y K+YSY +L+NGFAV V   +A K+  + E V  I  
Sbjct  81    MNGSYVSQMHDSLLRRVLRGEKYLKVYSYHYLINGFAVLVTPQQAFKLARRRE-VSNIVL  139

Query  364   DIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS--SPEEYN  537
             D  ++  TTHTP FLG+P   W + GG   +G G+VIG IDTGI+P H SF+  SPE+  
Sbjct  140   DFSVKTATTHTPQFLGLPRGAWAQEGGYETAGVGIVIGFIDTGIDPTHPSFNDKSPEQTY  199

Query  538   IGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGH  717
                  +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ +ASPFD DGH
Sbjct  200   ----PVPEHFSGICEVTLDFPSGSCNRKLVGARHFAASAITRGIFNATKDFASPFDGDGH  255

Query  718   GSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqav  894
             G+HTAS AAGN+  PVI     +G ASGMAP   IAVYKALY SFGG+ +DVVAA+DQA 
Sbjct  256   GTHTASIAAGNHGVPVIVAGHYFGNASGMAPHTHIAVYKALYKSFGGFAADVVAAIDQAA  315

Query  895   edgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSP  1074
             +DGVDI++LS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +S+ SFSP
Sbjct  316   QDGVDIINLSITPNRRPPGLATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSVASFSP  375

Query  1075  WVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLT  1254
             W+ SV AST DR Y+NSI+LGN  T SG GL+P T     + L +A+     ++ A  + 
Sbjct  376   WIFSVGASTHDRAYSNSILLGNNITISGVGLAPGT--DDMYMLVSAIH-SLNDTAAKDMY  432

Query  1255  VESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGS  1434
             V  CQDA +F  +LV+G L+IC+Y+  F    ++I   ++T     AAG V  MDP + S
Sbjct  433   VSECQDASKFNHTLVQGNLLICSYSIRFVLGLSTIKQASETAMNLSAAGVVFAMDPFVIS  492

Query  1435  EQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIY  1611
              Q+    V +++PG+II + + S  L QYYNS+  +  + R  V F A A IL G    +
Sbjct  493   YQLN--PVPMRLPGIIIPSPDDSKILLQYYNSSLEKDETTRKIVKFGAVACILGGVTPNF  550

Query  1612  SGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFAL  1791
             S   P V  YS+RGPD  +  +D AD+LKPN++APG+SIWAAWS         +G++FA+
Sbjct  551   SLSAPKVMYYSARGPDPEDNSVDNADILKPNLVAPGNSIWAAWSSRGAESIEFQGENFAM  610

Query  1792  VSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqq  1959
             +SGTSMA PHIAG+AALIK + P + P+AI SA+ T+A   ++    + +          
Sbjct  611   MSGTSMAAPHIAGLAALIKQKFPTFSPAAIGSALSTTASQHNKYGGPILAQRAYANPDLN  670

Query  1960  lapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENK  2139
              +PAT FD GSGF+N + AL+PGL+ +T +  Y+ FLC + G     +    G  C  + 
Sbjct  671   QSPATSFDMGSGFVNATAALDPGLILDTSYNDYMAFLCGING-SAPVLLNYTGESCGVS-  728

Query  2140  KFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISA  2319
                 +DLN PS+TIS L  SR V R +TN+ G +E Y V    P GV V + P+ FF+++
Sbjct  729   TMNGADLNMPSITISKLNQSRKVQRMLTNIAG-NETYIVGWSAPNGVSVKVNPKRFFVAS  787

Query  2320  DGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
                + L + LNAT  + + SFG + L+G++ H+V +P +V V  S  S
Sbjct  788   AQQQILNVFLNATMNSTTPSFGRIGLVGNKGHVVNIPLSVVVKISYHS  835



>emb|CDY49018.1| BnaAnng10120D [Brassica napus]
Length=859

 Score =   548 bits (1412),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 330/756 (44%), Positives = 456/756 (60%), Gaps = 14/756 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD FL   L+   Y KLYSY +L+NGFAV V S +A K+  + E V  I  D  + 
Sbjct  102   IAQTHDSFLRKTLKGEKYIKLYSYNYLINGFAVFVSSQQAEKLSMRRE-VANIVLDFSVR  160

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TT+TP F+G+P+  W + GG   +GEG+VIG IDTGI+P H SFS  +  +       
Sbjct  161   TATTYTPQFMGLPEGAWVKEGGFETAGEGIVIGFIDTGIDPNHPSFSDKDINSQHSYPTP  220

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
             + F+G C    +FP+ +CN K+VGA++FA++AI  G FN S  YASPFD DGHG+HTAS 
Sbjct  221   KHFSGVCEITPDFPSGSCNKKLVGARHFAQSAITRGTFNSSEDYASPFDGDGHGTHTASI  280

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI +  ++G ASG+AP A I+VYKALY SFGG+ +DVVAA+DQA +DGVDIL
Sbjct  281   AAGNHGVPVIVSNHSFGNASGIAPRAHISVYKALYKSFGGFAADVVAAIDQAAQDGVDIL  340

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ +L A + G+ VVQAAGN+GPS +SM SFSPW+ +V A
Sbjct  341   SLSITPNRKPPGVATFFNPIDMAILSAVKTGIFVVQAAGNTGPSPKSMSSFSPWIFTVGA  400

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVESCQD  1272
             S+ DR Y+NSI LGN  T  G G S PT     +++ +A       ++    + +  CQD
Sbjct  401   SSHDRVYSNSITLGNNVTIPGVGFSSPTDDGKMYKMVSAFHALNNTTSVDTDMYLGECQD  460

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
                +   LV G L++C+Y+  F    ++I    D      A G V  MDP +   Q    
Sbjct  461   YENYNQELVSGNLLMCSYSVRFVLGLSTIKQALDVAKNLSAVGVVFYMDPYVLGFQFN--  518

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGR-AVAFRATARILDGRRAIYSGQGPV  1629
                + +PG+II + E S  L +YYNS+  R  + +  V F A A I  G  A +S + P+
Sbjct  519   PTPMDMPGIIIPSAEDSKILLKYYNSSIERDATTKDVVEFGAVAAIEGGLNANFSNKAPM  578

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  +   + AD+LKPN++APG+SIW AWS  S      +G+ FA++SGTSM
Sbjct  579   VMYYSARGPDPEDNSFNDADILKPNLVAPGNSIWGAWSSGSIDSTEFEGEKFAMMSGTSM  638

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTP  1977
             A PH+AG+AALIK  +PN+ PSAI SA+ T+A + D       +        Q L  ATP
Sbjct  639   AAPHVAGVAALIKQTYPNFSPSAIASALSTTALLNDNKGGPIMAQRTYANPDQSLINATP  698

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-  2154
             FD GSGF+N + AL+PGL+F+T F+ Y+ FLC + G D   V    G++C  N     S 
Sbjct  699   FDMGSGFVNATAALDPGLIFDTSFEDYMSFLCGINGSDS-VVFNYTGIDCSSNNSSRISG  757

Query  2155  -DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
              DLN PS+T+S L G +   R V N+ G +E Y V    P GV + + P  F I    ++
Sbjct  758   FDLNLPSITVSTLNGKQVFKRWVRNIAG-NETYNVGWSPPYGVSMKVSPAQFSIGTGETQ  816

Query  2332  HLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              L I L  TK ++S SFG + L G   H+V +P +V
Sbjct  817   ILSITLEPTKNSSSSSFGRIGLFGKAGHVVNIPVSV  852



>ref|XP_007138552.1| hypothetical protein PHAVU_009G218900g [Phaseolus vulgaris]
 gb|ESW10546.1| hypothetical protein PHAVU_009G218900g [Phaseolus vulgaris]
Length=850

 Score =   548 bits (1411),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 335/764 (44%), Positives = 467/764 (61%), Gaps = 15/764 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   +++ HD  L  +L    Y KLYSY +L+NGFAV V   +A K+   +E V  +  D
Sbjct  88    YGSYVSRVHDSLLKKVLNGEKYLKLYSYHYLINGFAVLVTQKQAGKLARSSE-VSNVVLD  146

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP FLG+P   W + GG   +GEGVVIG +DTGI+P H SF   +  ++  
Sbjct  147   FSVRTATTHTPQFLGLPQGAWFQDGGFETAGEGVVIGFVDTGIDPTHPSFGDSKSNHL-Y  205

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
             P +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ YASPFD DGHG+H
Sbjct  206   P-VPAHFSGICEVTRDFPSGSCNRKLVGARHFAASAITRGIFNSTQDYASPFDGDGHGTH  264

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TA+ AAGN+  PVI    ++G ASGMAP + IAVYKALY SFGG+ +DVVAA+DQA +DG
Sbjct  265   TAAVAAGNHGIPVIVAGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVAAIDQAAQDG  324

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS  SM SFSPW+ 
Sbjct  325   VDIISLSITPNRRPPGVATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPTSMFSFSPWIF  384

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVE  1260
             +V A++ DR Y+NSI LGN  T  G GL+P T     ++L  A      ++T A  + V 
Sbjct  385   TVGAASHDRVYSNSIFLGNNVTIPGVGLAPGTDESKLYKLIHAHHALSNDTTVADDMYVG  444

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQDA +F   L++G L++C+Y+  F    ++I   ++T     AAG V  MDP +   Q
Sbjct  445   ECQDANKFNKDLIKGNLLMCSYSIRFVLGLSTIKRASETAKNLSAAGVVFYMDPYVIGFQ  504

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSN-TLRSRSGRAVAFRATARILDGRRAIYSG  1617
             +    V +++PG+I+ +   S  L QYYNS+  + + S + V F A ARI  G +A Y  
Sbjct  505   LN--PVPMKMPGIILASTNDSKILMQYYNSSLEIDAVSKKIVKFGAIARICGGLKANYGS  562

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  + L   AD+LKPN++APGS IWAAWS          G++FAL+S
Sbjct  563   VAPKVMYYSARGPDPEDGLPHQADILKPNLLAPGSFIWAAWSSVGTDSVEFLGENFALMS  622

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqla  1965
             GTSMA PH+AG+AALI+ + PN+ P+AI SA+ T+A + D+      +           +
Sbjct  623   GTSMAAPHVAGLAALIRQKFPNFSPAAIGSALSTTASLYDKSGGPIMAQRSYASPELNES  682

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECP-ENKK  2142
             PATPFD GSGF+N S ALNPGL+F++ +  Y+ FLC + G     V    G  C   N  
Sbjct  683   PATPFDMGSGFVNASGALNPGLIFDSSYDDYMSFLCGING-SAPVVLNYTGQNCGLYNST  741

Query  2143  FWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISAD  2322
              +  DLN PS+TIS L  SR V+R V N    +E Y V    P GV + + P +F I + 
Sbjct  742   VYGPDLNLPSITISKLNKSRIVLRTVQNT-AQNESYSVGWTAPYGVSLKVSPTHFCIGSG  800

Query  2323  GSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTAS  2454
               + L + LNAT  ++  SFG + L G++ H++ +P ++ VT S
Sbjct  801   ERQVLSVFLNATVNSSVSSFGRIGLFGNQGHVLNIPISIMVTIS  844



>gb|EAY75970.1| hypothetical protein OsI_03889 [Oryza sativa Indica Group]
Length=849

 Score =   548 bits (1411),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 329/758 (43%), Positives = 469/758 (62%), Gaps = 15/758 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   + +  +  L   LR   Y KLYSY +L+NGFAV +   +A ++    E V  +  D
Sbjct  92    YGSYLVRLQNSLLKRTLRGERYIKLYSYGYLINGFAVVITPQQAERLSMTKE-VANVMLD  150

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP+FLG+P   W + GGP  +G+GVV+G+IDTGI+P H SF+  ++     
Sbjct  151   FSVRTATTHTPEFLGLPQGAWVQEGGPQCAGQGVVVGLIDTGIDPTHPSFA--DDLITDS  208

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
               +   ++G C   ++FP+ +CN K+VGA++FA +AI  G FN S+ +ASP D+DGHG+H
Sbjct  209   YPVPAHYSGICEVTNDFPSGSCNRKLVGARHFAASAITRGVFNASQDHASPSDSDGHGTH  268

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PV+    ++G ASGMAP A IAVYKALY SFGG+ +DVVAA+DQA ED 
Sbjct  269   TASIAAGNHGIPVVVAGHHFGNASGMAPRAHIAVYKALYKSFGGFAADVVAAIDQAAEDN  328

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM S+SPW+ 
Sbjct  329   VDIISLSITPNRRPPGLATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSMSSYSPWIF  388

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRN-STAGLLTVE  1260
             +V AS  DR Y N +VLGN  T +G GL+P T G + F L AA    + N ++   +++ 
Sbjct  389   TVGASAHDREYNNYVVLGNNLTITGVGLAPGTDGDSMFTLVAAPHALKNNVASPTEMSLG  448

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD+      L+RGK+++C+Y+  F    +S+    DT     AAG +  +DP +   Q
Sbjct  449   ECQDSSHLDEDLIRGKILVCSYSIRFVLGLSSVKQALDTAKNVSAAGVIFYLDPFVIGFQ  508

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSG  1617
             +      + +PGLII + + S     YYN + +R   S + V+F A A+IL G+   Y  
Sbjct  509   LN--PTPMDMPGLIIPSSDDSKVFLNYYNESLVRDETSNKIVSFGAIAKILGGQNPNYGI  566

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  +  L  AD+LKPN++APGSSIW AWS          G+ FA++S
Sbjct  567   SAPKVMFYSARGPDPEDNSLANADILKPNLIAPGSSIWGAWSSLGLDSAEFAGESFAIIS  626

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqa----sqqla  1965
             GTSMA PH+AG+AAL+K + P + P+AI SA+ T+  ++DR G+P++AQ+     +   +
Sbjct  627   GTSMAAPHVAGLAALVKQKFPYFSPAAIGSALSTTTSLSDREGNPIMAQRTYGNPNSTQS  686

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF  2145
             PATPFD G+GF+N + AL+PGL+F++ +  +  FLC + G     V    G  C  +   
Sbjct  687   PATPFDMGNGFVNATAALDPGLIFDSSYDDFFSFLCGING-SAPVVMNYTGNSC-SSSAM  744

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
               +DLN PS+TI+ L  SRT+ R VTNV  +DERY V    P GV V+  P  FFI +  
Sbjct  745   TGADLNLPSITIAVLNRSRTITRTVTNV-ASDERYTVSYSAPYGVAVSASPAQFFIPSGQ  803

Query  2326  SRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              + +I V+NAT    S SFG +   GD+ H V +PF+V
Sbjct  804   RQQVIFVVNATMNGTSASFGSVGFYGDKGHRVMIPFSV  841



>ref|XP_006597917.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=888

 Score =   549 bits (1414),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 338/767 (44%), Positives = 469/767 (61%), Gaps = 15/767 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   +++ HD  L  +L    Y KLYSY +L+NGFAV V   +A K+   +E V  +  D
Sbjct  126   YDSYISRVHDSLLKKVLNGEKYLKLYSYHYLINGFAVLVTQQQAEKLSRSSE-VSNVVLD  184

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP FLG+P+  W + GG   +GEGVVIG +DTGI+P H SF    +Y    
Sbjct  185   FSVRTATTHTPQFLGLPEGAWFQDGGFETAGEGVVIGFVDTGIDPTHPSFDD-NKYEKPY  243

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
             P +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ YASPFD DGHG+H
Sbjct  244   P-VPAHFSGICEVTRDFPSGSCNRKLVGARHFAASAITRGIFNSTQDYASPFDGDGHGTH  302

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PVI    ++G ASGMAP + IAVYKALY SFGG+ +DVVAA+DQA +DG
Sbjct  303   TASVAAGNHGIPVIVAGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVAAIDQAAQDG  362

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ L+ A + G+ VVQAAGN+GPS  SM SFSPW+ 
Sbjct  363   VDIISLSITPNRRPPGVATFFNPIDMALMSAVKQGIFVVQAAGNTGPSPTSMFSFSPWIY  422

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVE  1260
             +V A++ DR Y+N+I LGN  T  G GL+  T     ++L  A      ++T A  + V 
Sbjct  423   TVGAASHDRVYSNAIFLGNNVTIPGVGLASGTDESKLYKLIHAHHSLSNDTTVADDMYVG  482

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQDA +F  SL++G L++C+Y+  F    ++I   ++T     AAG V  MDP +   Q
Sbjct  483   ECQDASKFNKSLIKGNLLMCSYSIRFVLGLSTIKQASETAKNLSAAGVVFYMDPFVIGFQ  542

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSN-TLRSRSGRAVAFRATARILDGRRAIYSG  1617
             +    V +++PG+II +   S  L QYYNS+  + + S + V F A A I  G +A YS 
Sbjct  543   LN--PVPMKMPGIIIASTNDSKVLMQYYNSSLEIDAVSNKIVKFGAVASICGGLKANYSN  600

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  ++L   AD+LKPN++APG+ IWAAWS          G++FAL+S
Sbjct  601   VAPKVMYYSARGPDPEDSLPHEADILKPNLLAPGNFIWAAWSSVGTESVEFLGENFALMS  660

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqla  1965
             GTSMA PH+AG+AALI+ + PN+ P+AI SA+ ++A + D+      +           +
Sbjct  661   GTSMAAPHVAGLAALIRQKFPNFSPAAIGSALSSTASLYDKSGGPIMAQRSYASPDLNQS  720

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECP-ENKK  2142
             PATPFD GSGF+N S ALNPGLVF++ +  Y+ FLC + G     V    G  C   N  
Sbjct  721   PATPFDMGSGFVNASGALNPGLVFDSGYDDYMSFLCGING-SAPVVLNYTGQNCGLYNST  779

Query  2143  FWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISAD  2322
              +  DLN PS+TIS L  SR V R V NV   +E Y V    P GV V + P +F I + 
Sbjct  780   VYGPDLNLPSITISKLNQSRIVQRTVQNV-AQNESYSVGWTAPYGVSVKVSPTHFCIPSG  838

Query  2323  GSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
              S+ L ++LNAT  ++  SFG + L G++ H+V +P +V V  S  +
Sbjct  839   ESQVLSVLLNATLNSSVASFGRIGLFGNQGHVVNIPLSVMVKISYNT  885



>ref|XP_002865359.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41618.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=841

 Score =   547 bits (1410),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 331/756 (44%), Positives = 464/756 (61%), Gaps = 16/756 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD FL   LR   Y KLYSY +L+NGFA+ V S +A K+  + E V  I  D  + 
Sbjct  86    VAQSHDSFLRKTLRGEKYIKLYSYHYLINGFALFVSSQQAEKLSMRRE-VANIVLDYSVR  144

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TT+TP F+G+P   W R GG  ++GEGVVIG IDTGI+P H SF+  +      P I 
Sbjct  145   TATTYTPQFMGLPQGAWVREGGYEIAGEGVVIGFIDTGIDPNHPSFNDNDSKR-SYP-IP  202

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
             + F+G C    +FP+ +CN K++GA++FA++A+  G FN+S  YASPFD DGHG+HTAS 
Sbjct  203   KHFSGVCEVTPDFPSGSCNKKLIGARHFAQSAVTRGIFNLSEEYASPFDGDGHGTHTASV  262

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI +  N+GYASG+AP A I+VYKALY SFGG+ +DVVAA+DQA +DGVDIL
Sbjct  263   AAGNHGVPVIVSNHNFGYASGIAPRAFISVYKALYKSFGGFAADVVAAIDQAAQDGVDIL  322

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GP+ +SM SFSPW+ +V A
Sbjct  323   SLSITPNRKPPGVATFFNPIDMALLSAVKAGIFVVQAAGNTGPAPKSMSSFSPWIFTVGA  382

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVESCQD  1272
             S+ DR Y+NS++LGN  T  G G + PT     +++ +A     ++++    + V  CQD
Sbjct  383   SSHDRVYSNSLILGNNVTIQGIGFAIPTDDGKMYKMISAFHALNKSTSVDRDMYVGECQD  442

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
                +   LV G L+IC+Y+  F    ++I    D      A G V  +DP +   +I   
Sbjct  443   YENYDQDLVSGNLLICSYSARFVLGLSTIKQALDVAKNLSAIGVVFYIDPYVLGFEIN--  500

Query  1453  TVTLQIPGLIINNMEASTA-LRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIYSGQGP  1626
                + +PG+II ++E S   L +YYNS+  R  + +  V+F A A I  G  A ++ + P
Sbjct  501   PTPMDMPGIIIPSVEDSKVILLKYYNSSLQRDGTTKEIVSFGAVAAIEGGLNANFNNRAP  560

Query  1627  VVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTS  1806
              V  YS+RGPD  +   + AD+LKPN++APG+SIW AWS  S      +G+ FA++SGTS
Sbjct  561   KVMYYSARGPDPEDNSFNDADILKPNLVAPGNSIWGAWSSASTDSTEFEGEKFAMMSGTS  620

Query  1807  MATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaT  1974
             MA PH+AG+AALIK  +P + PS I SA+ T+A + D       +        Q L  AT
Sbjct  621   MAAPHVAGVAALIKQTYPQFTPSQIASALSTTALLNDNKGGPIMAQRTYSNPDQSLYTAT  680

Query  1975  PFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS  2154
             PFD GSGF+N + AL+PGLVF+T F+ Y+ FLC + G D   V    G  CP N      
Sbjct  681   PFDMGSGFVNATAALDPGLVFDTSFEDYMSFLCGINGSDPL-VFNYTGFRCPANNTTISG  739

Query  2155  -DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
              DLN PS+T+S L G++   R + N+ G +E Y V    P GV + + P  F I+   ++
Sbjct  740   FDLNLPSITVSTLSGTQIFQRSMRNIAG-NETYNVGWSPPYGVSMKVSPTQFSIAMGETQ  798

