BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20124_g1_i2 len=655 path=[319:0-47 367:48-111 272:112-373
295:374-654]

Length=655
                                                                      Score     E

ref|XP_009621517.1|  PREDICTED: reticulon-like protein B21              183   3e-50   
ref|XP_009760122.1|  PREDICTED: reticulon-like protein B21              182   5e-50   
ref|XP_010323183.1|  PREDICTED: reticulon-like protein B21 isofor...    182   2e-49   
ref|XP_006343731.1|  PREDICTED: reticulon-like protein B21-like         181   3e-49   
ref|XP_004242584.1|  PREDICTED: reticulon-like protein B21 isofor...    181   3e-49   
ref|XP_010265609.1|  PREDICTED: reticulon-like protein B21 isofor...    176   2e-47   
ref|XP_002309341.2|  hypothetical protein POPTR_0006s19970g             174   9e-47   Populus trichocarpa [western balsam poplar]
gb|EYU34355.1|  hypothetical protein MIMGU_mgv1a004061mg                172   1e-46   
gb|EYU34356.1|  hypothetical protein MIMGU_mgv1a004061mg                172   2e-46   
ref|XP_011018019.1|  PREDICTED: reticulon-like protein B21 isofor...    171   1e-45   
ref|XP_010275780.1|  PREDICTED: reticulon-like protein B21 isofor...    170   2e-45   
ref|XP_010275779.1|  PREDICTED: reticulon-like protein B21 isofor...    170   2e-45   
ref|XP_011018020.1|  PREDICTED: reticulon-like protein B21 isofor...    170   2e-45   
ref|XP_011033436.1|  PREDICTED: reticulon-like protein B21 isofor...    169   5e-45   
ref|XP_011033437.1|  PREDICTED: reticulon-like protein B21 isofor...    169   5e-45   
ref|XP_002324545.2|  hypothetical protein POPTR_0018s11750g             168   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_007011951.1|  Reticulon family protein, putative isoform 1       168   1e-44   
emb|CDP10218.1|  unnamed protein product                                167   1e-44   
gb|ACJ86231.1|  unknown                                                 157   2e-44   Medicago truncatula
gb|KDP38668.1|  hypothetical protein JCGZ_04021                         166   4e-44   
ref|XP_006488206.1|  PREDICTED: reticulon-like protein B21-like         166   5e-44   
ref|XP_006424682.1|  hypothetical protein CICLE_v10028046mg             165   6e-44   
ref|XP_002533975.1|  hypothetical protein RCOM_0370390                  165   6e-44   Ricinus communis
ref|XP_011079424.1|  PREDICTED: LOW QUALITY PROTEIN: reticulon-li...    165   7e-44   
ref|XP_010110376.1|  Reticulon-like protein                             165   1e-43   
ref|XP_009795103.1|  PREDICTED: reticulon-like protein B21              164   2e-43   
gb|KCW81203.1|  hypothetical protein EUGRSUZ_C02575                     164   3e-43   
ref|XP_007138414.1|  hypothetical protein PHAVU_009G206800g             163   4e-43   
ref|XP_003525913.2|  PREDICTED: reticulon-like protein B21-like         163   5e-43   
gb|KHN11130.1|  Reticulon-like protein B21                              163   5e-43   
ref|XP_010048815.1|  PREDICTED: reticulon-like protein B21              162   2e-42   
ref|XP_004251753.1|  PREDICTED: reticulon-like protein B21              161   2e-42   
gb|KEH38077.1|  reticulon-like protein B2                               160   2e-42   
ref|XP_009587028.1|  PREDICTED: reticulon-like protein B21 isofor...    160   5e-42   
ref|XP_009587027.1|  PREDICTED: reticulon-like protein B21 isofor...    160   5e-42   
ref|XP_010687720.1|  PREDICTED: reticulon-like protein B21 isofor...    159   1e-41   
ref|XP_004514755.1|  PREDICTED: reticulon-like protein B21-like         158   2e-41   
ref|XP_006600546.1|  PREDICTED: reticulon-like protein B21-like i...    157   4e-41   
ref|XP_011084045.1|  PREDICTED: reticulon-like protein B21              156   6e-41   
ref|XP_006350096.1|  PREDICTED: reticulon-like protein B21-like         157   6e-41   
gb|KHN42814.1|  Reticulon-like protein B21                              153   1e-39   
ref|XP_003518216.1|  PREDICTED: reticulon-like protein B21-like         153   1e-39   
ref|XP_008443867.1|  PREDICTED: reticulon-like protein B21              151   6e-39   
ref|XP_008242972.1|  PREDICTED: reticulon-like protein B21              150   1e-38   
ref|XP_010545877.1|  PREDICTED: reticulon-like protein B21              150   2e-38   
ref|XP_004146687.1|  PREDICTED: reticulon-like protein B21-like         149   2e-38   
ref|XP_004161870.1|  PREDICTED: reticulon-like protein B21-like         149   2e-38   
ref|XP_007203773.1|  hypothetical protein PRUPE_ppa002580mg             149   6e-38   
ref|XP_009358457.1|  PREDICTED: reticulon-like protein B21 isofor...    149   8e-38   
ref|XP_009358458.1|  PREDICTED: reticulon-like protein B21 isofor...    149   8e-38   
ref|XP_004288712.1|  PREDICTED: reticulon-like protein B21-like         148   1e-37   
emb|CDY55012.1|  BnaA10g29370D                                          144   2e-36   
ref|XP_010930926.1|  PREDICTED: reticulon-like protein B21 isofor...    144   2e-36   
ref|XP_010930925.1|  PREDICTED: reticulon-like protein B21 isofor...    144   2e-36   
ref|XP_009395289.1|  PREDICTED: reticulon-like protein B21 isofor...    144   2e-36   
ref|XP_009395290.1|  PREDICTED: reticulon-like protein B21 isofor...    144   2e-36   
ref|XP_006401142.1|  hypothetical protein EUTSA_v10013006mg             144   2e-36   
emb|CDY57466.1|  BnaC09g33520D                                          144   2e-36   
gb|EEE68393.1|  hypothetical protein OsJ_26729                          144   3e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009120314.1|  PREDICTED: reticulon-like protein B21              143   4e-36   
gb|EEC83262.1|  hypothetical protein OsI_28591                          144   5e-36   Oryza sativa Indica Group [Indian rice]
gb|KDO73071.1|  hypothetical protein CISIN_1g0072731mg                  134   7e-36   
ref|NP_001061443.1|  Os08g0280600                                       135   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006424681.1|  hypothetical protein CICLE_v10028046mg             140   5e-35   
ref|XP_006659255.1|  PREDICTED: reticulon-like protein B21-like         139   7e-35   
ref|XP_010453049.1|  PREDICTED: reticulon-like protein B21              139   1e-34   
ref|XP_010443510.1|  PREDICTED: reticulon-like protein B21              139   1e-34   
ref|XP_010483359.1|  PREDICTED: reticulon-like protein B21              139   2e-34   
ref|XP_006279606.1|  hypothetical protein CARUB_v10026138mg             138   2e-34   
ref|XP_009385004.1|  PREDICTED: reticulon-like protein B21 isofor...    137   3e-34   
ref|XP_002445424.1|  hypothetical protein SORBIDRAFT_07g018020          137   4e-34   Sorghum bicolor [broomcorn]
ref|XP_007149094.1|  hypothetical protein PHAVU_005G040700g             137   5e-34   
dbj|BAD93974.1|  putative protein                                       136   6e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200608.3|  reticulon-like protein B21                            136   7e-34   Arabidopsis thaliana [mouse-ear cress]
emb|CDM82451.1|  unnamed protein product                                135   2e-33   
ref|XP_010234545.1|  PREDICTED: reticulon-like protein B21              136   2e-33   
gb|EMS49286.1|  Reticulon-like protein B21                              136   2e-33   
emb|CDY02784.1|  BnaC02g11050D                                          135   3e-33   
emb|CDY32734.1|  BnaA02g07960D                                          135   3e-33   
ref|XP_009126799.1|  PREDICTED: reticulon-like protein B21              135   3e-33   
dbj|BAK07265.1|  predicted protein                                      135   3e-33   
ref|XP_008802355.1|  PREDICTED: reticulon-like protein B21              134   4e-33   
gb|EMT20841.1|  Reticulon-like protein B21                              133   6e-33   
ref|XP_004973157.1|  PREDICTED: reticulon-like protein B21-like         134   2e-32   
ref|XP_010912152.1|  PREDICTED: reticulon-like protein B21 isofor...    132   2e-32   
ref|XP_009396755.1|  PREDICTED: reticulon-like protein B21 isofor...    132   2e-32   
ref|XP_006857216.1|  hypothetical protein AMTR_s00065p00202980          132   4e-32   
ref|XP_008790667.1|  PREDICTED: reticulon-like protein B21              131   6e-32   
ref|XP_006600547.1|  PREDICTED: reticulon-like protein B21-like i...    130   1e-31   
ref|XP_008678514.1|  PREDICTED: reticulon-like protein B21 isofor...    130   4e-31   
gb|AFW61968.1|  hypothetical protein ZEAMMB73_167181                    129   5e-31   
ref|XP_008394330.1|  PREDICTED: reticulon-like protein B21              117   2e-29   
ref|XP_009587029.1|  PREDICTED: reticulon-like protein B21 isofor...    117   8e-27   
gb|KCW78915.1|  hypothetical protein EUGRSUZ_C00355                     108   2e-23   
ref|XP_010047117.1|  PREDICTED: reticulon-like protein B21              108   2e-23   
dbj|BAB08870.1|  unnamed protein product                                106   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EPS63768.1|  hypothetical protein M569_11016                         101   2e-22   
ref|XP_002864543.1|  hypothetical protein ARALYDRAFT_332090             105   3e-22   
ref|XP_004169596.1|  PREDICTED: reticulon-like protein B21-like       89.0    4e-18   
ref|XP_008456496.1|  PREDICTED: reticulon-like protein B21            90.5    1e-17   
ref|XP_004139257.1|  PREDICTED: uncharacterized protein LOC101208213  89.0    4e-17   
gb|EAZ06360.1|  hypothetical protein OsI_28590                        82.0    5e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_010490286.1|  PREDICTED: reticulon-like protein B17            78.6    4e-14   
ref|XP_010490285.1|  PREDICTED: reticulon-like protein B17            78.6    4e-14   
ref|XP_010467796.1|  PREDICTED: reticulon-like protein B17 isofor...  79.7    7e-14   
ref|XP_010323753.1|  PREDICTED: reticulon-like protein B17            79.3    7e-14   
ref|XP_010467795.1|  PREDICTED: reticulon-like protein B17 isofor...  79.7    8e-14   
ref|XP_011100409.1|  PREDICTED: reticulon-like protein B17            79.0    1e-13   
ref|XP_010489015.1|  PREDICTED: reticulon-like protein B17 isofor...  78.6    1e-13   
ref|XP_010489014.1|  PREDICTED: reticulon-like protein B17 isofor...  78.6    1e-13   
gb|KHN01107.1|  Reticulon-like protein B17                            76.6    2e-13   
gb|KFK40434.1|  hypothetical protein AALP_AA3G372800                  78.2    2e-13   
ref|XP_010668132.1|  PREDICTED: reticulon-like protein B17 isofor...  77.8    3e-13   
ref|XP_010668133.1|  PREDICTED: reticulon-like protein B17 isofor...  77.8    3e-13   
emb|CDX81970.1|  BnaC08g36310D                                        77.0    5e-13   
emb|CDY13866.1|  BnaA09g43680D                                        77.0    5e-13   
ref|XP_007011952.1|  Reticulon family protein, putative isoform 2     77.4    5e-13   
ref|XP_006408990.1|  hypothetical protein EUTSA_v10001984mg           77.0    6e-13   
ref|XP_006348819.1|  PREDICTED: reticulon-like protein B17-like       76.6    6e-13   
ref|XP_009117478.1|  PREDICTED: reticulon-like protein B17            77.0    6e-13   
ref|XP_006582310.1|  PREDICTED: reticulon-like protein B17-like i...  76.3    8e-13   
gb|KEH39173.1|  reticulon-like protein B2                             76.3    8e-13   
ref|XP_003526265.1|  PREDICTED: reticulon-like protein B17-like i...  76.3    9e-13   
ref|XP_006297644.1|  hypothetical protein CARUB_v10013662mg           76.3    1e-12   
gb|AES89696.2|  reticulon-like protein B2                             74.7    1e-12   
ref|XP_004487260.1|  PREDICTED: reticulon-like protein B17-like       75.5    1e-12   
ref|XP_003607499.1|  Reticulon-like protein B18                       75.5    1e-12   
ref|XP_007132792.1|  hypothetical protein PHAVU_011G125100g           75.5    2e-12   
ref|XP_007132793.1|  hypothetical protein PHAVU_011G125100g           75.5    2e-12   
ref|XP_001764750.1|  predicted protein                                76.3    2e-12   
gb|KHG24941.1|  Reticulon-like protein B21                            75.5    2e-12   
ref|XP_004505553.1|  PREDICTED: reticulon-like protein B18-like i...  75.1    2e-12   
ref|XP_004505552.1|  PREDICTED: reticulon-like protein B18-like i...  75.1    2e-12   
ref|XP_004952313.1|  PREDICTED: reticulon-like protein B17-like       75.1    2e-12   
gb|AAD21707.1|  hypothetical protein                                  74.3    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179649.2|  reticulon-like protein B17                          74.3    4e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAO37135.1|  hypothetical protein                                  74.3    4e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDY38392.1|  BnaC01g10010D                                        74.3    4e-12   
gb|AFK47382.1|  unknown                                               73.2    6e-12   
gb|KEH38078.1|  reticulon-like protein B2                             73.6    7e-12   
ref|XP_010687721.1|  PREDICTED: reticulon-like protein B21 isofor...  73.6    9e-12   
ref|XP_007149817.1|  hypothetical protein PHAVU_005G101200g           72.4    1e-11   
gb|EMT16357.1|  Reticulon-like protein B17                            70.1    2e-11   
ref|XP_006424683.1|  hypothetical protein CICLE_v10028046mg           72.8    2e-11   
ref|XP_010540878.1|  PREDICTED: reticulon-like protein B17            72.0    2e-11   
ref|XP_002517867.1|  conserved hypothetical protein                   72.0    2e-11   Ricinus communis
ref|XP_009610404.1|  PREDICTED: reticulon-like protein B17 isofor...  71.6    3e-11   
ref|XP_009610412.1|  PREDICTED: reticulon-like protein B17 isofor...  71.6    3e-11   
ref|XP_008809498.1|  PREDICTED: reticulon-like protein B18 isofor...  71.6    3e-11   
gb|KHG24942.1|  Reticulon-like protein B21                            71.6    5e-11   
gb|KDP24091.1|  hypothetical protein JCGZ_25748                       70.9    6e-11   
ref|XP_009759396.1|  PREDICTED: reticulon-like protein B17 isofor...  70.9    7e-11   
ref|XP_009759395.1|  PREDICTED: reticulon-like protein B17 isofor...  70.5    8e-11   
ref|XP_011047681.1|  PREDICTED: reticulon-like protein B17 isofor...  70.5    8e-11   
ref|XP_011047680.1|  PREDICTED: reticulon-like protein B17 isofor...  70.5    9e-11   
gb|KCW78917.1|  hypothetical protein EUGRSUZ_C00355                   70.1    1e-10   
ref|XP_009129630.1|  PREDICTED: reticulon-like protein B18 isofor...  69.7    2e-10   
ref|XP_009129621.1|  PREDICTED: reticulon-like protein B18 isofor...  69.7    2e-10   
emb|CDY35185.1|  BnaA01g08460D                                        69.3    2e-10   
gb|KFK29370.1|  hypothetical protein AALP_AA7G125100                  69.3    3e-10   
gb|KFK29369.1|  hypothetical protein AALP_AA7G125100                  69.3    3e-10   
gb|EEE56796.1|  hypothetical protein OsJ_06381                        68.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|KCW81204.1|  hypothetical protein EUGRSUZ_C02575                   68.9    3e-10   
ref|XP_006852583.1|  hypothetical protein AMTR_s00021p00213680        68.2    4e-10   
ref|NP_001046629.1|  Os02g0302900                                     68.2    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010260314.1|  PREDICTED: reticulon-like protein B17            67.8    6e-10   
ref|XP_008678512.1|  PREDICTED: reticulon-like protein B21 isofor...  61.2    9e-10   
ref|XP_008678513.1|  PREDICTED: reticulon-like protein B21 isofor...  61.2    9e-10   
ref|XP_002437526.1|  hypothetical protein SORBIDRAFT_10g028710        67.4    9e-10   Sorghum bicolor [broomcorn]
ref|XP_002309754.1|  reticulon family protein                         67.4    9e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006594843.1|  PREDICTED: reticulon-like protein B17-like       67.0    1e-09   
gb|KDO43073.1|  hypothetical protein CISIN_1g022168mg                 66.2    1e-09   
dbj|BAJ88877.1|  predicted protein                                    66.6    1e-09   
ref|XP_004305428.1|  PREDICTED: reticulon-like protein B17-like       66.6    1e-09   
ref|XP_006469912.1|  PREDICTED: reticulon-like protein B17-like i...  66.6    2e-09   
ref|XP_006648565.1|  PREDICTED: reticulon-like protein B17-like       66.2    2e-09   
ref|XP_010272355.1|  PREDICTED: reticulon-like protein B17 isofor...  66.2    2e-09   
ref|XP_006447229.1|  hypothetical protein CICLE_v10015408mg           66.2    2e-09   
ref|XP_010272354.1|  PREDICTED: reticulon-like protein B17 isofor...  66.2    2e-09   
gb|AFW65726.1|  hypothetical protein ZEAMMB73_947370                  63.9    3e-09   
dbj|BAJ92676.1|  predicted protein                                    65.1    5e-09   
emb|CBI21893.3|  unnamed protein product                              64.7    5e-09   
ref|XP_010656999.1|  PREDICTED: reticulon-like protein B17            65.1    5e-09   
gb|KHN27905.1|  Reticulon-like protein B17                            64.7    6e-09   
ref|XP_010227678.1|  PREDICTED: reticulon-like protein B17 isofor...  64.7    6e-09   
ref|XP_003560742.1|  PREDICTED: reticulon-like protein B17 isofor...  64.7    6e-09   
gb|EYU29856.1|  hypothetical protein MIMGU_mgv1a007021mg              64.7    7e-09   
ref|XP_010555105.1|  PREDICTED: reticulon-like protein B18 isofor...  64.3    7e-09   
ref|XP_010555106.1|  PREDICTED: reticulon-like protein B17 isofor...  64.3    7e-09   
ref|XP_010555104.1|  PREDICTED: reticulon-like protein B18 isofor...  64.3    8e-09   
ref|XP_009396756.1|  PREDICTED: reticulon-like protein B21 isofor...  64.3    9e-09   
ref|XP_006372740.1|  reticulon family protein                         64.3    9e-09   
ref|NP_001130153.1|  uncharacterized protein LOC100191247             63.9    1e-08   Zea mays [maize]
ref|XP_011029062.1|  PREDICTED: reticulon-like protein B17 isofor...  63.5    1e-08   
ref|XP_011029065.1|  PREDICTED: reticulon-like protein B17 isofor...  63.5    1e-08   
ref|XP_003539539.1|  PREDICTED: reticulon-like protein B17-like       63.5    1e-08   
ref|XP_011029063.1|  PREDICTED: reticulon-like protein B17 isofor...  63.5    1e-08   
ref|XP_011029061.1|  PREDICTED: reticulon-like protein B17 isofor...  63.5    1e-08   
ref|XP_011029064.1|  PREDICTED: reticulon-like protein B17 isofor...  63.5    1e-08   
emb|CAA16882.1|  hypothetical protein                                 63.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|EMT33577.1|  Reticulon-like protein B17                            63.2    2e-08   
ref|NP_567809.1|  reticulon-like protein B18                          62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63049.1|  unknown                                               62.8    3e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99357.1|  hypothetical protein                                 62.8    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008809421.1|  PREDICTED: reticulon-like protein B17 isofor...  62.0    5e-08   
gb|EEC72976.1|  hypothetical protein OsI_06874                        61.6    6e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_007043668.1|  Reticulon family protein, putative isoform 2     61.6    7e-08   
ref|XP_007043667.1|  Reticulon family protein, putative isoform 1     61.6    7e-08   
gb|KHG20167.1|  Reticulon-like protein B17                            61.2    1e-07   
ref|XP_002869503.1|  hypothetical protein ARALYDRAFT_491927           60.8    1e-07   
ref|XP_007198848.1|  hypothetical protein PRUPE_ppa014722mg           60.8    1e-07   
ref|XP_008448255.1|  PREDICTED: reticulon-like protein B17            60.5    2e-07   
ref|XP_008229008.1|  PREDICTED: reticulon-like protein B17            60.1    2e-07   
ref|XP_009357134.1|  PREDICTED: reticulon-like protein B17            59.7    3e-07   
ref|XP_010447981.1|  PREDICTED: reticulon-like protein B18            59.3    5e-07   
emb|CDP15861.1|  unnamed protein product                              58.9    5e-07   
ref|XP_008363067.1|  PREDICTED: reticulon-like protein B17            58.5    7e-07   
gb|EPS61322.1|  hypothetical protein M569_13475                       57.0    2e-06   
ref|XP_010433219.1|  PREDICTED: reticulon-like protein B18            57.0    2e-06   
gb|KGN46983.1|  hypothetical protein Csa_6G157090                     57.0    2e-06   
ref|XP_010489016.1|  PREDICTED: reticulon-like protein B17 isofor...  57.0    2e-06   
ref|XP_004149275.1|  PREDICTED: reticulon-like protein B17-like       57.0    3e-06   
gb|EMS66529.1|  Reticulon-like protein B17                            55.8    3e-06   
ref|XP_010925974.1|  PREDICTED: LOW QUALITY PROTEIN: reticulon-li...  56.6    3e-06   
ref|XP_010438456.1|  PREDICTED: reticulon-like protein B18            56.2    4e-06   
ref|XP_003573179.1|  PREDICTED: reticulon-like protein B17            55.8    5e-06   
ref|XP_009405079.1|  PREDICTED: reticulon-like protein B17            53.5    4e-05   
ref|XP_001772106.1|  predicted protein                                53.5    4e-05   
ref|XP_010070414.1|  PREDICTED: reticulon-like protein B18            50.4    7e-05   
ref|XP_010041475.1|  PREDICTED: reticulon-like protein B18 isofor...  50.8    2e-04   
ref|XP_010041465.1|  PREDICTED: reticulon-like protein B18 isofor...  50.4    3e-04   
ref|XP_010041454.1|  PREDICTED: reticulon-like protein B18 isofor...  50.4    3e-04   
ref|XP_010052231.1|  PREDICTED: reticulon-like protein B18            50.8    3e-04   
ref|XP_010037770.1|  PREDICTED: reticulon-like protein B18 isofor...  50.4    3e-04   
ref|XP_009385021.1|  PREDICTED: reticulon-like protein B21 isofor...  50.4    4e-04   



