BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20124_g1_i1 len=667 path=[272:0-261 690:262-385 295:386-666]

Length=667
                                                                      Score     E

ref|XP_009621517.1|  PREDICTED: reticulon-like protein B21              109   9e-24   
ref|XP_009760122.1|  PREDICTED: reticulon-like protein B21              108   2e-23   
ref|XP_010265609.1|  PREDICTED: reticulon-like protein B21 isofor...    105   3e-22   
ref|XP_006343731.1|  PREDICTED: reticulon-like protein B21-like         105   3e-22   
ref|XP_010323183.1|  PREDICTED: reticulon-like protein B21 isofor...    104   4e-22   
ref|XP_009587027.1|  PREDICTED: reticulon-like protein B21 isofor...    103   5e-22   
ref|XP_009587028.1|  PREDICTED: reticulon-like protein B21 isofor...    103   6e-22   
ref|XP_004242584.1|  PREDICTED: reticulon-like protein B21 isofor...    104   7e-22   
gb|EYU34355.1|  hypothetical protein MIMGU_mgv1a004061mg                102   1e-21   
gb|EYU34356.1|  hypothetical protein MIMGU_mgv1a004061mg                102   1e-21   
ref|XP_004251753.1|  PREDICTED: reticulon-like protein B21              103   1e-21   
ref|XP_009795103.1|  PREDICTED: reticulon-like protein B21              102   2e-21   
gb|KDO73071.1|  hypothetical protein CISIN_1g0072731mg                94.0    2e-20   
gb|KCW81203.1|  hypothetical protein EUGRSUZ_C02575                     100   2e-20   
ref|XP_010275780.1|  PREDICTED: reticulon-like protein B21 isofor...    100   2e-20   
ref|XP_010275779.1|  PREDICTED: reticulon-like protein B21 isofor...    100   2e-20   
ref|XP_010048815.1|  PREDICTED: reticulon-like protein B21            99.8    2e-20   
ref|XP_002309341.2|  hypothetical protein POPTR_0006s19970g           99.0    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006350096.1|  PREDICTED: reticulon-like protein B21-like       98.6    5e-20   
emb|CDP10218.1|  unnamed protein product                              98.6    6e-20   
ref|XP_011018019.1|  PREDICTED: reticulon-like protein B21 isofor...  97.8    1e-19   
ref|XP_006488206.1|  PREDICTED: reticulon-like protein B21-like       97.4    1e-19   
ref|XP_006424682.1|  hypothetical protein CICLE_v10028046mg           97.4    1e-19   
ref|XP_011079424.1|  PREDICTED: LOW QUALITY PROTEIN: reticulon-li...  97.1    1e-19   
ref|XP_010545877.1|  PREDICTED: reticulon-like protein B21            97.4    1e-19   
ref|XP_011018020.1|  PREDICTED: reticulon-like protein B21 isofor...  97.4    1e-19   
ref|XP_010110376.1|  Reticulon-like protein                           97.1    2e-19   
gb|ACJ86231.1|  unknown                                               92.0    2e-19   Medicago truncatula
gb|KDP38668.1|  hypothetical protein JCGZ_04021                       96.3    4e-19   
ref|XP_002324545.2|  hypothetical protein POPTR_0018s11750g           96.3    4e-19   Populus trichocarpa [western balsam poplar]
ref|XP_011033436.1|  PREDICTED: reticulon-like protein B21 isofor...  96.3    4e-19   
ref|XP_011033437.1|  PREDICTED: reticulon-like protein B21 isofor...  95.9    4e-19   
gb|KHN11130.1|  Reticulon-like protein B21                            95.9    4e-19   
ref|XP_003525913.2|  PREDICTED: reticulon-like protein B21-like       95.9    5e-19   
ref|XP_007138414.1|  hypothetical protein PHAVU_009G206800g           95.5    5e-19   
ref|XP_007011951.1|  Reticulon family protein, putative isoform 1     95.9    6e-19   
ref|XP_002533975.1|  hypothetical protein RCOM_0370390                94.7    8e-19   Ricinus communis
gb|KEH38077.1|  reticulon-like protein B2                             94.7    9e-19   
ref|XP_004514755.1|  PREDICTED: reticulon-like protein B21-like       94.7    9e-19   
emb|CDY55012.1|  BnaA10g29370D                                        94.4    1e-18   
emb|CDY57466.1|  BnaC09g33520D                                        93.6    2e-18   
ref|XP_009120314.1|  PREDICTED: reticulon-like protein B21            93.6    2e-18   
ref|XP_010930925.1|  PREDICTED: reticulon-like protein B21 isofor...  92.4    4e-18   
ref|XP_010930926.1|  PREDICTED: reticulon-like protein B21 isofor...  92.4    4e-18   
ref|XP_009126799.1|  PREDICTED: reticulon-like protein B21            92.4    5e-18   
emb|CDY02784.1|  BnaC02g11050D                                        92.0    5e-18   
ref|XP_008443867.1|  PREDICTED: reticulon-like protein B21            92.4    5e-18   
ref|XP_006600546.1|  PREDICTED: reticulon-like protein B21-like i...  92.4    6e-18   
ref|XP_004146687.1|  PREDICTED: reticulon-like protein B21-like       91.3    1e-17   
ref|XP_004161870.1|  PREDICTED: reticulon-like protein B21-like       90.9    1e-17   
ref|XP_006401142.1|  hypothetical protein EUTSA_v10013006mg           91.3    2e-17   
emb|CDY32734.1|  BnaA02g07960D                                        90.9    2e-17   
ref|XP_010687720.1|  PREDICTED: reticulon-like protein B21 isofor...  91.3    2e-17   
ref|XP_008394330.1|  PREDICTED: reticulon-like protein B21            85.5    2e-17   
ref|XP_011084045.1|  PREDICTED: reticulon-like protein B21            90.1    2e-17   
ref|XP_010453049.1|  PREDICTED: reticulon-like protein B21            90.1    3e-17   
ref|XP_009358457.1|  PREDICTED: reticulon-like protein B21 isofor...  90.5    3e-17   
ref|XP_010443510.1|  PREDICTED: reticulon-like protein B21            90.1    4e-17   
ref|XP_009358458.1|  PREDICTED: reticulon-like protein B21 isofor...  90.1    4e-17   
ref|XP_010483359.1|  PREDICTED: reticulon-like protein B21            89.7    4e-17   
ref|XP_007203773.1|  hypothetical protein PRUPE_ppa002580mg           90.1    5e-17   
ref|XP_003518216.1|  PREDICTED: reticulon-like protein B21-like       89.4    7e-17   
gb|KHN42814.1|  Reticulon-like protein B21                            89.4    7e-17   
dbj|BAB08870.1|  unnamed protein product                              89.4    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008242972.1|  PREDICTED: reticulon-like protein B21            88.6    1e-16   