Query  2332  HLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              L + L ATK ++S SFG + L G+  HIV +P  V
Sbjct  799   VLSVTLTATKNSSSSSFGRIGLFGNTGHIVNIPITV  834



>gb|KHN09893.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=888

 Score =   548 bits (1413),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 338/767 (44%), Positives = 469/767 (61%), Gaps = 15/767 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   +++ HD  L  +L    Y KLYSY +L+NGFAV V   +A K+   +E V  +  D
Sbjct  126   YDSYISRVHDSLLKKVLNGEKYLKLYSYHYLINGFAVLVTQQQAEKLSRSSE-VSNVVLD  184

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP FLG+P+  W + GG   +GEGVVIG +DTGI+P H SF    +Y    
Sbjct  185   FSVRTATTHTPQFLGLPEGAWFQDGGFETAGEGVVIGFVDTGIDPTHPSFDD-NKYEKPY  243

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
             P +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ YASPFD DGHG+H
Sbjct  244   P-VPAHFSGICEVTRDFPSGSCNRKLVGARHFAASAITRGIFNSTQDYASPFDGDGHGTH  302

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PVI    ++G ASGMAP + IAVYKALY SFGG+ +DVVAA+DQA +DG
Sbjct  303   TASVAAGNHGIPVIVAGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVAAIDQAAQDG  362

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ L+ A + G+ VVQAAGN+GPS  SM SFSPW+ 
Sbjct  363   VDIISLSITPNRRPPGVATFFNPIDMALMSAVKQGIFVVQAAGNTGPSPTSMFSFSPWIY  422

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVE  1260
             +V A++ DR Y+N+I LGN  T  G GL+  T     ++L  A      ++T A  + V 
Sbjct  423   TVGAASHDRVYSNAIFLGNNVTIPGVGLASGTDESKLYKLIHAHHSLSNDTTVADDMYVG  482

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQDA +F  SL++G L++C+Y+  F    ++I   ++T     AAG V  MDP +   Q
Sbjct  483   ECQDASKFNKSLIKGNLLMCSYSIRFVLGLSTIKQASETAKNLSAAGVVFYMDPFVIGFQ  542

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSN-TLRSRSGRAVAFRATARILDGRRAIYSG  1617
             +    V +++PG+II +   S  L QYYNS+  + + S + V F A A I  G +A YS 
Sbjct  543   LN--PVPMKMPGIIIASTNDSKVLMQYYNSSLEIDAVSNKIVKFGAVASICGGLKANYSN  600

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  ++L   AD+LKPN++APG+ IWAAWS          G++FAL+S
Sbjct  601   VAPKVMYYSARGPDPEDSLPHEADILKPNLLAPGNFIWAAWSSVGTESVEFLGENFALMS  660

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqla  1965
             GTSMA PH+AG+AALI+ + PN+ P+AI SA+ ++A + D+      +           +
Sbjct  661   GTSMAAPHVAGLAALIRQKFPNFSPAAIGSALSSTASLYDKSGGPIMAQRSYASPDLNQS  720

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECP-ENKK  2142
             PATPFD GSGF+N S ALNPGLVF++ +  Y+ FLC + G     V    G  C   N  
Sbjct  721   PATPFDMGSGFVNASGALNPGLVFDSGYDDYMSFLCGING-SAPVVLNYTGQNCGLYNST  779

Query  2143  FWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISAD  2322
              +  DLN PS+TIS L  SR V R V NV   +E Y V    P GV V + P +F I + 
Sbjct  780   VYGPDLNLPSITISKLNQSRIVQRTVQNV-AQNESYSVGWTAPYGVSVKVSPTHFCIPSG  838

Query  2323  GSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
              S+ L ++LNAT  ++  SFG + L G++ H+V +P +V V  S  +
Sbjct  839   ESQVLSVLLNATLNSSVASFGRIGLFGNQGHVVNIPLSVMVKISYNT  885



>gb|AAF70850.1|AC003113_17 F2401.7 [Arabidopsis thaliana]
Length=762

 Score =   543 bits (1400),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 328/763 (43%), Positives = 452/763 (59%), Gaps = 13/763 (2%)
 Frame = +1

Query  178   VTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGI  357
             + +  +++ + HD  LGS L + +YTKLYS+ H++N  AV   + +A K L K +GV+ +
Sbjct  1     MALEAKKIEEIHDEILGSTLEKGSYTKLYSFKHVINAIAVRTTASQAKK-LGKTKGVKAV  59

Query  358   YEDIKMEKMTTHTPDFLGIPDTVWPRLG--GPSVSGEGVVIGMIDTGINPFHASFSSPEE  531
              ED  ++ MTT+TPDFL +P  VW ++   G   +GE +VIG +DTGINP H SF++ + 
Sbjct  60    EEDKGVKLMTTYTPDFLELPQQVWQKISNEGDRRAGEDIVIGFVDTGINPTHPSFAALDL  119

Query  532   YNIGRPRITR-KFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDA  708
              N     ++R  F+G C  G  FP  +CNGKI+ A++F+  A A+G  N S    SPFDA
Sbjct  120   TNPYSSNLSRLHFSGDCEIGPFFPPGSCNGKIISARFFSAGARASGALNSSLDILSPFDA  179

Query  709   DGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdq  888
              GHGSH AS AAGN   PVI + F YG ASGMAP + IAVYKA+Y   G + DV+AA+DQ
Sbjct  180   SGHGSHVASIAAGNAGVPVIVDGFFYGRASGMAPRSRIAVYKAIYPSIGTLVDVIAAIDQ  239

Query  889   avedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSF  1068
             A+ DGVD+L+LSVGP   P      L + ++ +L A +AGV VVQA GN+GPS  S+LS+
Sbjct  240   AIMDGVDVLTLSVGPDEPPVDKPTVLGIFDLAMLLARKAGVFVVQAVGNNGPSPSSVLSY  299

Query  1069  SPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQ--LAAAVDVCRRN-ST  1239
             SPWV  VAA  TDR Y   ++L  GQT  G GLS PT G    Q  L  A D  R N S 
Sbjct  300   SPWVVGVAAGNTDRSYPAPLILDGGQTVQGVGLSGPTLGAPLVQHRLVLAKDAVRTNGSV  359

Query  1240  AGLLT--VESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLT  1413
                LT  +E CQ    F P+ V G +VICT++  F ++ +++  +  T    G  GF+L 
Sbjct  360   LQPLTRDIEECQRPENFDPAAVFGSIVICTFSDGFYNQMSTVLAITQTARTLGFMGFILI  419

Query  1414  MDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILD  1593
              +P  G        V    PG++I  + A+  + +YY   T R   G A  F A ARI +
Sbjct  420   ANPRFG--DYVAEPVIFSAPGILIPTVSAAQIILRYYEEKTFRDTRGVATQFGARARIGE  477

Query  1594  GRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIK  1773
             GR ++++G+ PVV+ +SSRGP   +A     DVLKP+I+APG  IW AWS  S  D  + 
Sbjct  478   GRNSVFAGKAPVVSRFSSRGPAFIDATRSPLDVLKPDILAPGHQIWGAWSLPSAFDPILT  537

Query  1774  GQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqas  1953
             G+ FA++SGTSMATPHIAGI ALIK  +P+W P+ I SA+ T+A+  D  G  + A+   
Sbjct  538   GRSFAILSGTSMATPHIAGIGALIKQLNPSWTPAMIASAISTTANEYDSNGEIISAEYYE  597

Query  1954  qqlapaTP-FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECP  2130
                   +  FD G+G +NP+RAL+PGLV    F+ YI FLC++P +   ++R   GV C 
Sbjct  598   LSRLFPSNHFDHGAGHVNPARALDPGLVLPAGFEDYISFLCSLPNISPATIRDATGVLCT  657

Query  2131  ENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFF  2310
                    ++LN PSVTIS L  S  V R   +V    E Y   V  P G  V + P  F 
Sbjct  658   TTLSH-PANLNHPSVTISALKESLVVRRSFQDVSNKTETYLGSVLPPNGTTVRLTPTWFT  716

Query  2311  ISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             +    ++ L I  N T+  N ++FGE++L G  NHI+R+P +V
Sbjct  717   VPPQKTQDLDIEFNVTQVLNKFTFGEVVLTGSLNHIIRIPLSV  759



>ref|NP_001044371.1| Os01g0769200 [Oryza sativa Japonica Group]
 dbj|BAB56061.1| putative meiotic serine proteinase [Oryza sativa Japonica Group]
 dbj|BAD53340.1| putative meiotic serine proteinase [Oryza sativa Japonica Group]
 dbj|BAF06285.1| Os01g0769200 [Oryza sativa Japonica Group]
 gb|EAZ13678.1| hypothetical protein OsJ_03598 [Oryza sativa Japonica Group]
Length=849

 Score =   546 bits (1407),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 328/758 (43%), Positives = 468/758 (62%), Gaps = 15/758 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   + +  +  L   LR   Y KLYSY +L+NGFAV +   +A ++    E V  +  D
Sbjct  92    YGSYLVRLQNSLLKRTLRGERYIKLYSYRYLINGFAVVITPQQAERLSMTKE-VANVMLD  150

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP+FLG+P   W + GGP  +G+GVV+G+IDTGI+P H SF+  ++     
Sbjct  151   FSVRTATTHTPEFLGLPQGAWVQEGGPQCAGQGVVVGLIDTGIDPTHPSFA--DDLITDS  208

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
               +   ++G C   ++FP+ +CN K+VGA++FA +AI  G FN S+ +ASP D+DGHG+H
Sbjct  209   YPVPAHYSGICEVTNDFPSGSCNRKLVGARHFAASAITRGVFNASQDHASPSDSDGHGTH  268

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PV+    ++G ASGMAP A IAVYKALY SFGG+ +DVVAA+DQA ED 
Sbjct  269   TASIAAGNHGIPVVVAGHHFGNASGMAPRAHIAVYKALYKSFGGFAADVVAAIDQAAEDN  328

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM S+SPW+ 
Sbjct  329   VDIISLSITPNRRPPGLATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSMSSYSPWIF  388

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRN-STAGLLTVE  1260
             +V AS  DR Y N +VLGN  T +G GL+P T G + F L AA    + N ++   +++ 
Sbjct  389   TVGASAHDREYNNYVVLGNNLTITGVGLAPGTDGDSMFTLVAAPHALKNNVASPTEMSLG  448

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD+      L+RGK+++C+Y+  F    +S+    DT     AAG +  +DP +   Q
Sbjct  449   ECQDSSHLDEDLIRGKILVCSYSIRFVLGLSSVKQALDTAKNVSAAGVIFYLDPFVIGFQ  508

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSG  1617
             +      + +PGLII + + S     YYN + +R   S + V+F A A+IL G+   Y  
Sbjct  509   LN--PTPMDMPGLIIPSSDDSKVFLNYYNESLVRDETSNKIVSFGAIAKILGGQNPNYGI  566

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  +  L  AD+LKPN++APGSSIW AWS          G+ FA++S
Sbjct  567   SAPKVMFYSARGPDPEDNSLANADILKPNLIAPGSSIWGAWSSLGLDSAEFAGESFAIIS  626

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqa----sqqla  1965
             GTSMA PH+AG+AAL+K + P + P+AI SA+ T+  ++DR G+P++AQ+     +   +
Sbjct  627   GTSMAAPHVAGLAALVKQKFPYFSPAAIGSALSTTTSLSDREGNPIMAQRTYGNPNSTQS  686

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF  2145
             PATPFD G+GF+N + AL+PGL+F++ +  +  FLC + G     V    G  C  +   
Sbjct  687   PATPFDMGNGFVNATAALDPGLIFDSSYDDFFSFLCGING-SAPVVMNYTGNSC-SSSAM  744

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
               +DLN PS+TI+ L  SRT+ R VTNV  +DERY V    P GV V+  P  FFI +  
Sbjct  745   TGADLNLPSITIAVLNQSRTITRTVTNV-ASDERYTVSYSAPYGVAVSASPAQFFIPSGQ  803

Query  2326  SRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              + +  V+NAT    S SFG +   GD+ H V +PF+V
Sbjct  804   RQQVTFVVNATMNGTSASFGSVGFYGDKGHRVMIPFSV  841



>dbj|BAJ99303.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=846

 Score =   546 bits (1406),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 328/762 (43%), Positives = 455/762 (60%), Gaps = 15/762 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   + +  +  L   LR   Y KLYSY +L+NGFAV +   +A K+  + E V  I  D
Sbjct  92    YGSLLVRLQNSLLKKTLRGEHYIKLYSYHYLINGFAVVLTPQQAEKLNRRKE-VANIMLD  150

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TT+TP+FLG+P+  W + GGP  +G+GVV+G+IDTGI+P H SFS  ++     
Sbjct  151   FSVRTATTYTPEFLGLPEGAWVQDGGPQCAGQGVVVGLIDTGIDPNHPSFS--DDLTADN  208

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
               +   ++G C    +FP+ +CN K+VGA++FA +A+  G FN S+  ASP D+DGHG+H
Sbjct  209   YPVPAHYSGNCEVTSDFPSGSCNRKLVGARHFAASALTRGVFNASQDLASPSDSDGHGTH  268

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedg  903
             TAS AAGN+  PVI    ++G ASGM P A IAVYKALY  FGG+ +DVVAA+DQA ED 
Sbjct  269   TASIAAGNHGIPVIVAGHHFGNASGMTPRAHIAVYKALYKGFGGFAADVVAAIDQAAEDN  328

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ L+ A + G+ VVQAAGN+GPS +SM S+SPW+ 
Sbjct  329   VDIISLSITPNRRPPGLATFFNPIDMALMSAVKDGIFVVQAAGNTGPSPKSMSSYSPWIF  388

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVE  1260
             +V AS  DR Y N +VLGN  T SG GL+P T G + + L AA    +  +T  + +++ 
Sbjct  389   TVGASAHDREYYNYVVLGNNLTISGVGLAPGTDGDSMYNLIAAPHALQNYTTTPIEMSLG  448

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD       L+RGK+++C+Y+  F    +S+    DT     AAG +  +DP +   Q
Sbjct  449   ECQDPSHLDKDLIRGKILVCSYSIRFVLGLSSVKQALDTAKNVSAAGVIFYLDPFVLGFQ  508

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRS-RSGRAVAFRATARILDGRRAIYSG  1617
             +      + IPGLII + + S     YYN + +R   S R V F A A+IL G +  Y  
Sbjct  509   LN--PTPMDIPGLIIPSSDDSKIFLSYYNDSLVRDGTSDRVVNFGAVAKILGGLKPNYGS  566

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  +  L  AD+LKPN++APGSSIW AWS          G+ FA++S
Sbjct  567   SAPKVMFYSARGPDPEDNTLANADILKPNVVAPGSSIWGAWSSRGLDSAEFTGESFAMLS  626

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqla  1965
             GTSMA PHIAG+AALIK + P++ P+AI SA+ T+  ++DR      S            
Sbjct  627   GTSMAAPHIAGLAALIKQKFPSFSPAAIGSALSTTTTLSDREGKPIMSQRTYSNPDSTQT  686

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF  2145
             PATPFD G+GF N + AL+PGL+F+  +  YI FLC + G     V    G  C      
Sbjct  687   PATPFDMGNGFANATAALDPGLIFDCSYDDYISFLCGING-SAPVVANYTGNSC-GTSTM  744

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
               +DLN PS+TI+ L  SRT+ R VTN+  +DE Y V    P GV V+  P  FFI +  
Sbjct  745   TGADLNLPSITIAVLNQSRTITRTVTNI-ASDENYTVSCNAPYGVAVSTAPAQFFIPSGQ  803

Query  2326  SRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTA  2451
              + +  ++NAT + +S SFG++   GDR H V +PF V   A
Sbjct  804   KQLVTFIVNATMSNSSASFGDVEFYGDRGHRVVIPFTVMSKA  845



>ref|NP_568634.1| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB09160.1| serine proteinase [Arabidopsis thaliana]
 gb|AAT41839.1| At5g44530 [Arabidopsis thaliana]
 dbj|BAF02261.1| serine proteinase [Arabidopsis thaliana]
 gb|AED95120.1| Subtilase family protein [Arabidopsis thaliana]
Length=840

 Score =   545 bits (1405),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 331/755 (44%), Positives = 462/755 (61%), Gaps = 15/755 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD FL   L+   Y KLYSY +L+NGFA+ + S +A K+  + E V  I  D  + 
Sbjct  86    VVQSHDSFLRKTLKGEKYIKLYSYHYLINGFALFINSQQAEKLSMRKE-VANIVLDYSVR  144

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TT+TP F+G+P   W + GG  ++GEGV+IG IDTGI+P H SF+  +      P I 
Sbjct  145   TATTYTPQFMGLPQGAWVKEGGFEIAGEGVIIGFIDTGIDPNHPSFNDNDSKR-SYP-IP  202

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
             + F+G C    +FP+ +CN K++GA++FA++A+  G FN S  YASPFD DGHG+HTAS 
Sbjct  203   KHFSGVCEVTPDFPSGSCNKKLIGARHFAQSAVTRGIFNSSEDYASPFDGDGHGTHTASV  262

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI +  N+GYASG+AP A I+VYKALY SFGG+ +DVVAA+DQA +DGVDIL
Sbjct  263   AAGNHGVPVIVSNHNFGYASGIAPRAFISVYKALYKSFGGFAADVVAAIDQAAQDGVDIL  322

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GP+ ++M SFSPW+ +V A
Sbjct  323   SLSITPNRKPPGVATFFNPIDMALLSAVKAGIFVVQAAGNTGPAPKTMSSFSPWIFTVGA  382

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPT-AGKAFFQLAAAVDVCRRNSTAGLLTVESCQD  1272
             S+ DR Y+NS+ LGN  T  G G + PT +GK +  ++A   +    S    + V  CQD
Sbjct  383   SSHDRVYSNSLTLGNNVTIPGMGFAIPTDSGKMYKMISAFHALNNSTSVDKDMYVGECQD  442

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
                F    V GKL+IC+Y+  F    ++I    D      A G +  +DP +   +I   
Sbjct  443   YENFDQDRVSGKLLICSYSARFVLGLSTIKQALDVAKNLSATGVIFYIDPYVLGFEIN--  500

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIYSGQGPV  1629
                + +PG+II ++E S  L +YYNS+  R  + +  V+F A A I  G  A +S + P 
Sbjct  501   PTPMDMPGIIIPSVEDSKTLLKYYNSSIQRDVTTKEIVSFGAVAAIEGGLNANFSNRAPK  560

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  +   + ADVLKPN++APG+SIW AWS  S      +G+ FA++SGTSM
Sbjct  561   VMYYSARGPDPEDNSFNDADVLKPNLVAPGNSIWGAWSSASTDSTEFEGEKFAMMSGTSM  620

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTP  1977
             A PH+AG+AALIK  +P + PS I+SA+ T+A + D       +        Q L  ATP
Sbjct  621   AAPHVAGVAALIKQSYPQFTPSTISSALSTTALLNDNKGSPIMAQRTYSNPDQSLYTATP  680

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-  2154
              D GSGF+N + AL+PGLVF+T F+ YI FLC + G D   V    G  CP N       
Sbjct  681   SDMGSGFVNATAALDPGLVFDTSFEDYISFLCGINGSD-TVVFNYTGFRCPANNTPVSGF  739

Query  2155  DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRH  2334
             DLN PS+T+S L G++T  R + N+ G +E Y V    P GV + + P  F I+   ++ 
Sbjct  740   DLNLPSITVSTLSGTQTFQRSMRNIAG-NETYNVGWSPPYGVSMKVSPTQFSIAMGENQV  798

Query  2335  LIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             L + L  TK ++S SFG + L G+  HIV +P  V
Sbjct  799   LSVTLTVTKNSSSSSFGRIGLFGNTGHIVNIPVTV  833



>ref|XP_010460865.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=834

 Score =   545 bits (1404),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 343/808 (42%), Positives = 485/808 (60%), Gaps = 39/808 (5%)
 Frame = +1

Query  100   AEAKIYMVLMEDHPFVSTRIKG----------TSGNVTMYKQ-----RMTKQHDVFLGSL  234
             A + +Y+V ++D P V +  +            S +  +Y+       + + HD  L   
Sbjct  32    ASSAVYIVTLKDRPSVHSSGRESTSSSRHSLTASSSSQIYRTLNRSASIIRVHDSLLRKA  91

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
             LR+  Y KLYSY +L+NGF+  +   +A ++  + E V  +  D  +EK TTHTP FLG+
Sbjct  92    LRKENYLKLYSYHYLINGFSAVLTQKQADRLAAREE-VENVVLDFSVEKATTHTPQFLGL  150

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSP---EEYNIGRPRITRKFTGKCIT  585
             P   W R GG   +GEGVVIG IDTGI+P H SFS       Y+I  PR    FTG C  
Sbjct  151   PRGAWLRDGGYEYAGEGVVIGFIDTGIDPSHPSFSDKILGHTYSI-PPR----FTGVCEV  205

Query  586   GDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPV  765
                FP  +CN K++GA++FA +A++ G  N ++  ASPFD +GHG+HTAS AAGN+  PV
Sbjct  206   TIGFPPGSCNRKLIGARHFAESALSRGVLNSTQDDASPFDGEGHGTHTASVAAGNHGIPV  265

Query  766   ITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv  942
             +    + G ASGMAP A IAVYKALY  FGG+ +D++AA+DQA +DGVDI++LS+ P+  
Sbjct  266   VVAGHHLGNASGMAPRAHIAVYKALYKRFGGFAADIIAAIDQAAQDGVDIINLSITPNRR  325