>ref|XP_009621517.1| PREDICTED: reticulon-like protein B21 [Nicotiana tomentosiformis]
Length=615

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 99/127 (78%), Gaps = 13/127 (10%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKM+KLGFFGVFIVPKVCSSYS+QLTA+GT WIRR +++WESCTHKKA+AF
Sbjct  479  ARCGSSITIWKMSKLGFFGVFIVPKVCSSYSTQLTAYGTFWIRRFRDAWESCTHKKAVAF  538

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR-----ESVGSKPVD--------SRQ  321
             IFTL WNLSS  ARIWAVFMLYV FRYYQQ LM+     E   +K  D         RQ
Sbjct  539  AIFTLVWNLSSIAARIWAVFMLYVGFRYYQQKLMKEGWVSEEETTKAEDYWQGKIGGQRQ  598

Query  322  LGRRTNL  342
            +GRR+ L
Sbjct  599  IGRRSTL  605



>ref|XP_009760122.1| PREDICTED: reticulon-like protein B21 [Nicotiana sylvestris]
Length=623

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 103/136 (76%), Gaps = 14/136 (10%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKM+KLGFFGVFIVPKVCSSYS+QLTA+GT WIRR +++WESCTHKKA+AF
Sbjct  487  ARCGSSITIWKMSKLGFFGVFIVPKVCSSYSTQLTAYGTFWIRRFRDAWESCTHKKAVAF  546

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR-----ESVGSKPVD--------SRQ  321
             IFTL WNLSS  ARIWAVFMLYV FRYYQQ LM+     E   +K  D         RQ
Sbjct  547  AIFTLVWNLSSIAARIWAVFMLYVGFRYYQQKLMKEGWVSEEETTKVEDYWQGKIGGQRQ  606

Query  322  LGRRTNLTVNANKLKK  369
            +GRR+ + V   K KK
Sbjct  607  IGRRSTM-VETRKQKK  621



>ref|XP_010323183.1| PREDICTED: reticulon-like protein B21 isoform X2 [Solanum lycopersicum]
Length=715

 Score =   182 bits (461),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 76/96 (79%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKM+KLGFFGVFIVPKVCSSYS+QLTA+GT WIRR +++WESCTHKKA+AF
Sbjct  589  ARCGSSITIWKMSKLGFFGVFIVPKVCSSYSTQLTAYGTFWIRRFRDAWESCTHKKAVAF  648

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
             IFTL WNLSS  ARIWAVF+LYV FRYYQQ +M+E
Sbjct  649  AIFTLIWNLSSISARIWAVFVLYVGFRYYQQKMMKE  684



>ref|XP_006343731.1| PREDICTED: reticulon-like protein B21-like [Solanum tuberosum]
Length=746

 Score =   181 bits (459),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 84/135 (62%), Positives = 106/135 (79%), Gaps = 11/135 (8%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKM+KLGFFGVFIVPKVCSSYS+QLTA+GT WIRR +++WESCTHKKA+AF
Sbjct  613  ARCGSSITIWKMSKLGFFGVFIVPKVCSSYSTQLTAYGTFWIRRFRDAWESCTHKKAVAF  672

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES-VGSKPVD---------SRQLGR  330
             IFTL WNLSS  ARIWAVFMLYV FRYYQQ +M+E  +G + +           R++GR
Sbjct  673  AIFTLIWNLSSISARIWAVFMLYVGFRYYQQKMMKEGWIGEEEITISEDYWQERQRRIGR  732

Query  331  RTNLTVNANKLKKPM  375
            ++  ++ + K KK +
Sbjct  733  KST-SMESKKQKKTI  746



>ref|XP_004242584.1| PREDICTED: reticulon-like protein B21 isoform X1 [Solanum lycopersicum]
Length=738

 Score =   181 bits (458),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 76/96 (79%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKM+KLGFFGVFIVPKVCSSYS+QLTA+GT WIRR +++WESCTHKKA+AF
Sbjct  612  ARCGSSITIWKMSKLGFFGVFIVPKVCSSYSTQLTAYGTFWIRRFRDAWESCTHKKAVAF  671

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
             IFTL WNLSS  ARIWAVF+LYV FRYYQQ +M+E
Sbjct  672  AIFTLIWNLSSISARIWAVFVLYVGFRYYQQKMMKE  707



>ref|XP_010265609.1| PREDICTED: reticulon-like protein B21 isoform X1 [Nelumbo nucifera]
Length=685

 Score =   176 bits (445),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 81/115 (70%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSITVWKMAKLGFFGVF VPK+CSSYS+QLT  G  WIRR +++W SC+HKKA+AF
Sbjct  556  ARCGSSITVWKMAKLGFFGVFTVPKICSSYSTQLTGCGKFWIRRFRDAWNSCSHKKAVAF  615

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPV--DSRQ--LGRR  333
            GIFTL WNLSS +ARIWAVF+L VA +YYQQSL  E  G + V  DSRQ   GRR
Sbjct  616  GIFTLVWNLSSTVARIWAVFVLIVALKYYQQSLFAEEWGREDVAGDSRQEESGRR  670



>ref|XP_002309341.2| hypothetical protein POPTR_0006s19970g [Populus trichocarpa]
 gb|EEE92864.2| hypothetical protein POPTR_0006s19970g [Populus trichocarpa]
Length=722

 Score =   174 bits (440),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 72/96 (75%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKMAKLGFFGVFIVPKVCSSYS+QLTA+G  WIRR +++WESC+HKKA+A 
Sbjct  588  ARCGSSITIWKMAKLGFFGVFIVPKVCSSYSTQLTAYGKFWIRRFRDAWESCSHKKAVAL  647

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
            GIF+L WNLSS +ARIWAVFM++VA RYYQQ++ R+
Sbjct  648  GIFSLVWNLSSMVARIWAVFMMFVAVRYYQQTMERD  683



>gb|EYU34355.1| hypothetical protein MIMGU_mgv1a004061mg [Erythranthe guttata]
Length=546

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSITVWKMAKLGF GVF VPK+CS+YSSQLTA+GT WIRR +++WESC+HKKA+ F
Sbjct  409  ARCGSSITVWKMAKLGFIGVFTVPKICSTYSSQLTAYGTFWIRRFRDAWESCSHKKAVGF  468

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS +ARIWAVFML+VAF+YYQQSLM
Sbjct  469  ALFTLVWNLSSVVARIWAVFMLFVAFKYYQQSLM  502



>gb|EYU34356.1| hypothetical protein MIMGU_mgv1a004061mg [Erythranthe guttata]
Length=544

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSITVWKMAKLGF GVF VPK+CS+YSSQLTA+GT WIRR +++WESC+HKKA+ F
Sbjct  407  ARCGSSITVWKMAKLGFIGVFTVPKICSTYSSQLTAYGTFWIRRFRDAWESCSHKKAVGF  466

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS +ARIWAVFML+VAF+YYQQSLM
Sbjct  467  ALFTLVWNLSSVVARIWAVFMLFVAFKYYQQSLM  500



>ref|XP_011018019.1| PREDICTED: reticulon-like protein B21 isoform X1 [Populus euphratica]
Length=707

 Score =   171 bits (432),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 70/95 (74%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKMA+LGFFGVF VPKVCSSYS+QLTA+G  WIRR +++WESC+HKKA+A 
Sbjct  570  ARCGSSITIWKMARLGFFGVFTVPKVCSSYSTQLTAYGKFWIRRFRDAWESCSHKKAVAL  629

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
             IFTL WNLSS +ARIWAVFM++VA RYYQQ++ R
Sbjct  630  CIFTLVWNLSSMVARIWAVFMMFVAVRYYQQTMER  664



>ref|XP_010275780.1| PREDICTED: reticulon-like protein B21 isoform X2 [Nelumbo nucifera]
Length=689

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 71/96 (74%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSITVWKMAKLGFFGVF +PK+CSSYS+QLT +G  WIRR +++W SC HKKA+AF
Sbjct  554  ARCGSSITVWKMAKLGFFGVFTLPKICSSYSTQLTGYGKFWIRRFRDAWNSCAHKKAVAF  613

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
            GIFTL WNLSS +AR+WAVFML VAF+YYQQS++ E
Sbjct  614  GIFTLVWNLSSIVARVWAVFMLVVAFKYYQQSVIME  649



>ref|XP_010275779.1| PREDICTED: reticulon-like protein B21 isoform X1 [Nelumbo nucifera]
Length=691

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 71/96 (74%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSITVWKMAKLGFFGVF +PK+CSSYS+QLT +G  WIRR +++W SC HKKA+AF
Sbjct  556  ARCGSSITVWKMAKLGFFGVFTLPKICSSYSTQLTGYGKFWIRRFRDAWNSCAHKKAVAF  615

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
            GIFTL WNLSS +AR+WAVFML VAF+YYQQS++ E
Sbjct  616  GIFTLVWNLSSIVARVWAVFMLVVAFKYYQQSVIME  651



>ref|XP_011018020.1| PREDICTED: reticulon-like protein B21 isoform X2 [Populus euphratica]
Length=697

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 70/95 (74%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKMA+LGFFGVF VPKVCSSYS+QLTA+G  WIRR +++WESC+HKKA+A 
Sbjct  560  ARCGSSITIWKMARLGFFGVFTVPKVCSSYSTQLTAYGKFWIRRFRDAWESCSHKKAVAL  619

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
             IFTL WNLSS +ARIWAVFM++VA RYYQQ++ R
Sbjct  620  CIFTLVWNLSSMVARIWAVFMMFVAVRYYQQTMER  654



>ref|XP_011033436.1| PREDICTED: reticulon-like protein B21 isoform X1 [Populus euphratica]
Length=702

 Score =   169 bits (427),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 70/95 (74%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKMAKLGFFGVFIVPKVC SYS+QLTA+G  WIRR +++WESC+HKKA+A 
Sbjct  568  ARCGSSITIWKMAKLGFFGVFIVPKVCYSYSTQLTAYGKFWIRRFRDAWESCSHKKAVAL  627

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
            GIF+L W+LSS +ARIWAVFM++VA RYYQQ++ R
Sbjct  628  GIFSLVWHLSSMVARIWAVFMMFVAVRYYQQTMER  662



>ref|XP_011033437.1| PREDICTED: reticulon-like protein B21 isoform X2 [Populus euphratica]
Length=699

 Score =   169 bits (427),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 70/95 (74%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKMAKLGFFGVFIVPKVC SYS+QLTA+G  WIRR +++WESC+HKKA+A 
Sbjct  565  ARCGSSITIWKMAKLGFFGVFIVPKVCYSYSTQLTAYGKFWIRRFRDAWESCSHKKAVAL  624

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
            GIF+L W+LSS +ARIWAVFM++VA RYYQQ++ R
Sbjct  625  GIFSLVWHLSSMVARIWAVFMMFVAVRYYQQTMER  659



>ref|XP_002324545.2| hypothetical protein POPTR_0018s11750g [Populus trichocarpa]
 gb|EEF03110.2| hypothetical protein POPTR_0018s11750g [Populus trichocarpa]
Length=711

 Score =   168 bits (425),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 12/135 (9%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKMA+LGFFGVF VPKVCSSYS+QLTA+G  WIRR +++WESC+HKKA+A 
Sbjct  575  ARCGSSITIWKMARLGFFGVFTVPKVCSSYSTQLTAYGKFWIRRFRDAWESCSHKKAVAL  634

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES-VGSKPVDSRQ--------LGRR  333
             IFTL WNLSS +ARIWAVFM++VA RYYQQ++ R+  V  + VD+           G+R
Sbjct  635  CIFTLVWNLSSMVARIWAVFMMFVAVRYYQQTMERDDWVVEEEVDTEADGTWHGDIAGQR  694

Query  334  TN---LTVNANKLKK  369
                  +V  NK+KK
Sbjct  695  QGSGPTSVEVNKVKK  709



>ref|XP_007011951.1| Reticulon family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY29570.1| Reticulon family protein, putative isoform 1 [Theobroma cacao]
Length=716

 Score =   168 bits (425),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 70/94 (74%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKMAKLGFFGVF VPKVCSSYS QLTA+G  WIRR +++W+SCTHKKA+A 
Sbjct  581  ARCGSSITIWKMAKLGFFGVFTVPKVCSSYSHQLTAYGKFWIRRFRDAWDSCTHKKAVAV  640

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             IFTL WNLSS +ARIWA FML+VA RYYQQ ++
Sbjct  641  AIFTLVWNLSSIVARIWAAFMLFVALRYYQQKMV  674



>emb|CDP10218.1| unnamed protein product [Coffea canephora]
Length=684

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKM KLGFFGVF VPKVCSSYS+QLTA+G  WIRR +++WESC+HKKA+AF
Sbjct  545  ARCGSSITIWKMVKLGFFGVFTVPKVCSSYSTQLTAYGVFWIRRFRDAWESCSHKKAVAF  604

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
             IFTL WNLSS +ARIWAVFML+VA+RYYQ S + E
Sbjct  605  AIFTLVWNLSSIVARIWAVFMLFVAYRYYQPSFIGE  640



>gb|ACJ86231.1| unknown [Medicago truncatula]
Length=169

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 96/135 (71%), Gaps = 17/135 (13%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGS IT+WKMAK+GFFGVFIVPK+CSSYS+QLTA+   W+RR +++W+SCTHKKA+A 
Sbjct  38   ARCGSFITLWKMAKIGFFGVFIVPKICSSYSAQLTAYANFWVRRFRDAWDSCTHKKAVAL  97

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM------------RESVGSKPVDSRQL  324
            GIF L WNLSS +ARIWAVF+L+VAFRYYQQ  M             E+   +PV  +Q 
Sbjct  98   GIFGLVWNLSSVVARIWAVFVLFVAFRYYQQHYMVRDEWVEDEAGCDEAWEEEPVRQKQR  157

Query  325  GRRTNLTVNANKLKK  369
                   V  NK+KK
Sbjct  158  N-----FVATNKIKK  167



>gb|KDP38668.1| hypothetical protein JCGZ_04021 [Jatropha curcas]
Length=661

 Score =   166 bits (420),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 76/129 (59%), Positives = 96/129 (74%), Gaps = 9/129 (7%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+SIT+WKMAKLGFFGVF VPKVCSSYS+QLTA+G  WIRRL+++W+SC+HKKA+A 
Sbjct  534  ARCGTSITIWKMAKLGFFGVFTVPKVCSSYSTQLTAYGKFWIRRLRDAWDSCSHKKAVAL  593

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE------SVGSKPVDSRQLGRRTNL  342
             IFTL WNLS+ +AR+WAVFM++VA RYYQQ +  E       VG   +    +G     
Sbjct  594  AIFTLVWNLSTMVARVWAVFMMFVAVRYYQQKMESEDWAEDDDVGDDEILRHDVG---PT  650

Query  343  TVNANKLKK  369
             V  NK+KK
Sbjct  651  PVEVNKVKK  659



>ref|XP_006488206.1| PREDICTED: reticulon-like protein B21-like [Citrus sinensis]
Length=606

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKM K+GFFGVFIVPKVCSSYS+QL A+G  WIRR +++W+SC+HKKA+A 
Sbjct  456  ARCGSSITIWKMIKVGFFGVFIVPKVCSSYSTQLAAYGKFWIRRFRDAWDSCSHKKAVAV  515

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
            GIFTL WNLSS IARIWA FML+VA RYYQQS++R
Sbjct  516  GIFTLVWNLSSMIARIWAAFMLFVALRYYQQSMIR  550



>ref|XP_006424682.1| hypothetical protein CICLE_v10028046mg [Citrus clementina]
 gb|ESR37922.1| hypothetical protein CICLE_v10028046mg [Citrus clementina]
Length=607

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKM K+GFFGVFIVPKVCSSYS+QL A+G  WIRR +++W+SC+HKKA+A 
Sbjct  457  ARCGSSITIWKMIKVGFFGVFIVPKVCSSYSTQLAAYGKFWIRRFRDAWDSCSHKKAVAV  516

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
            GIFTL WNLSS IARIWA FML+VA RYYQQS++R
Sbjct  517  GIFTLVWNLSSMIARIWAAFMLFVALRYYQQSMIR  551



>ref|XP_002533975.1| hypothetical protein RCOM_0370390 [Ricinus communis]
 gb|EEF28406.1| hypothetical protein RCOM_0370390 [Ricinus communis]
Length=604

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  4    QCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAFG  183
            +CG+SIT+WKMAKLGFFGVF VPKVCSSYS+QLTA+G  WIRR +++W+SC+HKKA+A  
Sbjct  469  RCGTSITIWKMAKLGFFGVFTVPKVCSSYSTQLTAYGKFWIRRFRDAWDSCSHKKAVALA  528

Query  184  IFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
            IFTL WNLSS +AR+WAVFM+YVA RYYQQS+
Sbjct  529  IFTLVWNLSSMVARVWAVFMMYVAVRYYQQSM  560



>ref|XP_011079424.1| PREDICTED: LOW QUALITY PROTEIN: reticulon-like protein B21 [Sesamum 
indicum]
Length=559

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKMAKLGF GVF VPK CSSYSSQLTA+GT WIRR +++W SC+HKKA+ F
Sbjct  436  ARCGSSITIWKMAKLGFIGVFTVPKFCSSYSSQLTAYGTFWIRRFRDAWGSCSHKKAVGF  495

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
             +F L WNLSS +ARIWAVFML+V F+YYQQSL+R++
Sbjct  496  AVFALVWNLSSVVARIWAVFMLFVGFKYYQQSLVRDA  532



>ref|XP_010110376.1| Reticulon-like protein [Morus notabilis]
 gb|EXC26162.1| Reticulon-like protein [Morus notabilis]
Length=702

 Score =   165 bits (417),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 95/133 (71%), Gaps = 10/133 (8%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W MAKLGFFGVF VPKVCS YS Q+TA+G  W+RR +++W+SC+HKKA+  
Sbjct  417  ARCGSSITIWTMAKLGFFGVFTVPKVCSLYSRQITAYGKFWVRRFRDAWDSCSHKKAVTV  476

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR----------ESVGSKPVDSRQLGR  330
             +F L WNLSS +ARIWAVFMLYVAFRYYQQ+L+R          E    +P+  ++ G 
Sbjct  477  AVFLLVWNLSSIVARIWAVFMLYVAFRYYQQTLVRDDWVEDDAEGEETWHEPIGGQRQGH  536

Query  331  RTNLTVNANKLKK  369
             + +  N  K KK
Sbjct  537  GSIVVDNNTKQKK  549



>ref|XP_009795103.1| PREDICTED: reticulon-like protein B21 [Nicotiana sylvestris]
Length=608

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 94/122 (77%), Gaps = 8/122 (7%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GSSIT+WK++KLGFFGV ++PK CSSYS+QLT++GT  IR ++++WESCTHKKA+ F
Sbjct  477  ARYGSSITIWKLSKLGFFGVMVIPKTCSSYSTQLTSYGTFLIRYIRDAWESCTHKKAVGF  536

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDS--------RQLGRRT  336
             IFT+ WN SS IAR WAVFMLYV  RYYQQ+LM E +  K  DS        RQ+GR++
Sbjct  537  AIFTIVWNFSSIIARTWAVFMLYVGIRYYQQNLMTEDITIKADDSWQGKIREQRQVGRKS  596

Query  337  NL  342
            +L
Sbjct  597  SL  598



>gb|KCW81203.1| hypothetical protein EUGRSUZ_C02575 [Eucalyptus grandis]
Length=691

 Score =   164 bits (415),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 69/96 (72%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+SIT+WKMAK GFFG F VPKVCSSYS  +TA+G  WIRR +++W SC+HKKA+A 
Sbjct  558  ARCGNSITIWKMAKFGFFGAFTVPKVCSSYSGHITAYGKFWIRRFRDAWNSCSHKKAVAV  617

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
            GIFTL WNL S +ARIWAVFMLYVAFRYYQQ+L+ E
Sbjct  618  GIFTLVWNLCSVVARIWAVFMLYVAFRYYQQNLVIE  653



>ref|XP_007138414.1| hypothetical protein PHAVU_009G206800g [Phaseolus vulgaris]
 gb|ESW10408.1| hypothetical protein PHAVU_009G206800g [Phaseolus vulgaris]
Length=668