ref|XP_006279606.1|  hypothetical protein CARUB_v10026138mg           88.2    2e-16   
ref|XP_002864543.1|  hypothetical protein ARALYDRAFT_332090           88.2    3e-16   
dbj|BAD93974.1|  putative protein                                     86.7    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200608.3|  reticulon-like protein B21                          86.7    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288712.1|  PREDICTED: reticulon-like protein B21-like       86.7    5e-16   
ref|XP_009395289.1|  PREDICTED: reticulon-like protein B21 isofor...  86.7    5e-16   
ref|XP_009395290.1|  PREDICTED: reticulon-like protein B21 isofor...  86.3    6e-16   
gb|EAZ06360.1|  hypothetical protein OsI_28590                        80.1    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_006659255.1|  PREDICTED: reticulon-like protein B21-like       84.3    2e-15   
gb|EEE68393.1|  hypothetical protein OsJ_26729                        84.7    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83262.1|  hypothetical protein OsI_28591                        84.7    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_008802355.1|  PREDICTED: reticulon-like protein B21            84.0    3e-15   
ref|NP_001061443.1|  Os08g0280600                                     80.1    5e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008790667.1|  PREDICTED: reticulon-like protein B21            82.0    1e-14   
emb|CDM82451.1|  unnamed protein product                              82.0    2e-14   
dbj|BAK07265.1|  predicted protein                                    81.6    2e-14   
ref|XP_002445424.1|  hypothetical protein SORBIDRAFT_07g018020        81.3    3e-14   Sorghum bicolor [broomcorn]
ref|XP_007149094.1|  hypothetical protein PHAVU_005G040700g           81.3    3e-14   
gb|EMT20841.1|  Reticulon-like protein B21                            80.1    4e-14   
ref|XP_010234545.1|  PREDICTED: reticulon-like protein B21            80.9    5e-14   
gb|EMS49286.1|  Reticulon-like protein B21                            80.1    8e-14   
ref|XP_010912152.1|  PREDICTED: reticulon-like protein B21 isofor...  79.7    8e-14   
ref|XP_006857216.1|  hypothetical protein AMTR_s00065p00202980        79.7    9e-14   
ref|XP_004973157.1|  PREDICTED: reticulon-like protein B21-like       79.0    2e-13   
ref|XP_009385004.1|  PREDICTED: reticulon-like protein B21 isofor...  77.8    3e-13   
ref|XP_008678514.1|  PREDICTED: reticulon-like protein B21 isofor...  74.3    6e-12   
ref|XP_009396755.1|  PREDICTED: reticulon-like protein B21 isofor...  73.9    6e-12   
gb|AFW61968.1|  hypothetical protein ZEAMMB73_167181                  74.3    7e-12   
ref|XP_006424681.1|  hypothetical protein CICLE_v10028046mg           72.0    3e-11   
ref|XP_004169596.1|  PREDICTED: reticulon-like protein B21-like       65.5    6e-10   
ref|XP_008456496.1|  PREDICTED: reticulon-like protein B21            67.0    1e-09   
ref|XP_004139257.1|  PREDICTED: uncharacterized protein LOC101208213  65.9    3e-09   
ref|XP_006600547.1|  PREDICTED: reticulon-like protein B21-like i...  65.9    3e-09   
ref|XP_010047117.1|  PREDICTED: reticulon-like protein B21            62.8    4e-08   
gb|KCW78915.1|  hypothetical protein EUGRSUZ_C00355                   62.8    4e-08   
gb|KCW78917.1|  hypothetical protein EUGRSUZ_C00355                   62.4    4e-08   
ref|XP_009587029.1|  PREDICTED: reticulon-like protein B21 isofor...  61.2    1e-07   
ref|XP_001764750.1|  predicted protein                                56.6    4e-06   
gb|KEH39173.1|  reticulon-like protein B2                             55.1    1e-05   
gb|EPS63768.1|  hypothetical protein M569_11016                       53.5    1e-05   
ref|XP_010467796.1|  PREDICTED: reticulon-like protein B17 isofor...  53.9    2e-05   
ref|XP_010467795.1|  PREDICTED: reticulon-like protein B17 isofor...  53.9    3e-05   
ref|XP_001772106.1|  predicted protein                                53.9    3e-05   
ref|XP_010490286.1|  PREDICTED: reticulon-like protein B17            53.1    4e-05   
ref|XP_010490285.1|  PREDICTED: reticulon-like protein B17            53.1    4e-05   
ref|XP_010489015.1|  PREDICTED: reticulon-like protein B17 isofor...  53.5    4e-05   
ref|XP_010489014.1|  PREDICTED: reticulon-like protein B17 isofor...  53.5    4e-05   
gb|KFK40434.1|  hypothetical protein AALP_AA3G372800                  53.5    4e-05   
ref|XP_004487260.1|  PREDICTED: reticulon-like protein B17-like       52.8    7e-05   
ref|XP_011100409.1|  PREDICTED: reticulon-like protein B17            52.4    9e-05   
emb|CDX81970.1|  BnaC08g36310D                                        52.4    9e-05   
emb|CDY13866.1|  BnaA09g43680D                                        52.4    1e-04   
ref|XP_009117478.1|  PREDICTED: reticulon-like protein B17            52.0    1e-04   
ref|XP_006297644.1|  hypothetical protein CARUB_v10013662mg           51.2    2e-04   
ref|XP_006408990.1|  hypothetical protein EUTSA_v10001984mg           51.2    2e-04   
gb|KHN01107.1|  Reticulon-like protein B17                            50.8    3e-04   
ref|XP_003526265.1|  PREDICTED: reticulon-like protein B17-like i...  50.8    3e-04   
ref|XP_006582310.1|  PREDICTED: reticulon-like protein B17-like i...  50.8    3e-04   
gb|KDP24091.1|  hypothetical protein JCGZ_25748                       50.4    4e-04   
gb|AAD21707.1|  hypothetical protein                                  50.4    4e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAO37135.1|  hypothetical protein                                  50.4    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008809421.1|  PREDICTED: reticulon-like protein B17 isofor...  50.4    4e-04   
ref|XP_008809498.1|  PREDICTED: reticulon-like protein B18 isofor...  50.4    4e-04   
ref|NP_179649.2|  reticulon-like protein B17                          50.4    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010260314.1|  PREDICTED: reticulon-like protein B17            49.3    0.001   