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
             P G + F N +++ L  A +AG+ VVQAAGN+GP+ +SM SFSPW+ +V A++ DR YTN
Sbjct  326   PPGIATFFNPIDMALFSAVKAGIFVVQAAGNTGPAPKSMSSFSPWIFTVGATSHDRIYTN  385

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA-GLLTVESCQDAMQFVPSLV  1299
             SI+LGN  T  G GL+  T  +   +L  A    R  +T    + V  CQD+  F   LV
Sbjct  386   SIILGNNVTVPGVGLASGT--RTMHKLILATHALRNGTTVMDAIYVGECQDSSSFDQKLV  443

Query  1300  RGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGL  1479
             +GK+++C+YT  F    ++I     T     AAG V  +DP     Q+   +  + IPG+
Sbjct  444   QGKILVCSYTVRFILGVSTIKQALITAKNLTAAGLVFYIDPSAAGFQM--TSTPMDIPGI  501

Query  1480  IINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGP  1656
             +I++ + S AL +YYNS+ LR   SG+ V   + ARI+ G +  Y    P V  +S+RGP
Sbjct  502   LISSPQDSQALLRYYNSSLLRENGSGKIVGSASVARIVGGMKPTYGITSPKVMYFSARGP  561

Query  1657  DVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIA  1836
             D  +     AD++KPN++APG++IW AWSP   G    +G+ FA+ SGTSM+ PH+ GIA
Sbjct  562   DPEDDSFVDADIMKPNLVAPGNAIWGAWSPLGIGTTDFQGERFAMESGTSMSAPHVTGIA  621

Query  1837  ALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasq----qlapaTPFDFGSGFIN  2004
             ALIK + P++ P+AI SA+ T+A ++DR G  ++AQ+         +PATPFD GSGF+N
Sbjct  622   ALIKQKFPHFTPAAIASALSTTASLSDRKGQHIMAQRTVLNPDISQSPATPFDMGSGFVN  681

Query  2005  PSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPE-NKKFWCSDLNTPSVTI  2181
              + AL+PGL+F+  + +Y++FLC + G     V    G  C   N     SDLN PSVTI
Sbjct  682   ATAALDPGLIFDIGYNEYMKFLCGIDG-SSPVVLNYTGESCSAYNSSLAASDLNLPSVTI  740

Query  2182  SNLVGSRTVMRRVTNVG--GADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNA  2355
             + LVG+RTV+R VTN+     +E Y V  + P  V V + P  F I    +R L IVL A
Sbjct  741   AKLVGTRTVLRWVTNIATTATNETYTVGWKAPDSVSVKVSPAKFTIGNGQTRVLSIVLGA  800

Query  2356  TKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              K  +  SFG + L GDR H+V +P AV
Sbjct  801   MKNVSMASFGRIGLFGDRGHVVNIPVAV  828



>ref|XP_002893636.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69895.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=832

 Score =   545 bits (1404),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 343/802 (43%), Positives = 486/802 (61%), Gaps = 37/802 (5%)
 Frame = +1

Query  112   IYMVLMEDHPFV--STRIKGTSGNV------TMYKQ-----RMTKQHDVFLGSLLRRSAY  252
             +Y+V ++D P V  S R    S +V       +Y+       + + HD  L  +LR+  Y
Sbjct  36    VYIVTLKDRPLVHFSGRESSDSKHVLTPTSSQIYRTLNRSASIIRVHDSLLRKVLRKENY  95

Query  253   TKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWP  432
              KLYSY +L+NGF+  +   +A ++  + E V  +  D  +EK TTHTP FLG+P   W 
Sbjct  96    LKLYSYHYLINGFSAVLTRKQADRLAAREE-VDNVVLDFPVEKATTHTPQFLGLPRGAWL  154

Query  433   RLGGPSVSGEGVVIGMIDTGINPFHASFSSP---EEYNIGRPRITRKFTGKCITGDNFPA  603
             R GG   +GEGVVIG IDTGI+P H SFS       Y+I  PR    FTG C     FP 
Sbjct  155   RDGGSEYAGEGVVIGFIDTGIDPTHPSFSDKIPGHTYSI-PPR----FTGVCEVTIGFPP  209

Query  604   TACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFN  783
              +CN K++GA++FA +A++ G  N S+  ASPFD +GHG+HTAS AAGN+  PV+    +
Sbjct  210   GSCNRKLIGARHFAESALSRGVLNSSQDDASPFDGEGHGTHTASVAAGNHGIPVVVAGHH  269

Query  784   YGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSA  960
              G ASGM+P A IA+YKALY  FGG+ +D++AA+DQA +DGVDI++LS+ P+  P G + 
Sbjct  270   LGNASGMSPRAHIAIYKALYKRFGGFAADIIAAIDQAAQDGVDIINLSITPNRRPPGIAT  329

Query  961   FLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGN  1140
             F N +++ LL A +AG+ VVQAAGN+GP+ +SM SFSPW+ +V A++ DR Y+NSI+LGN
Sbjct  330   FFNPIDMALLSAVKAGIFVVQAAGNTGPAPKSMSSFSPWIFTVGATSHDRVYSNSIILGN  389

Query  1141  GQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLTVESCQDAMQFVPSLVRGKLVI  1317
               T  G GL+  T  +   +L  A    R  +T    + V  CQD+  F   LV GK+++
Sbjct  390   NVTIPGVGLASGT--RTMHKLVLATHALRNGTTIMDAIYVGECQDSSSFDQKLVHGKILV  447

Query  1318  CTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNME  1497
             C+YT  F    ++I     T     AAG V  +DP     Q+   +  + IPG++I++ +
Sbjct  448   CSYTVRFILGVSTIKQALITAKNLTAAGLVFYIDPSATGFQM--TSTPMDIPGILISSPQ  505

Query  1498  ASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNAL  1674
              S AL +YYNS+ LR   SG+ V   + ARI+ G +  Y    P V  +S+RGPD  +  
Sbjct  506   YSQALLRYYNSSLLRENGSGKIVGSASVARIVGGMKPTYGITAPKVMYFSARGPDPEDDS  565

Query  1675  LDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDR  1854
                AD++KPN++APG++IW AWSP + G    +G+ FA+ SGTSM+ PH+ GIAALIK +
Sbjct  566   FVDADIMKPNLVAPGNAIWGAWSPLAIGTTDFQGERFAMESGTSMSAPHVTGIAALIKQK  625

Query  1855  HPNWKPSAITSAMMTSADVTDRlgspllaqqasq----qlapaTPFDFGSGFINPSRALN  2022
              P++ P+AI SA+ T+A ++DR G  ++AQ+         +PATPFD GSGF+N + AL+
Sbjct  626   FPHFTPAAIASALSTTASLSDRKGEHIMAQRTVLNPDISQSPATPFDMGSGFVNATAALD  685

Query  2023  PGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPE-NKKFWCSDLNTPSVTISNLVGS  2199
             PGL+F+  + +Y++FLC++ G     V    G  C   N     SDLN PSVTI+ LVG+
Sbjct  686   PGLIFDIGYNEYMKFLCSING-SSPVVLNFTGESCSAYNSSLAASDLNLPSVTIAKLVGT  744

Query  2200  RTVMRRVTNVG--GADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNS  2373
             RTV+R VTN+     +E Y V    P  V V + P  F I    +R L +V  A K  + 
Sbjct  745   RTVLRWVTNIATTATNETYTVGWMAPDSVSVKVSPAKFTIGHGQTRVLSLVFRAMKNVSI  804

Query  2374  YSFGEMILLGDRNHIVRVPFAV  2439
              SFG + L GDR HIV++P AV
Sbjct  805   ASFGRIELFGDRGHIVKIPVAV  826



>ref|XP_011002567.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=786

 Score =   543 bits (1400),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 338/772 (44%), Positives = 446/772 (58%), Gaps = 20/772 (3%)
 Frame = +1

Query  154   RIKGTSGNVT-MYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKIL  330
             ++    G V+  + + +   HD  L S L   +Y KLYS+ H++NGF+VH    +A K L
Sbjct  19    KVLALDGEVSKAHAKHLVDSHDHLLQSNLETGSYNKLYSFKHIVNGFSVHTTPSQANK-L  77

Query  331   HKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHA  510
             + A GV+ + +D   + MTT+TP FLG+P  VW + GG   +GEG+VIG +DTGI P H 
Sbjct  78    NVAPGVKLVEKDRGAKLMTTYTPQFLGLPQEVWAKEGGDKNAGEGIVIGFVDTGITPKHP  137

Query  511   SFS----SPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNV  678
             SF+    +P   NI        F+G C TG  FP+++CNGKI+ A+YF+  A A    N 
Sbjct  138   SFTYDPLNPFTSNISH------FSGACETGPRFPSSSCNGKILSARYFSAGAQAIATLNT  191

Query  679   SRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYSFGGY  858
             S  + SPFDA GHGSH AS AAGN   PVI + F YG ASGMAP A IAVYKA+Y   G 
Sbjct  192   SVDFLSPFDAAGHGSHVASIAAGNAGVPVIVDGFYYGRASGMAPRARIAVYKAVYPTVGT  251

Query  859   MSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNS  1038
             ++DVVAA+DQA  DGVDIL+LSVGP   P     FL+V +V +LFA RAGV V QAAGN 
Sbjct  252   ITDVVAAIDQATMDGVDILTLSVGPDEPPEDTITFLSVFDVFMLFARRAGVFVAQAAGNH  311

Query  1039  GPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFF--QLAAA  1212
             GP   +++S+SPW   VAA +TDR Y  S++LGNG    G GLS PT G   F  +L  A
Sbjct  312   GPDFSTVVSYSPWAVGVAACSTDRSYPGSLLLGNGLKVGGVGLSGPTFGDGKFLCKLVLA  371

Query  1213  VDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHR  1386
              D  R N         VE CQ      P +VRG++VIC ++  F +  ++I  + DT   
Sbjct  372   KDAVRVNGAFPRTPAYVEECQYPEALDPIIVRGRIVICVFSAGFYNGTSNINAIIDTART  431

Query  1387  AGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVA  1566
              G  GF    +P  G        +   + G+II  +  +  + QYY  N  R   G  + 
Sbjct  432   LGFMGFAFVANPAYG--DFIAEPIPFAVSGIIIPKVADAQIISQYYEQNIQRDERGFVIQ  489

Query  1567  FRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSP  1746
             + A A I +GR A + GQ P+V+ +SSRGPD  +   + ADVLKP+I+APG  IWAAWSP
Sbjct  490   YCARAAIREGRVASFVGQAPIVSRFSSRGPDFVDINRNPADVLKPDILAPGHQIWAAWSP  549

Query  1747  NSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl-  1923
              S  +  + G HFAL+SGTSMATPH  GIAALIK  +P+W PS I SA+ T+A   D   
Sbjct  550   LSALEPVLTGYHFALLSGTSMATPHAVGIAALIKQYNPSWTPSMIASAISTTATKYDNYG  609

Query  1924  gspllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSV  2103
                L          P+T  D G+G +NP+RA++PGLV    F+ +I FLC++PG+D   +
Sbjct  610   EVILAEGSYLNSYYPSTHLDRGAGLVNPARAIDPGLVLPAEFEDHINFLCSLPGIDWSVI  669

Query  2104  RRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVR  2283
                 G  C        ++LN PSVTIS L  S TV R + NVG   E Y   V  P G  
Sbjct  670   NAATGERCSRLLSH-PANLNLPSVTISTLRSSLTVKRSLKNVGSRPETYTCSVISPNGTM  728

Query  2284  VTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             V + P  F I+    + + I     KA   +SFGE++L G  NHIVR+P +V
Sbjct  729   VNLSPTWFRIAPQEIQDIEIQFRVIKAGAEFSFGEIVLTGSLNHIVRLPLSV  780



>ref|XP_011096735.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=842

 Score =   545 bits (1404),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 337/773 (44%), Positives = 467/773 (60%), Gaps = 19/773 (2%)
 Frame = +1

Query  166   TSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEG  345
             T G+   Y  R+   HD  L   LR   Y KLYSY +L+NGFAV V   +A K+  + E 
Sbjct  79    TGGHHGSYIDRV---HDSLLRKALRGEKYLKLYSYRYLINGFAVLVTPQQADKLSRRRE-  134

Query  346   VRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSP  525
             V  +  D  +   TTHTP FLG+P   W + GG   +GEGVVIG IDTGI+P H SFS  
Sbjct  135   VSNVVLDFSVRTATTHTPQFLGLPQGAWAQEGGFETAGEGVVIGFIDTGIDPTHPSFSDD  194

Query  526   EEYNIGRPR-ITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPF  702
                  G+P  +   F+G C    +FP+ +CN K++GA++FA +AI  G FN ++ YASP+
Sbjct  195   TP---GKPYPVPEHFSGICEVTRDFPSGSCNRKLIGARHFAASAITRGIFNATQDYASPY  251

Query  703   DADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaa  879
             DADGHG+HTA+ AAGN+   V+    ++G ASGMAP + IAVYKALY SFGG+ +DVVAA
Sbjct  252   DADGHGTHTAAIAAGNHGIAVVVAGHHFGNASGMAPRSHIAVYKALYKSFGGFAADVVAA  311

Query  880   vdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSM  1059
             +DQA +DGVDI+SLS+ P+  P G + F N +++ LL A +AG+  VQAAGN+GPS +S+
Sbjct  312   IDQAAQDGVDIISLSITPNRRPPGIATFFNPIDMALLSAVKAGIFAVQAAGNTGPSPKSI  371

Query  1060  LSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST  1239
              SFSPW+ SV A+  DR Y+NSIVLGN  T  G GL+P T   A + L +A+      + 
Sbjct  372   SSFSPWIFSVGAAAHDRIYSNSIVLGNNITIQGVGLAPGTDTDAMYTLVSAIHALNDTTA  431

Query  1240  AGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMD  1419
             A  + V  CQDA  F   +VRG L+IC+Y+  F    ++I    +T     AAG V  MD
Sbjct  432   ANDMYVSECQDASNFNQDVVRGNLLICSYSIRFVLGLSTIKQALETAKNLSAAGVVFYMD  491

Query  1420  PDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRS-RSGRAVAFRATARILDG  1596
             P +   Q+    V ++IPG+II + + S  L QYYNS+  R   + + V F   A I  G
Sbjct  492   PYVIGFQLN--PVPMRIPGIIIPSPDDSKVLLQYYNSSLGRDGTTKKIVKFGGVASISGG  549

Query  1597  RRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKG  1776
              +A +S   P +  YS+RGPD  ++ LD AD+LKPNI+APG+ IW+AWS         +G
Sbjct  550   IKANFSRAAPKIMYYSARGPDPEDSSLDDADILKPNIVAPGNYIWSAWSCRGTDSVEFEG  609

Query  1777  QHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaq  1944
             + FA++SGTSMA PH+AG+AALIK + P + P+AI SA+ T+A ++DR      +     
Sbjct  610   ESFAMMSGTSMAAPHVAGLAALIKQKFPFFTPAAIGSALSTTASLSDRNGGPIMAQRAYA  669

Query  1945  qasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVE  2124
                   +PATPFD GSGF+N + AL+PGL+F++ +  Y+ FLC + G     V    G  
Sbjct  670   NPDLNQSPATPFDMGSGFVNATAALDPGLIFDSSYDDYMSFLCGING-SSPVVLNYTGQS  728

Query  2125  CPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQN  2304
             C  +     +DLN PS+TIS L  S  V R VTN+ G++E Y V    P G  V + P +
Sbjct  729   CGVS-TMNATDLNLPSITISKLNQSAIVQRTVTNI-GSNETYSVGWSAPYGASVKVTPTH  786

Query  2305  FFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
             F I++   + L ++ N T  +   SFG + L G + HI+ +P +V V  S  +
Sbjct  787   FSIASGEKQVLSVLFNTTMNSTVASFGRIGLFGTKGHIINIPVSVIVKVSYNT  839



>ref|XP_003569908.2| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=863

 Score =   546 bits (1406),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 326/758 (43%), Positives = 455/758 (60%), Gaps = 15/758 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   + +  +  L   LR   YTKLYSY +L+NGFAV +   +A K+  + E V  +  D
Sbjct  106   YGSYLVQLQNSVLKKTLRGERYTKLYSYHYLINGFAVVLTPQQAEKLYRRKE-VVNVMLD  164

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TT+TP+FLG+P   W + GGP  +G+GVV+G+IDTGI+P H SF+  ++     
Sbjct  165   FSVRTATTYTPEFLGLPQGAWVQEGGPQCAGQGVVVGLIDTGIDPNHPSFA--DDLTTDS  222

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
               +   + G C   ++FP+ +CN K+VGAQ+FA +AI  G FN S+  ASP D+DGHG+H
Sbjct  223   YPVPAHYAGSCEVTNDFPSGSCNRKLVGAQHFAASAITRGVFNASQDLASPSDSDGHGTH  282

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedg  903
             TAS AAGN   PVI    ++G ASGMAP A IAVYKAL+  FGG+ +DVVAA+DQA ED 
Sbjct  283   TASIAAGNNGIPVIVAGHHFGNASGMAPRAHIAVYKALFKGFGGFAADVVAAIDQAAEDN  342

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ L+ A +AG+ VVQAAGN+GPS +SM S+SPW+ 
Sbjct  343   VDIISLSITPNRRPPGLATFFNPIDMALMSAVKAGIFVVQAAGNTGPSPKSMSSYSPWIF  402

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVE  1260
             +V AS  DR Y N +VLGN  T  G GL+P T G + + L AA      N+ +   +++ 
Sbjct  403   TVGASAHDREYKNYVVLGNNLTIPGVGLAPGTDGDSMYNLIAAPHALENNTASPTEVSIG  462

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD+      L+RGK++IC+Y+  F    +S+    DT     AAG +  +DP +   Q
Sbjct  463   ECQDSSHLDKDLIRGKILICSYSIRFVLGLSSVKQALDTAKNTSAAGVIFYLDPFVLGFQ  522

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIYSG  1617
             +      + +PGLII + + S     YYN + +R  +    V+F A A+IL G    Y  
Sbjct  523   LN--PTPMDVPGLIIPSSDDSKVFLSYYNESLVRDETSNGIVSFGAVAKILGGLNPNYGS  580

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  +  L  AD+LKPN++APGSSIW AWS          G+ FA++S
Sbjct  581   SAPKVMFYSARGPDPEDNTLSNADILKPNLVAPGSSIWGAWSSLGMDSAEFAGEIFAMLS  640

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqla  1965
             GTSMA PHIAG+AALIK ++P++ P+AI SA+ T+  + D+      S            
Sbjct  641   GTSMAAPHIAGLAALIKQKYPSFSPAAIGSALSTTTTINDKQGNPIMSQRTYSNPDSTQT  700

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF  2145
             PATPFD G+GF+N + AL+PGL+F+  +  ++ FLC + G     V    G  C  +   
Sbjct  701   PATPFDMGNGFVNATAALDPGLIFDCSYDDFLSFLCGING-SASVVMNYTGNNCGVS-NM  758

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
               +DLN PS+TI+ L  SRT+ R VTNV  +DE Y V  R P GV V+  P  FFI +  
Sbjct  759   TGADLNLPSITIAVLNQSRTITRTVTNV-ASDENYTVSYRAPYGVAVSATPTQFFIPSGQ  817

Query  2326  SRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              + +  V+NAT   +S SFG +   GDR H V +PF+V
Sbjct  818   KQLVTFVMNATMNNSSASFGNVGFYGDRGHQVIIPFSV  855



>ref|XP_002886474.1| hypothetical protein ARALYDRAFT_893252 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62733.1| hypothetical protein ARALYDRAFT_893252 [Arabidopsis lyrata subsp. 
lyrata]
Length=832

 Score =   545 bits (1403),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 334/787 (42%), Positives = 461/787 (59%), Gaps = 14/787 (2%)
 Frame = +1

Query  109   KIYMVLMEDHPFVSTRIKGTSGNVTMYK-QRMTKQHDVFLGSLLRRSAYTKLYSYTHLLN  285
             KIY VL+E  P         +     Y+ +++ + HD  LGS L   +YTKLYS+ H++N
Sbjct  47    KIYSVLVEGEPLAFRASTNINSKAMAYEAKKIVEIHDEILGSTLENGSYTKLYSFKHVIN  106

Query  286   GFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLG--GPSVSG  459
              FAV   + +A K+      V+ + ED  ++ MTT+TPDFL +P  VWP++   G   +G
Sbjct  107   AFAVRTTASQAKKLKKTKG-VKAVEEDKGVKLMTTYTPDFLELPQQVWPKISSEGGRRAG  165

Query  460   EGVVIGMIDTGINPFHASFSSPEEYNIGRPRITR-KFTGKCITGDNFPATACNGKIVGAQ  636
             E +VIG +DTGINP H SF++ +  N     ++R KF+G C TG  FPA +CNGKI+ A+
Sbjct  166   EDIVIGFVDTGINPTHPSFAALDLTNPYSSNLSRLKFSGDCETGPLFPAGSCNGKIISAR  225

Query  637   YFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGA  816
             +F+  A A+   N S    SPFDA GHGSH AS AAGN   PVI + F YG ASGMAP A
Sbjct  226   FFSAGARASVALNSSLDILSPFDASGHGSHVASIAAGNAGVPVIVDGFFYGQASGMAPRA  285

Query  817   GIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFA  996
              IAVYKA+Y   G + DV+AA+DQA+ DGVD+L+LSVGP   P      L + ++ +L A
Sbjct  286   RIAVYKAIYPSIGTLVDVIAAIDQAIMDGVDVLTLSVGPDEPPVDKPTVLGIFDLSMLLA  345