 Score =   163 bits (413),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 69/102 (68%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGS IT+WKM KLGFFGVF VPK+C+SYS+QLTA+G  WIRR +++W+SC+HKKA+A 
Sbjct  533  ARCGSYITIWKMIKLGFFGVFTVPKICTSYSAQLTAYGNFWIRRFRDAWDSCSHKKAVAL  592

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRESVGSK  303
            GIF L WNLSS +ARIWAVF+L+VAFRYYQQ  L+R+  G +
Sbjct  593  GIFGLVWNLSSVVARIWAVFVLFVAFRYYQQHYLVRDEWGEE  634



>ref|XP_003525913.2| PREDICTED: reticulon-like protein B21-like [Glycine max]
Length=664

 Score =   163 bits (412),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 13/135 (10%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGS ITVWKMAK GFFGVF VPK+CSSYS+QLT +G  WIRR +++W+SCTHKKA+A 
Sbjct  529  ARCGSYITVWKMAKFGFFGVFTVPKICSSYSAQLTEYGNFWIRRFRDAWDSCTHKKAVAL  588

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRESVG----------SKPVDSR-QL  324
            GIF L WNLSS +ARIWAVF+L+ AFRYYQQ  L+R+  G            PV  R + 
Sbjct  589  GIFGLVWNLSSVVARIWAVFVLFAAFRYYQQHYLVRDEWGEDEAGCDETWQDPVGVRPKQ  648

Query  325  GRRTNLTVNANKLKK  369
            G  TN + + NK+KK
Sbjct  649  GPATNFS-DTNKIKK  662



>gb|KHN11130.1| Reticulon-like protein B21 [Glycine soja]
Length=664

 Score =   163 bits (412),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 13/135 (10%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGS ITVWKMAK GFFGVF VPK+CSSYS+QLT +G  WIRR +++W+SCTHKKA+A 
Sbjct  529  ARCGSYITVWKMAKFGFFGVFTVPKICSSYSAQLTEYGNFWIRRFRDAWDSCTHKKAVAL  588

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRESVG----------SKPVDSR-QL  324
            GIF L WNLSS +ARIWAVF+L+ AFRYYQQ  L+R+  G            PV  R + 
Sbjct  589  GIFGLVWNLSSVVARIWAVFVLFAAFRYYQQHYLVRDEWGEDEAGCDETWQDPVGVRPKQ  648

Query  325  GRRTNLTVNANKLKK  369
            G  TN + + NK+KK
Sbjct  649  GPATNFS-DTNKIKK  662



>ref|XP_010048815.1| PREDICTED: reticulon-like protein B21 [Eucalyptus grandis]
Length=693

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+SIT+WKMAK GFFG F VPKVCSSYS  +TA+G  WIRR +++W SC+HKKA+A 
Sbjct  560  ARCGNSITIWKMAKFGFFGAFTVPKVCSSYSGHITAYGKFWIRRFRDAWNSCSHKKAVAV  619

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
            GIFTL WNL S +ARIWAVFMLYVAFRYYQQ+L+ E 
Sbjct  620  GIFTLVWNLCSVVARIWAVFMLYVAFRYYQQNLVIED  656



>ref|XP_004251753.1| PREDICTED: reticulon-like protein B21 [Solanum lycopersicum]
Length=653

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 98/130 (75%), Gaps = 8/130 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G+ IT+WK+ KLGFFGVF++PKVCSSYS+QLT+ GT +IR ++++WESCTHKKAI F
Sbjct  523  AKFGNYITIWKLYKLGFFGVFVIPKVCSSYSTQLTSHGTFFIRYIRDAWESCTHKKAIGF  582

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES-------VGSKPVDSRQLGRRTN  339
             IFTL WN SS IARIWAVFMLYV FRYY Q+LMRE        +  K    +Q+G+++N
Sbjct  583  AIFTLVWNFSSIIARIWAVFMLYVGFRYYHQTLMREDTINSDDFLQGKISGLKQIGKKSN  642

Query  340  LTVNANKLKK  369
              ++  K KK
Sbjct  643  F-MDTRKQKK  651



>gb|KEH38077.1| reticulon-like protein B2 [Medicago truncatula]
Length=576

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGS IT+WKMAK+GFFGVFIVPK+CSSYS+QLTA+   W+RR +++W+SCTHKKA+A 
Sbjct  445  ARCGSFITLWKMAKIGFFGVFIVPKICSSYSAQLTAYANFWVRRFRDAWDSCTHKKAVAL  504

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
            GIF L WNLSS +ARIWAVF+L+VAFRYYQQ  M
Sbjct  505  GIFGLVWNLSSVVARIWAVFVLFVAFRYYQQHYM  538



>ref|XP_009587028.1| PREDICTED: reticulon-like protein B21 isoform X2 [Nicotiana tomentosiformis]
Length=595

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 95/122 (78%), Gaps = 8/122 (7%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS IT+WK++KLGFFGV ++PK+CSSYS+QL ++GT + R ++++WESC+HKKA+ F
Sbjct  464  ARYGSFITIWKLSKLGFFGVMVIPKICSSYSTQLASYGTFFTRCVRDAWESCSHKKAVGF  523

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDS--------RQLGRRT  336
             IFTL WN SS IARIWAVFMLYV FRYYQQ+L+ E +  K  DS        RQ+GR++
Sbjct  524  AIFTLVWNFSSIIARIWAVFMLYVGFRYYQQTLITEDITIKADDSWQGKIREQRQIGRKS  583

Query  337  NL  342
            +L
Sbjct  584  SL  585



>ref|XP_009587027.1| PREDICTED: reticulon-like protein B21 isoform X1 [Nicotiana tomentosiformis]
Length=606

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 95/122 (78%), Gaps = 8/122 (7%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS IT+WK++KLGFFGV ++PK+CSSYS+QL ++GT + R ++++WESC+HKKA+ F
Sbjct  475  ARYGSFITIWKLSKLGFFGVMVIPKICSSYSTQLASYGTFFTRCVRDAWESCSHKKAVGF  534

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDS--------RQLGRRT  336
             IFTL WN SS IARIWAVFMLYV FRYYQQ+L+ E +  K  DS        RQ+GR++
Sbjct  535  AIFTLVWNFSSIIARIWAVFMLYVGFRYYQQTLITEDITIKADDSWQGKIREQRQIGRKS  594

Query  337  NL  342
            +L
Sbjct  595  SL  596



>ref|XP_010687720.1| PREDICTED: reticulon-like protein B21 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=649

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKM KLGFFGVF++PK+CSSYSS +TA+G  W+RR +++WESC+HKKA+AF
Sbjct  514  ARCGSSITIWKMMKLGFFGVFVIPKLCSSYSSHVTAYGKFWVRRFQDAWESCSHKKALAF  573

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
             IFTL WN SS +AR WA F+L+VAFRYYQQSL  + 
Sbjct  574  TIFTLVWNYSSVVARAWAAFILFVAFRYYQQSLTTDD  610



>ref|XP_004514755.1| PREDICTED: reticulon-like protein B21-like [Cicer arietinum]
Length=567

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGS IT WKMAK GFFGVFIVPK+CSSYS+QLTA+   WIRR +++W+SCTHKKA+A 
Sbjct  437  ARCGSFITSWKMAKFGFFGVFIVPKICSSYSAQLTAYAKFWIRRFRDAWDSCTHKKAVAL  496

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
            GIF L WNLSS +ARIWAVF+L+VAFRYYQQ  M
Sbjct  497  GIFGLVWNLSSVVARIWAVFVLFVAFRYYQQHYM  530



>ref|XP_006600546.1| PREDICTED: reticulon-like protein B21-like isoform X1 [Glycine 
max]
 gb|KHN18320.1| Reticulon-like protein B21 [Glycine soja]
Length=609

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGS IT+WKMAK GFFGVF VPK+CSSYS+QLTAF   WIRR +++W+SC+HKKA+A 
Sbjct  471  ARCGSYITIWKMAKFGFFGVFTVPKICSSYSAQLTAFANFWIRRFRDAWDSCSHKKAVAL  530

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRESV  294
            GIF L WNLSS +ARIW+VF+L+VAFRYYQQ  L+RE +
Sbjct  531  GIFGLVWNLSSVVARIWSVFVLFVAFRYYQQHYLVREEL  569



>ref|XP_011084045.1| PREDICTED: reticulon-like protein B21 [Sesamum indicum]
Length=541

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G SIT+WKMAKLGFFGVF VPKVCSSYSSQLTA+GT WI R+   WESC+HKKA+ F
Sbjct  408  ARYGGSITIWKMAKLGFFGVFTVPKVCSSYSSQLTAYGTFWIGRVGERWESCSHKKAVGF  467

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
            G+FTL WNLSS +ARIWAVF+L+VAF+YY Q
Sbjct  468  GVFTLVWNLSSVVARIWAVFVLFVAFKYYHQ  498



>ref|XP_006350096.1| PREDICTED: reticulon-like protein B21-like [Solanum tuberosum]
Length=644

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 97/133 (73%), Gaps = 11/133 (8%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS IT+WK+ KLGFFGVF +PKVCSSYS+QLT+ GT +IR ++++WESCTHKKAI F
Sbjct  511  AKFGSYITIWKLYKLGFFGVFFIPKVCSSYSTQLTSHGTFFIRYIRDAWESCTHKKAIGF  570

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS----------KPVDSRQLGR  330
             IFTL WN SS IARIWAVFMLYV   YYQQ+LMR+   +          K  + RQ+G+
Sbjct  571  AIFTLVWNFSSIIARIWAVFMLYVGLWYYQQTLMRQDTTTTINGDDFLQGKIREQRQVGK  630

Query  331  RTNLTVNANKLKK  369
            ++N  ++  K KK
Sbjct  631  KSNF-MDTRKQKK  642



>gb|KHN42814.1| Reticulon-like protein B21 [Glycine soja]
Length=608

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKMAK GFFGVF  PK+CSSYS+QLTAF   WIRR +++W SC+HKKA+A 
Sbjct  470  ARCGSSITIWKMAKFGFFGVFTGPKICSSYSAQLTAFANFWIRRFRDAWVSCSHKKAVAL  529

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRE  288
            GIF L WNLSS +ARIW+VF+L+VAFRYYQQ  L+R+
Sbjct  530  GIFGLVWNLSSVVARIWSVFVLFVAFRYYQQHYLVRD  566



>ref|XP_003518216.1| PREDICTED: reticulon-like protein B21-like [Glycine max]
Length=608

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKMAK GFFGVF  PK+CSSYS+QLTAF   WIRR +++W SC+HKKA+A 
Sbjct  470  ARCGSSITIWKMAKFGFFGVFTGPKICSSYSAQLTAFANFWIRRFRDAWVSCSHKKAVAL  529

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRE  288
            GIF L WNLSS +ARIW+VF+L+VAFRYYQQ  L+R+
Sbjct  530  GIFGLVWNLSSVVARIWSVFVLFVAFRYYQQHYLVRD  566



>ref|XP_008443867.1| PREDICTED: reticulon-like protein B21 [Cucumis melo]
Length=554

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSITVWK+AK GFFGVF +PK+CSSYSS L A+   W+RR +++WESC+HKK +A 
Sbjct  413  ARCGSSITVWKVAKWGFFGVFTLPKICSSYSSHLAAYAKFWVRRFRDAWESCSHKKGVAL  472

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESV-GSKPVDSRQLGRRT  336
             IF L WNLSS +AR+WA FML+VAFRYYQQS+  E   G +     + G  T
Sbjct  473  AIFVLVWNLSSVVARVWAAFMLFVAFRYYQQSIQTEEYWGDEDDQVEEEGDET  525



>ref|XP_008242972.1| PREDICTED: reticulon-like protein B21 [Prunus mume]
Length=670

 Score =   150 bits (380),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W M+K+GFFGVF +PKVCS YS+QLT +   WIRR +++WESCTHKKA+  
Sbjct  522  ARCGSSITIWTMSKVGFFGVFTLPKVCSLYSAQLTVYAKFWIRRFRDAWESCTHKKALTV  581

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             IF L WNLSS +ARIWA F+L VAFRYYQQ L+
Sbjct  582  AIFLLVWNLSSVVARIWAAFILVVAFRYYQQKLV  615



>ref|XP_010545877.1| PREDICTED: reticulon-like protein B21 [Tarenaya hassleriana]
Length=605

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKM KLGFF +F VPK+ +SYS+ LTA+   W+RR +++WESCTHKKA+A 
Sbjct  455  ARCGSSITIWKMTKLGFFIIFTVPKIFTSYSACLTAYAQFWVRRFRDAWESCTHKKAVAL  514

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             IFTL WNLSS +AR+WAVF+LYVA RYYQQ++M
Sbjct  515  AIFTLVWNLSSVVARVWAVFILYVALRYYQQTIM  548



>ref|XP_004146687.1| PREDICTED: reticulon-like protein B21-like [Cucumis sativus]
 gb|KGN65248.1| hypothetical protein Csa_1G269900 [Cucumis sativus]
Length=555

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSITVWK+AK GFFGVF +PK+CSSYSS L A+   WIRR +++WESC+HKK +A 
Sbjct  413  ARCGSSITVWKVAKWGFFGVFTLPKICSSYSSHLAAYAKFWIRRFRDAWESCSHKKGVAL  472

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
             IF L WNLSS +AR+WA FML+VAFRYYQQS+
Sbjct  473  AIFVLVWNLSSVVARVWAAFMLFVAFRYYQQSI  505



>ref|XP_004161870.1| PREDICTED: reticulon-like protein B21-like [Cucumis sativus]
Length=555

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSITVWK+AK GFFGVF +PK+CSSYSS L A+   WIRR +++WESC+HKK +A 
Sbjct  413  ARCGSSITVWKVAKWGFFGVFTLPKICSSYSSHLAAYAKFWIRRFRDAWESCSHKKGVAL  472

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
             IF L WNLSS +AR+WA FML+VAFRYYQQS+
Sbjct  473  AIFVLVWNLSSVVARVWAAFMLFVAFRYYQQSI  505



>ref|XP_007203773.1| hypothetical protein PRUPE_ppa002580mg [Prunus persica]
 gb|EMJ04972.1| hypothetical protein PRUPE_ppa002580mg [Prunus persica]
Length=656

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W M+K+GFFGVF +PKVCS YS+QLT +   WIRR +++WESCTHKKA+  
Sbjct  510  ARCGSSITIWTMSKVGFFGVFTLPKVCSLYSAQLTVYAKFWIRRFRDAWESCTHKKALTV  569

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
             IF L WNLSS +ARIWA F+L VAFRYYQQ L+ E 
Sbjct  570  AIFLLVWNLSSVVARIWAAFILVVAFRYYQQKLVTEE  606



>ref|XP_009358457.1| PREDICTED: reticulon-like protein B21 isoform X1 [Pyrus x bretschneideri]
Length=749

 Score =   149 bits (376),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W M K+GFFGVF VPK+CS YS+Q+T +   W+RR +++WESCTHKK +  
Sbjct  614  ARCGSSITIWTMCKVGFFGVFTVPKLCSLYSAQITVYAKFWVRRFRDAWESCTHKKPLTI  673

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDS  315
             +F L WNLSS +ARIWA F+L VAFRYYQQ L+ E    +  D+
Sbjct  674  AVFLLVWNLSSVVARIWAAFILLVAFRYYQQKLVAEEWAEESDDT  718



>ref|XP_009358458.1| PREDICTED: reticulon-like protein B21 isoform X2 [Pyrus x bretschneideri]
Length=710

 Score =   149 bits (375),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W M K+GFFGVF VPK+CS YS+Q+T +   W+RR +++WESCTHKK +  
Sbjct  575  ARCGSSITIWTMCKVGFFGVFTVPKLCSLYSAQITVYAKFWVRRFRDAWESCTHKKPLTI  634

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDS  315
             +F L WNLSS +ARIWA F+L VAFRYYQQ L+ E    +  D+
Sbjct  635  AVFLLVWNLSSVVARIWAAFILLVAFRYYQQKLVAEEWAEESDDT  679



>ref|XP_004288712.1| PREDICTED: reticulon-like protein B21-like [Fragaria vesca subsp. 
vesca]
Length=671

 Score =   148 bits (373),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W MAK+GFFGVF VPKVCS YS+Q+T +   W+RR +++W+SCTHK+A+  
Sbjct  539  ARCGSSITIWTMAKVGFFGVFTVPKVCSLYSTQITIYAKFWVRRFRDAWDSCTHKRAVTI  598

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
             IF L WNLSS  ARIWA F+L VAFRYYQQ L+ E
Sbjct  599  AIFLLVWNLSSVGARIWAAFILVVAFRYYQQKLVAE  634



>emb|CDY55012.1| BnaA10g29370D [Brassica napus]
Length=567

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 90/144 (63%), Gaps = 24/144 (17%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK GF G F VPK+  SYS+  +A+G  W+RR +++WESC+HKKA+A 
Sbjct  425  ARCGSSITLWNLAKFGFLGAFTVPKIFISYSTHFSAYGKFWMRRFRDAWESCSHKKAVAL  484

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM---------------------RESVG  297
             +FTL WNLSS +AR+WA FML+VAFRYYQQ ++                      E + 
Sbjct  485  ALFTLVWNLSSVVARVWAAFMLFVAFRYYQQKMIWTTDQEDDLDDEEHVDDDHVGEEELV  544

Query  298  SKPVDSRQLGRRTNLTVNANKLKK  369
             KP+      +R   T+  NKLKK
Sbjct  545  PKPI---HKPKRATYTMMPNKLKK  565



>ref|XP_010930926.1| PREDICTED: reticulon-like protein B21 isoform X2 [Elaeis guineensis]
Length=517

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG SIT+W  AKL FFGVF +PKV SSYS+QL  +G  W+ R+++ WESCTHKKA+A 
Sbjct  377  ARCGGSITIWTTAKLVFFGVFTIPKVYSSYSTQLARYGKFWLERIRDGWESCTHKKAVAA  436

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQLGRRTNLTVN  351
             IFTL WNLSSA+ARIWAVFML VAF++YQQ ++ E  G + V   +    + L  N
Sbjct  437  AIFTLIWNLSSAVARIWAVFMLVVAFKFYQQCIVDEWSGQEDVGVEEGQEDSKLGQN  493



>ref|XP_010930925.1| PREDICTED: reticulon-like protein B21 isoform X1 [Elaeis guineensis]
Length=518

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG SIT+W  AKL FFGVF +PKV SSYS+QL  +G  W+ R+++ WESCTHKKA+A 
Sbjct  378  ARCGGSITIWTTAKLVFFGVFTIPKVYSSYSTQLARYGKFWLERIRDGWESCTHKKAVAA  437

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQLGRRTNLTVN  351
             IFTL WNLSSA+ARIWAVFML VAF++YQQ ++ E  G + V   +    + L  N
Sbjct  438  AIFTLIWNLSSAVARIWAVFMLVVAFKFYQQCIVDEWSGQEDVGVEEGQEDSKLGQN  494



>ref|XP_009395289.1| PREDICTED: reticulon-like protein B21 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=589

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+SIT+W +++L FFGVF VPK+CSSYS+QL  +G  W+ R+++ WESC+HKKA+A 
Sbjct  446  ARCGNSITIWTLSRLSFFGVFTVPKICSSYSTQLAKYGNFWVERIRDGWESCSHKKAVAA  505

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
             IFTL WN+SS +ARIWAVFML VA +YYQQ +  E
Sbjct  506  AIFTLIWNISSTVARIWAVFMLVVAVKYYQQCVAEE  541



>ref|XP_009395290.1| PREDICTED: reticulon-like protein B21 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=568

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+SIT+W +++L FFGVF VPK+CSSYS+QL  +G  W+ R+++ WESC+HKKA+A 
Sbjct  425  ARCGNSITIWTLSRLSFFGVFTVPKICSSYSTQLAKYGNFWVERIRDGWESCSHKKAVAA  484

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
             IFTL WN+SS +ARIWAVFML VA +YYQQ +  E
Sbjct  485  AIFTLIWNISSTVARIWAVFMLVVAVKYYQQCVAEE  520



>ref|XP_006401142.1| hypothetical protein EUTSA_v10013006mg [Eutrema salsugineum]
 gb|ESQ42595.1| hypothetical protein EUTSA_v10013006mg [Eutrema salsugineum]
Length=608

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK+GFFG F VPK+  SYS+  +A+G  W RR +++WESCTHKKA+A 
Sbjct  464  ARCGSSITLWNLAKIGFFGAFTVPKIFISYSTHFSAYGKFWFRRFRDAWESCTHKKAVAL  523

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS +AR+WA FML+VA RYYQQ+++
Sbjct  524  ALFTLVWNLSSVVARVWAAFMLFVALRYYQQNMI  557



>emb|CDY57466.1| BnaC09g33520D [Brassica napus]
Length=586

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK GF G F VPK+  SYS+  +A+G  W+RR +++WESC HKKA+A 
Sbjct  445  ARCGSSITLWNLAKFGFLGAFTVPKIFISYSTHFSAYGNFWVRRFRDAWESCNHKKAVAL  504

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS +AR+WA FML+VAFRYYQQ ++
Sbjct  505  ALFTLVWNLSSVVARVWAAFMLFVAFRYYQQKMI  538



>gb|EEE68393.1| hypothetical protein OsJ_26729 [Oryza sativa Japonica Group]
Length=673