>ref|XP_009621517.1| PREDICTED: reticulon-like protein B21 [Nicotiana tomentosiformis]
Length=615

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 61/89 (69%), Gaps = 13/89 (15%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR---  173
            T WIRR +++WESCTHKKA+AF IFTL WNLSS  ARIWAVFMLYV FRYYQQ LM+   
Sbjct  517  TFWIRRFRDAWESCTHKKAVAFAIFTLVWNLSSIAARIWAVFMLYVGFRYYQQKLMKEGW  576

Query  174  --ESVGSKPVD--------SRQLGRRTNL  230
              E   +K  D         RQ+GRR+ L
Sbjct  577  VSEEETTKAEDYWQGKIGGQRQIGRRSTL  605



>ref|XP_009760122.1| PREDICTED: reticulon-like protein B21 [Nicotiana sylvestris]
Length=623

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 65/98 (66%), Gaps = 14/98 (14%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR---  173
            T WIRR +++WESCTHKKA+AF IFTL WNLSS  ARIWAVFMLYV FRYYQQ LM+   
Sbjct  525  TFWIRRFRDAWESCTHKKAVAFAIFTLVWNLSSIAARIWAVFMLYVGFRYYQQKLMKEGW  584

Query  174  --ESVGSKPVD--------SRQLGRRTNLTVNANKLKK  257
              E   +K  D         RQ+GRR+ + V   K KK
Sbjct  585  VSEEETTKVEDYWQGKIGGQRQIGRRSTM-VETRKQKK  621



>ref|XP_010265609.1| PREDICTED: reticulon-like protein B21 isoform X1 [Nelumbo nucifera]
Length=685

 Score =   105 bits (262),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 4/76 (5%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVG  185
             WIRR +++W SC+HKKA+AFGIFTL WNLSS +ARIWAVF+L VA +YYQQSL  E  G
Sbjct  595  FWIRRFRDAWNSCSHKKAVAFGIFTLVWNLSSTVARIWAVFVLIVALKYYQQSLFAEEWG  654

Query  186  SKPV--DSRQ--LGRR  221
             + V  DSRQ   GRR
Sbjct  655  REDVAGDSRQEESGRR  670



>ref|XP_006343731.1| PREDICTED: reticulon-like protein B21-like [Solanum tuberosum]
Length=746

 Score =   105 bits (262),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/97 (53%), Positives = 68/97 (70%), Gaps = 11/97 (11%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES-  179
            T WIRR +++WESCTHKKA+AF IFTL WNLSS  ARIWAVFMLYV FRYYQQ +M+E  
Sbjct  651  TFWIRRFRDAWESCTHKKAVAFAIFTLIWNLSSISARIWAVFMLYVGFRYYQQKMMKEGW  710