Query  997   TRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPP  1176
              +AGV VVQA GN+GPS  S+LS+SPWV  VAA +TDR Y  S++L  GQT  G GLS P
Sbjct  346   RKAGVFVVQAVGNNGPSPSSVLSYSPWVVGVAAGSTDRSYPASLILDGGQTVYGVGLSGP  405

Query  1177  TAGKAFFQ--LAAAVDVCRRNSTAGL---LTVESCQDAMQFVPSLVRGKLVICTYTYDFE  1341
             T G    Q  L  A D  R N +        +E CQ    F P+ V G +VICT++  F 
Sbjct  406   TLGAPLLQHRLVLARDAVRTNGSVLQPLRSDIEECQRPENFDPAAVFGTIVICTFSDGFY  465

Query  1342  SEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQY  1521
             ++ +++  +  T    G  GF+L  +P  G        V    PG++I  + A+  + +Y
Sbjct  466   NQMSTVRAITQTARNLGFMGFILIANPRFG--DYVAEPVLFSAPGILIPTVSAAQIILRY  523

Query  1522  YNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKP  1701
             Y   T R + G    F A  RI +GR ++++G+ PVV+ +SSRGP   +A  +  DVLKP
Sbjct  524   YEEKTYRDKRGIVTQFGARGRIDEGRNSVFAGKAPVVSRFSSRGPAFIDANRNLLDVLKP  583

Query  1702  NIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAI  1881
             +I+APG  IW AWS  S  D  + G+ FA++SGTSMATPHIAGI ALIK  +P+W P+ I
Sbjct  584   DILAPGHQIWGAWSLPSAFDPILTGRSFAILSGTSMATPHIAGIGALIKQLNPSWTPAMI  643

Query  1882  TSAMMTSADVTDRlgspllaqqasqqlapaTP-FDFGSGFINPSRALNPGLVFNTYFQQY  2058
              SA+ T+A+  D  G  + A+         +  FD G+G +NP+RAL+PGLV    F+ Y
Sbjct  644   ASAISTTANEYDSSGEVISAESYEISGLFPSNHFDHGAGHVNPARALDPGLVLPAGFEDY  703

Query  2059  IQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGA  2238
             I FLC++P ++  ++R   GV C        ++LN PSVTIS L  S  V R   NV   
Sbjct  704   ISFLCSLPNINPVTIRAATGVSC-TTALSHPANLNHPSVTISALKESLVVRRSFQNVSNK  762

Query  2239  DERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHI  2418
              E Y   V  P G  V + P  F +    ++ L I  N T+    ++FGE++L G  NHI
Sbjct  763   TETYLGSVLPPNGTTVRLTPSYFTVPPQRTQDLDIEFNITQVLTKFTFGEVVLTGSLNHI  822

Query  2419  VRVPFAV  2439
             +R+P +V
Sbjct  823   IRIPLSV  829



>ref|XP_008383350.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=846

 Score =   545 bits (1404),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 336/773 (43%), Positives = 471/773 (61%), Gaps = 19/773 (2%)
 Frame = +1

Query  154   RIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILH  333
             R +  S     Y   + + HD  L  + R   Y KLYSY +L+NGFAV V  D+  K+  
Sbjct  74    RFRNISRTDRRYSSYIARVHDSLLRRVFRGEKYLKLYSYHYLINGFAVFVTQDQVDKLSR  133

Query  334   KAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHAS  513
             + E V  +  D  +   TTHTP FLG+P   W + GG   +GEGVVIG IDTGI+P H+S
Sbjct  134   RRE-VANVVLDFSVRTATTHTPRFLGLPQGAWVQGGGYESAGEGVVIGFIDTGIDPTHSS  192

Query  514   FSSPEEYNIGRPR-ITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHY  690
             F   +++   RP  +   F+G C    +FP+ +CN K++ A++FA +AI  G FN S+ Y
Sbjct  193   F---DDHTSERPYPVPAHFSGICEVTPDFPSGSCNRKLIAARHFASSAITRGVFNSSQDY  249

Query  691   ASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSd  867
             ASPFD +GHG+HTAS AAGN+   V+    ++G ASGMAP + IAVYKALY SFGG+ +D
Sbjct  250   ASPFDGEGHGTHTASIAAGNHGIRVVVAGHHFGNASGMAPRSHIAVYKALYKSFGGFAAD  309

Query  868   vvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPS  1047
             VVAA+DQA +DGVDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS
Sbjct  310   VVAAIDQAAQDGVDIISLSITPNRRPPGIATFFNPIDMALLSAVKAGIFVVQAAGNTGPS  369

Query  1048  SRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCR  1227
              +SM SFSPW+ +V +S+ DR Y+NSI+LGN  T +G GL+P T     + L +A     
Sbjct  370   PKSMSSFSPWIFTVGSSSHDRNYSNSIMLGNNVTITGVGLAPGT--DTMYTLISATHALN  427

Query  1228  RNST-AGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGF  1404
               +T +  + V  CQD+  F   LVRG L+IC+Y+  F    ++I    +T     A G 
Sbjct  428   NGTTVSDDMYVGECQDSSNFNRDLVRGNLLICSYSIRFVLGISTIHKSLETAKNLSAIGV  487

Query  1405  VLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRS-RSGRAVAFRATA  1581
             V TMD  +   Q+      +++PG+II + E S  L +YYN +  R   + R   F A A
Sbjct  488   VFTMDAFVIGFQLN--PTPMKLPGIIIPSPEDSKVLLKYYNLSLERDIMTKRITKFGALA  545

Query  1582  RILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGD  1761
              I  G +A YS   P +  YS+RGPD  +  LD AD++KPN++APG+SIWAAWS   +  
Sbjct  546   TICGGLKANYSTSAPKIMYYSARGPDPEDNFLDDADIMKPNLVAPGNSIWAAWSSVGQDS  605

Query  1762  KYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gs  1929
                +G+HFA++SGTSMA PH+AG+AAL++ + PN+ PSAI SA+ T+A + DR      +
Sbjct  606   IEFQGEHFAMMSGTSMAAPHVAGLAALVRQKFPNFSPSAIASALSTTASLYDRNGGPIMA  665

Query  1930  pllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRR  2109
                     Q  +PATPFD GSGF+N + ALNPGL+F+T +  Y+ FLC + G     V  
Sbjct  666   QRAYAFPDQNQSPATPFDMGSGFVNATAALNPGLIFDTSYDNYMSFLCGING-SAPVVLN  724

Query  2110  VVGVEC-PENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRV  2286
               G  C   N      DLN PS+TI+ L  SRTV+R V NV  A+E Y V    P GV +
Sbjct  725   YTGESCWTYNSTINGGDLNLPSITIAKLNQSRTVLRTVRNV-AANETYSVGWSAPFGVSL  783

Query  2287  TIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
              + P +F I++  ++ L + +NAT  + + S+G + L G  +H+V +P +V V
Sbjct  784   KVSPLHFSIASGETQVLSVFVNATSNSTTASYGRIGLFGHLSHVVNIPLSVIV  836



>gb|KDP34877.1| hypothetical protein JCGZ_09165 [Jatropha curcas]
Length=843

 Score =   545 bits (1403),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 335/756 (44%), Positives = 468/756 (62%), Gaps = 18/756 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD  L  +LR   Y KLYSY +L+NGFAV V   +A K+  + E V  +  D  + 
Sbjct  86    IARVHDSLLRRVLRGEKYLKLYSYHYLINGFAVLVTQQQADKLSRRRE-VANVVLDFSVR  144

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSP-EEYNIGRPRI  555
               TTHTP FLG+P   W + GG   +GEG+VIG IDTGI+P H SF+    E++   P  
Sbjct  145   TATTHTPQFLGLPQGAWVKEGGYEAAGEGIVIGFIDTGIDPTHPSFADDISEHSYPVPG-  203

Query  556   TRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAS  735
                ++G C    +FP+ +CN K++GA++FA +AI  G FN S  YASPFD DGHG+HTAS
Sbjct  204   --HYSGICEVTRDFPSGSCNRKLIGARHFAASAITRGIFNSSEDYASPFDGDGHGTHTAS  261

Query  736   TAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdI  912
              AAGN+  PVI    ++G ASGMAP A IAVYKALY SFGG+ +DVVAA+DQA +DGVDI
Sbjct  262   VAAGNHGIPVIVAGHHFGNASGMAPRAHIAVYKALYKSFGGFAADVVAAIDQAAQDGVDI  321

Query  913   lslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVA  1092
             +SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM SFSPW+ +V 
Sbjct  322   ISLSITPNRRPPGLATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSMSSFSPWIFTVG  381

Query  1093  ASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVESCQ  1269
             A++ DR Y+NS+ LGN  T  G GL+P T   A + L +A+     ++T    + V  CQ
Sbjct  382   AASHDRDYSNSMTLGNNVTIPGVGLAPGTK-DASYTLISAIHALNNDTTVTTDMYVGECQ  440

Query  1270  DAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKG  1449
             D+  F   +V+G L+IC+Y+  F    ++I    +T     AAG V  MDP +   ++  
Sbjct  441   DSSNFNQDVVQGNLLICSYSIRFVLGLSTIKQALETAKNLSAAGVVFYMDPFVIGFRLN-  499

Query  1450  ATVTLQIPGLIINNMEASTALRQYYNSN-TLRSRSGRAVAFRATARILDGRRAIYSGQGP  1626
               + +++PG+II++ + S  L  YYNS+  + + S + + F A A I  G +A YS   P
Sbjct  500   -PIPMRMPGIIISSPDDSKILLNYYNSSLEIDAMSKKIIKFGAVACISGGLKANYSNSAP  558

Query  1627  VVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTS  1806
             VV  YS+RGPD  ++ LD AD+LKPN++APG+SIWAAWS         +G++FA++SGTS
Sbjct  559   VVMFYSARGPDPEDSFLDDADILKPNLVAPGNSIWAAWSSLGTDSVEFQGENFAMMSGTS  618

Query  1807  MATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaT  1974
             MA PH+AG+AALIK   P++ PSAI SA+ T+A + D+      +        Q  +PAT
Sbjct  619   MAAPHVAGLAALIKQNFPSFSPSAIASALSTTASLIDKNGRSIMAQRAYANPDQNKSPAT  678

Query  1975  PFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKKFWC  2151
             PFD GSGF+N + AL+PGL+F++ +  Y+ FLC + G     V    G  C   N     
Sbjct  679   PFDMGSGFVNATAALDPGLIFDSSYDDYMSFLCGING-SGPVVFNYTGQNCWTYNSTING  737

Query  2152  SDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
             SDLN PS+TIS L   R V R VTN+ G +E Y V    P GV V + P +F I++    
Sbjct  738   SDLNLPSITISKLDQYRMVQRTVTNIAG-NESYNVGWSAPYGVAVKVAPTHFTIASGEKL  796

Query  2332  HLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              L I+LNAT  +    +G + L G++ H++ +P AV
Sbjct  797   VLNIMLNATMNSTVAGYGRIGLFGNKGHVLNIPMAV  832



>dbj|BAG95740.1| unnamed protein product [Oryza sativa Japonica Group]
Length=718

 Score =   540 bits (1392),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 326/711 (46%), Positives = 437/711 (61%), Gaps = 14/711 (2%)
 Frame = +1

Query  322   KILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINP  501
             + L KA GV+ +  D+K++K+TTHTP FLG+P  VWP  GG   +GE VVIG +D+GI P
Sbjct  7     EFLRKAPGVKHVERDMKIQKLTTHTPQFLGLPTGVWPTGGGFDRAGEDVVIGFVDSGIYP  66

Query  502   FHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVS  681
              H SFS+ +    G       + GKC        + CNGKIVGAQ+FA+AAIAAG FN  
Sbjct  67    QHPSFSAHKTDPYGP---VPHYKGKCEMDPVTRRSFCNGKIVGAQHFAKAAIAAGAFNPD  123

Query  682   RHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGY  858
               +ASP D DGHGSHTA+ AAGN   PV  +   +G ASGMAP A IAVYK LY  FGGY
Sbjct  124   VDFASPLDGDGHGSHTAAIAAGNNGIPVRMHGHEFGKASGMAPRARIAVYKVLYRLFGGY  183

Query  859   MSdvvaavdqavedgvdIlslsv-gpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGN  1035
             +SDVVAA+DQAV+DGVDIL+LSV   S   +  + FLN  +  LL A +AGV V QAAGN
Sbjct  184   VSDVVAAIDQAVQDGVDILNLSVGPNSPPTATRTTFLNPFDAALLSAVKAGVFVAQAAGN  243

Query  1036  SGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAV  1215
              GP  ++++SFSPW+T+VAA   DRRY N +VLGNG+   G G+SP T     F L +A 
Sbjct  244   GGPFPKTLVSFSPWITTVAAGVDDRRYKNHLVLGNGKLLPGLGVSPATHENKSFSLISAA  303

Query  1216  DVCRRNSTAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGA  1395
             D     S+A   +   CQ         ++GK+++C Y++++ S  ASI  V++T    GA
Sbjct  304   DALL-GSSATKYSALDCQRPELLNKRKIQGKILLCGYSFNYISGTASIKKVSETARSLGA  362

Query  1396  AGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRA  1575
             AGF++ ++      +     V + +PG++I ++  +  L  YYNS+T+R  +GRA  F+A
Sbjct  363   AGFIVAVENSYPGTKFD--PVPVSMPGILITDVSRTKDLIDYYNSSTIRDWAGRATTFQA  420

Query  1576  TARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSE  1755
             TA I DG         P VA +SSRGPDV +     ADVLKP+I+APG+ IWAAW+PN  
Sbjct  421   TAAIADGLAPTLYNSAPQVALFSSRGPDVKDFSFQDADVLKPDILAPGNLIWAAWAPNGT  480

Query  1756  GDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlg---  1926
              +    G+ FA+VSGTSMA PHIAGIAALIK ++P W PSAI SA+MT+++  D+     
Sbjct  481   DEANYAGEGFAMVSGTSMAAPHIAGIAALIKQKNPKWSPSAIKSALMTTSNTLDKGSHPL  540

Query  1927  -spllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSV  2103
              +   +      L  ATPFD+GSG +NP  AL+PGLV +   Q YI FLC++P V+   V
Sbjct  541   RAQQYSTSEIMTLTRATPFDYGSGAVNPKAALDPGLVLDATHQDYITFLCSIPDVEHSEV  600

Query  2104  RRVVGVECPENKKFWCS--DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLG  2277
               + G  C  + K      DLN PS+TIS L G++TV R VT+V    E Y ++ R    
Sbjct  601   SNITGSTCSSSSKVQQRPYDLNIPSITISQLRGTQTVKRTVTSVAAEAETYTIMTRMSPE  660

Query  2278  VRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVP  2430
             + + + P    +    SR +   L A   T +YSFGE+ + GDR H+VR+P
Sbjct  661   IALEVSPPALTVLPGASREITATLTARSVTGTYSFGEITMKGDRGHLVRIP  711



>ref|XP_006353035.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=854

 Score =   545 bits (1403),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 334/762 (44%), Positives = 467/762 (61%), Gaps = 21/762 (3%)
 Frame = +1

Query  202   TKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEK  381
             ++ H+  L  +LR   Y KLYSY +L+NGFAV V   +A K+ ++ E V  +  D  +  
Sbjct  103   SRMHNSLLRKVLRGEKYLKLYSYHYLINGFAVLVTPQQAFKLANRRE-VANVALDFSIRT  161

Query  382   MTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS--SPEEYNIGRPRI  555
              TTHTP FLG+P   W   GG   +GEG+VIG IDTGI+P H SFS  +PE +      +
Sbjct  162   ATTHTPQFLGLPLGAWAEEGGYETAGEGIVIGFIDTGIDPTHPSFSDNTPERHY----PV  217

Query  556   TRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAS  735
              + F+G C    +FP+ +CN K+VGA++FA +AI  G FN S+ YASPFD DGHG+HTAS
Sbjct  218   PQHFSGICEVTRDFPSGSCNRKLVGARHFAASAITRGIFNTSQDYASPFDGDGHGTHTAS  277

Query  736   TAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdI  912
              AAGN+   V+    ++G ASGMAP A +AVYKALY SFGG+ +DVVAA+DQA +DGVDI
Sbjct  278   VAAGNHGISVVVAGHHFGDASGMAPRAHVAVYKALYKSFGGFAADVVAAIDQAAQDGVDI  337

Query  913   lslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVA  1092
             ++LS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +S+ SFSPW+ +V 
Sbjct  338   INLSITPNRRPPGVATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSVSSFSPWIFTVG  397

Query  1093  ASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQD  1272
             AST DR Y+NSIVLGN  T  G GL+P T   + + L  A      ++ A  + V  CQD
Sbjct  398   ASTHDRVYSNSIVLGNNITIPGVGLAPGT--DSMYTLVMASHALN-DTVASDMYVGECQD  454

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
             A  F  +LV+G L++C+Y+  F    ++I    +T     AAG V  MDP +   QI   
Sbjct  455   ASSFNQTLVQGNLLVCSYSVRFVLGLSTIKQALETAKNLSAAGVVFCMDPFVIGFQIN--  512

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVA-FRATARILDGRRAIYSGQGPV  1629
                +++PG+II +   S  L QYYNS+  +    + +  F A A I  G +A +S   P 
Sbjct  513   LTPMRLPGIIIPSANDSKILLQYYNSSLDQDEVTKKITRFGAVASISGGLKANFSLSAPN  572

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  ++ LD AD+LKPN++APG+ IWAAWS         +G+ FA++SGTSM
Sbjct  573   VMFYSARGPDPEDSFLDDADILKPNLVAPGNLIWAAWSSGGMDSVEFEGEDFAMMSGTSM  632

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTP  1977
             A PH+AG+AALIK + PN   +AI SA+ T+A ++D+    + +           +PATP
Sbjct  633   AAPHVAGLAALIKQKFPNLSTAAIGSALSTTASLSDKYGGPILAQRSYANPDSNQSPATP  692

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSD  2157
             FD GSGF+N + AL+PGL+F+T +  Y+ FLC + G     VR   G  C  +     +D
Sbjct  693   FDMGSGFVNATAALDPGLIFDTGYSDYMSFLCGING-SAPMVRNYTGESCGAS-TMSGTD  750

Query  2158  LNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHL  2337
             LN PS+TIS L  SRTV R + N+  A+E Y V    P G  + + P  FFI+    + L
Sbjct  751   LNLPSITISKLNQSRTVQRTLINI-AANETYVVGWSAPYGASIKVTPARFFIACGQQQVL  809

Query  2338  IIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
              +  NAT   +S SFG + L G++ H++ +P +V V  S  +
Sbjct  810   NVDFNATMNNSSPSFGRIGLFGNQGHVINIPLSVIVKISYNT  851



>ref|XP_004233183.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=854

 Score =   545 bits (1403),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 334/762 (44%), Positives = 469/762 (62%), Gaps = 21/762 (3%)
 Frame = +1

Query  202   TKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEK  381
             ++ H+  L  +LR   Y KLYSY +L+NGFAV V   +A K+ ++ E V  +  D  +  
Sbjct  103   SRMHNSLLRKVLRGEKYLKLYSYHYLINGFAVLVTPQQAFKLANRRE-VANVALDFSVRT  161

Query  382   MTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFS--SPEEYNIGRPRI  555
              TTHTP FLG+P   W + GG   +GEG+VIG IDTGI+P H SFS  +PE +      +
Sbjct  162   ATTHTPQFLGLPLGAWAQEGGYETAGEGIVIGFIDTGIDPTHPSFSDNTPERHY----PV  217

Query  556   TRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAS  735
              + F+G C    +FP+ +CN K+VGA++FA +AI  G FN S+ YASPFD DGHG+HTAS
Sbjct  218   PQHFSGICEVTRDFPSGSCNRKLVGARHFAASAITRGIFNTSQDYASPFDGDGHGTHTAS  277

Query  736   TAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdI  912
              AAGN+   V+    ++G ASGMAP A IAVYKALY SFGG+ +DVVAA+DQA +DGVDI
Sbjct  278   VAAGNHGISVVVAGHHFGDASGMAPRAHIAVYKALYKSFGGFAADVVAAIDQAAQDGVDI  337

Query  913   lslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVA  1092
             ++LS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +S+ SFSPW+ +V 
Sbjct  338   INLSITPNRRPPGVATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSVSSFSPWIFTVG  397

Query  1093  ASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQD  1272
             AST DR Y+NSIVLGN  T +G GL+P T   + + L  A      ++ A  + V  CQD
Sbjct  398   ASTHDRVYSNSIVLGNNITIAGVGLAPGT--DSMYTLVMASHALN-DTAASDMYVGECQD  454

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
             A  F  +LV+G L++C+Y+  F    ++I    +T     AAG V  MDP +   QI   
Sbjct  455   ASSFNQTLVQGNLLVCSYSVRFVLGLSTIKQALETAKNLSAAGVVFCMDPFVIGFQIN--  512

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVA-FRATARILDGRRAIYSGQGPV  1629
                +++PG+II +   S  L QYYNS+  +    + +  F A A I  G +A +S   P 
Sbjct  513   PTPMRLPGIIIPSANDSKILLQYYNSSLDQDEVTKKITRFGAVASISGGLKANFSLSAPN  572

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  ++ LD AD+LKPN++APG+ IWAAWS         +G+ FA++SGTSM
Sbjct  573   VMFYSARGPDPEDSFLDDADILKPNLVAPGNLIWAAWSSGGMDSVEFEGEDFAMMSGTSM  632