 Score =   144 bits (363),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFGVFI+PKVCSSYS+QL  +G  W+ R ++ WESC+HKKA+  
Sbjct  502  ARCGNFVTLWTLAKLVFFGVFIIPKVCSSYSTQLARYGRFWLERFRDGWESCSHKKAVVA  561

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQ  321
             +FTL WN+SS +AR+WAVFML VA + YQQ +M     S   DS++
Sbjct  562  AVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMMEYGWSSTVEDSQE  608



>ref|XP_009120314.1| PREDICTED: reticulon-like protein B21 [Brassica rapa]
 ref|XP_009120315.1| PREDICTED: reticulon-like protein B21 [Brassica rapa]
Length=580

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK GF G F VPK+  SYS+  +A+G  W+RR +++WESC+HKKA+A 
Sbjct  438  ARCGSSITLWNLAKFGFLGAFTVPKIFISYSTHFSAYGKFWMRRFRDAWESCSHKKAVAL  497

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS +AR+WA FML+VAFRYYQQ ++
Sbjct  498  ALFTLVWNLSSVVARVWAAFMLFVAFRYYQQKMI  531



>gb|EEC83262.1| hypothetical protein OsI_28591 [Oryza sativa Indica Group]
Length=740

 Score =   144 bits (364),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFGVFI+PKVCSSYS+QL  +G  W+ R ++ WESC+HKKA+  
Sbjct  569  ARCGNFVTLWTLAKLVFFGVFIIPKVCSSYSTQLARYGRFWLERFRDGWESCSHKKAVVA  628

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQ  321
             +FTL WN+SS +AR+WAVFML VA + YQQ +M     S   DS++
Sbjct  629  AVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMMEYGWSSTVEDSQE  675



>gb|KDO73071.1| hypothetical protein CISIN_1g0072731mg, partial [Citrus sinensis]
Length=135

 Score =   134 bits (337),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  49   FFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARI  228
            FFGVFIVPKVCSSYS+QL A+G  WIRR +++W+SC+HKKA+A GIFTL WNLSS IARI
Sbjct  1    FFGVFIVPKVCSSYSTQLAAYGKFWIRRFRDAWDSCSHKKAVAVGIFTLVWNLSSMIARI  60

Query  229  WAVFMLYVAFRYYQQSLMR  285
            WA FML+VA RYYQQS++R
Sbjct  61   WAAFMLFVALRYYQQSMIR  79



>ref|NP_001061443.1| Os08g0280600 [Oryza sativa Japonica Group]
 dbj|BAC99407.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23357.1| Os08g0280600 [Oryza sativa Japonica Group]
Length=182

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFGVFI+PKVCSSYS+QL  +G  W+ R ++ WESC+HKKA+  
Sbjct  11   ARCGNFVTLWTLAKLVFFGVFIIPKVCSSYSTQLARYGRFWLERFRDGWESCSHKKAVVA  70

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQ  321
             +FTL WN+SS +AR+WAVFML VA + YQQ +M     S   DS++
Sbjct  71   AVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMMEYGWSSTVEDSQE  117



>ref|XP_006424681.1| hypothetical protein CICLE_v10028046mg [Citrus clementina]
 gb|ESR37921.1| hypothetical protein CICLE_v10028046mg [Citrus clementina]
Length=539

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+WKM K+GFFGVFIVPKVCSSYS+QL A+G  WIRR +++W+SC+HKKA+A 
Sbjct  457  ARCGSSITIWKMIKVGFFGVFIVPKVCSSYSTQLAAYGKFWIRRFRDAWDSCSHKKAVAV  516

Query  181  GIFTLAWNLSSAIARIWAVF  240
            GIFTL WNLSS IARIWAV+
Sbjct  517  GIFTLVWNLSSMIARIWAVY  536



>ref|XP_006659255.1| PREDICTED: reticulon-like protein B21-like [Oryza brachyantha]
Length=467

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFGVFI+PKVCSSYS+QL  +G  W+ RL++ WESC+HKKA+  
Sbjct  303  ARCGNFVTLWTLAKLVFFGVFIIPKVCSSYSTQLARYGRFWLERLRDGWESCSHKKAVVA  362

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
             +FTL WN+SS +AR+WAVFML VA + YQQ +M 
Sbjct  363  AVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMME  397



>ref|XP_010453049.1| PREDICTED: reticulon-like protein B21 [Camelina sativa]
Length=591

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK GF G F +PK+  SYS+  +A+G  WIRR +++WESC HKKA+A 
Sbjct  446  ARCGSSITLWNLAKFGFLGAFTMPKIFISYSTHFSAYGNFWIRRFRDAWESCNHKKAVAL  505

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS  AR+WA FML+VA RYYQQ+++
Sbjct  506  ALFTLVWNLSSVTARVWAAFMLFVALRYYQQNMI  539



>ref|XP_010443510.1| PREDICTED: reticulon-like protein B21 [Camelina sativa]
Length=633

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK GF G F +PK+  SYS+  +A+G  WIRR +++WESC HKKA+A 
Sbjct  491  ARCGSSITLWNLAKFGFLGAFTMPKIFISYSTHFSAYGNFWIRRFRDAWESCNHKKAVAL  550

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS  AR+WA FML+VA RYYQQ+++
Sbjct  551  ALFTLVWNLSSVTARVWAAFMLFVALRYYQQNMI  584



>ref|XP_010483359.1| PREDICTED: reticulon-like protein B21 [Camelina sativa]
Length=590

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK GF G F +PK+  SYS+  +A+G  WIRR +++WESC HKKA+A 
Sbjct  447  ARCGSSITLWNLAKFGFLGAFTMPKIFISYSTHFSAYGNFWIRRFRDAWESCNHKKAVAL  506

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS  AR+WA FML+VA RYYQQ+++
Sbjct  507  ALFTLVWNLSSVTARVWAAFMLFVALRYYQQNMV  540



>ref|XP_006279606.1| hypothetical protein CARUB_v10026138mg [Capsella rubella]
 gb|EOA12504.1| hypothetical protein CARUB_v10026138mg [Capsella rubella]
Length=586

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK GF G F VPK+  SYS+  +A+G  W+RR +++WESC HKKA+A 
Sbjct  445  ARCGSSITLWNLAKFGFLGAFTVPKIFISYSTHFSAYGNFWMRRFRDAWESCNHKKAVAL  504

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS  AR+WA FML+VA RYYQQ ++
Sbjct  505  ALFTLVWNLSSVTARVWAAFMLFVALRYYQQKMI  538



>ref|XP_009385004.1| PREDICTED: reticulon-like protein B21 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385013.1| PREDICTED: reticulon-like protein B21 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=503

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AKL FFGVF +PK+CSSYS+QL  FG  W+ RL + WESCTHKKA+A 
Sbjct  355  ARCGSSITIWSLAKLMFFGVFTIPKICSSYSTQLAKFGKFWLERLGDGWESCTHKKAVAT  414

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             IF L WN+SS +ARIWA FM+ VA + YQQ
Sbjct  415  AIFALVWNISSTVARIWAFFMVVVAVKLYQQ  445



>ref|XP_002445424.1| hypothetical protein SORBIDRAFT_07g018020 [Sorghum bicolor]
 gb|EES14919.1| hypothetical protein SORBIDRAFT_07g018020 [Sorghum bicolor]
Length=591

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ IT+W +AKL FFGVFI+PKVCSSYS+QL  +G  W+ RL+++WESC+HKKA+  
Sbjct  431  ARCGNFITLWTLAKLVFFGVFIIPKVCSSYSTQLARYGKFWLERLRDAWESCSHKKAVVA  490

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WN+SS +AR+WAVFML VA + YQQ ++
Sbjct  491  AVFTLVWNVSSTVARVWAVFMLVVAIKCYQQRMV  524



>ref|XP_007149094.1| hypothetical protein PHAVU_005G040700g [Phaseolus vulgaris]
 gb|ESW21088.1| hypothetical protein PHAVU_005G040700g [Phaseolus vulgaris]
Length=613

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W MAK  FFG F VP+VCS+YS+QLT F   WI R +++W+SC+HKK +A 
Sbjct  475  ARCGSSITIWNMAKFCFFGFFTVPRVCSTYSAQLTTFANFWIGRFRDAWDSCSHKKLVAL  534

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRES  291
             IF L WNLSS +AR+W+VF+L+VAFRYYQQ  L+R+ 
Sbjct  535  AIFGLVWNLSSFVARVWSVFVLFVAFRYYQQHYLVRDE  572



>dbj|BAD93974.1| putative protein [Arabidopsis thaliana]
Length=487

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK GF G F +PK+  SYS+  +A+G  W+RR +++WESC HKKA+A 
Sbjct  348  ARCGSSITLWNLAKFGFLGAFTIPKIFISYSTHFSAYGNFWMRRFRDAWESCNHKKAVAL  407

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS  AR+WA FML VAFRYYQ  ++
Sbjct  408  ALFTLVWNLSSVTARVWAAFMLLVAFRYYQHKMI  441



>ref|NP_200608.3| reticulon-like protein B21 [Arabidopsis thaliana]
 sp|Q56X72.2|RTNLS_ARATH RecName: Full=Reticulon-like protein B21; Short=AtRTNLB21 [Arabidopsis 
thaliana]
 gb|AED96983.1| reticulon-like protein B21 [Arabidopsis thaliana]
Length=487

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK GF G F +PK+  SYS+  +A+G  W+RR +++WESC HKKA+A 
Sbjct  348  ARCGSSITLWNLAKFGFLGAFTIPKIFISYSTHFSAYGNFWMRRFRDAWESCNHKKAVAL  407

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS  AR+WA FML VAFRYYQ  ++
Sbjct  408  ALFTLVWNLSSVTARVWAAFMLLVAFRYYQHKMI  441



>emb|CDM82451.1| unnamed protein product [Triticum aestivum]
Length=576

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFG+F +PKVCSSYS+QL  +G  W+ R +++WESC+HKKA+  
Sbjct  412  ARCGNFVTLWTLAKLVFFGIFTIPKVCSSYSTQLARYGKFWLERFRDAWESCSHKKAVVA  471

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WN+SS +AR+WAVFML VA + YQQ LM
Sbjct  472  AVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRLM  505



>ref|XP_010234545.1| PREDICTED: reticulon-like protein B21 [Brachypodium distachyon]
Length=618

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFG+FI+PKVCSSYS+QL  +G  W+ R +++WESC+HKKA+  
Sbjct  458  ARCGNFVTLWTLAKLVFFGIFIIPKVCSSYSTQLARYGKFWLERFRDAWESCSHKKAVVA  517

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WN+SS +AR+WAVFML VA + YQQ +M
Sbjct  518  AMFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMM  551



>gb|EMS49286.1| Reticulon-like protein B21 [Triticum urartu]
Length=694

 Score =   136 bits (343),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFG+F +PKVCSSYS+QL  +G  W+ R +++WESC+HKKA+  
Sbjct  451  ARCGNFVTLWTLAKLVFFGIFTIPKVCSSYSTQLARYGKFWLERFRDAWESCSHKKAVVA  510

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WN+SS +AR+WAVFML VA + YQQ +M
Sbjct  511  AVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMM  544



>emb|CDY02784.1| BnaC02g11050D [Brassica napus]
Length=497

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G SIT+W +AK GF G F VPK+  SYS+  +A+G  W+RR K++WE+C HKKA+A 
Sbjct  351  ARWGPSITLWNLAKFGFLGAFTVPKIFISYSTHFSAYGIFWLRRFKDAWETCNHKKAVAL  410

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS +AR+WA FML+VAFRYYQQ ++
Sbjct  411  ALFTLVWNLSSVVARVWAAFMLFVAFRYYQQKMI  444



>emb|CDY32734.1| BnaA02g07960D [Brassica napus]
Length=564

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GSSIT+W +AK GF G F VPK+  SYS+  +A+G  W+RR +++WE+C HKKA+A 
Sbjct  424  ARWGSSITLWNLAKFGFLGAFTVPKIFISYSTHFSAYGIFWLRRFRDAWETCNHKKAVAL  483

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS +AR+WA FML+VAFRYYQQ ++
Sbjct  484  ALFTLVWNLSSVVARVWAAFMLFVAFRYYQQKMI  517



>ref|XP_009126799.1| PREDICTED: reticulon-like protein B21 [Brassica rapa]
Length=558

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G SIT+W +AK GF G F VPK+  SYS+  +A+G  W+RR K++WE+C HKKA+A 
Sbjct  419  ARWGPSITLWNLAKFGFLGAFTVPKIFISYSTHFSAYGIFWLRRFKDAWETCNHKKAVAL  478

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS +AR+WA FML+VAFRYYQQ+++
Sbjct  479  ALFTLVWNLSSVVARVWAAFMLFVAFRYYQQNMI  512



>dbj|BAK07265.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=606

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFG+F +PKVCSSYS+QL  +G  W+ R +++WESC+HKKA+  
Sbjct  442  ARCGNFVTLWTLAKLVFFGIFTIPKVCSSYSTQLARYGKFWLERFRDAWESCSHKKAVVA  501

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WN+SS +AR+WAVFML VA + YQQ +M
Sbjct  502  AVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMM  535



>ref|XP_008802355.1| PREDICTED: reticulon-like protein B21 [Phoenix dactylifera]
Length=526

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+SIT W +AKL FFGVF +PKV S+YS QL  +G  W+ R ++ WE+CTHKKA+A 
Sbjct  386  ARCGASITTWTLAKLVFFGVFTIPKVYSTYSIQLAKYGKFWLERFRDGWETCTHKKAVAA  445

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
             IFTL WN+SS +ARIWAVFML VA ++YQQ +  E
Sbjct  446  AIFTLVWNISSTVARIWAVFMLVVAVKFYQQHVADE  481



>gb|EMT20841.1| Reticulon-like protein B21 [Aegilops tauschii]
Length=431

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFG+F +PKVCSSYS+QL  +G  W+ R +++WESC+HKKA+  
Sbjct  267  ARCGNFVTLWTLAKLVFFGIFTIPKVCSSYSTQLARYGKFWLERFRDAWESCSHKKAVVA  326

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
             +FTL WN+SS +AR+WAVFML VA + YQQ +M 
Sbjct  327  AVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMME  361



>ref|XP_004973157.1| PREDICTED: reticulon-like protein B21-like [Setaria italica]
Length=651

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFGVFI+PKVC+SYS+QL  +G  W+ R  ++WESC+HKKA+  
Sbjct  483  ARCGNFVTLWTLAKLVFFGVFIIPKVCASYSTQLARYGKFWLERFSDAWESCSHKKAVVA  542

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WN+SS +AR+WAVFML VA + YQQ ++
Sbjct  543  AVFTLVWNVSSTVARVWAVFMLVVAMKLYQQRMV  576



>ref|XP_010912152.1| PREDICTED: reticulon-like protein B21 isoform X1 [Elaeis guineensis]
Length=536

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG SIT+W +AKL FFGVF +PKV S+YS+QL  +G  W+ R ++ WE+CTHKKA+A 
Sbjct  396  ARCGGSITIWTLAKLVFFGVFTIPKVYSTYSTQLAKYGKFWLERFRDGWETCTHKKAVAA  455

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPV  309
             +FTL WNLSS +ARIWAVFML V  + YQQ +  E  G + V
Sbjct  456  AMFTLIWNLSSTVARIWAVFMLVVVVKCYQQHVADEWNGQEEV  498



>ref|XP_009396755.1| PREDICTED: reticulon-like protein B21 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=491

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGS+ITVW +AKL FFGVF +PKVCSSYS+QL   G  W+ RL++ WESCTHK+A A 
Sbjct  336  ARCGSTITVWSLAKLIFFGVFTIPKVCSSYSTQLAKLGKFWLDRLRDGWESCTHKRAAAA  395

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             IF L WN+SSA+ARIWA FML VA + YQQ
Sbjct  396  AIFALIWNISSAVARIWAFFMLVVAVKLYQQ  426



>ref|XP_006857216.1| hypothetical protein AMTR_s00065p00202980 [Amborella trichopoda]
 gb|ERN18683.1| hypothetical protein AMTR_s00065p00202980 [Amborella trichopoda]
Length=596

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +A++ FFG+F +PKV SSYS QL+ +G  W RR +++W SC+HKKA+A 
Sbjct  453  ARCGSSITIWTLARIAFFGLFTIPKVYSSYSVQLSKYGRFWFRRFRDAWNSCSHKKAVAI  512

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
              F + WNLSS +ARIWA F+L VA RYYQQSL+
Sbjct  513  AAFMVIWNLSSVVARIWAAFILIVAVRYYQQSLI  546



>ref|XP_008790667.1| PREDICTED: reticulon-like protein B21 [Phoenix dactylifera]
Length=533

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG SIT+W +AKL FFGVF +P+  SS+S+QL  +G  W+ R ++ WESCTHKKA+  
Sbjct  396  ARCGGSITIWTLAKLVFFGVFTIPRAYSSHSTQLAKYGKFWLERTRDGWESCTHKKAVVA  455

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             IFTL WNLSS +ARIWAVFML VA ++YQQ
Sbjct  456  AIFTLIWNLSSIVARIWAVFMLVVAVKFYQQ  486



>ref|XP_006600547.1| PREDICTED: reticulon-like protein B21-like isoform X2 [Glycine 
max]
Length=556

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGS IT+WKMAK GFFGVF VPK+CSSYS+QLTAF   WIRR +++W+SC+HKKA+A 
Sbjct  471  ARCGSYITIWKMAKFGFFGVFTVPKICSSYSAQLTAFANFWIRRFRDAWDSCSHKKAVAL  530

Query  181  GIFTLAWNLSSAIARIWA  234
            GIF L WNLSS +ARIW+
Sbjct  531  GIFGLVWNLSSVVARIWS  548



>ref|XP_008678514.1| PREDICTED: reticulon-like protein B21 isoform X3 [Zea mays]
Length=653

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFGVFI+PKVCSSYS+QL  +G  W+ RL+++WESCTHKKA+  
Sbjct  489  ARCGNFVTLWTLAKLVFFGVFIIPKVCSSYSTQLARYGRFWLERLRDAWESCTHKKAVVA  548

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
              FTL WN+SS  +R+WAVFML VA + Y Q +
Sbjct  549  AAFTLVWNVSSTASRVWAVFMLAVAVKCYHQRV  581



>gb|AFW61968.1| hypothetical protein ZEAMMB73_167181 [Zea mays]
Length=616

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CG+ +T+W +AKL FFGVFI+PKVCSSYS+QL  +G  W+ RL+++WESCTHKKA+  
Sbjct  452  ARCGNFVTLWTLAKLVFFGVFIIPKVCSSYSTQLARYGRFWLERLRDAWESCTHKKAVVA  511

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
              FTL WN+SS  +R+WAVFML VA + Y Q +
Sbjct  512  AAFTLVWNVSSTASRVWAVFMLAVAVKCYHQRV  544



>ref|XP_008394330.1| PREDICTED: reticulon-like protein B21 [Malus domestica]
Length=134

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +1

Query  46   GFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIAR  225
            GFFGVF +PK+CS YS+Q T +   W+RR +++WESCTHKK +   IF L WNLSS +AR
Sbjct  10   GFFGVFTLPKLCSLYSAQXTVYAKFWVRRFRDAWESCTHKKPLTIAIFLLVWNLSSVVAR  69

Query  226  IWAVFMLYVAFRYYQQSLMRESVGSKPVD  312
            IWA F+L VAFRYYQQ L+ E    +  D
Sbjct  70   IWAAFILLVAFRYYQQKLVAEEWAEESDD  98



>ref|XP_009587029.1| PREDICTED: reticulon-like protein B21 isoform X3 [Nicotiana tomentosiformis]
Length=553

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS IT+WK++KLGFFGV ++PK+CSSYS+QL ++GT + R ++++WESC+HKKA+ F
Sbjct  475  ARYGSFITIWKLSKLGFFGVMVIPKICSSYSTQLASYGTFFTRCVRDAWESCSHKKAVGF  534

Query  181  GIFTLAWNLSSAIARIWA  234
             IFTL WN SS IARIWA
Sbjct  535  AIFTLVWNFSSIIARIWA  552



>gb|KCW78915.1| hypothetical protein EUGRSUZ_C00355 [Eucalyptus grandis]
Length=607

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGS +TV  M KLGFFG FIVPK+C  YS  +T  G + I+  ++SW  C+HKK IA 
Sbjct  469  AKCGSYMTVGMMVKLGFFGAFIVPKLCLMYSEHITTQGKVLIQLFRDSWGVCSHKKVIAA  528

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS  300
              F++ W+ SS + R+W VF  Y+AFRYY+Q+    S G+
Sbjct  529  ITFSIFWSFSSIVGRVWGVFFAYIAFRYYEQTTRDGSAGN  568



>ref|XP_010047117.1| PREDICTED: reticulon-like protein B21 [Eucalyptus grandis]
 gb|KCW78916.1| hypothetical protein EUGRSUZ_C00355 [Eucalyptus grandis]
Length=601

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGS +TV  M KLGFFG FIVPK+C  YS  +T  G + I+  ++SW  C+HKK IA 
Sbjct  469  AKCGSYMTVGMMVKLGFFGAFIVPKLCLMYSEHITTQGKVLIQLFRDSWGVCSHKKVIAA  528

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS  300
              F++ W+ SS + R+W VF  Y+AFRYY+Q+    S G+
Sbjct  529  ITFSIFWSFSSIVGRVWGVFFAYIAFRYYEQTTRDGSAGN  568



>dbj|BAB08870.1| unnamed protein product [Arabidopsis thaliana]
Length=1065

 Score =   106 bits (265),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 58/94 (62%), Gaps = 22/94 (23%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK                      FG  W+RR +++WESC HKKA+A 
Sbjct  472  ARCGSSITLWNLAK----------------------FGNFWMRRFRDAWESCNHKKAVAL  509