Query  180  VGSKPVD---------SRQLGRRTNLTVNANKLKKPM  263
            +G + +           R++GR++  ++ + K KK +
Sbjct  711  IGEEEITISEDYWQERQRRIGRKST-SMESKKQKKTI  746



>ref|XP_010323183.1| PREDICTED: reticulon-like protein B21 isoform X2 [Solanum lycopersicum]
Length=715

 Score =   104 bits (260),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
            T WIRR +++WESCTHKKA+AF IFTL WNLSS  ARIWAVF+LYV FRYYQQ +M+E
Sbjct  627  TFWIRRFRDAWESCTHKKAVAFAIFTLIWNLSSISARIWAVFVLYVGFRYYQQKMMKE  684



>ref|XP_009587027.1| PREDICTED: reticulon-like protein B21 isoform X1 [Nicotiana tomentosiformis]
Length=606

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 61/84 (73%), Gaps = 8/84 (10%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESV  182
            T + R ++++WESC+HKKA+ F IFTL WN SS IARIWAVFMLYV FRYYQQ+L+ E +
Sbjct  513  TFFTRCVRDAWESCSHKKAVGFAIFTLVWNFSSIIARIWAVFMLYVGFRYYQQTLITEDI  572

Query  183  GSKPVDS--------RQLGRRTNL  230
              K  DS        RQ+GR+++L
Sbjct  573  TIKADDSWQGKIREQRQIGRKSSL  596



>ref|XP_009587028.1| PREDICTED: reticulon-like protein B21 isoform X2 [Nicotiana tomentosiformis]
Length=595

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 61/84 (73%), Gaps = 8/84 (10%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESV  182
            T + R ++++WESC+HKKA+ F IFTL WN SS IARIWAVFMLYV FRYYQQ+L+ E +
Sbjct  502  TFFTRCVRDAWESCSHKKAVGFAIFTLVWNFSSIIARIWAVFMLYVGFRYYQQTLITEDI  561

Query  183  GSKPVDS--------RQLGRRTNL  230
              K  DS        RQ+GR+++L
Sbjct  562  TIKADDSWQGKIREQRQIGRKSSL  585



>ref|XP_004242584.1| PREDICTED: reticulon-like protein B21 isoform X1 [Solanum lycopersicum]
Length=738

 Score =   104 bits (259),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
            T WIRR +++WESCTHKKA+AF IFTL WNLSS  ARIWAVF+LYV FRYYQQ +M+E
Sbjct  650  TFWIRRFRDAWESCTHKKAVAFAIFTLIWNLSSISARIWAVFVLYVGFRYYQQKMMKE  707



>gb|EYU34355.1| hypothetical protein MIMGU_mgv1a004061mg [Erythranthe guttata]
Length=546

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            T WIRR +++WESC+HKKA+ F +FTL WNLSS +ARIWAVFML+VAF+YYQQSLM
Sbjct  447  TFWIRRFRDAWESCSHKKAVGFALFTLVWNLSSVVARIWAVFMLFVAFKYYQQSLM  502



>gb|EYU34356.1| hypothetical protein MIMGU_mgv1a004061mg [Erythranthe guttata]
Length=544

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            T WIRR +++WESC+HKKA+ F +FTL WNLSS +ARIWAVFML+VAF+YYQQSLM
Sbjct  445  TFWIRRFRDAWESCSHKKAVGFALFTLVWNLSSVVARIWAVFMLFVAFKYYQQSLM  500



>ref|XP_004251753.1| PREDICTED: reticulon-like protein B21 [Solanum lycopersicum]
Length=653

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 7/83 (8%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES-  179
            T +IR ++++WESCTHKKAI F IFTL WN SS IARIWAVFMLYV FRYY Q+LMRE  
Sbjct  561  TFFIRYIRDAWESCTHKKAIGFAIFTLVWNFSSIIARIWAVFMLYVGFRYYHQTLMREDT  620

Query  180  ------VGSKPVDSRQLGRRTNL  230
                  +  K    +Q+G+++N 
Sbjct  621  INSDDFLQGKISGLKQIGKKSNF  643



>ref|XP_009795103.1| PREDICTED: reticulon-like protein B21 [Nicotiana sylvestris]
Length=608

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 8/84 (10%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESV  182
            T  IR ++++WESCTHKKA+ F IFT+ WN SS IAR WAVFMLYV  RYYQQ+LM E +
Sbjct  515  TFLIRYIRDAWESCTHKKAVGFAIFTIVWNFSSIIARTWAVFMLYVGIRYYQQNLMTEDI  574

Query  183  GSKPVDS--------RQLGRRTNL  230
              K  DS        RQ+GR+++L
Sbjct  575  TIKADDSWQGKIREQRQVGRKSSL  598



>gb|KDO73071.1| hypothetical protein CISIN_1g0072731mg, partial [Citrus sinensis]
Length=135

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
             WIRR +++W+SC+HKKA+A GIFTL WNLSS IARIWA FML+VA RYYQQS++R
Sbjct  24   FWIRRFRDAWDSCSHKKAVAVGIFTLVWNLSSMIARIWAAFMLFVALRYYQQSMIR  79



>gb|KCW81203.1| hypothetical protein EUGRSUZ_C02575 [Eucalyptus grandis]
Length=691