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTP  1977
             A PH+AG+AALIK + PN   +AI SA+ T+A ++D+    + +           +PATP
Sbjct  633   AAPHVAGLAALIKQKFPNLSTAAIGSALSTTASLSDKYGGPILAQRSYANPDSNQSPATP  692

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSD  2157
             FD GSGF+N + AL+PGL+F+T +  Y+ FLC + G     VR   G  C  +     +D
Sbjct  693   FDMGSGFVNATAALDPGLIFDTGYSDYMSFLCGING-SAPMVRNYTGESCGAS-TMSGTD  750

Query  2158  LNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHL  2337
             LN PS+TIS L  +RTV R + N+  A+E Y V    P G  + + P  FFI+    + L
Sbjct  751   LNLPSITISKLNQTRTVQRTLINI-AANETYVVGWSAPYGASMKVTPARFFIACGQQQVL  809

Query  2338  IIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQS  2463
              +  NAT   +S SFG + L G++ H++ +P +V V  S  +
Sbjct  810   SVDFNATMNNSSPSFGRIGLFGNQGHVINIPLSVIVKISYNT  851



>ref|XP_006415447.1| hypothetical protein EUTSA_v10006799mg [Eutrema salsugineum]
 gb|ESQ33800.1| hypothetical protein EUTSA_v10006799mg [Eutrema salsugineum]
Length=834

 Score =   543 bits (1400),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 338/805 (42%), Positives = 484/805 (60%), Gaps = 35/805 (4%)
 Frame = +1

Query  100   AEAKIYMVLMEDHPFVSTRIKGTSGN--------VTMYKQR-----MTKQHDVFLGSLLR  240
             + + +Y+V ++  P V +    TSG+          +YK +     + + HD  L  +LR
Sbjct  34    SSSAVYIVTLKHPPSVHSSGSETSGSKHGLTSTSSQIYKTQNRSASIIRVHDSLLRKVLR  93

Query  241   RSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPD  420
                Y KLYSY +L+NGF+  +   +A K+  + E V  +  D  ++K TTHTP FLG+P 
Sbjct  94    NENYIKLYSYHYLINGFSAIITQKQADKLAAREE-VNNVVLDFPVKKATTHTPQFLGLPR  152

Query  421   TVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSS--PEEYNIGRPRITRKFTGKCITGDN  594
               W R GG   +GEGVVIG IDTGI+P H SFS   P       PR    F G C     
Sbjct  153   GAWLREGGSEYAGEGVVIGFIDTGIDPTHPSFSDKIPGHSYPVPPR----FNGVCEVAIG  208

Query  595   FPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITN  774
             FP  +CN K++GA++FA +A++ G  N S+  ASPFD +GHG+HTAS AAGN+  PV+ +
Sbjct  209   FPPGSCNRKLIGARHFAESALSRGVLNSSQDDASPFDGEGHGTHTASVAAGNHGIPVVVS  268

Query  775   RFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssvpsg  951
                 G ASGMAP A +A+YKALY  FGG+ +D++AA+DQA +DGVDI++LS+ P+  P G
Sbjct  269   GHYLGNASGMAPRAHVAIYKALYKRFGGFAADIIAAIDQAAQDGVDIINLSITPNRRPPG  328

Query  952   DSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIV  1131
              + F N +++ LL A +AG+ VVQAAGN+GP+ +SM SFSPW+ +V A++ DR Y+NS++
Sbjct  329   IATFFNPIDMALLSAVKAGIFVVQAAGNTGPAPKSMSSFSPWIFTVGATSHDRVYSNSLI  388

Query  1132  LGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA-GLLTVESCQDAMQFVPSLVRGK  1308
             LGN  T SG GL+  T  +   +L  A    R  +T    + +  CQD+  +   LV+GK
Sbjct  389   LGNNVTISGVGLASGT--RTMHKLILAAHALRNGTTVMDAVYIGECQDSSSYDQKLVQGK  446

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +++C+YT  F    ++I     T     AAG V  MDP     Q+  ++  + IPG++I+
Sbjct  447   ILVCSYTVRFILGVSTIKQALITAKNLTAAGLVFYMDPSATGFQM--SSTPMDIPGILIS  504

Query  1489  NMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVN  1665
             + + S AL +YYN++  R   SG+ V   + ARI+ G +A Y    P V  +S+RGPD  
Sbjct  505   SAQDSQALLRYYNTSLSRDNASGKIVGSASVARIVGGMKATYGVTSPKVMFFSARGPDPE  564

Query  1666  NALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALI  1845
             +   + ADV+KPN++APG+SIW AWSP   G    +G+ FA+ SGTSM+ PH+ G+AALI
Sbjct  565   DDSFENADVMKPNLVAPGNSIWGAWSPLGIGTTDFQGERFAMESGTSMSAPHVTGVAALI  624

Query  1846  KDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasq----qlapaTPFDFGSGFINPSR  2013
             K + P++ P+AI SA+ T+A ++DR G  ++AQ          +PATPFD GSGF+N + 
Sbjct  625   KQKFPHFTPAAIGSALSTTASLSDRKGEHIMAQHTVLNPDISQSPATPFDMGSGFVNATA  684

Query  2014  ALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPE-NKKFWCSDLNTPSVTISNL  2190
             AL+PGLVF+  + +Y++FLC + G     V    G  C   N     SDLN PSVTI+ L
Sbjct  685   ALDPGLVFDIGYNEYMKFLCRING-SSPVVFNYTGESCSAYNSSLAASDLNLPSVTIAKL  743

Query  2191  VGSRTVMRRVTNVGGA--DERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKA  2364
             VG+RTV+R VTN+  +  +E Y V    P  V V + P  F I    +R L +V  A K 
Sbjct  744   VGTRTVLRWVTNIAASVTNETYTVGWMAPDSVSVKVSPAKFTIGNGQTRVLSLVFQAMKN  803

Query  2365  TNSYSFGEMILLGDRNHIVRVPFAV  2439
               + SFG + L GDR H+V +P  V
Sbjct  804   VTTASFGRIGLFGDRGHVVNIPVTV  828



>ref|XP_009403397.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=842

 Score =   543 bits (1398),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 333/760 (44%), Positives = 465/760 (61%), Gaps = 15/760 (2%)
 Frame = +1

Query  181   TMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIY  360
             T Y   + +  ++ L   LR   Y KLYSY +L+NGFAV +   +A K+  + E V  + 
Sbjct  76    TSYSSYLIRLQNLLLKRTLRGEKYLKLYSYHYLINGFAVLITPQQADKLSRRHE-VANLM  134

Query  361   EDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNI  540
              D  +   TTHTP+FLG+P   W + GGP V+GEG+VIG IDTGI+P H SFS  +  +I
Sbjct  135   LDFSVRTATTHTPEFLGLPHGAWAQDGGPEVAGEGIVIGFIDTGIDPTHPSFS--DTLSI  192

Query  541   GRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHG  720
                 +   F+G C    +FP+ +CN K+VGA++FA +AI  G FN ++ YASPFD DGHG
Sbjct  193   NHYPVPAHFSGICEVTRDFPSGSCNRKLVGARHFAASAIIRGMFNATQDYASPFDGDGHG  252

Query  721   SHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqave  897
             +HT S AAGN+  PVI +  ++G ASGMAP A IAVYKALY SFGG+ +DVVAA+DQA +
Sbjct  253   THTTSIAAGNHGIPVIVSGHHFGNASGMAPHAHIAVYKALYKSFGGFAADVVAAIDQAAQ  312

Query  898   dgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPW  1077
             DGVDI+SLS+ P+  P G + F N +++ LL A ++G+ VVQAAGN+GPS +S+ SFSPW
Sbjct  313   DGVDIISLSITPNRRPWGLATFFNPIDMSLLSAVKSGIFVVQAAGNTGPSPKSVSSFSPW  372

Query  1078  VTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNST-AGLLT  1254
             + +V AS  DR Y N ++LGN  T SG GL+P T G + F L AA+   + N+T A  + 
Sbjct  373   IFTVGASAHDRVYNNWLLLGNNLTISGVGLAPGTDGDSMFPLIAAIHAMKNNTTVANDMY  432

Query  1255  VESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGS  1434
             +  CQD+      L+ GK++IC+Y+  F    +SI    +T     A G +  MDP +  
Sbjct  433   LGECQDSSYLDEDLIDGKILICSYSIRFVLGLSSIKQALETAKNVSAVGVIFYMDPFVTG  492

Query  1435  EQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAV-AFRATARILDGRRAIY  1611
               +    + + +PGLII + + S     YYNS+ +R    +++  +   A IL G +A Y
Sbjct  493   FHLN--PIPMDMPGLIIPSTDDSKVFFDYYNSSLVRDDMSKSIIKYCGVANILGGLKANY  550

Query  1612  SGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFAL  1791
             S   P V  YS+RGPD  +  L  AD++KPN++APG+ IW AWS         +G+ FA+
Sbjct  551   SNTAPKVMYYSARGPDPEDNSLADADIMKPNLIAPGNFIWGAWSSVGTDSAEFEGESFAM  610

Query  1792  VSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqq  1959
             +SGTSMA PHIAG+AALIK + P++ PSAI SA+ T+A + DR      +    +     
Sbjct  611   ISGTSMAAPHIAGLAALIKQKFPSFSPSAIASALSTTATLYDRQGGPIMAQRAYRNPDSN  670

Query  1960  lapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENK  2139
              +PATPFD GSGF+N + AL+PGL+F+T +  +I FLC + G     V    G  C E  
Sbjct  671   QSPATPFDMGSGFVNATAALDPGLIFDTGYDDFISFLCGING-SGPIVLNYTGHTC-EVS  728

Query  2140  KFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISA  2319
                 SDLN PS+TIS L   R ++R VTNV   DE Y V    P G  V++ P  FF+++
Sbjct  729   NMTGSDLNIPSITISLLNQLRVIVRTVTNVAN-DEYYHVSWSAPFGASVSVAPAQFFVAS  787

Query  2320  DGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
                ++L IVLNAT  ++  SFG + L G+  H   +P +V
Sbjct  788   GQQQNLTIVLNATMNSSFASFGSIGLYGNLGHKSIIPLSV  827



>ref|XP_010441875.1| PREDICTED: subtilisin-like protease [Camelina sativa]
 ref|XP_010441876.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=845

 Score =   542 bits (1397),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 334/755 (44%), Positives = 456/755 (60%), Gaps = 13/755 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD FL   L+   Y KLYSY +L+NGFA+ V S +A K+  + E V  I  D  + 
Sbjct  89    VAQSHDSFLRKTLKGETYIKLYSYHYLINGFALFVNSQQAEKLAMRRE-VANIVLDYSVR  147

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TT+TP F+G+P   W + GG  ++GEGVVIG IDTGI+P H SF   + Y+       
Sbjct  148   TATTYTPQFMGLPQGAWVKEGGFEIAGEGVVIGFIDTGIDPKHPSFDDKDSYSQRSYPTP  207

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
             + F+G C    +FP+ +CN K++GA++FA +A+  G FN S  YASPFD DGHG+HTAS 
Sbjct  208   KHFSGICEVTPDFPSGSCNRKLIGARHFAESAVTRGIFNSSEDYASPFDGDGHGTHTASI  267

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI +  ++G ASG+AP A I+VYKALY  FGG+ +DVVAA+DQA +DGVDIL
Sbjct  268   AAGNHGVPVIVSNHSFGNASGVAPRAFISVYKALYKGFGGFAADVVAAIDQAAQDGVDIL  327

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GP+ +SM SFSPW+ +V A
Sbjct  328   SLSITPNRKPPGVATFFNPIDMALLSAVKAGIFVVQAAGNTGPAPKSMSSFSPWIFTVGA  387

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPT-AGKAFFQLAAAVDVCRRNSTAGLLTVESCQD  1272
             S+ DR Y+NS++LGN  T  G G + PT  GK +  ++A   +    S    + V  CQD
Sbjct  388   SSHDRVYSNSLILGNNVTIPGIGFAIPTDDGKMYKMISAFHALNNITSVDKDMYVGECQD  447

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
                F   LV G L+IC+Y+  F    ++I    D      A G V  MDP +   QI   
Sbjct  448   YENFDQDLVSGNLLICSYSARFVIGLSTIKQALDVAKNLSAVGVVFYMDPYVFGFQIN--  505

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGR-AVAFRATARILDGRRAIYSGQGPV  1629
                + +PG+II + E S  L +YYN++  R  S +  V+F A A I  G  A +S + P 
Sbjct  506   PTPMDMPGIIIPSAEDSKTLLKYYNTSLQRDGSTKDIVSFGAVAAIEGGLNANFSDRAPK  565

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  + L + AD+LKPN++APG+SIW AWS  S       G+  A++SGTSM
Sbjct  566   VMYYSARGPDPEDNLFNDADILKPNLVAPGNSIWGAWSSASTDSTEFIGEKCAMMSGTSM  625

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTP  1977
             A PH+AG+AALIK  +P + PS I SA+ T+A + D       +        Q L  ATP
Sbjct  626   AAPHVAGVAALIKQTYPQFTPSQIASALSTTALLYDNKGSPIMAQRSFSNPDQSLYTATP  685

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKKFWCS  2154
             FD G+GF+N + ALNPGL+F+T F+ Y+ FLC + G D   V    G+ C   N      
Sbjct  686   FDMGNGFVNATAALNPGLIFDTSFEDYMSFLCGINGSD-PVVFNYTGLHCSATNTTISGF  744

Query  2155  DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRH  2334
             DLN PS+T+S L G++   R V N+ G +E Y V    P GV + I P  F I    ++ 
Sbjct  745   DLNMPSITVSTLNGTQIFQRSVRNIAG-NETYNVGWSPPYGVSMKISPGLFSIGLGETQV  803

Query  2335  LIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             L I LNATK ++S SFG + L G+  HIV +P  V
Sbjct  804   LSITLNATKNSSSSSFGRIGLFGNTGHIVNIPVTV  838



>emb|CDP12620.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   542 bits (1397),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 337/762 (44%), Positives = 468/762 (61%), Gaps = 15/762 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   +++ HD  L   LR   Y KLYSY +L+NGFAV V   +A K+  + E V  +  D
Sbjct  88    YGSYISRVHDTLLRKALRGEKYLKLYSYHYLINGFAVLVTPQQAGKLSGRQE-VSNVVLD  146

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP FLG+P   W + GG   +GEG+VIG IDTGI+P H SFS     N   
Sbjct  147   FSVRTATTHTPQFLGLPQGAWAKEGGSETAGEGIVIGFIDTGIDPTHPSFSDTTSEN-SY  205

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
             P + + FTG C    +FP+ +CN K+VGA++FA +AI  G FN S+ YASPFD DGHG+H
Sbjct  206   P-VPQHFTGICEVTPDFPSGSCNRKLVGARHFAASAITRGIFNASQDYASPFDGDGHGTH  264

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PV+    ++G ASGMAP A IAVYKALY SFGG+ +DVVAA+DQA +DG
Sbjct  265   TASVAAGNHGVPVVVAGHHFGNASGMAPRAHIAVYKALYKSFGGFAADVVAAIDQAAQDG  324

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A +AG+ V+QAAGN+GPS +S+ SFSPW+ 
Sbjct  325   VDIISLSITPNRRPPGIATFFNPIDMALLSAFKAGIFVIQAAGNTGPSPKSIFSFSPWIF  384

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVES  1263
             +V A+  DR Y+NSI+LGN  T SG GL+P T       L +A+D    +S    + V  
Sbjct  385   TVGAAAHDRIYSNSILLGNNVTISGVGLAPGT-NNTMCTLVSALDALSDSSAGNDMYVGE  443

Query  1264  CQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQI  1443
             CQD+  F   LV+G L+IC+Y+  F    ++I    +T     AAG V  MDP +   Q+
Sbjct  444   CQDSTNFNQDLVQGNLLICSYSIRFVLGLSTIKQAMETAKNLSAAGVVFYMDPFVIGFQL  503

Query  1444  KGATVTLQIPGLIINNMEASTALRQYYNSNTLRS-RSGRAVAFRATARILDGRRAIYSGQ  1620
                 + L +PG+II   E S  L +YYNS++ R   + + V F A A I  G +A +S  
Sbjct  504   N--PIPLSMPGIIIPTPEDSKVLLRYYNSSSERDGTTKKIVKFGAVACISGGIKANFSYL  561

Query  1621  GPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSG  1800
              P +  YS+RGPD  +  LD AD+LKPN++APG+ IWAAWS         +G++FA++SG
Sbjct  562   APKIMFYSARGPDPEDTFLDDADILKPNLVAPGNFIWAAWSSRGTDSIEFQGENFAMMSG  621

Query  1801  TSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqa----sqqlap  1968
             TSMA PHIAG+AALIK ++P + PSA+ SA+ T+A   D+  +P++AQ+A        +P
Sbjct  622   TSMAAPHIAGLAALIKQKYPTFSPSALGSALSTTASQLDKNQAPIMAQRAYANPELNQSP  681

Query  1969  aTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFW  2148
             ATPFD GSGF+N + AL+PGL+F+  + +Y  FLC + G          G  C       
Sbjct  682   ATPFDMGSGFVNATAALDPGLIFDISYDEYASFLCGING-SAPIFLNYTGQSC-SVCAIN  739

Query  2149  CSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGS  2328
              +DLN PS+T+S L  S+TV R  TN+ GA+E Y V    P GV + + P +F +++   
Sbjct  740   ATDLNLPSITMSKLNQSQTVQRLATNI-GANETYSVGWFAPYGVTLKVSPTHFSLASGER  798

Query  2329  RHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTAS  2454
             + L +   A   + + SFG + + G   H+V +P +V V  S
Sbjct  799   QVLNVSFTAQINSTAASFGRIGIFGHLGHVVNIPVSVIVKIS  840



>ref|XP_009133843.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
 ref|XP_009133851.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
Length=858

 Score =   543 bits (1398),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 333/761 (44%), Positives = 465/761 (61%), Gaps = 15/761 (2%)
 Frame = +1

Query  190   KQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDI  369
             +  + + HD  L   L+   Y KLYS+ +L+NGFAV V S +A K+  ++E V  I  D 
Sbjct  98    RSAIAQAHDSLLRDALKGEKYIKLYSFHYLINGFAVFVSSQQAEKLSRRSE-VANIVLDF  156

Query  370   KMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRP  549
              +   TT+TP F+G+P   W + GG   +GEG+VIG IDTGI+P H SF+  +      P
Sbjct  157   SVRTATTYTPQFMGLPKGAWVKEGGYETAGEGIVIGFIDTGIDPTHPSFNGTDASQRQYP  216

Query  550   RITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHT  729
              I   F+G C    +FP+ +CN K+VGA++FA++AI  G FN S  +ASPFD DGHG+HT
Sbjct  217   -IPNHFSGVCEVTPDFPSGSCNRKLVGARHFAQSAITRGIFNSSEDFASPFDGDGHGTHT  275

Query  730   ASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgv  906
             AS AAGN+    + +  N+G ASG+AP A I+VYKALY SFGG+ +DVVAA+DQA +DGV
Sbjct  276   ASIAAGNHGVSAVVSGHNFGSASGIAPRAHISVYKALYKSFGGFAADVVAAIDQAAQDGV  335

Query  907   dIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTS  1086
             DILSLS+ P+  P G + F N L++ +L A +AG+ VVQAAGN+GPS +SM SFSPW+ +
Sbjct  336   DILSLSITPNRRPPGVATFFNPLDMAMLSAVKAGIFVVQAAGNTGPSPKSMSSFSPWIFT  395

Query  1087  VAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA--GLLTVE  1260
             V A+T DR Y+NSI LGN  T  G GL+ PT     F +  AVD  +  S+A    +   
Sbjct  396   VGAATHDRVYSNSITLGNNVTIPGVGLAVPTDEGKMFTMIYAVDALKNKSSAVDKDMYAS  455

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD   F   L+ GKL+IC+Y+  F    ++I           A G V  MDP +   Q
Sbjct  456   ECQDYDSFDKDLICGKLLICSYSIRFVLGLSTIKQALAVSKNLSAKGVVFYMDPYVLGFQ  515

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVA-FRATARILDGRRAIYSG  1617
             I      + +PG+II + E S  L +YYNS   R R+ + +  F   A I  G++A +S 
Sbjct  516   IN--PTPMDMPGIIIPSPEDSKVLLKYYNSTLERDRTTKEIVRFGGVAAITGGQKANFSD  573

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
             + P +  YS+RGPD  ++ L+ AD+LKPN++APG SIW AWS  +      +G+ FA++S
Sbjct  574   RAPKIMYYSARGPDPQDSFLNDADILKPNLVAPGHSIWGAWSSAATDSTEFEGESFAMMS  633

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqa----sqqla  1965
             GTSMA PH+AG+AALIK +   + PSAI SA+ T+A   D  G  ++AQ+A     Q + 
Sbjct  634   GTSMAAPHVAGVAALIKQKFRKFSPSAIASALSTTAVTLDNKGEEIMAQRAYANPDQSMT  693

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKK  2142
             PATPFD G+GF+N + AL+PGL+F+T F+ Y+ FLC + G    +V    G  C   N  
Sbjct  694   PATPFDMGNGFVNATAALDPGLIFDTSFEDYMSFLCGING-SAPAVFNYTGKNCLLSNAT  752

Query  2143  FWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISAD  2322
                SDLN PS+T+S L  +RTV R + N+ G +E Y V +  P GV +   P  F I++ 
Sbjct  753   ISASDLNLPSITLSRLNNTRTVQRLMKNIAG-NETYSVGLVPPFGVLMKASPTQFSIASG  811