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS  AR+WA FML VAFRYYQ  ++
Sbjct  510  ALFTLVWNLSSVTARVWAAFMLLVAFRYYQHKMI  543



>gb|EPS63768.1| hypothetical protein M569_11016, partial [Genlisea aurea]
Length=214

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            AQ GSSIT+ KM KLGF  VF +PK+C+SYSS  +A G  W RR +++WESC+HKK +AF
Sbjct  122  AQYGSSITMMKMVKLGFVAVFTLPKLCTSYSSHFSAQGRFWTRRFRDAWESCSHKKVVAF  181

Query  181  GIFTLAWN-LSSAIARIWAVFMLYVAFRYYQQS  276
             +F L WN +   + R+W  FML+VAF+ Y++S
Sbjct  182  VVFALVWNSMMPLVTRLWTAFMLFVAFKNYRES  214



>ref|XP_002864543.1| hypothetical protein ARALYDRAFT_332090 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40802.1| hypothetical protein ARALYDRAFT_332090 [Arabidopsis lyrata subsp. 
lyrata]
Length=1006

 Score =   105 bits (263),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 22/94 (23%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+CGSSIT+W +AK                      FG  W+RR +++WESC HKKA++ 
Sbjct  397  ARCGSSITLWNLAK----------------------FGNFWMRRFRDAWESCNHKKAVSL  434

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
             +FTL WNLSS  AR+WA FML VAFRYYQ  ++
Sbjct  435  ALFTLVWNLSSVTARVWAAFMLLVAFRYYQHKMI  468



>ref|XP_004169596.1| PREDICTED: reticulon-like protein B21-like [Cucumis sativus]
Length=188

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 71/123 (58%), Gaps = 12/123 (10%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS IT+W + K+GF GVF +PK        L   G  W++   +SW+ C+HK+ +  
Sbjct  76   AKWGSFITLWNVLKIGFIGVFTLPK--------LITHGEHWLKLCGSSWKLCSHKRGVFI  127

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQLGRRTNLTVNANK  360
             IF L WN SS + R+WA F++ V+FRYYQ+S  R+      V + ++  R      ++K
Sbjct  128  AIFFLVWNFSSTLYRVWAAFIVLVSFRYYQESPERDVW----VKNGEVASRNKTMSTSSK  183

Query  361  LKK  369
            LKK
Sbjct  184  LKK  186



>ref|XP_008456496.1| PREDICTED: reticulon-like protein B21 [Cucumis melo]
Length=447

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 72/123 (59%), Gaps = 12/123 (10%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS IT+W + K+GF GVF +PK        L   G  W++   +SW+ C+HK+ +  
Sbjct  335  AKWGSFITLWNVLKIGFIGVFTLPK--------LITHGEHWLKLCGSSWKLCSHKRGVFV  386

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQLGRRTNLTVNANK  360
             IF L WN SS + R+WA F++ V+FRYYQ+S  R+      V + ++  R N    ++K
Sbjct  387  AIFFLVWNFSSTLYRVWAAFIVLVSFRYYQESPERDVW----VKNGEVASRNNTVSTSSK  442

Query  361  LKK  369
            LK+
Sbjct  443  LKR  445



>ref|XP_004139257.1| PREDICTED: uncharacterized protein LOC101208213 [Cucumis sativus]
 gb|KGN60763.1| hypothetical protein Csa_2G009500 [Cucumis sativus]
Length=444

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 60/96 (63%), Gaps = 8/96 (8%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS IT+W + K+GF GVF +PK        L   G  W++   +SW+ C+HK+ +  
Sbjct  332  AKWGSFITLWNVLKIGFIGVFTLPK--------LITHGEHWLKLCGSSWKLCSHKRGVFI  383

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
             IF L WN SS + R+WA F++ V+FRYYQ+S  R+
Sbjct  384  AIFFLVWNFSSTLYRVWAAFIVLVSFRYYQESPERD  419



>gb|EAZ06360.1| hypothetical protein OsI_28590 [Oryza sativa Indica Group]
Length=137

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  112  GTLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
            G  W+ R ++ WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ +M
Sbjct  3    GRFWLERFRDGWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMM  59



>ref|XP_010490286.1| PREDICTED: reticulon-like protein B17, partial [Camelina sativa]
Length=293

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +W  C+HKK +A 
Sbjct  135  AEYGHLITLWRLSAFGFFLSFTIPKLYSCYTHQISQKVERVKTRIGEAWGVCSHKKILAA  194

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQ  321
               T  WNL+S   RI+A+F++ V FRY +Q+L       +PV++ +
Sbjct  195  SAVTAFWNLTSIRTRIFAIFIILVIFRYRRQNLELNPEEDEPVENEK  241



>ref|XP_010490285.1| PREDICTED: reticulon-like protein B17 [Camelina sativa]
Length=290

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +W  C+HKK +A 
Sbjct  132  AEYGHLITLWRLSAFGFFLSFTIPKLYSCYTHQISQKVERVKTRIGEAWGVCSHKKILAA  191

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQ  321
               T  WNL+S   RI+A+F++ V FRY +Q+L       +PV++ +
Sbjct  192  SAVTAFWNLTSIRTRIFAIFIILVIFRYRRQNLELNPEEDEPVENEK  238



>ref|XP_010467796.1| PREDICTED: reticulon-like protein B17 isoform X2 [Camelina sativa]
Length=451

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +W  C+HKK +A 
Sbjct  287  AEYGHLITLWRLSAFGFFLSFTIPKLYSCYTHQISQKVERVTTRIGEAWGVCSHKKILAA  346

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQ  321
               T  WNL+S   RI+AVF++ V FRY +Q+L       KPV++ +
Sbjct  347  SAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLEINPEEVKPVENEK  393



>ref|XP_010323753.1| PREDICTED: reticulon-like protein B17 [Solanum lycopersicum]
Length=415

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  ITVW++  LGFF  FI PK+ SSYS Q+ +       RL  +W +C+HKK IA 
Sbjct  294  AEYGHLITVWRLCALGFFISFIAPKLYSSYSHQIYSKAKYMKYRLLETWGNCSHKKMIAA  353

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             + T  WNL++   RI+  F+  V FRY +Q
Sbjct  354  SVLTAFWNLTTVRTRIFTAFICLVIFRYCKQ  384



>ref|XP_010467795.1| PREDICTED: reticulon-like protein B17 isoform X1 [Camelina sativa]
Length=454

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +W  C+HKK +A 
Sbjct  290  AEYGHLITLWRLSAFGFFLSFTIPKLYSCYTHQISQKVERVTTRIGEAWGVCSHKKILAA  349

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQ  321
               T  WNL+S   RI+AVF++ V FRY +Q+L       KPV++ +
Sbjct  350  SAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLEINPEEVKPVENEK  396



>ref|XP_011100409.1| PREDICTED: reticulon-like protein B17 [Sesamum indicum]
Length=444

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 10/105 (10%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLK----NSWESCTHKK  168
            A+ G  IT+W++  LGFF  F  PK+ S+YSSQL+      +  LK    N+WESCTHKK
Sbjct  306  AEYGHLITLWRLCALGFFISFTAPKLYSAYSSQLSK----KVEHLKSWALNAWESCTHKK  361

Query  169  AIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSK  303
             +A    T  WNL+S   RI+A F+  V  RY +Q    E++G +
Sbjct  362  VVAASAVTAFWNLTSIRTRIFAAFLCLVILRYRRQQT--EAMGEE  404



>ref|XP_010489015.1| PREDICTED: reticulon-like protein B17 isoform X2 [Camelina sativa]
Length=421

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +W  C+HKK +A 
Sbjct  263  AEYGHLITLWRLSAFGFFLSFTIPKLYSCYTHQISQKVERVKTRIGEAWGVCSHKKILAA  322

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQ  321
               T  WNL+S   RI+A+F++ V FRY +Q+L       +PV++ +
Sbjct  323  SAVTAFWNLTSIRTRIFAIFIILVIFRYRRQNLELNPEEDEPVENEK  369



>ref|XP_010489014.1| PREDICTED: reticulon-like protein B17 isoform X1 [Camelina sativa]
Length=424

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +W  C+HKK +A 
Sbjct  266  AEYGHLITLWRLSAFGFFLSFTIPKLYSCYTHQISQKVERVKTRIGEAWGVCSHKKILAA  325

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQ  321
               T  WNL+S   RI+A+F++ V FRY +Q+L       +PV++ +
Sbjct  326  SAVTAFWNLTSIRTRIFAIFIILVIFRYRRQNLELNPEEDEPVENEK  372



>gb|KHN01107.1| Reticulon-like protein B17 [Glycine soja]
Length=282

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 58/95 (61%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  +GFF  F VP++ S YS+Q+         RL ++W +CTHKK +  
Sbjct  146  AEYGHLITIWRLCAIGFFVSFSVPRLYSCYSAQINLRVECLKLRLLDTWSACTHKKIVIA  205

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
             +    WNLS+   RI+  F+L V  RY+++++M+
Sbjct  206  SVLIAFWNLSTIKTRIFTAFILLVILRYFRETIMQ  240



>gb|KFK40434.1| hypothetical protein AALP_AA3G372800 [Arabis alpina]
Length=425

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +WE C+HKK +A 
Sbjct  283  AEYGHLITLWRLSAFGFFLSFTIPKLYSCYTHQISQKVERVKTRIGEAWEMCSHKKILAG  342

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
               T  WNL+S   RI+AVF++ V FRY +Q+L 
Sbjct  343  SAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLQ  376



>ref|XP_010668132.1| PREDICTED: reticulon-like protein B17 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 1/102 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+W++  LGFF  F  PK+ SSYS+Q+ +    +  R+  +W +C HKK +A 
Sbjct  312  AEYGHLLTLWRLCALGFFTSFTAPKLYSSYSAQIDSKAEQFKSRVLEAWRACYHKKIVAG  371

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKP  306
               T  WN+SS   RI+A F+  V  RYY+Q L ++    +P
Sbjct  372  SAATAFWNMSSLKTRIFAAFISLVILRYYRQ-LSKDKTEEEP  412



>ref|XP_010668133.1| PREDICTED: reticulon-like protein B17 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=447

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 1/102 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+W++  LGFF  F  PK+ SSYS+Q+ +    +  R+  +W +C HKK +A 
Sbjct  311  AEYGHLLTLWRLCALGFFTSFTAPKLYSSYSAQIDSKAEQFKSRVLEAWRACYHKKIVAG  370

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKP  306
               T  WN+SS   RI+A F+  V  RYY+Q L ++    +P
Sbjct  371  SAATAFWNMSSLKTRIFAAFISLVILRYYRQ-LSKDKTEEEP  411



>emb|CDX81970.1| BnaC08g36310D [Brassica napus]
Length=437

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F VPK+ S Y+ Q++        R+  +W+ C+HKK +A 
Sbjct  296  AEYGHLITLWRLSAFGFFLSFTVPKLYSCYTHQISQKVERVKTRIGEAWQVCSHKKILAG  355

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
               T  WNL+S   RI+AVF++ V FRY +Q+L++
Sbjct  356  SAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLVQ  390



>emb|CDY13866.1| BnaA09g43680D [Brassica napus]
Length=451

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F VPK+ S Y+ Q++        R+  +W+ C+HKK +A 
Sbjct  296  AEYGHLITLWRLSAFGFFLSFTVPKLYSCYTHQISQKVERVKTRIGEAWQVCSHKKILAG  355

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
               T  WNL+S   RI+AVF++ V FRY +Q+L++
Sbjct  356  SAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLVQ  390



>ref|XP_007011952.1| Reticulon family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY29571.1| Reticulon family protein, putative isoform 2 [Theobroma cacao]
Length=626

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTL  120
            A+CGSSIT+WKMAKLGFFGVF VPKVCSSYS QLTA+G +
Sbjct  581  ARCGSSITIWKMAKLGFFGVFTVPKVCSSYSHQLTAYGKI  620



>ref|XP_006408990.1| hypothetical protein EUTSA_v10001984mg [Eutrema salsugineum]
 gb|ESQ50443.1| hypothetical protein EUTSA_v10001984mg [Eutrema salsugineum]
Length=456

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 62/107 (58%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ SSY+ Q+         R+  +W  C+HKK +A 
Sbjct  310  AEYGHLITLWRLSAFGFFLSFTIPKLYSSYTHQIHLTVERVKTRIGEAWGVCSHKKILAG  369

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQ  321
               T  WNL+S   RI+AVF++ V  RY +Q+L       +PV++ +
Sbjct  370  SAVTAFWNLTSIRTRIFAVFIILVILRYRRQNLQLNPDEVEPVENEK  416



>ref|XP_006348819.1| PREDICTED: reticulon-like protein B17-like [Solanum tuberosum]
Length=418

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  ITVW++  LGFF  F  PK+ SSYS Q+ +       RL  +W +C+HKK IA 
Sbjct  294  AEYGHLITVWRLCALGFFISFTAPKLYSSYSHQIYSKAKYLKYRLLETWGACSHKKMIAA  353

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             + T  WNL++   RI+  F+  V FRY +Q
Sbjct  354  SVLTAFWNLTTVRTRIFTAFISLVIFRYCKQ  384



>ref|XP_009117478.1| PREDICTED: reticulon-like protein B17 [Brassica rapa]
Length=513

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F VPK+ S Y+ Q++        R+  +W+ C+HKK +A 
Sbjct  358  AEYGHLITLWRLSAFGFFLSFTVPKLYSCYTHQISQKVERVKTRIGEAWQVCSHKKILAG  417

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
               T  WNL+S   RI+AVF++ V FRY +Q+L++
Sbjct  418  SAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLVQ  452



>ref|XP_006582310.1| PREDICTED: reticulon-like protein B17-like isoform X2 [Glycine 
max]
Length=429

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 58/95 (61%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  +GFF  F VP++ S YS+Q+         RL ++W +CTHKK +  
Sbjct  293  AEYGHLITIWRLCAIGFFVSFSVPRLYSCYSAQINLRVECLKLRLLDTWSACTHKKIVIA  352

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
             +    WNLS+   RI+  F+L V  RY+++++M+
Sbjct  353  SVLIAFWNLSTIKTRIFTAFILLVILRYFRETIMQ  387



>gb|KEH39173.1| reticulon-like protein B2 [Medicago truncatula]
Length=394

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+ ++   GFF  F +PK+ S Y+SQ+          L ++W +CTHKK +  
Sbjct  255  AEFGHLITIRRLCVTGFFVSFTIPKIYSCYTSQIDKRAEGLKLLLFDTWCACTHKKKLMV  314

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE-SVGSKPVDSRQLGRRTNLTVNAN  357
             +    WNLSS   RI+  FML V FRY +Q ++++   G   VD ++  ++  + V   
Sbjct  315  SVLLTFWNLSSIKTRIFTAFMLLVLFRYLKQHVVQQLQDGEAQVDEKEQQKKEPVVVKTE  374

Query  358  K  360
            +
Sbjct  375  E  375



>ref|XP_003526265.1| PREDICTED: reticulon-like protein B17-like isoform X1 [Glycine 
max]
Length=430

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 58/95 (61%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  +GFF  F VP++ S YS+Q+         RL ++W +CTHKK +  
Sbjct  294  AEYGHLITIWRLCAIGFFVSFSVPRLYSCYSAQINLRVECLKLRLLDTWSACTHKKIVIA  353

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
             +    WNLS+   RI+  F+L V  RY+++++M+
Sbjct  354  SVLIAFWNLSTIKTRIFTAFILLVILRYFRETIMQ  388



>ref|XP_006297644.1| hypothetical protein CARUB_v10013662mg [Capsella rubella]
 gb|EOA30542.1| hypothetical protein CARUB_v10013662mg [Capsella rubella]
Length=458

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 6/118 (5%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +W  C+HKK +A 
Sbjct  298  AEYGHFITLWRLSAFGFFLSFTIPKLYSCYTDQISQRVERVKTRIGEAWGVCSHKKILAG  357

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS--LMRESV----GSKPVDSRQLGRRT  336
               T  WNL+S   RI+AVF++ V FRY +Q+  L  E V      KPV+  +  + T
Sbjct  358  SAVTAFWNLTSIRTRIFAVFIILVIFRYKRQNIELYPEEVEPVEDDKPVEDDKPEKET  415



>gb|AES89696.2| reticulon-like protein B2 [Medicago truncatula]
Length=313

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++ +GFF  F VPK+ S YS+Q+         RL ++W +C+HKK +  
Sbjct  177  AEYGHLITIWRLSAIGFFVNFSVPKLYSCYSAQINQRVECLKLRLLDTWNACSHKKIVVV  236

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
                  WNLS+   RI   F+L V  +Y+QQ++ ++
Sbjct  237  SALVTFWNLSTIRTRICTAFLLIVLLKYFQQNVTQQ  272



>ref|XP_004487260.1| PREDICTED: reticulon-like protein B17-like [Cicer arietinum]
Length=402

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            ++ G  IT+ ++  +GFF  F VPK+ S Y+SQ+          L  +W +CTHKK +  
Sbjct  257  SEFGHLITIRRLCAIGFFVSFTVPKLYSCYTSQIDKRAEYLKSLLLETWCACTHKKKVMA  316

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE-SVGSKPVDSRQLGRRTNLTVNAN  357
             I    WNLSS   RI+  FML V FRY +Q ++++   G   V  ++  ++ ++ V   
Sbjct  317  SILLTFWNLSSVKTRIFTAFMLLVLFRYLKQRVVQQLQDGEAQVGEKEQQKKESVVVETE  376

Query  358  K  360
            +
Sbjct  377  E  377



>ref|XP_003607499.1| Reticulon-like protein B18 [Medicago truncatula]
Length=390

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++ +GFF  F VPK+ S YS+Q+         RL ++W +C+HKK +  
Sbjct  254  AEYGHLITIWRLSAIGFFVNFSVPKLYSCYSAQINQRVECLKLRLLDTWNACSHKKIVVV  313

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
                  WNLS+   RI   F+L V  +Y+QQ++ ++
Sbjct  314  SALVTFWNLSTIRTRICTAFLLIVLLKYFQQNVTQQ  349



>ref|XP_007132792.1| hypothetical protein PHAVU_011G125100g [Phaseolus vulgaris]
 gb|ESW04786.1| hypothetical protein PHAVU_011G125100g [Phaseolus vulgaris]
Length=422

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  +GFF  F VPK+ S YS+Q+         RL ++W +CTHKK +  
Sbjct  288  AEYGHLITIWRLCAIGFFVSFSVPKLYSCYSAQINQRVECLKLRLVDTWNACTHKKKVVA  347

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
             +    WNLS+   RI   F+L V  RY++Q +
Sbjct  348  LVLITFWNLSTIKTRICTAFILLVILRYFRQDI  380



>ref|XP_007132793.1| hypothetical protein PHAVU_011G125100g [Phaseolus vulgaris]
 gb|ESW04787.1| hypothetical protein PHAVU_011G125100g [Phaseolus vulgaris]
Length=421

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  +GFF  F VPK+ S YS+Q+         RL ++W +CTHKK +  
Sbjct  287  AEYGHLITIWRLCAIGFFVSFSVPKLYSCYSAQINQRVECLKLRLVDTWNACTHKKKVVA  346

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
             +    WNLS+   RI   F+L V  RY++Q +
Sbjct  347  LVLITFWNLSTIKTRICTAFILLVILRYFRQDI  379



>ref|XP_001764750.1| predicted protein [Physcomitrella patens]
 gb|EDQ70449.1| predicted protein [Physcomitrella patens]
Length=922

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 29/121 (24%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFG----------TLWI--------  126
            ++ G+ +++W   + GFF +F +PK  S YS+QL   G          ++++        
Sbjct  532  SKMGAGVSIWSFLRFGFFALFTIPKCHSRYSTQLYELGISLKPLEPRLSIYVFITALSDY  591

Query  127  -----------RRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
                        R + +W+S THKKAI  G F LAWN SS  +R W  F+L V  + YQQ
Sbjct  592  KPSCEAAQSLLLRGRATWDSFTHKKAILLGGFLLAWNTSSYSSRFWGGFILMVWLKLYQQ  651

Query  274  S  276
            S
Sbjct  652  S  652



>gb|KHG24941.1| Reticulon-like protein B21 [Gossypium arboreum]
Length=598

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 48/96 (50%), Gaps = 41/96 (43%)
 Frame = +1

Query  4    QCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAFG  183
            +CGSSIT+WKM KLGFFGVFIVPKVCS+YS QLTA+                        
Sbjct  517  RCGSSITIWKMTKLGFFGVFIVPKVCSAYSHQLTAY------------------------  552

Query  184  IFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
                              FML+VA RYYQQ ++ + 
Sbjct  553  -----------------AFMLFVALRYYQQKMVTDE  571



>ref|XP_004505553.1| PREDICTED: reticulon-like protein B18-like isoform X2 [Cicer 
arietinum]
Length=429

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++ +GFF  F VPK+ S YS+Q+          L + W +C HKK +  
Sbjct  293  AEYGHLITIWRLSAIGFFVSFSVPKLYSCYSTQINRRAECMKSGLLDMWSTCGHKKIVVA  352

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
             I    WNLS+   RI   F+L V  RY++Q++M++
Sbjct  353  SILITFWNLSTIKTRICTAFLLLVILRYFRQNVMQQ  388



>ref|XP_004505552.1| PREDICTED: reticulon-like protein B18-like isoform X1 [Cicer 
arietinum]
Length=430