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/57 (72%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
             WIRR +++W SC+HKKA+A GIFTL WNL S +ARIWAVFMLYVAFRYYQQ+L+ E
Sbjct  597  FWIRRFRDAWNSCSHKKAVAVGIFTLVWNLCSVVARIWAVFMLYVAFRYYQQNLVIE  653



>ref|XP_010275780.1| PREDICTED: reticulon-like protein B21 isoform X2 [Nelumbo nucifera]
Length=689

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
             WIRR +++W SC HKKA+AFGIFTL WNLSS +AR+WAVFML VAF+YYQQS++ E
Sbjct  593  FWIRRFRDAWNSCAHKKAVAFGIFTLVWNLSSIVARVWAVFMLVVAFKYYQQSVIME  649



>ref|XP_010275779.1| PREDICTED: reticulon-like protein B21 isoform X1 [Nelumbo nucifera]
Length=691

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
             WIRR +++W SC HKKA+AFGIFTL WNLSS +AR+WAVFML VAF+YYQQS++ E
Sbjct  595  FWIRRFRDAWNSCAHKKAVAFGIFTLVWNLSSIVARVWAVFMLVVAFKYYQQSVIME  651



>ref|XP_010048815.1| PREDICTED: reticulon-like protein B21 [Eucalyptus grandis]
Length=693

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/57 (72%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
             WIRR +++W SC+HKKA+A GIFTL WNL S +ARIWAVFMLYVAFRYYQQ+L+ E
Sbjct  599  FWIRRFRDAWNSCSHKKAVAVGIFTLVWNLCSVVARIWAVFMLYVAFRYYQQNLVIE  655



>ref|XP_002309341.2| hypothetical protein POPTR_0006s19970g [Populus trichocarpa]
 gb|EEE92864.2| hypothetical protein POPTR_0006s19970g [Populus trichocarpa]
Length=722

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
             WIRR +++WESC+HKKA+A GIF+L WNLSS +ARIWAVFM++VA RYYQQ++ R+
Sbjct  627  FWIRRFRDAWESCSHKKAVALGIFSLVWNLSSMVARIWAVFMMFVAVRYYQQTMERD  683



>ref|XP_006350096.1| PREDICTED: reticulon-like protein B21-like [Solanum tuberosum]
Length=644

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 10/86 (12%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESV  182
            T +IR ++++WESCTHKKAI F IFTL WN SS IARIWAVFMLYV   YYQQ+LMR+  
Sbjct  549  TFFIRYIRDAWESCTHKKAIGFAIFTLVWNFSSIIARIWAVFMLYVGLWYYQQTLMRQDT  608

Query  183  GS----------KPVDSRQLGRRTNL  230
             +          K  + RQ+G+++N 
Sbjct  609  TTTINGDDFLQGKIREQRQVGKKSNF  634



>emb|CDP10218.1| unnamed protein product [Coffea canephora]
Length=684

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVG  185
             WIRR +++WESC+HKKA+AF IFTL WNLSS +ARIWAVFML+VA+RYYQ S + E   
Sbjct  584  FWIRRFRDAWESCSHKKAVAFAIFTLVWNLSSIVARIWAVFMLFVAYRYYQPSFIGEGWA  643

Query  186  SKPVDSR  206
            +    +R
Sbjct  644  TAEEQTR  650



>ref|XP_011018019.1| PREDICTED: reticulon-like protein B21 isoform X1 [Populus euphratica]
Length=707

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
             WIRR +++WESC+HKKA+A  IFTL WNLSS +ARIWAVFM++VA RYYQQ++ R
Sbjct  609  FWIRRFRDAWESCSHKKAVALCIFTLVWNLSSMVARIWAVFMMFVAVRYYQQTMER  664



>ref|XP_006488206.1| PREDICTED: reticulon-like protein B21-like [Citrus sinensis]
Length=606

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
            WIRR +++W+SC+HKKA+A GIFTL WNLSS IARIWA FML+VA RYYQQS++R
Sbjct  496  WIRRFRDAWDSCSHKKAVAVGIFTLVWNLSSMIARIWAAFMLFVALRYYQQSMIR  550



>ref|XP_006424682.1| hypothetical protein CICLE_v10028046mg [Citrus clementina]
 gb|ESR37922.1| hypothetical protein CICLE_v10028046mg [Citrus clementina]
Length=607

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
            WIRR +++W+SC+HKKA+A GIFTL WNLSS IARIWA FML+VA RYYQQS++R
Sbjct  497  WIRRFRDAWDSCSHKKAVAVGIFTLVWNLSSMIARIWAAFMLFVALRYYQQSMIR  551



>ref|XP_011079424.1| PREDICTED: LOW QUALITY PROTEIN: reticulon-like protein B21 [Sesamum 
indicum]
Length=559

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  179
            T WIRR +++W SC+HKKA+ F +F L WNLSS +ARIWAVFML+V F+YYQQSL+R++
Sbjct  474  TFWIRRFRDAWGSCSHKKAVGFAVFALVWNLSSVVARIWAVFMLFVGFKYYQQSLVRDA  532



>ref|XP_010545877.1| PREDICTED: reticulon-like protein B21 [Tarenaya hassleriana]
Length=605

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
             W+RR +++WESCTHKKA+A  IFTL WNLSS +AR+WAVF+LYVA RYYQQ++M
Sbjct  494  FWVRRFRDAWESCTHKKAVALAIFTLVWNLSSVVARVWAVFILYVALRYYQQTIM  548