Query  2323  GSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
              ++ L +   A K ++  SFG + L GD  H+V +P +V V
Sbjct  812   ETKLLSVTFKAKKNSSIASFGIIKLFGDMGHVVHIPVSVIV  852



>gb|EMT07893.1| Subtilisin-like protease [Aegilops tauschii]
Length=830

 Score =   541 bits (1394),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 339/765 (44%), Positives = 453/765 (59%), Gaps = 41/765 (5%)
 Frame = +1

Query  166   TSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEG  345
             TS  VT Y   + + H+  L SL     Y KLYSY HL+NGFAVH+ S +A   L KA G
Sbjct  90    TSEAVTSYSLHLRRHHEKLLDSLFVAGTYEKLYSYHHLINGFAVHMSSLQA-DFLRKAPG  148

Query  346   VRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSP  525
             V+ +  D K++K+TTHTP FLG+   VWP  GG   +GE VVIG +D+GI P H SFS+ 
Sbjct  149   VKYVERDTKIQKLTTHTPQFLGLTTAVWPTGGGFDRAGEDVVIGFVDSGIYPEHPSFSTH  208

Query  526   EEYNIGR-PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPF  702
                  G  PR    + GKC        + CNGKIVGAQ+FA+AAIAAG FN    +ASP 
Sbjct  209   RTDPYGPVPR----YKGKCEIDPVTQRSFCNGKIVGAQHFAKAAIAAGAFNPDVEFASPL  264

Query  703   DADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaa  879
             D DGHGSH A+ AAGN   PV  + + +G ASGMAP A IAVYK LY  FGGY+SDVVAA
Sbjct  265   DGDGHGSHIAAIAAGNNGIPVRMHGYEFGKASGMAPRARIAVYKVLYRLFGGYVSDVVAA  324

Query  880   vdqavedgvdIlslsv-gpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRS  1056
             +DQAV+DGVDIL+LSV   S   +  + FLN  +  LL A +AGV V QAAGN GP  ++
Sbjct  325   IDQAVQDGVDILNLSVGPNSPPTATRTTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKT  384

Query  1057  MLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNS  1236
             ++SFSPW+T+VAA   DRRY N ++LGNG+  +G G+SP T G   F L +A D    +S
Sbjct  385   LVSFSPWITTVAAGVDDRRYKNHLILGNGKRIAGLGVSPATHGNKSFGLISATDALLGSS  444

Query  1237  TAGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTM  1416
             +     ++ CQ         V+GK+++C Y++++ S  ASI  V+ T    GAAGFV+ +
Sbjct  445   STKYSALD-CQRPELLNKRKVQGKILLCGYSFNYISGTASIKKVSQTAKSLGAAGFVVAV  503

Query  1417  DPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDG  1596
             +      +     V + IPG++I ++  +  L  YYNS+T R  +GRA AF+AT  I DG
Sbjct  504   EDSYPGTKFD--PVPVNIPGILITDVSKTKDLIDYYNSSTTRDWAGRATAFQATVGIADG  561

Query  1597  RRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKG  1776
                      P VA +SSRGPDV +     ADVLKP+I+APG+ IW+AW+PN   +     
Sbjct  562   LAPTLFNSAPQVALFSSRGPDVKDFSFQDADVLKPDILAPGNLIWSAWAPNGTDE-----  616

Query  1777  QHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlg----spllaq  1944
                             A  AALIK ++P W PSAI SA+MT+A+  D+      +   + 
Sbjct  617   ----------------ANYAALIKQKYPKWSPSAIKSALMTTANTIDKGSHPLRAQQYST  660

Query  1945  qasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVE  2124
                  LA ATPFD+GSG +NP  AL+PGLV +   Q YI FLC++P VD   V  + G  
Sbjct  661   SEMMTLARATPFDYGSGAVNPKAALDPGLVLDATHQDYITFLCSIPDVDPSEVSNITGSR  720

Query  2125  C---PENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTII  2295
             C   P+ ++ +  DLN PS+T+S L G +TV R VTNV    E Y ++ R    + + + 
Sbjct  721   CGSGPKGQRPY--DLNIPSITVSQLKGIQTVKRTVTNVADEAETYTIMTRMSPEIALDVS  778

Query  2296  PQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVP  2430
             P    +    SR + + L     T +YSFGE+ + GDR H+VR+P
Sbjct  779   PPALTVLPGSSREITVTLTTRSVTGTYSFGEITMKGDRRHLVRIP  823



>ref|XP_010054605.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=832

 Score =   541 bits (1394),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 347/811 (43%), Positives = 470/811 (58%), Gaps = 41/811 (5%)
 Frame = +1

Query  109   KIYMVLMEDHPFVSTRIKGTSGN-----------VTMYKQRMTKQHDVFLGSLLRRSAYT  255
             +IY+ LME  P     +  +  +              + +R+   HD  L S+L   +Y 
Sbjct  31    EIYLALMEGDPVAFAGVSSSPEHGLSRHNLNRKVSRAHAKRLVNSHDQLLQSVLETGSYK  90

Query  256   KLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPR  435
             KLYS+ H++NGF+VH+   +A K L +  GVR +  D   + MTT+TP FLG+    W +
Sbjct  91    KLYSFNHVINGFSVHITESQA-KRLKETPGVRLVERDRGAKLMTTYTPQFLGLRQGAWSQ  149

Query  436   LGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRP---RITRKFTGK-CITGDNFPA  603
             LGGP  +GEG+V+G +DTGINP H SF+     N+G P   R T +F+G  C  G  FP 
Sbjct  150   LGGPRNAGEGIVLGFVDTGINPAHPSFA-----NLGLPPLNRSTSRFSGAACEAGPLFPV  204

Query  604   TACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFN  783
              +CNGKIV A++F+  A AAG  N +    SPFDA GHGSH A+ AAGN    V+ N   
Sbjct  205   FSCNGKIVSARFFSAGARAAGPLNPAVDILSPFDAVGHGSHVAAIAAGNPDVAVVANGL-  263

Query  784   YGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAF  963
             YG+ASG+APGA IAVYKA+Y   G M+DVVAA+DQAV DGVD LSLSVGP   P      
Sbjct  264   YGWASGVAPGARIAVYKAVYPTLGTMTDVVAAIDQAVRDGVDALSLSVGPDEAPEDTPTL  323

Query  964   LNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNG  1143
             L+V ++ +L A RAGV V QA GN GPS  ++L++ PW   VAA++TDR Y  S++LG+G
Sbjct  324   LSVFDMAMLSARRAGVFVAQAVGNKGPSPSTVLAYGPWTVGVAAASTDRTYPVSLLLGSG  383

Query  1144  QTFSGSGLSPPTAGKAFFQ--LAAAVD------VCRRNSTAGLLTVESCQDAMQFVPSLV  1299
             Q  SG GL+ PT G    Q  L  A D      V  R         E CQ      P++V
Sbjct  384   QRISGVGLTGPTLGNGMIQYKLVLAKDAILPYGVFPRTPP----YTEECQSPRALDPTVV  439

Query  1300  RGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGL  1479
              G +VICT++  F +  +S+  + +T      AGFVL  +P  G        +   +PG+
Sbjct  440   LGSVVICTFSAGFFNRTSSLTAILNTAISLRFAGFVLVANPAYG--DFISEPIPFPVPGM  497

Query  1480  IINNMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPD  1659
             +I  +  +  L +YY   T+R R G A  F ATA I +GR A + G+ P V+ +SSRGPD
Sbjct  498   MIPRVADAQILSRYYEQETVRGRGGAATRFGATAAIREGRVASFGGRAPTVSRFSSRGPD  557

Query  1660  VNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAA  1839
               +      DVLKP+I+APG  +WAAWSP S  +  + GQ FAL+SGTSMATPH+ G AA
Sbjct  558   YIDVKKTPMDVLKPDILAPGHQVWAAWSPMSASEPILVGQSFALLSGTSMATPHVVGAAA  617

Query  1840  LIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqas-qqlapaTPFDFGSGFINPSRA  2016
             LIK  +P+W PS I SAM+T+A   D  G  ++A+ +    L+ ATPFD GSG +NP+ A
Sbjct  618   LIKQVNPSWTPSMIASAMLTTATKRDSYGDLIMAEGSDFSSLSRATPFDVGSGLLNPTSA  677

Query  2017  LNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVG  2196
             LNPGLVF + ++ YI FLC++P +D   VR   G  C      + SDLN PSVTIS L G
Sbjct  678   LNPGLVFPSDYEDYISFLCSLPKIDPSMVRAATGESC-ARPLTYPSDLNLPSVTISALAG  736

Query  2197  SRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNS-  2373
              RTV RRV NV      + V +R P G  +++ P  F I   G + L + +  TKA+   
Sbjct  737   VRTVRRRVKNVSARQLTFVVSMRPPNGTVISVNPPWFTIDPQGVQDLDMEIRVTKASTEL  796

Query  2374  --YSFGEMILLGDRNHIVRVPFAVYVTASLQ  2460
               +  GE++L G  +   +    V +T S++
Sbjct  797   GQFHHGEVVLTGPADPSSQSLLEVPITLSIR  827



>ref|XP_009353895.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=846

 Score =   541 bits (1395),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 334/773 (43%), Positives = 468/773 (61%), Gaps = 19/773 (2%)
 Frame = +1

Query  154   RIKGTSGNVTMYKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILH  333
             R +  S     Y   + + HD  L  + R   Y KLYSY +L+NGFAV V  D+  K+  
Sbjct  74    RFRNISRTDRRYSSYIARVHDSLLRRVFRGEKYLKLYSYHYLINGFAVFVTQDQVDKLSR  133

Query  334   KAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHAS  513
             + E V  +  D  +   TTHTP FLG+P   W + GG   +GEGVVIG IDTGI+P H+S
Sbjct  134   RRE-VANVVLDFSVRTATTHTPRFLGLPQGAWVQGGGYESAGEGVVIGFIDTGIDPTHSS  192

Query  514   FSSPEEYNIGRPR-ITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHY  690
             F   +++   RP  +   F+G C    +FP+ +CN K++ A++FA +AI  G FN S+ Y
Sbjct  193   F---DDHTSERPYPVPAHFSGICEVTPDFPSGSCNRKLIAARHFASSAITRGVFNSSQDY  249

Query  691   ASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSd  867
             ASPFD +GHG+HTAS AAGN+   V+    ++G ASGMAP + IAVYKALY SFGG+ +D
Sbjct  250   ASPFDGEGHGTHTASIAAGNHGIRVVVAGHHFGNASGMAPRSHIAVYKALYKSFGGFAAD  309

Query  868   vvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPS  1047
             VVAA+DQA +DGVDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS
Sbjct  310   VVAAIDQAAQDGVDIISLSITPNRRPPGIATFFNPIDMALLSAVKAGIFVVQAAGNTGPS  369

Query  1048  SRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCR  1227
              +SM SFSPW+ +V +++ DR Y+NSI+LGN  T +G GL+P T     + L +A     
Sbjct  370   PKSMSSFSPWIFTVGSASHDRNYSNSIMLGNNVTITGVGLAPGT--DTMYTLISATHALN  427

Query  1228  RNST-AGLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGF  1404
               +T +  + V  CQD+  F   LVRG L+IC+Y+  F    ++I    +T     A G 
Sbjct  428   NGTTVSDDMYVGECQDSSNFNQDLVRGNLLICSYSIRFVLGISTIHKSLETAKNLSAIGV  487

Query  1405  VLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRS-RSGRAVAFRATA  1581
             V TMD  +   Q+      ++IPG+II + E S  L +YYN +  R   + R   F A A
Sbjct  488   VFTMDAFVIGFQLN--PTPMKIPGIIIPSPEDSKVLLKYYNLSLERDIMTKRITKFGALA  545

Query  1582  RILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGD  1761
              I  G +A Y    P +  YS+RGPD  +  LD AD++KPN++APG+SIWAAWS   +  
Sbjct  546   TICGGLKAKYGTSAPKIMYYSARGPDPEDNFLDDADIMKPNLVAPGNSIWAAWSSVGQDS  605

Query  1762  KYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gs  1929
                +G+HFA++SGTSMA PH+AG+AAL++ + PN+ PSAI SA+ T+A + DR      +
Sbjct  606   IEFQGEHFAMMSGTSMAAPHVAGLAALVRQKFPNFSPSAIASALSTTASLYDRNGGPIMA  665

Query  1930  pllaqqasqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRR  2109
                     Q  +PATPFD GSGF+N + ALNPGL+F+T +  Y+ FLC + G     V  
Sbjct  666   QRAYSFPDQNQSPATPFDMGSGFVNATAALNPGLIFDTSYDNYMSFLCGING-SAPVVLN  724

Query  2110  VVGVEC-PENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRV  2286
               G  C   N      DLN PS+TI+ L  SRTV+R V NV  A+E Y V    P GV +
Sbjct  725   YTGESCWTYNSTINGGDLNLPSITIAKLNQSRTVLRTVRNV-AANETYSVGWSAPFGVSL  783

Query  2287  TIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
              + P +F I++  ++ L + +NAT  + + S+G + L G   H+  +P +V V
Sbjct  784   KVSPLHFSIASGETQVLSVFVNATSNSTTASYGRIGLFGHLGHVANIPLSVIV  836



>gb|KFK31649.1| hypothetical protein AALP_AA6G140700 [Arabis alpina]
Length=855

 Score =   542 bits (1396),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 334/753 (44%), Positives = 458/753 (61%), Gaps = 14/753 (2%)
 Frame = +1

Query  205   KQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKM  384
             + HD FL   L+   Y KLYSY +L+NGFAV + S +A K+  + E V  I  D  +   
Sbjct  102   QNHDSFLRKTLKGEKYIKLYSYHYLINGFAVFLTSQQAEKLSMRRE-VANIVLDYSVRTA  160

Query  385   TTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRK  564
             TT+TP F+G+P+  W + GG  V+GEG+VIG+IDTGI+P H SFS         P I + 
Sbjct  161   TTYTPQFMGLPEGAWLKEGGFEVAGEGIVIGIIDTGIDPNHPSFSDNINSQHSYP-IPKH  219

Query  565   FTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAA  744
             F+G C    +FP+ +CN K++GA++FA++AI    FN S  YASPFDADGHG+ TAS AA
Sbjct  220   FSGLCEVTPDFPSGSCNKKLIGARHFAQSAITRAIFNSSEEYASPFDADGHGTLTASIAA  279

Query  745   GNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlsl  921
             GN+  PVI +  N G ASG+AP A I+VYKALY  FGG+ +DVVAA+DQA +DGVDILSL
Sbjct  280   GNHGVPVILSNHNLGNASGIAPRAHISVYKALYKGFGGFAADVVAAIDQAAQDGVDILSL  339

Query  922   svgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAAST  1101
             S  P+  P G + F N L++ +L A ++G+ VVQAAGN+GPS +SM SFSPW+ +V AS+
Sbjct  340   SFIPNQKPPGVAIFFNPLDMAILSAVKSGIFVVQAAGNTGPSPQSMSSFSPWIFTVGASS  399

Query  1102  TDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRR-NSTAGLLTVESCQDAM  1278
              DR Y+NS+ LGN  T  G G S PT     +++ +A+       S    + V  CQD  
Sbjct  400   HDRVYSNSLTLGNNVTIPGVGFSSPTDDGEMYKIVSAIHALNNITSVDNDMYVGECQDYK  459

Query  1279  QFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATV  1458
              F   LV G L++C+YT  F    ++I    D      A G V   DP +   QI     
Sbjct  460   NFDQDLVSGNLLLCSYTVRFVLGLSTIKQALDVAKNLSAIGVVFYKDPYVLGFQIN--PT  517

Query  1459  TLQIPGLIINNMEASTALRQYYNSNTLRSRSGRA-VAFRATARILDGRRAIYSGQGPVVA  1635
              + +PG+I+ + E S  L +YYNS   R  + +  V F A A I  G  A +S + P V 
Sbjct  518   PMDMPGIIVPSAEDSKILLKYYNSFLQRDVTTKQIVGFGAVAAIEGGLNANFSNRAPQVM  577

Query  1636  SYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMAT  1815
              YS+RGPD  +   + AD+LKPN++APG+SIWAAWS  S      +G+ FAL+SGTSMA 
Sbjct  578   YYSARGPDPEDNSTNNADILKPNLVAPGNSIWAAWSSASTDSTEFQGEKFALMSGTSMAA  637

Query  1816  PHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFD  1983
             PH+AG+AALIK  +P + PS I SA+ T+A + D       S        Q L+PATPFD
Sbjct  638   PHVAGVAALIKQTYPQFSPSEIASALSTTALLYDNKGGPIMSQRSYTNPDQSLSPATPFD  697

Query  1984  FGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKKFWCSDL  2160
              GSGF+N + A+NPGL+F+T F+ Y+ FLC + G D   V    G+ C  +N +    DL
Sbjct  698   MGSGFVNATAAVNPGLIFDTSFEDYMSFLCGINGSD-PVVFNYTGLSCSAKNARISGFDL  756

Query  2161  NTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLI  2340
             N PS+T+S L G++   R + N+ G +E Y V    P GV + + P  F I+   ++ L 
Sbjct  757   NFPSITVSMLKGTQIFRRSMKNIAG-NETYNVGWSPPYGVSMKVSPTQFSIAMGETQTLS  815

Query  2341  IVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             + LNATK ++S SFG + L G+  H+V +P +V
Sbjct  816   VTLNATKNSSSSSFGRIGLFGNTGHVVNIPVSV  848



>ref|XP_006413867.1| hypothetical protein EUTSA_v10024389mg [Eutrema salsugineum]
 gb|ESQ55320.1| hypothetical protein EUTSA_v10024389mg [Eutrema salsugineum]
Length=855

 Score =   541 bits (1395),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 336/777 (43%), Positives = 481/777 (62%), Gaps = 18/777 (2%)
 Frame = +1

Query  151   TRIKGTSGNVTMYKQR---MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKAL  321
             TR K    N++ ++ R   + + HD  L ++L+   Y KLYS+ +L+NGFAV V S +A 
Sbjct  79    TRPKLQPRNISNWRSRGSSIAQAHDSLLRNVLKGEKYIKLYSFHYLINGFAVFVSSQQAE  138

Query  322   KILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINP  501
             K+  + E V  I  D  +   TT+TP F+G+P+  W + GG   +GEG+VIG IDTGI+P
Sbjct  139   KLSRRRE-VANIVLDFSVRTATTYTPQFMGLPNGAWVKEGGYESAGEGIVIGFIDTGIDP  197

Query  502   FHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVS  681
              H SF+  +      P I   F+G C    +FP+ +CN K+VGA++FA++AI  G FN S
Sbjct  198   THPSFNGTDTSQRQYP-IPNHFSGVCEVTPDFPSGSCNRKLVGARHFAQSAITRGIFNSS  256

Query  682   RHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGY  858
               YASPFD DGHG+HTAS AAGN+    + +  N+G ASG+AP A I+VYKALY SFGG+
Sbjct  257   EDYASPFDGDGHGTHTASIAAGNHGVSAVVSGHNFGNASGIAPRAHISVYKALYKSFGGF  316

Query  859   MSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNS  1038
              +DVVAA+DQA +DGVDILSLS+ P+  P G + F N L++ +L A +AG+ VVQAAGN+
Sbjct  317   AADVVAAIDQAAQDGVDILSLSITPNRRPPGVATFFNPLDMAMLSAVKAGIFVVQAAGNT  376

Query  1039  GPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVD  1218
             GPS +SM SFSPW+ +V A+T DR Y+NSI+LGN  +  G GL+ PT     + + +AVD
Sbjct  377   GPSPKSMSSFSPWIFTVGAATHDRVYSNSIILGNNASIPGVGLALPTDESKMYTMISAVD  436

Query  1219  VCRRNSTAGL--LTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAG  1392
               +  S+     + V  CQ++     +LV G L+IC+Y+  F    +SI           
Sbjct  437   ALKNKSSVADKDMYVGECQESDSLDKNLVFGNLLICSYSIRFVLGLSSIKQALAVAKNLS  496

Query  1393  AAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVA-F  1569
             A G V  +DP +   QI      + +PG+II + E S  L +YYNS+  R  + + +  F
Sbjct  497   AKGAVFYLDPYVLGFQIN--PTPMDMPGIIIPSSEDSKVLLKYYNSSLERDGTTKEIVRF  554

Query  1570  RATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPN  1749
              A A I  G+ A +S + P +  YS+RGPD  + L + AD+LKPN++APG+SIW AWS  
Sbjct  555   GAVAAIAGGQNANFSNRAPKIMYYSARGPDPEDNLFNDADILKPNLVAPGNSIWGAWSSA  614

Query  1750  SEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgs  1929
             +      +G+ FA++SGTSMA PH+AG+AALIK +  N+ PSAI SA+ T++ + D  G 
Sbjct  615   ATDSAEFEGESFAMMSGTSMAAPHVAGVAALIKHKFRNFSPSAIASALSTTSVLFDNKGE  674

Query  1930  pllaqqa----sqqlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEK  2097
              ++AQ+A     Q L+PA PFD G+GF+N + AL+PGL+F+T F+ Y+ FLC + G    
Sbjct  675   AIMAQRAYANPDQTLSPAIPFDMGNGFVNATAALDPGLIFDTGFEDYMSFLCGING-SAP  733

Query  2098  SVRRVVGVECP-ENKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPL  2274
              V    G  C   N     SDLN PS+T+S L  +RTV R +TN+ G +E Y V +  P 
Sbjct  734   VVFNYTGKNCMLRNATISGSDLNLPSITVSRLNNTRTVQRLMTNIAG-NETYSVGLTPPF  792