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 0/96 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++ +GFF  F VPK+ S YS+Q+          L + W +C HKK +  
Sbjct  294  AEYGHLITIWRLSAIGFFVSFSVPKLYSCYSTQINRRAECMKSGLLDMWSTCGHKKIVVA  353

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  288
             I    WNLS+   RI   F+L V  RY++Q++M++
Sbjct  354  SILITFWNLSTIKTRICTAFLLLVILRYFRQNVMQQ  389



>ref|XP_004952313.1| PREDICTED: reticulon-like protein B17-like [Setaria italica]
Length=439

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS +TVW++   GFF  F VPK+ SSYSSQ+     +   R + SW+SC  KK +A 
Sbjct  324  AKYGSLVTVWRLLAAGFFTSFTVPKLYSSYSSQIHRRVEILRDRAQESWKSCPRKKLVAA  383

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
               T+ WNL S   R+ A F+  V  RY Q+
Sbjct  384  TAVTMCWNLFSVKTRVMAAFVSLVILRYNQK  414



>gb|AAD21707.1| hypothetical protein [Arabidopsis thaliana]
Length=408

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +W  C+HKK +A 
Sbjct  261  AEYGHLITLWRLSAFGFFLSFTIPKLYSCYTHQISQKVERVKTRIGEAWGVCSHKKILAG  320

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
               T  WNL+S   RI+AVF++ V FRY +Q+L
Sbjct  321  SAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNL  353



>ref|NP_179649.2| reticulon-like protein B17 [Arabidopsis thaliana]
 sp|Q6DR04.1|RTNLQ_ARATH RecName: Full=Reticulon-like protein B17; Short=AtRTNLB17 [Arabidopsis 
thaliana]
 gb|AAT69228.1| hypothetical protein At2g20590 [Arabidopsis thaliana]
 gb|AEC07036.1| reticulon-like protein B17 [Arabidopsis thaliana]
Length=431

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +W  C+HKK +A 
Sbjct  284  AEYGHLITLWRLSAFGFFLSFTIPKLYSCYTHQISQKVERVKTRIGEAWGVCSHKKILAG  343

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
               T  WNL+S   RI+AVF++ V FRY +Q+L
Sbjct  344  SAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNL  376



>gb|AAO37135.1| hypothetical protein [Arabidopsis thaliana]
Length=431

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +W  C+HKK +A 
Sbjct  284  AEYGHLITLWRLSAFGFFLSFTIPKLYSCYTHQISQKVERVKTRIGEAWGVCSHKKILAG  343

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
               T  WNL+S   RI+AVF++ V FRY +Q+L
Sbjct  344  SAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNL  376



>emb|CDY38392.1| BnaC01g10010D [Brassica napus]
Length=441

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  LGFF  F VPK+ SSY+SQ+        +R+  +W  CTHKK +A 
Sbjct  298  AEYGYLITLWRLFALGFFLSFTVPKLYSSYASQINQKVENAQKRIVEAWGICTHKKFVAG  357

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
             + T  WNL+S   R + VF++ V  RY +Q++  +S
Sbjct  358  SMITAFWNLTSLKIRFFTVFIIVVVIRYKRQNVQLDS  394



>gb|AFK47382.1| unknown [Medicago truncatula]
Length=364

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++ +GFF  F VPK+ S YS+Q+         RL ++W +C+HK+ +  
Sbjct  271  AEYGHLITIWRLSAIGFFVNFSVPKLYSCYSAQINQRVECLKLRLLDTWNACSHKEIVVV  330

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
                  WNLS+   RI   F+L V  +Y+QQ++
Sbjct  331  SALVTFWNLSTIRTRICTAFLLIVLLKYFQQNV  363



>gb|KEH38078.1| reticulon-like protein B2 [Medicago truncatula]
Length=494

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFG  114
            A+CGS IT+WKMAK+GFFGVFIVPK+CSSYS+QLTA+G
Sbjct  445  ARCGSFITLWKMAKIGFFGVFIVPKICSSYSAQLTAYG  482



>ref|XP_010687721.1| PREDICTED: reticulon-like protein B21 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=556

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFG  114
            A+CGSSIT+WKM KLGFFGVF++PK+CSSYSS +TA+G
Sbjct  514  ARCGSSITIWKMMKLGFFGVFVIPKLCSSYSSHVTAYG  551



>ref|XP_007149817.1| hypothetical protein PHAVU_005G101200g [Phaseolus vulgaris]
 gb|ESW21811.1| hypothetical protein PHAVU_005G101200g [Phaseolus vulgaris]
Length=376

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 57/96 (59%), Gaps = 6/96 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGT---LWIRRLKNSWESCTHKKA  171
            A+ G  IT+W++  +GFF  F VPK+ S YS+Q+        LW   L ++W +CTHKK 
Sbjct  255  AEYGHLITIWRLCAIGFFISFSVPKLYSCYSAQINKRAECLKLW---LLDAWSACTHKKK  311

Query  172  IAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
            +   +    WNLSS   RI+ +F+L V FR+ +Q +
Sbjct  312  VLASVVMAFWNLSSIKTRIFTIFILLVLFRHLRQQV  347



>gb|EMT16357.1| Reticulon-like protein B17 [Aegilops tauschii]
Length=218

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 58/107 (54%), Gaps = 3/107 (3%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G   TVW++   GFFG F +P++ S YSS +   G     R+ N+W+SC  KK +A 
Sbjct  105  AKYGHLFTVWRLLATGFFGCFTLPRLYSCYSSHIHEKG--LNARILNAWKSCPRKKLVAA  162

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQ  321
               T  WNL S   R+ A F+  VA RY+ Q   R S  S+ V  RQ
Sbjct  163  AAVTTFWNLVSVKTRVMAAFVSAVALRYHYQ-YGRSSRNSEGVIQRQ  208



>ref|XP_006424683.1| hypothetical protein CICLE_v10028046mg [Citrus clementina]
 gb|ESR37923.1| hypothetical protein CICLE_v10028046mg [Citrus clementina]
Length=524

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFG  114
            A+CGSSIT+WKM K+GFFGVFIVPKVCSSYS+QL A+G
Sbjct  457  ARCGSSITIWKMIKVGFFGVFIVPKVCSSYSTQLAAYG  494



>ref|XP_010540878.1| PREDICTED: reticulon-like protein B17 [Tarenaya hassleriana]
Length=436

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 64/116 (55%), Gaps = 1/116 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  +GFF  F VPK+ S YS+ +        RR+  +   C+HKK +AF
Sbjct  309  AEYGHLITLWRLCAIGFFLSFTVPKLYSCYSAHINQKVERMKRRIVEALRGCSHKKMVAF  368

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQLGRRTNLTV  348
               T  W L+S   RI+AVF+  V  R  +Q++    V  + VD++Q   +  L++
Sbjct  369  SAITAFWKLTSVRTRIFAVFIAVVILRCMKQNVEVNPVAEE-VDAQQEEPQKELSL  423



>ref|XP_002517867.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44385.1| conserved hypothetical protein [Ricinus communis]
Length=444

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (60%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  +GFF  F +PK+ S YSSQ+         R+ ++WE+C+HKK +A 
Sbjct  307  AEYGHLITMWRLCAIGFFIGFTIPKLYSCYSSQINQKVDYARGRVLDAWEACSHKKIVAA  366

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
               T  WN+SS   RI+A F+  V  R  +Q ++
Sbjct  367  SAITAFWNMSSVKTRIFAAFIFLVILRCCRQHMI  400



>ref|XP_009610404.1| PREDICTED: reticulon-like protein B17 isoform X1 [Nicotiana tomentosiformis]
Length=433

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  ITVW++  LGFF  F  PK+ S YSSQ++         +  +W +C+HKK IA 
Sbjct  304  AEYGHLITVWRLCALGFFISFTAPKLYSCYSSQISNKANYMKCWMMETWGACSHKKMIAA  363

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             + T  WNL++   RI+  F+  V FRY +Q
Sbjct  364  SVLTAFWNLTTVRTRIFTAFICLVIFRYCRQ  394



>ref|XP_009610412.1| PREDICTED: reticulon-like protein B17 isoform X2 [Nicotiana tomentosiformis]
Length=431

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  ITVW++  LGFF  F  PK+ S YSSQ++         +  +W +C+HKK IA 
Sbjct  302  AEYGHLITVWRLCALGFFISFTAPKLYSCYSSQISNKANYMKCWMMETWGACSHKKMIAA  361

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             + T  WNL++   RI+  F+  V FRY +Q
Sbjct  362  SVLTAFWNLTTVRTRIFTAFICLVIFRYCRQ  392



>ref|XP_008809498.1| PREDICTED: reticulon-like protein B18 isoform X2 [Phoenix dactylifera]
Length=439

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 62/115 (54%), Gaps = 17/115 (15%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNS-------WESCT  159
            A+ G  IT+W++   GFF  F  PK+ S YS Q+        RR++N+       WESC 
Sbjct  323  AKYGHLITLWRLLATGFFLSFTAPKLYSCYSQQIH-------RRVENTRNWIQEAWESCP  375

Query  160  HKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM-RESVGSKPVDSRQ  321
             K+ IA    T+ WNLSS  ARI+A F+  V  RY+ Q  M  E  G K  +SR+
Sbjct  376  RKRLIAASAATVLWNLSSVKARIFAAFISVVILRYHHQRRMGGEENGEK--ESRE  428



>gb|KHG24942.1| Reticulon-like protein B21 [Gossypium arboreum]
Length=582

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    QCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAF  111
            +CGSSIT+WKM KLGFFGVFIVPKVCS+YS QLTA+
Sbjct  517  RCGSSITIWKMTKLGFFGVFIVPKVCSAYSHQLTAY  552



>gb|KDP24091.1| hypothetical protein JCGZ_25748 [Jatropha curcas]
Length=431

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+ ++  LG F  F +PK+ S YSSQ+         R+  +WE+C+HKK +A 
Sbjct  310  AEYGHLVTLRRLCALGLFIGFTIPKLYSCYSSQINQKVDYIKSRILEAWEACSHKKIVAG  369

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE-SVGSKPVDSRQ  321
               T  WN+SS   RI+A F+  V  R ++Q L+ E   G +  + +Q
Sbjct  370  SAITAFWNMSSVKTRIFAAFIFLVILRCFRQHLLPEQEKGEREQEPQQ  417



>ref|XP_009759396.1| PREDICTED: reticulon-like protein B17 isoform X2 [Nicotiana sylvestris]
Length=468

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  ITVW++  +GFF  F  PK+ S YSSQ++         +  +W +C+HKK IA 
Sbjct  336  AEYGHLITVWRLCAIGFFISFTAPKLYSCYSSQISNKANYMKCWMMETWGACSHKKMIAA  395

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             + T  WNL++   RI+  F+  V FRY +Q
Sbjct  396  SVLTAFWNLTTVRTRIFTAFICLVIFRYCRQ  426



>ref|XP_009759395.1| PREDICTED: reticulon-like protein B17 isoform X1 [Nicotiana sylvestris]
Length=484

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  ITVW++  +GFF  F  PK+ S YSSQ++         +  +W +C+HKK IA 
Sbjct  352  AEYGHLITVWRLCAIGFFISFTAPKLYSCYSSQISNKANYMKCWMMETWGACSHKKMIAA  411

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             + T  WNL++   RI+  F+  V FRY +Q
Sbjct  412  SVLTAFWNLTTVRTRIFTAFICLVIFRYCRQ  442



>ref|XP_011047681.1| PREDICTED: reticulon-like protein B17 isoform X2 [Populus euphratica]
Length=461

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+ ++  +GFF  F +PK+C+ YSSQ+         R+  +W +C+HKK +A 
Sbjct  313  AEYGHLVTLRRLCAIGFFISFTIPKLCACYSSQIKQKAEQMKNRMFEAWGACSHKKIVAA  372

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
               T  WNLSS   RI+  F+  V  R ++Q L+
Sbjct  373  SAVTAFWNLSSVKTRIFTAFISLVILRCFRQHLV  406



>ref|XP_011047680.1| PREDICTED: reticulon-like protein B17 isoform X1 [Populus euphratica]
Length=462

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+ ++  +GFF  F +PK+C+ YSSQ+         R+  +W +C+HKK +A 
Sbjct  314  AEYGHLVTLRRLCAIGFFISFTIPKLCACYSSQIKQKAEQMKNRMFEAWGACSHKKIVAA  373

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
               T  WNLSS   RI+  F+  V  R ++Q L+
Sbjct  374  SAVTAFWNLSSVKTRIFTAFISLVILRCFRQHLV  407



>gb|KCW78917.1| hypothetical protein EUGRSUZ_C00355 [Eucalyptus grandis]
Length=579

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 7/99 (7%)
 Frame = +1

Query  10   GSSITVWKMAKLGFFGVFIVPKVCSSYSS--QLTAFGTLWIRRLKNSWESCTHKKAIAFG  183
            G   T  K+A L    +F+V K C SY +   +   G + I+  ++SW  C+HKK IA  
Sbjct  453  GDPSTTMKLAVL----LFVVAK-CGSYMTVGMMVKLGKVLIQLFRDSWGVCSHKKVIAAI  507

Query  184  IFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS  300
             F++ W+ SS + R+W VF  Y+AFRYY+Q+    S G+
Sbjct  508  TFSIFWSFSSIVGRVWGVFFAYIAFRYYEQTTRDGSAGN  546



>ref|XP_009129630.1| PREDICTED: reticulon-like protein B18 isoform X2 [Brassica rapa]
Length=450

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  LGFF  F +PK+ S Y++Q+        +R+  +W  CTHKK +A 
Sbjct  303  AEYGYLITLWRLFALGFFLSFTLPKLYSCYANQINQKVENAQKRIVEAWGICTHKKFVAG  362

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
             + T  WNL+S   R + VF++ V  RY +Q++  +S
Sbjct  363  SMITAFWNLTSLKIRFFTVFIIVVVIRYKRQNVQLDS  399



>ref|XP_009129621.1| PREDICTED: reticulon-like protein B18 isoform X1 [Brassica rapa]
Length=452

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  LGFF  F +PK+ S Y++Q+        +R+  +W  CTHKK +A 
Sbjct  305  AEYGYLITLWRLFALGFFLSFTLPKLYSCYANQINQKVENAQKRIVEAWGICTHKKFVAG  364

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
             + T  WNL+S   R + VF++ V  RY +Q++  +S
Sbjct  365  SMITAFWNLTSLKIRFFTVFIIVVVIRYKRQNVQLDS  401



>emb|CDY35185.1| BnaA01g08460D [Brassica napus]
Length=446

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  LGFF  F +PK+ S Y++Q+        +R+  +W  CTHKK +A 
Sbjct  299  AEYGYLITLWRLFALGFFLSFTLPKLYSCYANQINQKVENAQKRIVEAWGICTHKKFVAG  358

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
             + T  WNL+S   R + VF++ V  RY +Q++  +S
Sbjct  359  SMITAFWNLTSLKIRFFTVFIIVVVIRYKRQNVQLDS  395



>gb|KFK29370.1| hypothetical protein AALP_AA7G125100 [Arabis alpina]
Length=781

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +1

Query  19   ITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAFGIFTLA  198
            IT+W++   GFF  F VPK+ S Y++Q+        +R+  +W  CTHKK +A  I T  
Sbjct  694  ITLWRLCAFGFFLSFTVPKLYSCYATQINRKVESAQKRIVEAWGICTHKKIVAGSIVTAF  753

Query  199  WNLSSAIARIWAVFMLYVAFRYYQQ  273
            WNL+S   R + VF+  VA RY +Q
Sbjct  754  WNLTSLKTRFFTVFITVVAIRYRRQ  778



>gb|KFK29369.1| hypothetical protein AALP_AA7G125100 [Arabis alpina]
Length=777

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +1

Query  19   ITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAFGIFTLA  198
            IT+W++   GFF  F VPK+ S Y++Q+        +R+  +W  CTHKK +A  I T  
Sbjct  690  ITLWRLCAFGFFLSFTVPKLYSCYATQINRKVESAQKRIVEAWGICTHKKIVAGSIVTAF  749

Query  199  WNLSSAIARIWAVFMLYVAFRYYQQ  273
            WNL+S   R + VF+  VA RY +Q
Sbjct  750  WNLTSLKTRFFTVFITVVAIRYRRQ  774



>gb|EEE56796.1| hypothetical protein OsJ_06381 [Oryza sativa Japonica Group]
Length=347

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS +TVW++   GFF  F +PK+ S YSSQ+     +   R   +W+SC  KK +A 
Sbjct  231  AKYGSLVTVWRLLATGFFTSFTLPKLYSCYSSQIHKRVEILRDRALEAWKSCPRKKLVAG  290

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
               T+ WN+ S   RI A F+  V  RY Q+
Sbjct  291  TAVTMCWNMFSVKTRIIAAFISVVILRYNQK  321



>gb|KCW81204.1| hypothetical protein EUGRSUZ_C02575 [Eucalyptus grandis]
Length=603

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFG  114
            A+CG+SIT+WKMAK GFFG F VPKVCSSYS  +TA+G
Sbjct  558  ARCGNSITIWKMAKFGFFGAFTVPKVCSSYSGHITAYG  595



>ref|XP_006852583.1| hypothetical protein AMTR_s00021p00213680 [Amborella trichopoda]
 gb|ERN14050.1| hypothetical protein AMTR_s00021p00213680 [Amborella trichopoda]
Length=382

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +++W++A  GF   F VPK+ SSYS Q+        +    +W +C+HKK +  
Sbjct  275  AEFGPLLSIWRLAAAGFLVSFTVPKLYSSYSDQIQRQVKCTGKWFLEAWSACSHKKIVVA  334

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             + T+ WNLS+   R +A F+  V  R+YQQ
Sbjct  335  SVATVFWNLSTVKTRAFAAFLCLVTLRHYQQ  365



>ref|NP_001046629.1| Os02g0302900 [Oryza sativa Japonica Group]
 dbj|BAD23260.1| reticulon-like [Oryza sativa Japonica Group]
 dbj|BAF08543.1| Os02g0302900 [Oryza sativa Japonica Group]
Length=450

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS +TVW++   GFF  F +PK+ S YSSQ+     +   R   +W+SC  KK +A 
Sbjct  334  AKYGSLVTVWRLLATGFFTSFTLPKLYSCYSSQIHKRVEILRDRALEAWKSCPRKKLVAG  393

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
               T+ WN+ S   RI A F+  V  RY Q+
Sbjct  394  TAVTMCWNMFSVKTRIIAAFISVVILRYNQK  424



>ref|XP_010260314.1| PREDICTED: reticulon-like protein B17 [Nelumbo nucifera]
Length=434

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+W++   GFF  F VPK+ S Y   +          +K +WE+C+HKK +A 
Sbjct  298  AEYGHLMTLWRLCATGFFVTFTVPKLYSCYHESINKQVKYLSSWMKETWEACSHKKIVAA  357

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
               TL WNLSS   RI+  F+  V  R+++Q
Sbjct  358  SAATLFWNLSSLKTRIFTAFISLVLLRFHRQ  388



>ref|XP_008678512.1| PREDICTED: reticulon-like protein B21 isoform X1 [Zea mays]
Length=691

 Score = 61.2 bits (147),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFG  114
            A+CG+ +T+W +AKL FFGVFI+PKVCSSYS+QL  + 
Sbjct  489  ARCGNFVTLWTLAKLVFFGVFIIPKVCSSYSTQLARYA  526


 Score = 28.9 bits (63),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 15/41 (37%), Positives = 21/41 (51%), Gaps = 0/41 (0%)
 Frame = +3

Query  144  MGIVHS*ESHCIWHLHAGMEFIFGHCSNLGSFHVVCGIQIL  266
            +G+VH  E      LHAG+E +    + LG  H   G Q+L
Sbjct  562  LGVVHPQEGRGGGRLHAGLERLVHGVARLGGVHAGGGRQVL  602



>ref|XP_008678513.1| PREDICTED: reticulon-like protein B21 isoform X2 [Zea mays]
Length=690

 Score = 61.2 bits (147),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFG  114
            A+CG+ +T+W +AKL FFGVFI+PKVCSSYS+QL  + 
Sbjct  488  ARCGNFVTLWTLAKLVFFGVFIIPKVCSSYSTQLARYA  525


 Score = 28.9 bits (63),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 15/41 (37%), Positives = 21/41 (51%), Gaps = 0/41 (0%)
 Frame = +3

Query  144  MGIVHS*ESHCIWHLHAGMEFIFGHCSNLGSFHVVCGIQIL  266
            +G+VH  E      LHAG+E +    + LG  H   G Q+L
Sbjct  561  LGVVHPQEGRGGGRLHAGLERLVHGVARLGGVHAGGGRQVL  601



>ref|XP_002437526.1| hypothetical protein SORBIDRAFT_10g028710 [Sorghum bicolor]
 gb|EER88893.1| hypothetical protein SORBIDRAFT_10g028710 [Sorghum bicolor]
Length=443

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +TVW++   GFF  F VPK+ S YSSQ+     +   +   +W+SC  KK +A 
Sbjct  328  AKYGGLVTVWRLVAAGFFTSFTVPKLYSCYSSQIHRRVEILRDQALEAWKSCPRKKLVAA  387

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             + T+ WN+ S   R+ A F+  V  RY Q+
Sbjct  388  MVVTMCWNMFSVKTRVMAAFVSLVILRYNQK  418



>ref|XP_002309754.1| reticulon family protein [Populus trichocarpa]
 gb|EEE90204.1| reticulon family protein [Populus trichocarpa]
Length=457