>ref|XP_011018020.1| PREDICTED: reticulon-like protein B21 isoform X2 [Populus euphratica]
Length=697

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
             WIRR +++WESC+HKKA+A  IFTL WNLSS +ARIWAVFM++VA RYYQQ++ R
Sbjct  599  FWIRRFRDAWESCSHKKAVALCIFTLVWNLSSMVARIWAVFMMFVAVRYYQQTMER  654



>ref|XP_010110376.1| Reticulon-like protein [Morus notabilis]
 gb|EXC26162.1| Reticulon-like protein [Morus notabilis]
Length=702

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/94 (47%), Positives = 61/94 (65%), Gaps = 10/94 (11%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR----  173
             W+RR +++W+SC+HKKA+   +F L WNLSS +ARIWAVFMLYVAFRYYQQ+L+R    
Sbjct  456  FWVRRFRDAWDSCSHKKAVTVAVFLLVWNLSSIVARIWAVFMLYVAFRYYQQTLVRDDWV  515

Query  174  ------ESVGSKPVDSRQLGRRTNLTVNANKLKK  257
                  E    +P+  ++ G  + +  N  K KK
Sbjct  516  EDDAEGEETWHEPIGGQRQGHGSIVVDNNTKQKK  549



>gb|ACJ86231.1| unknown [Medicago truncatula]
Length=169

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM----  170
              W+RR +++W+SCTHKKA+A GIF L WNLSS +ARIWAVF+L+VAFRYYQQ  M    
Sbjct  76   NFWVRRFRDAWDSCTHKKAVALGIFGLVWNLSSVVARIWAVFVLFVAFRYYQQHYMVRDE  135

Query  171  ---RESVGSKPVDSRQLGRRTNLTVNANKLKK  257
                E+   +  +   + ++    V  NK+KK
Sbjct  136  WVEDEAGCDEAWEEEPVRQKQRNFVATNKIKK  167



>gb|KDP38668.1| hypothetical protein JCGZ_04021 [Jatropha curcas]
Length=661

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 9/90 (10%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE---  176
             WIRRL+++W+SC+HKKA+A  IFTL WNLS+ +AR+WAVFM++VA RYYQQ +  E   
Sbjct  573  FWIRRLRDAWDSCSHKKAVALAIFTLVWNLSTMVARVWAVFMMFVAVRYYQQKMESEDWA  632

Query  177  ---SVGSKPVDSRQLGRRTNLTVNANKLKK  257
                VG   +    +G      V  NK+KK
Sbjct  633  EDDDVGDDEILRHDVGP---TPVEVNKVKK  659



>ref|XP_002324545.2| hypothetical protein POPTR_0018s11750g [Populus trichocarpa]
 gb|EEF03110.2| hypothetical protein POPTR_0018s11750g [Populus trichocarpa]
Length=711

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES-V  182
             WIRR +++WESC+HKKA+A  IFTL WNLSS +ARIWAVFM++VA RYYQQ++ R+  V
Sbjct  614  FWIRRFRDAWESCSHKKAVALCIFTLVWNLSSMVARIWAVFMMFVAVRYYQQTMERDDWV  673

Query  183  GSKPVDSRQLG  215
              + VD+   G
Sbjct  674  VEEEVDTEADG  684



>ref|XP_011033436.1| PREDICTED: reticulon-like protein B21 isoform X1 [Populus euphratica]
Length=702

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
             WIRR +++WESC+HKKA+A GIF+L W+LSS +ARIWAVFM++VA RYYQQ++ R
Sbjct  607  FWIRRFRDAWESCSHKKAVALGIFSLVWHLSSMVARIWAVFMMFVAVRYYQQTMER  662



>ref|XP_011033437.1| PREDICTED: reticulon-like protein B21 isoform X2 [Populus euphratica]
Length=699

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
             WIRR +++WESC+HKKA+A GIF+L W+LSS +ARIWAVFM++VA RYYQQ++ R
Sbjct  604  FWIRRFRDAWESCSHKKAVALGIFSLVWHLSSMVARIWAVFMMFVAVRYYQQTMER  659



>gb|KHN11130.1| Reticulon-like protein B21 [Glycine soja]
Length=664

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 13/96 (14%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRESV  182
             WIRR +++W+SCTHKKA+A GIF L WNLSS +ARIWAVF+L+ AFRYYQQ  L+R+  
Sbjct  568  FWIRRFRDAWDSCTHKKAVALGIFGLVWNLSSVVARIWAVFVLFAAFRYYQQHYLVRDEW  627

Query  183  G----------SKPVDSR-QLGRRTNLTVNANKLKK  257
            G            PV  R + G  TN + + NK+KK
Sbjct  628  GEDEAGCDETWQDPVGVRPKQGPATNFS-DTNKIKK  662



>ref|XP_003525913.2| PREDICTED: reticulon-like protein B21-like [Glycine max]
Length=664

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 13/96 (14%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRESV  182
             WIRR +++W+SCTHKKA+A GIF L WNLSS +ARIWAVF+L+ AFRYYQQ  L+R+  
Sbjct  568  FWIRRFRDAWDSCTHKKAVALGIFGLVWNLSSVVARIWAVFVLFAAFRYYQQHYLVRDEW  627

Query  183  G----------SKPVDSR-QLGRRTNLTVNANKLKK  257
            G            PV  R + G  TN + + NK+KK
Sbjct  628  GEDEAGCDETWQDPVGVRPKQGPATNFS-DTNKIKK  662