Query  2275  GVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
              V + + P  F I++  ++ L +VL A K ++  SFG ++L G+  H V +P +V V
Sbjct  793   DVLMKVTPNQFSIASGETKLLSVVLKAKKNSSIASFGRIMLFGNTGHTVHIPVSVIV  849



>ref|XP_010478484.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=834

 Score =   541 bits (1393),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 341/808 (42%), Positives = 481/808 (60%), Gaps = 39/808 (5%)
 Frame = +1

Query  100   AEAKIYMVLMEDHPFV------STRIKGTSGNVTMYKQR---------MTKQHDVFLGSL  234
             A + +Y+V ++D P V      ST     S       Q          + + HD  L  +
Sbjct  32    ASSAVYIVTLKDRPSVHFPGRESTSSSKQSLTACSSSQNYRTLNRSASIIRVHDSLLRKV  91

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGI  414
             LR   Y KLYSY +L+NGF+  +   +A ++  + E V  +  D  +EK TTHTP FLG+
Sbjct  92    LRNENYLKLYSYHYLINGFSAVLTQKQADRLAAREE-VDNVVLDFSVEKATTHTPQFLGL  150

Query  415   PDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSP---EEYNIGRPRITRKFTGKCIT  585
             P   W R GG   +GEGVVIG IDTGI+P H SFS       Y +  PR    FTG C  
Sbjct  151   PRGAWLRDGGYEYAGEGVVIGFIDTGIDPTHPSFSDKILGHTYTV-PPR----FTGVCEV  205

Query  586   GDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPV  765
                FP  +CN K++GA++FA +A++ G  N ++  ASPFD +GHG+HTAS AAGN+  PV
Sbjct  206   TSGFPPGSCNRKLIGARHFAESALSRGVLNSTQDDASPFDGEGHGTHTASVAAGNHGIPV  265

Query  766   ITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssv  942
             +    + G ASGMAP A IAVYKALY  FGG+ +D++AA+DQA +DGVDI++LS+ P+  
Sbjct  266   VVAGHHLGNASGMAPRAHIAVYKALYKRFGGFAADIIAAIDQAAQDGVDIINLSITPNRR  325

Query  943   psgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTN  1122
             P G + F N +++ L  A +AG+ VVQAAGN+GP+ ++M SFSPW+ +V A++ DR YTN
Sbjct  326   PPGIATFFNPIDMALFSAVKAGIFVVQAAGNTGPAPKTMSSFSPWIFTVGATSHDRVYTN  385

Query  1123  SIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA-GLLTVESCQDAMQFVPSLV  1299
             SI+LGN  T  G GL+  T  +   +L  A       +T    + V  CQD+  F   LV
Sbjct  386   SIILGNNVTVPGVGLASGT--RTMHKLILATHALSNGTTVMDAIYVGECQDSSSFDQKLV  443

Query  1300  RGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGL  1479
             +GK+++C+YT  F    ++I     T     AAG V  +DP     Q+   +  + IPG+
Sbjct  444   QGKILVCSYTVRFILGVSTIKQALITAKNLTAAGLVFYIDPSAAGFQM--TSTPMDIPGI  501

Query  1480  IINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGP  1656
             +I++ + S AL +YYNS+ +R   SG+ V   + ARI+ G +  Y    P V  +S+RGP
Sbjct  502   LISSPQDSQALLRYYNSSLVRENGSGKIVGSASAARIVGGMKPTYGITAPKVMYFSARGP  561

Query  1657  DVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIA  1836
             D  +     AD++KPNI+APG++IW AWSP   G    +G+ FA+ SGTSM+ PH+ GIA
Sbjct  562   DPEDDSFVDADIMKPNIVAPGNAIWGAWSPLGIGTTDFQGERFAMESGTSMSAPHVTGIA  621

Query  1837  ALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqasq----qlapaTPFDFGSGFIN  2004
             ALIK + P++ P+AI SA+ T+A ++DR G  ++AQ+         +PATPFD GSGF+N
Sbjct  622   ALIKQKFPHFTPAAIASALSTTASLSDRKGQHIMAQRIVLNPDISQSPATPFDMGSGFVN  681

Query  2005  PSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPE-NKKFWCSDLNTPSVTI  2181
              + AL+PGL+F+  + +Y++FLC + G     V    G  C   N     SDLN PSVTI
Sbjct  682   ATAALDPGLIFDIGYNEYMKFLCGING-SSPVVLNYTGESCSAYNSSLAASDLNLPSVTI  740

Query  2182  SNLVGSRTVMRRVTNVG--GADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNA  2355
             + LVG+RTV+R VTN+     +E Y+V  + P  V V + P  F I    +R L +VL A
Sbjct  741   AKLVGTRTVLRWVTNIATTATNETYKVGWKAPDSVSVKVSPAKFTIGNGQTRVLTVVLGA  800

Query  2356  TKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              K  +  SFG + L GDR H+V +P AV
Sbjct  801   MKNVSMASFGRIGLFGDRGHVVNIPVAV  828



>ref|XP_010439575.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=856

 Score =   541 bits (1394),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 334/766 (44%), Positives = 474/766 (62%), Gaps = 15/766 (2%)
 Frame = +1

Query  190   KQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDI  369
             +  + + HD  L + L+   Y KLYS+ +L+NGFAV V S +A K+  + E V  +  D 
Sbjct  94    RSAIAQAHDSLLRNALKGEKYIKLYSFHYLINGFAVFVSSQQADKLSKRKE-VANVVLDF  152

Query  370   KMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRP  549
              +   TT+TP F+G+P   W + GG   +GEG+VIG IDTGI+P H SF+  +      P
Sbjct  153   SVRTATTYTPQFMGLPKGAWVKEGGYETAGEGIVIGFIDTGIDPTHPSFNGTDTSQRQYP  212

Query  550   RITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHT  729
              I   F+G C    +FP+ +CN K+VGA++FA++AI  G FN S  YASPFD DGHG+HT
Sbjct  213   -IPNHFSGVCEVTPDFPSGSCNRKLVGARHFAQSAITRGIFNSSEDYASPFDGDGHGTHT  271

Query  730   ASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgv  906
             AS AAGN+    + +  N+G ASG+AP A I+VYKALY SFGG+ +DVVAA+DQA +DGV
Sbjct  272   ASIAAGNHGVSAVVSGHNFGSASGIAPRAHISVYKALYKSFGGFAADVVAAIDQAAQDGV  331

Query  907   dIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTS  1086
             DILSLS+ P+  P G + F N L++ +L A +AG+ VVQAAGN+GPS +SM SFSPW+ +
Sbjct  332   DILSLSITPNRRPPGVATFFNPLDMAMLSAVKAGIFVVQAAGNTGPSPKSMSSFSPWIFT  391

Query  1087  VAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA--GLLTVE  1260
             V A+T DR Y+NSI LGN  +  G GL+ PT     + L +A+D  +  S+     + V 
Sbjct  392   VGAATHDRVYSNSITLGNNVSIPGIGLALPTDEGKKYTLISALDALKNKSSVVDKDMYVG  451

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD   F   LV G L+IC+Y+  F    ++I           A G V  MDP +   Q
Sbjct  452   ECQDYDNFDKDLVHGNLLICSYSIRFVLGLSTIKQALAVAKNLTAKGVVFYMDPYVLGFQ  511

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVA-FRATARILDGRRAIYSG  1617
             I      + +PG+II + E S  L +YYNS+  RS + + +  F A A I  GR   +S 
Sbjct  512   IN--PTPMDMPGIIIPSSEDSKVLLKYYNSSLERSGTTKEIVRFGAVAAISGGRNPNFSD  569

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
             + P +  YS+RGPD  ++L + AD+LKPN++APG+SIW AWS  +      +G++FA++S
Sbjct  570   RAPKIMYYSARGPDPEDSLFNDADILKPNLVAPGNSIWGAWSSAATESTEFEGENFAMMS  629

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqa----sqqla  1965
             GTSMA PHIAG+AALIK +   + PSAI SA+ T++ + D  G  ++AQ+A     Q + 
Sbjct  630   GTSMAAPHIAGVAALIKQKFRKFSPSAIASALSTTSVLFDNKGEAIMAQRAYANPDQTMT  689

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECP-ENKK  2142
             PATPFD G+GF+N + ALNPGL+F+T ++ Y+ FLC + G    +V    G  C   N  
Sbjct  690   PATPFDMGNGFVNATAALNPGLIFDTSYEDYMSFLCGING-SAPAVFNYTGKNCMLRNAT  748

Query  2143  FWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISAD  2322
                SDLN PS+T+S L  +RTV R VTN+ G +E Y V +  P  V + + P  F I++ 
Sbjct  749   ISGSDLNLPSITVSRLNNTRTVQRLVTNIAG-NETYNVGLVPPFDVLMKVSPTQFSIASG  807

Query  2323  GSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYVTASLQ  2460
              ++ L ++L A K ++  SFG + L G+  H+V +P +V V  +L+
Sbjct  808   ETKLLSVILTAKKNSSIASFGGIKLFGNAGHVVHIPVSVTVKIALK  853



>gb|EYU27728.1| hypothetical protein MIMGU_mgv1a001453mg [Erythranthe guttata]
Length=816

 Score =   540 bits (1390),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 348/805 (43%), Positives = 470/805 (58%), Gaps = 24/805 (3%)
 Frame = +1

Query  97    MAEAK-IYMVLMEDHP--FVSTRIKGTSGNVTM--------YKQRMTKQHDVFLGSLLRR  243
             +AE + IY+VL+E  P  F      G  G            + + +   HD FL S L  
Sbjct  18    VAEKRDIYLVLLEGEPVAFHHGAAPGKDGKKPFLHSEASVAHAKHLVDSHDRFLQSKLDA  77

Query  244   SAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDT  423
              +Y KLYS+ +++NGFAVH    +  K L    GV+ + +D   + MTTH+P+FLG+P  
Sbjct  78    GSYNKLYSFKNIVNGFAVHTTRSQVEK-LKGGHGVKLVEKDTGAKLMTTHSPEFLGMP-A  135

Query  424   VWPRLGGPSVSGEGVVIGMIDTGINPFHASFS-SPEEYNIGRPRITRKFTGKCITGDNFP  600
             VW + GG   +GEG+VIG +D+GINP H SF+  P    +     T  F+G C  G  FP
Sbjct  136   VWTQQGGDRNAGEGIVIGFVDSGINPVHPSFAYDPMHPPLISNYTTSHFSGSCEVGPLFP  195

Query  601   ATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRF  780
              T+CNGKI+ A++FA  A AA   + S    SP+D  GHGSH ASTAAGN+  PV+ + F
Sbjct  196   QTSCNGKIISARFFAAGARAAATLDPSVDIMSPYDVVGHGSHVASTAAGNFGVPVVVDGF  255

Query  781   NYGYASGMAPGAGIAVYKALYSFGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSA  960
              YG ASGMAP A IAVYKA+Y   G ++DV+AA+DQAV DGVDIL+LS+GP S P     
Sbjct  256   FYGRASGMAPRARIAVYKAIYPTVGTLTDVLAAIDQAVLDGVDILTLSIGPDSPPQDTVT  315

Query  961   FLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGN  1140
             FL   E+ +L A +AG+ V QAAGN GP   +++S+SPW   VAAS TDR Y  S++LG+
Sbjct  316   FLGAFEIFMLSAHKAGIFVAQAAGNQGPGPYTVVSYSPWSVGVAASGTDRTYPGSLLLGD  375

Query  1141  GQTFSGSGLSPPTAGKAFFQ--LAAAVDVCRRNSTAGLLT--VESCQDAMQFVPSLVRGK  1308
             GQ   G GLS P+ G    Q  L +A D  + N         VE CQ      P++V+G 
Sbjct  376   GQKIGGVGLSGPSFGNGLLQYKLVSARDAVKVNGAFPRTPPYVEECQYPEALDPTVVQGS  435

Query  1309  LVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIIN  1488
             +VICT++  F +  +++  V  T    G  GFVL  +PD G        +   IPG++I 
Sbjct  436   VVICTFSSGFYNGTSNLTAVIQTARVLGFTGFVLAANPDYG--DFIAEPIPFSIPGIMIP  493

Query  1489  NMEASTALRQYYNSNTLRSRSGRAVAFRATARILDGRRAIYSGQ-GPVVASYSSRGPDVN  1665
                 +  + +YY   T R+  G  + +   A I +GR A Y  +  PVV+ +SSRGPD  
Sbjct  494   RTTDAQIISRYYEQQTYRNDKGLVIRYSGRAAIGEGRVASYMDERAPVVSRFSSRGPDYI  553

Query  1666  NALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALI  1845
             +   + AD+LKP+I+APG  IWAAWSP S  +  + G +FAL+SGTSMATPHIAGIAALI
Sbjct  554   DERRNPADLLKPDILAPGHQIWAAWSPMSVQNPILCGYNFALISGTSMATPHIAGIAALI  613

Query  1846  KDRHPNWKPSAITSAMMTSADVTD-RlgspllaqqasqqlapaTPFDFGSGFINPSRALN  2022
             K  +P W PS I SAM T+A   D R    +    A+  L  A PF +G+GF++P RAL+
Sbjct  614   KQNNPTWTPSMIASAMSTTATKHDNRGEPIMAEGYAAYTLHTAAPFGYGAGFVDPVRALD  673

Query  2023  PGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSVTISNLVGSR  2202
             PGLVF+T ++ Y+ FLC++P  D + +R   G  C        SDLN PSVTI+ L G R
Sbjct  674   PGLVFSTGYEDYLSFLCSLPNTDPEKIRVATGGTCAATFSN-PSDLNQPSVTITALSGMR  732

Query  2203  TVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSF  2382
                R V NV    E Y   V  P GV V++ P  F ++    + L+I L  T+    +SF
Sbjct  733   VTQRVVENVANKPETYLCAVLPPNGVTVSVDPPWFTLAPQEKQTLVIRLVVTQVLEDFSF  792

Query  2383  GEMILLGDRNHIVRVPFAVYVTASL  2457
             GE++L G  NHIVR+P +V +T SL
Sbjct  793   GEIVLTGSLNHIVRIPLSV-LTISL  816



>ref|XP_010501666.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=861

 Score =   541 bits (1394),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 348/834 (42%), Positives = 487/834 (58%), Gaps = 64/834 (8%)
 Frame = +1

Query  100   AEAKIYMVLMEDHPFVSTRIKGT----------SGNVTMYKQ-----RMTKQHDVFLGSL  234
             A + +Y+V ++D P V    + T          S +  +Y+       + + HD  L  +
Sbjct  32    ASSAVYIVTLKDRPSVHLSGRETTSSSKHSLTASSSSQVYRTLNRSASIIRVHDSLLRKV  91

Query  235   LRRSAYTKLYSYTHLLNGFAVHVKSDKALKI--------------------------LHK  336
             LR+  Y KLYSY +L+NGF+  +   +A ++                          L  
Sbjct  92    LRKENYLKLYSYHYLINGFSAVLTQKQADRLAAREEVDNLVLDFSVEKAEQYINADRLAA  151

Query  337   AEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASF  516
              E V  +  D  +EK TTHTP FLG+P   W R GG   +GEGVVIG IDTGI+P H SF
Sbjct  152   REEVDNLVLDFSVEKATTHTPQFLGLPRGAWLRDGGYEYAGEGVVIGFIDTGIDPTHPSF  211

Query  517   SSP---EEYNIGRPRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRH  687
             S       Y+I  PR    FTG C     FP  +CN K++GA++FA +A++ G  N ++ 
Sbjct  212   SDKIPGHTYSI-PPR----FTGVCEVTIGFPPGSCNRKLIGARHFAESALSRGVLNSTQD  266

Query  688   YASPFDADGHGSHTASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMS  864
              ASPFD +GHG+HTAS AAGN+  PV+    + G ASGMAP A IAVYKALY  FGG+ +
Sbjct  267   DASPFDGEGHGTHTASVAAGNHGIPVVVAGHHLGNASGMAPRAHIAVYKALYKRFGGFAA  326

Query  865   dvvaavdqavedgvdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGP  1044
             D++AA+DQA +DGVDI++LS+ P+  P G + F N +++ L  A +AG+ VVQAAGN+GP
Sbjct  327   DIIAAIDQAAQDGVDIINLSITPNRRPPGIATFFNPIDMALFSAVKAGIFVVQAAGNTGP  386

Query  1045  SSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVC  1224
             + +SM SFSPW+ +V A++ DR YTNSI+LGN  T  G GL+  T  K   +L  A    
Sbjct  387   APKSMSSFSPWIFTVGATSHDRVYTNSIILGNNVTVPGVGLASGT--KTMHKLILATHAL  444

Query  1225  RRNSTA-GLLTVESCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAG  1401
             R  +T    + V  CQDA  F   LV+GK+++C+YT  F    ++I     T     AAG
Sbjct  445   RNGTTVMDAIYVGECQDASSFDQKLVQGKILVCSYTVRFILGVSTIKQALITAKNLTAAG  504

Query  1402  FVLTMDPDIGSEQIKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRAT  1578
              V  +DP     Q+   +  + IPG++I++ + S AL +YYNS+ LR   SG+ V   + 
Sbjct  505   LVFYIDPSATGFQM--TSTPMDIPGILISSSQDSQALLRYYNSSLLRENGSGKIVGSASA  562

Query  1579  ARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEG  1758
             ARI+ G +  Y    P V  +S+RGPD  +     AD++KPNI+APG++IW AWSP   G
Sbjct  563   ARIVGGMKPTYGIAAPKVMYFSARGPDPEDDSFVDADIMKPNIVAPGNAIWGAWSPLGIG  622

Query  1759  DKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspll  1938
                 +G+ FA+ SGTSM+ PH+AGIAALIK + P++ P+AI SA+ T+A ++DR G  ++
Sbjct  623   TTDFEGERFAMESGTSMSAPHVAGIAALIKQKFPHFTPAAIASALSTTASLSDRKGQHIM  682

Query  1939  aqqasq----qlapaTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVR  2106
             AQ+         +PATPFD GSGF+N + AL+PGL+F+  + +Y++FLC + G     V 
Sbjct  683   AQRTVLNPDISQSPATPFDMGSGFVNATAALDPGLIFDIGYNEYMKFLCGING-SSPVVL  741

Query  2107  RVVGVECPE-NKKFWCSDLNTPSVTISNLVGSRTVMRRVTNVG--GADERYRVIVREPLG  2277
                G  C   N     SDLN PSVTI+ LVG+RTV+R VTN+     +E Y V  + P  
Sbjct  742   NYTGESCSAYNSSLAASDLNLPSVTIAKLVGTRTVLRWVTNIATTATNETYTVGWKAPDS  801

Query  2278  VRVTIIPQNFFISADGSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
             V V + P  F I    +R L IVL A K  +  SFG + + GDR H+V +P AV
Sbjct  802   VSVKVSPAKFTIGNGQTRVLSIVLGAMKNVSMASFGRIGMFGDRGHVVNIPVAV  855



>emb|CDY49493.1| BnaC07g18060D [Brassica napus]
Length=862

 Score =   541 bits (1393),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 328/756 (43%), Positives = 457/756 (60%), Gaps = 14/756 (2%)
 Frame = +1

Query  199   MTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKME  378
             + + HD FL   L+   Y KLYSY +L+NGFAV V S +A K+  + E V  I  D  + 
Sbjct  105   IAQTHDSFLRKTLKGEKYIKLYSYNYLINGFAVFVSSQQAEKLSMRKE-VANIVLDFSVR  163

Query  379   KMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRIT  558
               TT+TP F+G+P+  W + GG   +GEG+VIG IDTGI+P H SFS  +  +       
Sbjct  164   TATTYTPQFMGLPEGAWVKEGGFETAGEGIVIGFIDTGIDPNHPSFSDKDINSQHSYPTP  223

Query  559   RKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTAST  738
             + F+G C    +FP+ +CN K+VGA++F ++AI  G FN S  YASPFD DGHG+HTAS 
Sbjct  224   KHFSGVCEVTPDFPSGSCNKKLVGARHFVQSAITRGTFNSSEDYASPFDGDGHGTHTASI  283

Query  739   AAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgvdIl  915
             AAGN+  PVI +  ++G ASG+AP A I+VYKALY SFGG+ +DVVAA+DQA +DGVDIL
Sbjct  284   AAGNHGVPVIVSNHSFGNASGIAPRAQISVYKALYKSFGGFAADVVAAIDQAAQDGVDIL  343

Query  916   slsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAA  1095
             SLS+ P+  P G + F N +++ +L A + G+ VVQAAGN+GPS +SM SFSPW+ +V A
Sbjct  344   SLSITPNRKPPGVATFFNPIDMAILSAVKTGIFVVQAAGNTGPSPKSMSSFSPWIFTVGA  403

Query  1096  STTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVESCQD  1272
             S+ DR Y+NSI LGN  T  G G S PT     +++ +A      +++    + +  CQD
Sbjct  404   SSHDRVYSNSITLGNNVTIPGVGFSSPTDDGKMYKMVSAFHALNNSTSVDTDMYLGECQD  463

Query  1273  AMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGA  1452
                +   LV   L++C+Y+  F    ++I    D      A G V  MDP +   QI   
Sbjct  464   YENYNQELVSENLLMCSYSVRFVLGLSTIKQALDVAKNLSAVGVVFYMDPYVLGFQIN--  521

Query  1453  TVTLQIPGLIINNMEASTALRQYYNSNTLR-SRSGRAVAFRATARILDGRRAIYSGQGPV  1629
                + +PG+II + E S  L +YYNS+  R + +   V F A A I  G  A +S + P+
Sbjct  522   PTPMDMPGIIIPSAEDSKILLKYYNSSIERDATTNEIVEFGAVAAIEGGLNANFSNKAPM  581