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+ ++  +GFF  F +PK+ + YSSQ+         R+  +W +C+HKK +A 
Sbjct  308  AEYGHLVTLRRLCAIGFFISFTIPKLYACYSSQIKQKAEQMKNRMFEAWGACSHKKIVAA  367

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
               T  WNLSS   RI+  F+  V  R ++Q LM
Sbjct  368  SAVTAFWNLSSVKTRIFTAFISLVILRCFRQHLM  401



>ref|XP_006594843.1| PREDICTED: reticulon-like protein B17-like, partial [Glycine 
max]
Length=404

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+ ++  +GF   F VPK+ SSY+ Q+          L ++W +CTHKK +  
Sbjct  269  AEYGHLITIRRLCAIGFVVSFSVPKLYSSYTVQINQRAEGLKSWLLDTWSACTHKKKVMA  328

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
                  WNLSS   RI+ VF+L V FRY +Q ++
Sbjct  329  SALMTFWNLSSIKTRIFTVFILLVLFRYLRQHVV  362



>gb|KDO43073.1| hypothetical protein CISIN_1g022168mg [Citrus sinensis]
Length=301

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  LGFF  FIVPK+ S YS+Q+          L  +W SC+HKK +A 
Sbjct  181  AEYGHLITIWRLCALGFFSSFIVPKLYSCYSNQINQKVDNTKYWLLEAWGSCSHKKVVAA  240

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
                  WNLS+   RI+  F+  V  R  +Q L+
Sbjct  241  SAVMAFWNLSTIRIRIFTAFISLVILRCCRQHLL  274



>dbj|BAJ88877.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +TVW++   GFFG F +P++ S YSS +         R+ N+W+SC  KK +A 
Sbjct  306  AKYGHLLTVWRLLATGFFGCFTLPRLYSCYSSHIHEKVEGLNARILNAWKSCPRKKLVAA  365

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYY  267
               T  WNL S   R+   F+  VA RY+
Sbjct  366  AAVTTFWNLVSVKTRVMTAFVSAVALRYH  394



>ref|XP_004305428.1| PREDICTED: reticulon-like protein B17-like [Fragaria vesca subsp. 
vesca]
Length=434

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++ L FF  F +P++ S YS Q+         R+  +W +C+HKK +A 
Sbjct  297  AEYGHHITLWRLSMLAFFISFTIPRLYSCYSIQMNQKAECLKWRVLEAWGACSHKKIVAA  356

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
               T  WNLSS   RI+  F+  V  RY +Q +++
Sbjct  357  SAATAFWNLSSVKTRIFTAFISLVILRYCRQHMVQ  391



>ref|XP_006469912.1| PREDICTED: reticulon-like protein B17-like isoform X2 [Citrus 
sinensis]
Length=405

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (55%), Gaps = 6/97 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLT---AFGTLWIRRLKNSWESCTHKKA  171
            A+ G  IT+W++  LGFF  FIVPK+ S YS+Q+         W   L  +W SC+HKK 
Sbjct  285  AEYGHLITIWRLCALGFFSSFIVPKLYSCYSNQINQKVDNTKCW---LLEAWGSCSHKKV  341

Query  172  IAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
            +A       WNLS+   RI+  F+  V  R  +Q L+
Sbjct  342  VAASAVMAFWNLSTIRTRIFTAFISLVILRCCRQHLL  378



>ref|XP_006648565.1| PREDICTED: reticulon-like protein B17-like, partial [Oryza brachyantha]
Length=343

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 57/110 (52%), Gaps = 3/110 (3%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS +TVW+    GFF  F +PK+ S YSSQ+     +   +   +W+SC  KK +A 
Sbjct  228  AKYGSLVTVWRFLATGFFTSFAIPKLYSCYSSQIHKRVEVLRDQALEAWKSCPRKKLVAG  287

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRY---YQQSLMRESVGSKPVDSRQ  321
               T+ WNL S   RI A F+  V  RY   Y+++ M     S P +  Q
Sbjct  288  TAVTMCWNLFSVKTRIIAAFISIVILRYNQKYRKAFMNTEHESCPDEQGQ  337



>ref|XP_010272355.1| PREDICTED: reticulon-like protein B17 isoform X2 [Nelumbo nucifera]
Length=446

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++   GFF  F  PK+ S +S ++      W   ++  W +C+ KK +A 
Sbjct  308  AEYGHLITLWRLCATGFFVSFTAPKLYSCHSEKIKKQVENWRSWMREKWVACSRKKIVAA  367

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
               T+ WNLSS   R++AVF+L V  R+++Q
Sbjct  368  SAATVLWNLSSLKTRMFAVFILLVILRFHRQ  398



>ref|XP_006447229.1| hypothetical protein CICLE_v10015408mg [Citrus clementina]
 ref|XP_006469911.1| PREDICTED: reticulon-like protein B17-like isoform X1 [Citrus 
sinensis]
 gb|ESR60469.1| hypothetical protein CICLE_v10015408mg [Citrus clementina]
Length=413

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (55%), Gaps = 6/97 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLT---AFGTLWIRRLKNSWESCTHKKA  171
            A+ G  IT+W++  LGFF  FIVPK+ S YS+Q+         W   L  +W SC+HKK 
Sbjct  293  AEYGHLITIWRLCALGFFSSFIVPKLYSCYSNQINQKVDNTKCW---LLEAWGSCSHKKV  349

Query  172  IAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
            +A       WNLS+   RI+  F+  V  R  +Q L+
Sbjct  350  VAASAVMAFWNLSTIRTRIFTAFISLVILRCCRQHLL  386



>ref|XP_010272354.1| PREDICTED: reticulon-like protein B17 isoform X1 [Nelumbo nucifera]
Length=448

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++   GFF  F  PK+ S +S ++      W   ++  W +C+ KK +A 
Sbjct  310  AEYGHLITLWRLCATGFFVSFTAPKLYSCHSEKIKKQVENWRSWMREKWVACSRKKIVAA  369

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
               T+ WNLSS   R++AVF+L V  R+++Q
Sbjct  370  SAATVLWNLSSLKTRMFAVFILLVILRFHRQ  400



>gb|AFW65726.1| hypothetical protein ZEAMMB73_947370 [Zea mays]
Length=223

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +TVW++   GFF  F VPK+ S YSS++     +   +   +W+SC  KK +A 
Sbjct  111  AKYGGLVTVWRLLAAGFFISFTVPKLYSCYSSRIHKRVEILRDQALEAWKSCPRKKLVAA  170

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS  300
             I T+ WN+ S   R+ A F+  V  RY ++      VGS
Sbjct  171  IIVTMFWNMFSVKTRVMAAFVSLVILRYNKKHHKAAEVGS  210



>dbj|BAJ92676.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS ITVW+    GFF  F +PK+  SYS+Q+       I R   +W+SC  KK +A 
Sbjct  318  AKYGSLITVWRFLATGFFTSFTLPKLYISYSTQIHMIAENLIDRALEAWKSCPRKKFVAG  377

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
                + WNL S   R  A F+  V  RY  Q
Sbjct  378  TAVAVCWNLFSVKTRFLAAFVSVVILRYNHQ  408



>emb|CBI21893.3| unnamed protein product [Vitis vinifera]
Length=330

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 55/95 (58%), Gaps = 8/95 (8%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLK----NSWESCTHKK  168
            A+ G  +TV ++  LGFF  F +PK+ S YS+Q+       +  LK     +W +C+HKK
Sbjct  198  AEYGHLLTVRRLCALGFFISFTIPKLYSCYSAQINT----RVEYLKGWVVEAWGACSHKK  253

Query  169  AIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             +A    T+ WNLS+   RI+A F+  V  RY++Q
Sbjct  254  IVAASAVTVFWNLSAIKTRIFAAFIALVILRYHRQ  288



>ref|XP_010656999.1| PREDICTED: reticulon-like protein B17 [Vitis vinifera]
Length=433

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 55/95 (58%), Gaps = 8/95 (8%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLK----NSWESCTHKK  168
            A+ G  +TV ++  LGFF  F +PK+ S YS+Q+       +  LK     +W +C+HKK
Sbjct  301  AEYGHLLTVRRLCALGFFISFTIPKLYSCYSAQINT----RVEYLKGWVVEAWGACSHKK  356

Query  169  AIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
             +A    T+ WNLS+   RI+A F+  V  RY++Q
Sbjct  357  IVAASAVTVFWNLSAIKTRIFAAFIALVILRYHRQ  391



>gb|KHN27905.1| Reticulon-like protein B17 [Glycine soja]
Length=362

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFG-TLWIRR-LKNSWESCTHKKAI  174
            A+ G  IT+W++  +GF   F VPK+ S Y++Q+   G T  ++  L ++W +CT KK +
Sbjct  225  AEYGHLITIWRLCAIGFLVSFSVPKLYSCYTAQINQRGMTEGLKSWLLDTWSACTRKKKV  284

Query  175  AFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
                    WNLSS   RI+ VF+L V  RY +Q ++
Sbjct  285  MASALMAFWNLSSIKTRIFTVFILLVLCRYLRQHVV  320



>ref|XP_010227678.1| PREDICTED: reticulon-like protein B17 isoform X1 [Brachypodium 
distachyon]
Length=404

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQL-TAFGTLWIRRLKNSWESCTHKKAIA  177
            A+ G   TVW++   GFFG F +P++ S YSS +    G L  + L N+W+SC  KK +A
Sbjct  291  AKYGHLFTVWRLLATGFFGCFTLPRLYSCYSSHIHEKVGGLKTQIL-NAWKSCPRKKLVA  349

Query  178  FGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
                T  WN+     RI A  +  V  RYY Q
Sbjct  350  AAAVTTFWNMVGVKTRIMAALVAAVTLRYYDQ  381



>ref|XP_003560742.1| PREDICTED: reticulon-like protein B17 isoform X2 [Brachypodium 
distachyon]
Length=401

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQL-TAFGTLWIRRLKNSWESCTHKKAIA  177
            A+ G   TVW++   GFFG F +P++ S YSS +    G L  + L N+W+SC  KK +A
Sbjct  288  AKYGHLFTVWRLLATGFFGCFTLPRLYSCYSSHIHEKVGGLKTQIL-NAWKSCPRKKLVA  346

Query  178  FGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
                T  WN+     RI A  +  V  RYY Q
Sbjct  347  AAAVTTFWNMVGVKTRIMAALVAAVTLRYYDQ  378



>gb|EYU29856.1| hypothetical protein MIMGU_mgv1a007021mg [Erythranthe guttata]
Length=422

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  LGFF  F  PK+ S+YSSQL+           + W SCTHKK IA 
Sbjct  293  AEYGHLITLWRLCALGFFISFTGPKLYSAYSSQLSKKVEYVKSWAMDVWGSCTHKK-IAS  351

Query  181  GIFTLA-WNLSSAIARIWAVFMLYVAFRYYQQ  273
            G+   A WNL+S   R++A F+  V  RY +Q
Sbjct  352  GLAATAFWNLTSIRTRVFAAFLCLVILRYRRQ  383



>ref|XP_010555105.1| PREDICTED: reticulon-like protein B18 isoform X2 [Tarenaya hassleriana]
Length=424

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  +GFF  F VPK+ S YS  +        +R+   W  C+HK+ +A 
Sbjct  306  AEYGHLITLWRLCAVGFFLGFSVPKLYSCYSIPINQKVERMKKRVVEGWGGCSHKRMVAL  365

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
               T  WNL+S  +RI A FM+ V  RY + +L
Sbjct  366  SAATAFWNLTSFKSRILAGFMVMVIVRYRRINL  398



>ref|XP_010555106.1| PREDICTED: reticulon-like protein B17 isoform X3 [Tarenaya hassleriana]
Length=420

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  +GFF  F VPK+ S YS  +        +R+   W  C+HK+ +A 
Sbjct  302  AEYGHLITLWRLCAVGFFLGFSVPKLYSCYSIPINQKVERMKKRVVEGWGGCSHKRMVAL  361

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
               T  WNL+S  +RI A FM+ V  RY + +L
Sbjct  362  SAATAFWNLTSFKSRILAGFMVMVIVRYRRINL  394



>ref|XP_010555104.1| PREDICTED: reticulon-like protein B18 isoform X1 [Tarenaya hassleriana]
Length=426

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  +GFF  F VPK+ S YS  +        +R+   W  C+HK+ +A 
Sbjct  308  AEYGHLITLWRLCAVGFFLGFSVPKLYSCYSIPINQKVERMKKRVVEGWGGCSHKRMVAL  367

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
               T  WNL+S  +RI A FM+ V  RY + +L
Sbjct  368  SAATAFWNLTSFKSRILAGFMVMVIVRYRRINL  400



>ref|XP_009396756.1| PREDICTED: reticulon-like protein B21 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=434

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWI  126
            A+CGS+ITVW +AKL FFGVF +PKVCSSYS+QL   G L +
Sbjct  336  ARCGSTITVWSLAKLIFFGVFTIPKVCSSYSTQLAKLGLLGL  377



>ref|XP_006372740.1| reticulon family protein [Populus trichocarpa]
 gb|ERP50537.1| reticulon family protein [Populus trichocarpa]
Length=439

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 2/105 (2%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+ ++  +GFF  F +PK+ + YSSQ+         R+  +W +C HKK +A 
Sbjct  313  AEYGHLVTLRRLCGIGFFISFTIPKLFACYSSQINQKVEHLKCRMMEAWRACFHKKMVAA  372

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM--RESVGSKPV  309
               T  WNLSS   RI+  F+  V  R  +Q LM  +E  G +P 
Sbjct  373  SAVTAFWNLSSVKTRIFTAFISLVILRCCRQQLMPSQEEGGLQPT  417



>ref|NP_001130153.1| uncharacterized protein LOC100191247 [Zea mays]
 gb|ACF78290.1| unknown [Zea mays]
 gb|AFW65724.1| hypothetical protein ZEAMMB73_947370 [Zea mays]
 gb|AFW65725.1| hypothetical protein ZEAMMB73_947370 [Zea mays]
Length=439

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +TVW++   GFF  F VPK+ S YSS++     +   +   +W+SC  KK +A 
Sbjct  327  AKYGGLVTVWRLLAAGFFISFTVPKLYSCYSSRIHKRVEILRDQALEAWKSCPRKKLVAA  386

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS  300
             I T+ WN+ S   R+ A F+  V  RY ++      VGS
Sbjct  387  IIVTMFWNMFSVKTRVMAAFVSLVILRYNKKHHKAAEVGS  426



>ref|XP_011029062.1| PREDICTED: reticulon-like protein B17 isoform X2 [Populus euphratica]
Length=438

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 2/105 (2%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+ ++  +GFF  F +PK+ + YSSQ+         R+  +W +C+HKK +A 
Sbjct  310  AEYGHLVTLRRLCGIGFFISFTIPKLFACYSSQINQKAEHLKCRMMEAWRACSHKKMVAA  369

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM--RESVGSKPV  309
               T  WNLSS   RI+  F+  V  R  +Q  M  +E  G  P 
Sbjct  370  SAVTAFWNLSSLKTRIFTAFISLVILRCCRQQQMPSQEEGGLPPT  414



>ref|XP_011029065.1| PREDICTED: reticulon-like protein B17 isoform X5 [Populus euphratica]
Length=412

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 2/105 (2%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+ ++  +GFF  F +PK+ + YSSQ+         R+  +W +C+HKK +A 
Sbjct  284  AEYGHLVTLRRLCGIGFFISFTIPKLFACYSSQINQKAEHLKCRMMEAWRACSHKKMVAA  343

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM--RESVGSKPV  309
               T  WNLSS   RI+  F+  V  R  +Q  M  +E  G  P 
Sbjct  344  SAVTAFWNLSSLKTRIFTAFISLVILRCCRQQQMPSQEEGGLPPT  388



>ref|XP_003539539.1| PREDICTED: reticulon-like protein B17-like [Glycine max]
Length=393

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++  +GF   F VPK+ S Y++Q+          L ++W +CT KK +  
Sbjct  258  AEYGHLITIWRLCAIGFLVSFSVPKLYSCYTAQINQRAEGLKSWLLDTWSACTRKKKVMA  317

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  282
                  WNLSS   RI+ VF+L V  RY +Q ++
Sbjct  318  SALMAFWNLSSIKTRIFTVFILLVLCRYLRQHVV  351



>ref|XP_011029063.1| PREDICTED: reticulon-like protein B17 isoform X3 [Populus euphratica]
Length=437

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 2/105 (2%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+ ++  +GFF  F +PK+ + YSSQ+         R+  +W +C+HKK +A 
Sbjct  309  AEYGHLVTLRRLCGIGFFISFTIPKLFACYSSQINQKAEHLKCRMMEAWRACSHKKMVAA  368

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM--RESVGSKPV  309
               T  WNLSS   RI+  F+  V  R  +Q  M  +E  G  P 
Sbjct  369  SAVTAFWNLSSLKTRIFTAFISLVILRCCRQQQMPSQEEGGLPPT  413



>ref|XP_011029061.1| PREDICTED: reticulon-like protein B17 isoform X1 [Populus euphratica]
Length=439

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 2/105 (2%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+ ++  +GFF  F +PK+ + YSSQ+         R+  +W +C+HKK +A 
Sbjct  311  AEYGHLVTLRRLCGIGFFISFTIPKLFACYSSQINQKAEHLKCRMMEAWRACSHKKMVAA  370

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM--RESVGSKPV  309
               T  WNLSS   RI+  F+  V  R  +Q  M  +E  G  P 
Sbjct  371  SAVTAFWNLSSLKTRIFTAFISLVILRCCRQQQMPSQEEGGLPPT  415



>ref|XP_011029064.1| PREDICTED: reticulon-like protein B17 isoform X4 [Populus euphratica]
Length=414

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 2/105 (2%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+ ++  +GFF  F +PK+ + YSSQ+         R+  +W +C+HKK +A 
Sbjct  286  AEYGHLVTLRRLCGIGFFISFTIPKLFACYSSQINQKAEHLKCRMMEAWRACSHKKMVAA  345

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM--RESVGSKPV  309
               T  WNLSS   RI+  F+  V  R  +Q  M  +E  G  P 
Sbjct  346  SAVTAFWNLSSLKTRIFTAFISLVILRCCRQQQMPSQEEGGLPPT  390



>emb|CAA16882.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79645.1| hypothetical protein [Arabidopsis thaliana]
Length=406

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++   GFF  F +PK+ S Y+SQL        RR   +W  CTHKK +A 
Sbjct  261  AEYGYLITLWRLCAFGFFLSFTIPKLYSCYASQLNQKVECAQRRFVEAWGVCTHKKFVAG  320

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
               T  WNL+S   R  AVF++ V  RY +Q+L  +S
Sbjct  321  SAVTAFWNLTSLKTRFIAVFIIVVVIRYRRQNLQLDS  357



>gb|EMT33577.1| Reticulon-like protein B17 [Aegilops tauschii]
Length=367

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 48/92 (52%), Gaps = 0/92 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS +TVW++   GFF  F +PK+   YS+Q+       I R   +W+SC  KK +A 
Sbjct  272  AKYGSLVTVWRLLATGFFTSFTLPKLYICYSTQIHMIAENLIDRALEAWKSCPRKKFVAG  331

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS  276
                + WNL S   R  A F+  V  RY  Q+
Sbjct  332  TAVIVCWNLFSVKTRFVAAFISVVILRYNHQT  363



>ref|NP_567809.1| reticulon-like protein B18 [Arabidopsis thaliana]
 sp|Q8LDS3.2|RTNLR_ARATH RecName: Full=Reticulon-like protein B18; Short=AtRTNLB18 [Arabidopsis 
thaliana]
 gb|AEE85486.1| reticulon-like protein B18 [Arabidopsis thaliana]
Length=457

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++   GFF  F +PK+ S Y+SQL        RR   +W  CTHKK +A 
Sbjct  312  AEYGYLITLWRLCAFGFFLSFTIPKLYSCYASQLNQKVECAQRRFVEAWGVCTHKKFVAG  371

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
               T  WNL+S   R  AVF++ V  RY +Q+L  +S
Sbjct  372  SAVTAFWNLTSLKTRFIAVFIIVVVIRYRRQNLQLDS  408



>gb|AAM63049.1| unknown [Arabidopsis thaliana]
Length=457

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++   GFF  F +PK+ S Y+SQL        RR   +W  CTHKK +A 
Sbjct  312  AEYGYLITLWRLCAFGFFLSFTIPKLYSCYASQLNQKVECAQRRFVEAWGVCTHKKFVAG  371

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
               T  WNL+S   R  AVF++ V  RY +Q+L  +S
Sbjct  372  SAVTAFWNLTSLKTRFIAVFIIVVVIRYRRQNLQLDS  408



>dbj|BAE99357.1| hypothetical protein [Arabidopsis thaliana]
Length=457

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++   GFF  F +PK+ S Y+SQL        RR   +W  CTHKK +A 
Sbjct  312  AEYGYLITLWRLCAFGFFLSFTIPKLYSCYASQLNQKVECAQRRFVEAWGVCTHKKFVAG  371

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
               T  WNL+S   R  AVF++ V  RY +Q+L  +S
Sbjct  372  SAVTAFWNLTSLKTRFIAVFIIVVVIRYRRQNLQLDS  408



>ref|XP_008809421.1| PREDICTED: reticulon-like protein B17 isoform X1 [Phoenix dactylifera]
Length=467

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 53/100 (53%), Gaps = 17/100 (17%)
 Frame = +1

Query  46   GFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNS-------WESCTHKKAIAFGIFTLAWN  204
            GFF  F  PK+ S YS Q+        RR++N+       WESC  K+ IA    T+ WN
Sbjct  366  GFFLSFTAPKLYSCYSQQIH-------RRVENTRNWIQEAWESCPRKRLIAASAATVLWN  418