>ref|XP_007138414.1| hypothetical protein PHAVU_009G206800g [Phaseolus vulgaris]
 gb|ESW10408.1| hypothetical protein PHAVU_009G206800g [Phaseolus vulgaris]
Length=668

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRESV  182
             WIRR +++W+SC+HKKA+A GIF L WNLSS +ARIWAVF+L+VAFRYYQQ  L+R+  
Sbjct  572  FWIRRFRDAWDSCSHKKAVALGIFGLVWNLSSVVARIWAVFVLFVAFRYYQQHYLVRDEW  631

Query  183  GSK  191
            G +
Sbjct  632  GEE  634



>ref|XP_007011951.1| Reticulon family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY29570.1| Reticulon family protein, putative isoform 1 [Theobroma cacao]
Length=716

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
             WIRR +++W+SCTHKKA+A  IFTL WNLSS +ARIWA FML+VA RYYQQ ++
Sbjct  620  FWIRRFRDAWDSCTHKKAVAVAIFTLVWNLSSIVARIWAAFMLFVALRYYQQKMV  674



>ref|XP_002533975.1| hypothetical protein RCOM_0370390 [Ricinus communis]
 gb|EEF28406.1| hypothetical protein RCOM_0370390 [Ricinus communis]
Length=604

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  167
            WIRR +++W+SC+HKKA+A  IFTL WNLSS +AR+WAVFM+YVA RYYQQS+
Sbjct  508  WIRRFRDAWDSCSHKKAVALAIFTLVWNLSSMVARVWAVFMMYVAVRYYQQSM  560



>gb|KEH38077.1| reticulon-like protein B2 [Medicago truncatula]
Length=576

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
              W+RR +++W+SCTHKKA+A GIF L WNLSS +ARIWAVF+L+VAFRYYQQ  M
Sbjct  483  NFWVRRFRDAWDSCTHKKAVALGIFGLVWNLSSVVARIWAVFVLFVAFRYYQQHYM  538



>ref|XP_004514755.1| PREDICTED: reticulon-like protein B21-like [Cicer arietinum]
Length=567

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
             WIRR +++W+SCTHKKA+A GIF L WNLSS +ARIWAVF+L+VAFRYYQQ  M
Sbjct  476  FWIRRFRDAWDSCTHKKAVALGIFGLVWNLSSVVARIWAVFVLFVAFRYYQQHYM  530



>emb|CDY55012.1| BnaA10g29370D [Brassica napus]
Length=567

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 61/105 (58%), Gaps = 24/105 (23%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM-----  170
             W+RR +++WESC+HKKA+A  +FTL WNLSS +AR+WA FML+VAFRYYQQ ++     
Sbjct  464  FWMRRFRDAWESCSHKKAVALALFTLVWNLSSVVARVWAAFMLFVAFRYYQQKMIWTTDQ  523

Query  171  ----------------RESVGSKPVDSRQLGRRTNLTVNANKLKK  257
                             E +  KP+      +R   T+  NKLKK
Sbjct  524  EDDLDDEEHVDDDHVGEEELVPKPI---HKPKRATYTMMPNKLKK  565



>emb|CDY57466.1| BnaC09g33520D [Brassica napus]
Length=586

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
             W+RR +++WESC HKKA+A  +FTL WNLSS +AR+WA FML+VAFRYYQQ ++
Sbjct  484  FWVRRFRDAWESCNHKKAVALALFTLVWNLSSVVARVWAAFMLFVAFRYYQQKMI  538



>ref|XP_009120314.1| PREDICTED: reticulon-like protein B21 [Brassica rapa]
 ref|XP_009120315.1| PREDICTED: reticulon-like protein B21 [Brassica rapa]
Length=580

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
             W+RR +++WESC+HKKA+A  +FTL WNLSS +AR+WA FML+VAFRYYQQ ++
Sbjct  477  FWMRRFRDAWESCSHKKAVALALFTLVWNLSSVVARVWAAFMLFVAFRYYQQKMI  531



>ref|XP_010930925.1| PREDICTED: reticulon-like protein B21 isoform X1 [Elaeis guineensis]
Length=518

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS  188
            W+ R+++ WESCTHKKA+A  IFTL WNLSSA+ARIWAVFML VAF++YQQ ++ E  G 
Sbjct  418  WLERIRDGWESCTHKKAVAAAIFTLIWNLSSAVARIWAVFMLVVAFKFYQQCIVDEWSGQ  477

Query  189  KPVDSRQLGRRTNLTVN  239
            + V   +    + L  N
Sbjct  478  EDVGVEEGQEDSKLGQN  494



>ref|XP_010930926.1| PREDICTED: reticulon-like protein B21 isoform X2 [Elaeis guineensis]
Length=517

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS  188
            W+ R+++ WESCTHKKA+A  IFTL WNLSSA+ARIWAVFML VAF++YQQ ++ E  G 
Sbjct  417  WLERIRDGWESCTHKKAVAAAIFTLIWNLSSAVARIWAVFMLVVAFKFYQQCIVDEWSGQ  476

Query  189  KPVDSRQLGRRTNLTVN  239
            + V   +    + L  N
Sbjct  477  EDVGVEEGQEDSKLGQN  493



>ref|XP_009126799.1| PREDICTED: reticulon-like protein B21 [Brassica rapa]
Length=558