Query  1630  VASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSM  1809
             V  YS+RGPD  +   + AD+LKPN++APG+SIW AWS  S      +G+ FA++SGTSM
Sbjct  582   VMYYSARGPDPEDNSFNDADILKPNLVAPGNSIWGAWSSASIDSTEFEGEKFAMMSGTSM  641

Query  1810  ATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDR----lgspllaqqasqqlapaTP  1977
             A PH+AG+AALIK  +PN+ PSAI SA+ T+A + D     + +        Q L  ATP
Sbjct  642   AAPHVAGVAALIKQTYPNFSPSAIASALSTTALLNDNRGGPIMAQRTYANPDQSLLNATP  701

Query  1978  FDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCS-  2154
             FD GSGF+N + AL+PGL+F+T F+ Y+ FLC + G D   V    G++C  +     S 
Sbjct  702   FDMGSGFVNATAALDPGLIFDTSFEDYMSFLCGINGSDS-VVLNYTGIDCSSSNSSTISG  760

Query  2155  -DLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSR  2331
              DLN PS+T+S L G +   R V N+ G +E Y V    P GV + + P  F I    ++
Sbjct  761   FDLNLPSITVSTLNGKQVFKRSVRNIAG-NETYNVGWSPPYGVSMKVSPSLFSIGTGETQ  819

Query  2332  HLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              L I L  TK ++S SFG + L G   H+V +P +V
Sbjct  820   VLSITLEPTKNSSSSSFGRIGLFGKAGHVVNIPVSV  855



>emb|CDX78995.1| BnaA01g10620D [Brassica napus]
Length=858

 Score =   540 bits (1391),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 332/761 (44%), Positives = 465/761 (61%), Gaps = 15/761 (2%)
 Frame = +1

Query  190   KQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDI  369
             +  + + HD  L   L+   Y KLYS+ +L+NGFAV V S +A K+  ++E V  I  D 
Sbjct  98    RSAIAQAHDSLLRDALKGEKYIKLYSFHYLINGFAVFVSSQQAEKLSRRSE-VANIVLDF  156

Query  370   KMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRP  549
              +   TT+TP F+G+P   W + GG   +GEG+VIG IDTGI+P H SF+  +      P
Sbjct  157   SVRTATTYTPQFMGLPKGAWVKEGGYETAGEGIVIGFIDTGIDPTHPSFNGTDASQRQYP  216

Query  550   RITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHT  729
              I   F+G C    +FP+ +CN K+VGA++FA++AI  G FN S  +ASPFD DGHG+HT
Sbjct  217   -IPNHFSGVCEVTPDFPSGSCNRKLVGARHFAQSAITRGIFNSSEDFASPFDGDGHGTHT  275

Query  730   ASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedgv  906
             AS AAGN+    + +  N+G ASG+AP A I+VYKALY SFGG+ +DVVAA+DQA +DGV
Sbjct  276   ASIAAGNHGVSAVVSGHNFGSASGIAPRAHISVYKALYKSFGGFAADVVAAIDQAAQDGV  335

Query  907   dIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTS  1086
             DILSLS+ P+  P G + F N L++ +L A +AG+ VVQAAGN+GPS +SM SFSPW+ +
Sbjct  336   DILSLSITPNRRPPGVATFFNPLDMAMLSAVKAGIFVVQAAGNTGPSPKSMSSFSPWIFT  395

Query  1087  VAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA--GLLTVE  1260
             V A+T DR Y+NSI LGN  T  G GL+ PT     F +  AVD  +  S+A    +   
Sbjct  396   VGAATHDRVYSNSITLGNNVTIPGVGLAVPTDEGKMFTMIYAVDALKNKSSAVDKDMYAS  455

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD   F   L+ GKL+IC+Y+  F    ++I           A G V  MDP +   Q
Sbjct  456   ECQDYDSFDKDLICGKLLICSYSIRFVLGLSTIKQALAVSKNLSAKGVVFYMDPYVLGFQ  515

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSRSGRAVA-FRATARILDGRRAIYSG  1617
             I      + +PG+II + E S  L +YYNS   R  + + +  F A A +  G++A +S 
Sbjct  516   IN--PTPMDMPGIIIPSPEDSKVLLKYYNSTLERDATTKEIVRFGAVAAVSGGQKANFSD  573

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
             + P +  YS+RGPD  ++ L+ AD+LKPN++APG SIW AWS  +      +G+ FA++S
Sbjct  574   RAPKIMYYSARGPDPQDSFLNDADILKPNLVAPGHSIWGAWSSAATDSTEFEGESFAMMS  633

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRlgspllaqqa----sqqla  1965
             GTSMA PH+AG+AALIK +   + PSAI SA+ T+A   D  G  ++AQ+A     Q + 
Sbjct  634   GTSMAAPHVAGVAALIKQKFRKFSPSAIASALSTTAVTLDNKGEEIMAQRAYANPDQSMT  693

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVEC-PENKK  2142
             PATPFD G+GF+N + AL+PGL+F+T F+ Y+ FLC + G    +V    G  C   N  
Sbjct  694   PATPFDMGNGFVNATAALDPGLIFDTSFEDYMSFLCGING-SAPAVFNYTGKNCLLSNAT  752

Query  2143  FWCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISAD  2322
                SDLN PS+T+S L  +RTV R + N+ G +E Y V +  P GV +   P  F I++ 
Sbjct  753   ISASDLNLPSITLSRLNNTRTVQRLMKNIAG-NETYSVGLVPPFGVLMKASPTQFSIASG  811

Query  2323  GSRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAVYV  2445
              ++ L +   A K ++  SFG + L GD  H+V +P +V V
Sbjct  812   ETKLLSVTFKAKKNSSIASFGTIKLFGDMGHVVHIPVSVIV  852



>ref|NP_174348.1| subtilase-like protein [Arabidopsis thaliana]
 gb|AAD25747.1|AC007060_5 Strong similarity to gb|U80583 proteinase TMP from Lycopersicon 
esculentum and is a member of the PF|00082 subtilase family 
[Arabidopsis thaliana]
 gb|AAL59964.1| putative serine proteinase [Arabidopsis thaliana]
 gb|AAM20050.1| putative serine proteinase [Arabidopsis thaliana]
 gb|AEE31248.1| subtilase-like protein [Arabidopsis thaliana]
Length=832

 Score =   539 bits (1389),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 336/799 (42%), Positives = 479/799 (60%), Gaps = 31/799 (4%)
 Frame = +1

Query  112   IYMVLMEDHPFV----------STRIKGTSGNVTMYKQR---MTKQHDVFLGSLLRRSAY  252
             +Y+V ++D P V             +  TS  +     R   + + HD  L ++LR+  Y
Sbjct  36    VYIVTLKDRPSVHFSGRESSDSKHSLTATSSQIYRTLNRSASIIRVHDSLLRNVLRKENY  95

Query  253   TKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHTPDFLGIPDTVWP  432
              KLYSY +L+NGF+  +   +A ++  + E V  +  D  +EK TTHTP FLG+P   W 
Sbjct  96    LKLYSYHYLINGFSAVLTRKQADRLAAREE-VENVVLDFLVEKATTHTPQFLGLPRGAWL  154

Query  433   RLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGKCITGDNFPATAC  612
             R GG   +GEGVVIG IDTGI+P H SFS  ++ +     +   FTG C     FP  +C
Sbjct  155   RDGGSEYAGEGVVIGFIDTGIDPTHPSFS--DKISGHTYSVPPHFTGVCEVTIGFPPGSC  212

Query  613   NGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYHTPVITNRFNYGY  792
             N K++GA++FA +A++ G  N S+  ASPFD +GHG+HTAS AAGN+  PV+      G 
Sbjct  213   NRKLIGARHFAESALSRGVLNSSQDDASPFDGEGHGTHTASVAAGNHGIPVVVAGHRLGN  272

Query  793   ASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsvgpssvpsgDSAFLN  969
             ASGMAP A IA+YKALY  FGG+ +D++AA+DQA +DGVDI++LS+ P+  P G + F N
Sbjct  273   ASGMAPRAHIAIYKALYKRFGGFAADIIAAIDQAAQDGVDIINLSITPNRRPPGIATFFN  332

Query  970   VLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDRRYTNSIVLGNGQT  1149
              +++ LL A +AG+ VVQAAGN+GP+ +SM SFSPW+ +V A++ DR Y+NSI+LGN  T
Sbjct  333   PIDMALLSAVKAGIFVVQAAGNTGPAPKSMSSFSPWIFTVGATSHDRVYSNSIILGNNVT  392

Query  1150  FSGSGLSPPTAGKAFFQLAAAVDVCRRNSTA-GLLTVESCQDAMQFVPSLVRGKLVICTY  1326
               G GL+  T  +   +L  A    R  +T    + V  CQD+  F   LV+GK+++C+Y
Sbjct  393   IPGVGLASGT--RIMHKLVLATHALRNGTTVMDAIYVGECQDSSSFDQKLVQGKILVCSY  450

Query  1327  TYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQIPGLIINNMEAST  1506
             T  F    ++I     T     AAG V  +DP     Q+  +   + IPG++I++ + S 
Sbjct  451   TVRFILGVSTIKQALLTAKNLTAAGLVFYIDPSATGFQMTSSP--MDIPGILISSPQDSQ  508

Query  1507  ALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGPVVASYSSRGPDVNNALLDT  1683
             AL +YYNS+ LR   SG+ V   + A+I+ G R  Y    P V  +S+RGPD  +     
Sbjct  509   ALLRYYNSSLLRENGSGKIVGSASVAKIVGGMRPTYGITAPKVMYFSARGPDPEDDSFVD  568

Query  1684  ADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIAGIAALIKDRHPN  1863
             AD++KPN++APG++IW AWSP   G    +G+ FA+ SGTSM+ PH+ GIAALIK + P+
Sbjct  569   ADIMKPNLVAPGNAIWGAWSPLGIGTNDFQGERFAMESGTSMSAPHVTGIAALIKQKFPH  628

Query  1864  WKPSAITSAMMTSADVTDRlgspllaqqasq----qlapaTPFDFGSGFINPSRALNPGL  2031
             + P+AI SA+ T+A ++DR G  ++AQ+         +PATPFD GSGF+N + AL+PGL
Sbjct  629   FTPAAIASALSTTASLSDRKGEHIMAQRTVLNPDISQSPATPFDMGSGFVNATAALDPGL  688

Query  2032  VFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPE-NKKFWCSDLNTPSVTISNLVGSRTV  2208
             +F+  + +Y++FLC + G     V    G  C   N     SDLN PSVTI+ LVG+R V
Sbjct  689   IFDIGYNEYMKFLCGING-SSPVVLNYTGESCSSYNSSLAASDLNLPSVTIAKLVGTRAV  747

Query  2209  MRRVTNVG--GADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNATKATNSYSF  2382
             +R VTN+     +E Y V    P  V V + P  F I    +R L +V  A K  +  SF
Sbjct  748   LRWVTNIATTATNETYIVGWMAPDSVSVKVSPAKFTIGNGQTRVLSLVFRAMKNVSMASF  807

Query  2383  GEMILLGDRNHIVRVPFAV  2439
             G + L GDR H+V +P AV
Sbjct  808   GRIGLFGDRGHVVNIPVAV  826



>ref|XP_007014400.1| Subtilisin-like serine protease 3 isoform 5 [Theobroma cacao]
 gb|EOY32019.1| Subtilisin-like serine protease 3 isoform 5 [Theobroma cacao]
Length=741

 Score =   536 bits (1380),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 330/745 (44%), Positives = 455/745 (61%), Gaps = 19/745 (3%)
 Frame = +1

Query  217   VFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYEDIKMEKMTTHT  396
             + LG L  R +Y KLYSY HL+NGF+VH+  ++A + L +A GV+ +  D K+ ++TTHT
Sbjct  1     MLLGMLFERGSYKKLYSYKHLINGFSVHLSPEQA-ETLRRAPGVKSVERDWKVRRLTTHT  59

Query  397   PDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGRPRITRKFTGK  576
             P FLG+P  VWP  GG   +GE +VIG +D+GI P H SF++   Y+        K+ GK
Sbjct  60    PQFLGLPTGVWPTGGGFDRAGEDIVIGFVDSGIYPLHPSFAA---YHTDPYGPVPKYRGK  116

Query  577   CITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSHTASTAAGNYH  756
             C    +     CNGKI+GAQ+FA AA AAG FN +  +ASP D DGHGSHTA+ AAGN  
Sbjct  117   CEIDPDTKRDFCNGKIIGAQHFAEAAKAAGAFNPAIDFASPMDGDGHGSHTAAIAAGNNG  176

Query  757   TPVITNRFNYGYASGMAPGAGIAVYKALYS-FGGYMSdvvaavdqavedgvdIlslsv-g  930
              PV  +   +G ASGMAP A IAVYKALY  FGG+++DVVAA+DQAV DGVDILSLSV  
Sbjct  177   IPVRVHGHEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDILSLSVGP  236

Query  931   pssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVTSVAASTTDR  1110
              S   +  + FLN  +  LL A +AGV V QAAGN GP  ++++S+SPW+ SVAA+  DR
Sbjct  237   NSPQATTKTTFLNPFDATLLAAVKAGVFVAQAAGNGGPFPKTLVSYSPWIASVAAAIDDR  296

Query  1111  RYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGLLTVESCQDAMQFVP  1290
             RY N + LGNG+  +G GLSP T     + + AA DV   +S+    +   CQ       
Sbjct  297   RYKNHLNLGNGKILAGMGLSPSTHPNQTYTMVAANDVLL-DSSVMKYSPSDCQRPEVLNK  355

Query  1291  SLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQIKGATVTLQI  1470
             +LV G +++C Y+++F    ASI  V++T     A GFVL ++    S   K   V + I
Sbjct  356   NLVEGNILLCGYSFNFVVGTASIKKVSETAKALRAVGFVLAVENV--SPGTKFDPVPVGI  413

Query  1471  PGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSGQGPVVASYSS  1647
             PG++I ++  S     Y  S  L    +GR  +F+A   I DG   I     P VA +S+
Sbjct  414   PGILITDVSKSMV---YLGSLLLLPDWTGRVKSFKAIGSIGDGLMPILHKSAPQVALFSA  470

Query  1648  RGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVSGTSMATPHIA  1827
             RGP++ +     AD+LKP+I+APGS IWAAWSPN   +    G+ FA++SGTSMA PHIA
Sbjct  471   RGPNIKDYSFQDADLLKPDILAPGSLIWAAWSPNGTDEPNYVGEGFAMISGTSMAAPHIA  530

Query  1828  GIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqlapaTPFDFGSG  1995
             GIAAL+K +HP+W P+AI SA+MT++   DR      +   ++  + +L  ATPFD+GSG
Sbjct  531   GIAALLKQKHPHWSPAAIKSALMTTSTKLDRAGRPLQAQQYSETEAMKLVTATPFDYGSG  590

Query  1996  FINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKFWCSDLNTPSV  2175
              +NP  AL+PGL+F+  ++ Y+ FLC+ PG+D   ++      C  +     S+LNTPS+
Sbjct  591   HVNPRAALDPGLIFHAGYEDYLGFLCSTPGIDIHEIKNYTNSPC-NHTMGHPSNLNTPSI  649

Query  2176  TISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADGSRHLIIVLNA  2355
             TIS+LVG++TV R VTNV   +E Y +  R    + +   P    +    SR   + L A
Sbjct  650   TISHLVGTQTVTRTVTNV-AEEETYVITARMHPSIAIETNPSAMTLKPGASRKFSVTLTA  708

Query  2356  TKATNSYSFGEMILLGDRNHIVRVP  2430
                T +YSFGE+ + G R H V +P
Sbjct  709   RSVTGTYSFGEITMKGSRGHKVSIP  733



>ref|XP_002456409.1| hypothetical protein SORBIDRAFT_03g035770 [Sorghum bicolor]
 gb|EES01529.1| hypothetical protein SORBIDRAFT_03g035770 [Sorghum bicolor]
Length=868

 Score =   540 bits (1391),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 319/758 (42%), Positives = 456/758 (60%), Gaps = 14/758 (2%)
 Frame = +1

Query  187   YKQRMTKQHDVFLGSLLRRSAYTKLYSYTHLLNGFAVHVKSDKALKILHKAEGVRGIYED  366
             Y   +    +  L   LR   Y KLYSY +L+NGFA  +   +A K+  + E V  +  D
Sbjct  110   YGSYIVHLQNALLKRTLRGEHYIKLYSYRYLINGFAAVITPLQADKLSRRKE-VANVMLD  168

Query  367   IKMEKMTTHTPDFLGIPDTVWPRLGGPSVSGEGVVIGMIDTGINPFHASFSSPEEYNIGR  546
               +   TTHTP+FLG+P   W + GGP  +G+GVV+G+IDTGI+P H SF+  ++ +   
Sbjct  169   YSVRTATTHTPEFLGLPQGAWVQEGGPQFAGQGVVVGLIDTGIDPTHPSFA--DDLSTDS  226

Query  547   PRITRKFTGKCITGDNFPATACNGKIVGAQYFARAAIAAGDFNVSRHYASPFDADGHGSH  726
               +   ++G C   ++FP+ +CN K+VGA++FA +AI  G FN S+  ASP D+DGHG+H
Sbjct  227   YPVPAHYSGICEVTNDFPSGSCNRKLVGARHFAASAITRGVFNASQDLASPSDSDGHGTH  286

Query  727   TASTAAGNYHTPVITNRFNYGYASGMAPGAGIAVYKALY-SFGGYMSdvvaavdqavedg  903
             TAS AAGN+  PV+     +G ASGMAP A IAVYKALY SFGG+ +DVVAA+DQA ED 
Sbjct  287   TASIAAGNHGIPVVVAGHQFGNASGMAPRAHIAVYKALYKSFGGFAADVVAAIDQAAEDN  346

Query  904   vdIlslsvgpssvpsgDSAFLNVLEVQLLFATRAGVLVVQAAGNSGPSSRSMLSFSPWVT  1083
             VDI+SLS+ P+  P G + F N +++ LL A +AG+ VVQAAGN+GPS +SM S+SPW+ 
Sbjct  347   VDIISLSITPNRRPPGLATFFNPIDMALLSAVKAGIFVVQAAGNTGPSPKSMSSYSPWIF  406

Query  1084  SVAASTTDRRYTNSIVLGNGQTFSGSGLSPPTAGKAFFQLAAAVDVCRRNSTAGL-LTVE  1260
             +V AS  DR Y+N +VLGN  T  G GL+P T G   + L AA    + N+ +   +++ 
Sbjct  407   TVGASAHDRVYSNYVVLGNNLTIQGVGLAPGTDGDCMYTLVAAPHALKNNTVSPTEMSLG  466

Query  1261  SCQDAMQFVPSLVRGKLVICTYTYDFESEAASIATVADTVHRAGAAGFVLTMDPDIGSEQ  1440
              CQD+ +    L+RGK+++C+Y+  F    +S+    DT +   AAG +  +DP +   Q
Sbjct  467   ECQDSSRLDADLIRGKILVCSYSIRFVLGLSSVKQALDTANNVSAAGVIFYLDPFVLGFQ  526

Query  1441  IKGATVTLQIPGLIINNMEASTALRQYYNSNTLRSR-SGRAVAFRATARILDGRRAIYSG  1617
             +      + +PGLII + + S     YYN + +R   SG+ V+F   A+IL G    Y  
Sbjct  527   LN--PTPMHMPGLIIPSSDDSKVFLTYYNDSLVRDETSGQVVSFGGVAKILGGLNPNYGN  584

Query  1618  QGPVVASYSSRGPDVNNALLDTADVLKPNIMAPGSSIWAAWSPNSEGDKYIKGQHFALVS  1797
               P V  YS+RGPD  +  L  AD+LKPN++APGSSIW AWS          G+ FA++S
Sbjct  585   SAPKVMFYSARGPDPEDNSLSNADILKPNLVAPGSSIWGAWSSLGLDSAEFAGESFAMLS  644

Query  1798  GTSMATPHIAGIAALIKDRHPNWKPSAITSAMMTSADVTDRl----gspllaqqasqqla  1965
             GTSMA PH+AG+AALIK + P++ P+AI SA+ T+  ++DR      +           +
Sbjct  645   GTSMAAPHVAGLAALIKQKFPSFSPAAIASALSTTTTLSDRQGKPIMAQRTYSNPDSTQS  704

Query  1966  paTPFDFGSGFINPSRALNPGLVFNTYFQQYIQFLCAVPGVDEKSVRRVVGVECPENKKF  2145
             PAT FD G+GF+N + AL+PGLVF+  +  +  FLC + G     V    G  C  +   
Sbjct  705   PATAFDMGNGFVNATAALDPGLVFDCSYDDFFSFLCGING-SSPVVTNYTGNSCVAS-TM  762

Query  2146  WCSDLNTPSVTISNLVGSRTVMRRVTNVGGADERYRVIVREPLGVRVTIIPQNFFISADG  2325
               +DLN PS+TI+ L  +R + R VTNV  ADE Y V    P G  V+++P  F I +  
Sbjct  763   TGADLNLPSITIAVLNQTRAITRTVTNVAAADESYTVSYSAPYGTAVSVVPTQFLIPSGQ  822

Query  2326  SRHLIIVLNATKATNSYSFGEMILLGDRNHIVRVPFAV  2439
              + +  V+NAT  ++S SFG +   GD+ H   +PF+V
Sbjct  823   KQLVTFVVNATMNSSSASFGNVGFYGDKGHRAIIPFSV  860



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8084880484048