Query  205  LSSAIARIWAVFMLYVAFRYYQQSLM-RESVGSKPVDSRQ  321
            LSS  ARI+A F+  V  RY+ Q  M  E  G K  +SR+
Sbjct  419  LSSVKARIFAAFISVVILRYHHQRRMGGEENGEK--ESRE  456



>gb|EEC72976.1| hypothetical protein OsI_06874 [Oryza sativa Indica Group]
Length=453

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 53/103 (51%), Gaps = 13/103 (13%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFG------------TLWIRRLKNS  144
            A+ GS +TVW++    FF  F +PK+ S YSSQ+   G             L  R L+ +
Sbjct  332  AKYGSLVTVWRLLATAFFTSFTLPKLYSCYSSQIHKRGYRTKYPPFFLVENLTDRALE-A  390

Query  145  WESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
            W+SC  KK +A    T+ WNL S   RI A F+  V  RY Q+
Sbjct  391  WKSCPRKKLVAGTAVTMCWNLFSVKTRIIAAFISVVILRYNQK  433



>ref|XP_007043668.1| Reticulon family protein, putative isoform 2 [Theobroma cacao]
 gb|EOX99499.1| Reticulon family protein, putative isoform 2 [Theobroma cacao]
Length=441

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+ ++   GFF  F +PK+ S YSS ++       + +  +W +C+HKK +A 
Sbjct  318  AEYGHIITLRRLCAFGFFLSFSLPKLYSCYSSPISQKAGYMKQWVIEAWGACSHKKVVAA  377

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
               T  WNLSS   R++  F+  V  RYY+Q  +++S
Sbjct  378  SAATAFWNLSSVKTRVFTAFISLVIIRYYRQHQVQKS  414



>ref|XP_007043667.1| Reticulon family protein, putative isoform 1 [Theobroma cacao]
 gb|EOX99498.1| Reticulon family protein, putative isoform 1 [Theobroma cacao]
Length=442

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+ ++   GFF  F +PK+ S YSS ++       + +  +W +C+HKK +A 
Sbjct  319  AEYGHIITLRRLCAFGFFLSFSLPKLYSCYSSPISQKAGYMKQWVIEAWGACSHKKVVAA  378

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
               T  WNLSS   R++  F+  V  RYY+Q  +++S
Sbjct  379  SAATAFWNLSSVKTRVFTAFISLVIIRYYRQHQVQKS  415



>gb|KHG20167.1| Reticulon-like protein B17 [Gossypium arboreum]
Length=440

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+ ++   GFF  F VPK+ S YS  +             +W +C+HKK +A 
Sbjct  317  AEYGHIITLRRLCAFGFFISFSVPKLYSRYSGLINKKAEYMKEWGMETWGACSHKKLVAA  376

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
               T  WNLSS   RI++ F+  V  RY +Q L+++S
Sbjct  377  SAATAFWNLSSIKTRIFSAFIAMVIIRYCRQHLVQDS  413



>ref|XP_002869503.1| hypothetical protein ARALYDRAFT_491927 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45762.1| hypothetical protein ARALYDRAFT_491927 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++   GFF  F +PK+ S Y+SQ+        +R+  +W  CTHKK +A 
Sbjct  311  AEYGYLITLWRLCAFGFFLSFTIPKLYSCYASQINQKVESAQKRIVEAWGVCTHKKFVAG  370

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
               T  WNL+S   R  AVF++ V  RY +Q+L  +S
Sbjct  371  SAITAFWNLTSLKTRFIAVFIIVVVIRYRRQNLQLDS  407



>ref|XP_007198848.1| hypothetical protein PRUPE_ppa014722mg [Prunus persica]
 gb|EMJ00047.1| hypothetical protein PRUPE_ppa014722mg [Prunus persica]
Length=438

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (55%), Gaps = 8/99 (8%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLK----NSWESCTHKK  168
            A+ G  IT+W++  L FF  F +PK+ S YS Q+       +  LK     +W +C+HKK
Sbjct  299  AEYGHLITLWRLCMLAFFISFTIPKLYSCYSIQMNQ----KVECLKWWVLEAWGACSHKK  354

Query  169  AIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
             +A    T  WNLSS   RI+  F+  V  RY +Q +++
Sbjct  355  IVAASAATAFWNLSSVRTRIFTAFLSLVILRYCRQHMVQ  393



>ref|XP_008448255.1| PREDICTED: reticulon-like protein B17 [Cucumis melo]
Length=425

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+ ++  +GFF  F VPK+ S Y  Q+ +      + L  +WE+C+HKK +  
Sbjct  293  AEYGHLITLRRLCAIGFFSSFSVPKLYSCYQIQINSKVDAVKQWLFEAWEACSHKKVVIG  352

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
               T+ WN SS   RI+  F++ V  RY +Q
Sbjct  353  SAATVFWNFSSLKTRIFTAFIVLVIVRYCRQ  383



>ref|XP_008229008.1| PREDICTED: reticulon-like protein B17 [Prunus mume]
Length=445

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 53/98 (54%), Gaps = 6/98 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTL---WIRRLKNSWESCTHKKA  171
            A+ G  IT+W++  L FF  F +PK+ S YS Q+         W+     +W +C+HKK 
Sbjct  305  AEYGHLITLWRLCMLAFFISFTIPKLYSCYSIQMNQKVDCLKWWV---MEAWGACSHKKI  361

Query  172  IAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
            +A    T  WNLSS   RI+  F+  V  RY +Q +++
Sbjct  362  VAASAATAFWNLSSVRTRIFTAFISLVILRYCRQHMVQ  399



>ref|XP_009357134.1| PREDICTED: reticulon-like protein B17 [Pyrus x bretschneideri]
Length=448

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 57/112 (51%), Gaps = 9/112 (8%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLK----NSWESCTHKK  168
            A+ G  IT W++  L FF  F +PK+ S YS Q+       +  LK     +W +C+HK+
Sbjct  307  AEYGHLITFWRLCMLAFFISFTIPKLYSCYSIQINQ----KVDCLKWWVLEAWGACSHKR  362

Query  169  AIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE-SVGSKPVDSRQ  321
             +A    T  WNLSS   RI+  F+  V  RY +Q +++    G   V+  Q
Sbjct  363  IVAASAATAFWNLSSVKTRIFTAFISLVILRYCRQHMVQPMETGEAEVEQEQ  414



>ref|XP_010447981.1| PREDICTED: reticulon-like protein B18 [Camelina sativa]
Length=459

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 67/129 (52%), Gaps = 7/129 (5%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++   GFF  F VPK+ S Y+SQ++       +R+  +W  CTHKK +A 
Sbjct  310  AEYGYLITLWRLCAFGFFLSFTVPKLYSCYASQISRQVESAQKRIVEAWGICTHKKFVAG  369

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQLGRRTNLTVNANK  360
               T  WNL+S   R  AVF++ V  RY +Q+ ++       +DS+++           +
Sbjct  370  SAVTAFWNLTSLKTRFIAVFIIVVVIRYKRQNHLQ-------LDSKEVEENHQEQTQPEQ  422

Query  361  LKKPM*QFP  387
             K P  + P
Sbjct  423  QKLPKEKSP  431



>emb|CDP15861.1| unnamed protein product [Coffea canephora]
Length=432

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 0/91 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  +T+ ++  LGFF  F  PK+ SSYS Q+          +   W +C+HKK +A 
Sbjct  305  AEYGHLLTLRRLCALGFFISFTCPKLYSSYSVQICRKVDYLQSWMLERWRACSHKKIVAA  364

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
               T  WNL+S   RI+A F+  V  RY +Q
Sbjct  365  SAVTAFWNLTSIRIRIFAAFICLVIVRYSRQ  395



>ref|XP_008363067.1| PREDICTED: reticulon-like protein B17 [Malus domestica]
Length=449

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 53/99 (54%), Gaps = 8/99 (8%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLK----NSWESCTHKK  168
            A+ G  IT W++  L FF  F +PK+ S YS Q+       +  LK     +W +C+HK+
Sbjct  307  AEYGHLITFWRLCMLAFFIXFTIPKLYSCYSIQINQ----KVDCLKWWVLEAWGACSHKR  362

Query  169  AIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  285
             +A    T  WNLSS   RI+  F+  V  RY +Q +++
Sbjct  363  IVAASAATAFWNLSSVKTRIFTAFISLVILRYCRQHMVQ  401



>gb|EPS61322.1| hypothetical protein M569_13475, partial [Genlisea aurea]
Length=297

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            ++CG  +TV+++  L FF  F  PK+ SSYSS +             SW +C  KK IA 
Sbjct  188  SKCGHLLTVFRLCALCFFIGFTAPKLYSSYSSGVRERVESAKSWGLESWRNCRRKKMIAG  247

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  279
                  WNL+S   R++A FM  V  RY +Q +
Sbjct  248  STLMAFWNLTSTRTRLFAAFMCLVIIRYRKQGM  280



>ref|XP_010433219.1| PREDICTED: reticulon-like protein B18 [Camelina sativa]
Length=468

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 7/124 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++   GFF  F VPK+ S Y+SQ++       +R+  +W  CTHKK +  
Sbjct  315  AEYGYLITLWRLCAFGFFLSFTVPKLYSCYASQISLQVESAQKRVVEAWGICTHKKFVTG  374

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQLGRRTNLTVNANK  360
               T  WNL+S   R  AVF++ V  RY +Q+ ++       +DS ++  +        +
Sbjct  375  SAVTAFWNLTSLKTRFIAVFIIVVVIRYRRQNHLQ-------LDSEEVEEKHQEQTQPEQ  427

Query  361  LKKP  372
             K P
Sbjct  428  QKLP  431



>gb|KGN46983.1| hypothetical protein Csa_6G157090 [Cucumis sativus]
Length=426

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 5/117 (4%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+ ++  +GFF  F VPK+ + Y  Q+ +      + +  +WE+C+HKK +  
Sbjct  294  AEYGYLITLRRLCAIGFFSSFSVPKLYTCYQIQINSKVDAVKQWMFEAWEACSHKKVVIG  353

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKP-VDSRQLGRRTNLTV  348
               T  WN SS   RI+  F++ V  RY +Q +    V S+P ++  Q   +  L V
Sbjct  354  SAATAFWNFSSLKTRIFTAFIVLVIVRYCRQFI----VSSEPEIEEVQEDEKQALVV  406



>ref|XP_010489016.1| PREDICTED: reticulon-like protein B17 isoform X3 [Camelina sativa]
Length=347

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W+++  GFF  F +PK+ S Y+ Q++        R+  +W  C+HKK +A 
Sbjct  266  AEYGHLITLWRLSAFGFFLSFTIPKLYSCYTHQISQKVERVKTRIGEAWGVCSHKKILAA  325

Query  181  GIFTLAWNLSSAIARIWA  234
               T  WNL+S   RI+A
Sbjct  326  SAVTAFWNLTSIRTRIFA  343



>ref|XP_004149275.1| PREDICTED: reticulon-like protein B17-like [Cucumis sativus]
 ref|XP_004162469.1| PREDICTED: reticulon-like protein B17-like [Cucumis sativus]
Length=426

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 5/117 (4%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+ ++  +GFF  F VPK+ + Y  Q+ +      + +  +WE+C+HKK +  
Sbjct  294  AEYGYLITLRRLCAIGFFSSFSVPKLYTCYQIQINSKVDAVKQWMFEAWEACSHKKVVIG  353

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKP-VDSRQLGRRTNLTV  348
               T  WN SS   RI+  F++ V  RY +Q +    V S+P ++  Q   +  L V
Sbjct  354  SAATAFWNFSSLKTRIFTAFIVLVIVRYCRQFI----VSSEPEIEEVQEDEKQALVV  406



>gb|EMS66529.1| Reticulon-like protein B17 [Triticum urartu]
Length=232

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ GS +TVW++   GFF  F +PK+   YS+Q+       I R   +W+SC  KK +A 
Sbjct  148  AKYGSLVTVWRLLATGFFTSFTLPKLYICYSTQIHMIAENLIDRALEAWKSCPRKKFVAG  207

Query  181  GIFTLAWNLSSAIARIWA  234
               T+ WNL S   R  A
Sbjct  208  TAVTVCWNLFSVKTRFLA  225



>ref|XP_010925974.1| PREDICTED: LOW QUALITY PROTEIN: reticulon-like protein B17 [Elaeis 
guineensis]
Length=464

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 51/100 (51%), Gaps = 17/100 (17%)
 Frame = +1

Query  46   GFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNS-------WESCTHKKAIAFGIFTLAWN  204
            GFF  F  PK+ S YS  +        RR++N+       WESC  K+ IA    T+ WN
Sbjct  363  GFFLSFTAPKLYSCYSQPIH-------RRVENTRNWIQEAWESCPRKRFIAASAATVFWN  415

Query  205  LSSAIARIWAVFMLYVAFRYYQQSLM-RESVGSKPVDSRQ  321
            L S  ARI+A F+  V  RY+ Q  M  E  G K  +SR+
Sbjct  416  LFSVRARIFAAFISVVILRYHHQQRMGEEENGEK--ESRE  453



>ref|XP_010438456.1| PREDICTED: reticulon-like protein B18 [Camelina sativa]
Length=463

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 7/124 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A+ G  IT+W++   GFF  F VPK+ S Y+SQ++       +R+  +W  CTHKK +  
Sbjct  311  AEYGYLITLWRLCAFGFFLSFTVPKLYSCYASQISRQVESAQKRIVEAWGICTHKKFLTG  370

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQLGRRTNLTVNANK  360
               T  WNL+S   R  AVF++ V  RY +Q+ ++       +DS ++  +        +
Sbjct  371  SAVTAFWNLTSLKTRFIAVFIIVVVIRYRRQNHLQ-------LDSEEVEEKHQEQTQPKQ  423

Query  361  LKKP  372
             K P
Sbjct  424  QKLP  427



>ref|XP_003573179.1| PREDICTED: reticulon-like protein B17 [Brachypodium distachyon]
Length=432

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (48%), Gaps = 2/117 (2%)
 Frame = +1

Query  10   GSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAFGIF  189
            GS +TVW++   GFF  F +PK+   Y +Q+     +   R   +W SC  KK +     
Sbjct  317  GSLVTVWRLLATGFFAGFTLPKLYICYLTQIHGGVEILRDRALEAWNSCPRKKLVTATAV  376

Query  190  TLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPVDSRQLGRRTNLTVNANK  360
            T+ WNL S   R  A F+  V  R   Q   R++  +  V+  Q G+   + ++ ++
Sbjct  377  TICWNLFSIKTRFMAGFISLVILRCNHQC--RKAELNPEVECCQDGQEQEMEIDPSE  431



>ref|XP_009405079.1| PREDICTED: reticulon-like protein B17 [Musa acuminata subsp. 
malaccensis]
Length=358

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 48/97 (49%), Gaps = 0/97 (0%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYSSQLTAFGTLWIRRLKNSWESCTHKKAIAF  180
            A  G  IT+W++   GFF  F VPK+  SYS Q+       +  ++ SW SC  K+ +A 
Sbjct  239  ANYGHLITLWRLLVTGFFVSFTVPKLYLSYSQQIHRTAENAMHWVQESWISCRFKRLVAA  298

Query  181  GIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  291
               T+ WN+ S   RI+  F+  V   Y  +  + E 
Sbjct  299  SAATIFWNVFSLRTRIFTAFIFLVMLCYRHERRVGED  335



>ref|XP_001772106.1| predicted protein [Physcomitrella patens]
 gb|EDQ63050.1| predicted protein [Physcomitrella patens]
Length=857

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  142  SWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS  276
            +W+S THKKAI  G F  AWN+SS  +R+W  F+L V F+ YQQS
Sbjct  660  TWDSFTHKKAILIGGFIFAWNISSYSSRLWGGFILVVWFKLYQQS  704



>ref|XP_010070414.1| PREDICTED: reticulon-like protein B18 [Eucalyptus grandis]
 gb|KCW59182.1| hypothetical protein EUGRSUZ_H01835 [Eucalyptus grandis]
Length=138

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 47/94 (50%), Gaps = 6/94 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYS---SQLTAFGTLWIRRLKNSWESCTHKKA  171
            A+ G  IT+ ++  +GFF  F  PK+   YS   SQ       W+     +W +C+HKK 
Sbjct  13   AEYGHLITLRRLCAIGFFVSFTAPKLYLRYSARISQKVECSKWWVL---EAWVACSHKKI  69

Query  172  IAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
            +A       WNL++   R+   F+  V  RY++Q
Sbjct  70   VAASAIMAFWNLTTIKTRLLTAFISVVVLRYHRQ  103



>ref|XP_010041475.1| PREDICTED: reticulon-like protein B18 isoform X3 [Eucalyptus 
grandis]
 gb|KCW49507.1| hypothetical protein EUGRSUZ_K03028 [Eucalyptus grandis]
 gb|KCW84882.1| hypothetical protein EUGRSUZ_B01702 [Eucalyptus grandis]
Length=212

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 47/94 (50%), Gaps = 6/94 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYS---SQLTAFGTLWIRRLKNSWESCTHKKA  171
            A+ G  IT+ ++  +GFF  F  PK+   YS   SQ       W+     +W +C+HKK 
Sbjct  87   AEYGHLITLRRLCAIGFFVSFTAPKLYLRYSARISQKVECSKWWVL---EAWVACSHKKI  143

Query  172  IAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
            +A       WNL++   R+   F+  V  RY++Q
Sbjct  144  VAASAIMAFWNLTTIKTRLLTAFISVVVLRYHRQ  177



>ref|XP_010041465.1| PREDICTED: reticulon-like protein B18 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010037772.1| PREDICTED: reticulon-like protein B18 isoform X2 [Eucalyptus 
grandis]
Length=260

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 47/94 (50%), Gaps = 6/94 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYS---SQLTAFGTLWIRRLKNSWESCTHKKA  171
            A+ G  IT+ ++  +GFF  F  PK+   YS   SQ       W+     +W +C+HKK 
Sbjct  135  AEYGHLITLRRLCAIGFFVSFTAPKLYLRYSARISQKVECSKWWVL---EAWVACSHKKI  191

Query  172  IAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
            +A       WNL++   R+   F+  V  RY++Q
Sbjct  192  VAASAIMAFWNLTTIKTRLLTAFISVVVLRYHRQ  225



>ref|XP_010041454.1| PREDICTED: reticulon-like protein B18 isoform X1 [Eucalyptus 
grandis]
Length=275

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 47/94 (50%), Gaps = 6/94 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYS---SQLTAFGTLWIRRLKNSWESCTHKKA  171
            A+ G  IT+ ++  +GFF  F  PK+   YS   SQ       W+     +W +C+HKK 
Sbjct  150  AEYGHLITLRRLCAIGFFVSFTAPKLYLRYSARISQKVECSKWWVL---EAWVACSHKKI  206

Query  172  IAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
            +A       WNL++   R+   F+  V  RY++Q
Sbjct  207  VAASAIMAFWNLTTIKTRLLTAFISVVVLRYHRQ  240



>ref|XP_010052231.1| PREDICTED: reticulon-like protein B18 [Eucalyptus grandis]
 gb|KCW89569.1| hypothetical protein EUGRSUZ_A01854 [Eucalyptus grandis]
Length=435

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 47/94 (50%), Gaps = 6/94 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYS---SQLTAFGTLWIRRLKNSWESCTHKKA  171
            A+ G  IT+ ++  +GFF  F  PK+   YS   SQ       W+     +W +C+HKK 
Sbjct  310  AEYGHLITLRRLCAIGFFVSFTAPKLYLRYSARISQKVECSKWWV---LEAWGACSHKKI  366

Query  172  IAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
            +A       WNL++   R+   F+  V  RY++Q
Sbjct  367  VAASAIMAFWNLTTIKTRLLTAFISVVVLRYHRQ  400



>ref|XP_010037770.1| PREDICTED: reticulon-like protein B18 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010037771.1| PREDICTED: reticulon-like protein B18 isoform X1 [Eucalyptus 
grandis]
Length=281

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 47/94 (50%), Gaps = 6/94 (6%)
 Frame = +1

Query  1    AQCGSSITVWKMAKLGFFGVFIVPKVCSSYS---SQLTAFGTLWIRRLKNSWESCTHKKA  171
            A+ G  IT+ ++  +GFF  F  PK+   YS   SQ       W+     +W +C+HKK 
Sbjct  156  AEYGHLITLRRLCAIGFFVSFTAPKLYLRYSARISQKVECSKWWVL---EAWVACSHKKI  212

Query  172  IAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  273
            +A       WNL++   R+   F+  V  RY++Q
Sbjct  213  VAASAIMAFWNLTTIKTRLLTAFISVVVLRYHRQ  246



>ref|XP_009385021.1| PREDICTED: reticulon-like protein B21 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (53%), Gaps = 2/93 (2%)
 Frame = +3

Query  3    TMWQLH--NRMENG*IGLFWRFHCPKSLLFLLLSVNCIWYTLDSALKKLMGIVHS*ESHC  176
            T+W L   +++ +G   + W  H PK LL LL S   IW  L  A ++ MG++H  ES  
Sbjct  362  TIWSLAKLSKIRHGRQNVLWSLHHPKDLLLLLHSAGKIWQVLVGAARRWMGVMHPQESSG  421

Query  177  IWHLHAGMEFIFGHCSNLGSFHVVCGIQILSAI  275
              +L   +E +   CS+LG FH   G + L A+
Sbjct  422  HCNLRPRLEHLLHGCSHLGIFHGGGGCEALPAM  454



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 935048050050