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            W+RR K++WE+C HKKA+A  +FTL WNLSS +AR+WA FML+VAFRYYQQ+++
Sbjct  459  WLRRFKDAWETCNHKKAVALALFTLVWNLSSVVARVWAAFMLFVAFRYYQQNMI  512



>emb|CDY02784.1| BnaC02g11050D [Brassica napus]
Length=497

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
             W+RR K++WE+C HKKA+A  +FTL WNLSS +AR+WA FML+VAFRYYQQ ++
Sbjct  390  FWLRRFKDAWETCNHKKAVALALFTLVWNLSSVVARVWAAFMLFVAFRYYQQKMI  444



>ref|XP_008443867.1| PREDICTED: reticulon-like protein B21 [Cucumis melo]
Length=554

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
             W+RR +++WESC+HKK +A  IF L WNLSS +AR+WA FML+VAFRYYQQS+  E
Sbjct  452  FWVRRFRDAWESCSHKKGVALAIFVLVWNLSSVVARVWAAFMLFVAFRYYQQSIQTE  508



>ref|XP_006600546.1| PREDICTED: reticulon-like protein B21-like isoform X1 [Glycine 
max]
 gb|KHN18320.1| Reticulon-like protein B21 [Glycine soja]
Length=609

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 51/61 (84%), Gaps = 1/61 (2%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRES  179
              WIRR +++W+SC+HKKA+A GIF L WNLSS +ARIW+VF+L+VAFRYYQQ  L+RE 
Sbjct  509  NFWIRRFRDAWDSCSHKKAVALGIFGLVWNLSSVVARIWSVFVLFVAFRYYQQHYLVREE  568

Query  180  V  182
            +
Sbjct  569  L  569



>ref|XP_004146687.1| PREDICTED: reticulon-like protein B21-like [Cucumis sativus]
 gb|KGN65248.1| hypothetical protein Csa_1G269900 [Cucumis sativus]
Length=555

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  167
             WIRR +++WESC+HKK +A  IF L WNLSS +AR+WA FML+VAFRYYQQS+
Sbjct  452  FWIRRFRDAWESCSHKKGVALAIFVLVWNLSSVVARVWAAFMLFVAFRYYQQSI  505



>ref|XP_004161870.1| PREDICTED: reticulon-like protein B21-like [Cucumis sativus]
Length=555

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  167
             WIRR +++WESC+HKK +A  IF L WNLSS +AR+WA FML+VAFRYYQQS+
Sbjct  452  FWIRRFRDAWESCSHKKGVALAIFVLVWNLSSVVARVWAAFMLFVAFRYYQQSI  505



>ref|XP_006401142.1| hypothetical protein EUTSA_v10013006mg [Eutrema salsugineum]
 gb|ESQ42595.1| hypothetical protein EUTSA_v10013006mg [Eutrema salsugineum]
Length=608

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            W RR +++WESCTHKKA+A  +FTL WNLSS +AR+WA FML+VA RYYQQ+++
Sbjct  504  WFRRFRDAWESCTHKKAVALALFTLVWNLSSVVARVWAAFMLFVALRYYQQNMI  557



>emb|CDY32734.1| BnaA02g07960D [Brassica napus]
Length=564

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            W+RR +++WE+C HKKA+A  +FTL WNLSS +AR+WA FML+VAFRYYQQ ++
Sbjct  464  WLRRFRDAWETCNHKKAVALALFTLVWNLSSVVARVWAAFMLFVAFRYYQQKMI  517



>ref|XP_010687720.1| PREDICTED: reticulon-like protein B21 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=649

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRES  179
            W+RR +++WESC+HKKA+AF IFTL WN SS +AR WA F+L+VAFRYYQQSL  + 
Sbjct  554  WVRRFQDAWESCSHKKALAFTIFTLVWNYSSVVARAWAAFILFVAFRYYQQSLTTDD  610



>ref|XP_008394330.1| PREDICTED: reticulon-like protein B21 [Malus domestica]
Length=134

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVG  185
             W+RR +++WESCTHKK +   IF L WNLSS +ARIWA F+L VAFRYYQQ L+ E   
Sbjct  34   FWVRRFRDAWESCTHKKPLTIAIFLLVWNLSSVVARIWAAFILLVAFRYYQQKLVAEEWA  93

Query  186  SKPVD  200
             +  D
Sbjct  94   EESDD  98



>ref|XP_011084045.1| PREDICTED: reticulon-like protein B21 [Sesamum indicum]
Length=541

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  161
            T WI R+   WESC+HKKA+ FG+FTL WNLSS +ARIWAVF+L+VAF+YY Q
Sbjct  446  TFWIGRVGERWESCSHKKAVGFGVFTLVWNLSSVVARIWAVFVLFVAFKYYHQ  498



>ref|XP_010453049.1| PREDICTED: reticulon-like protein B21 [Camelina sativa]
Length=591

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
              WIRR +++WESC HKKA+A  +FTL WNLSS  AR+WA FML+VA RYYQQ+++
Sbjct  484  NFWIRRFRDAWESCNHKKAVALALFTLVWNLSSVTARVWAAFMLFVALRYYQQNMI  539



>ref|XP_009358457.1| PREDICTED: reticulon-like protein B21 isoform X1 [Pyrus x bretschneideri]
Length=749

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVG  185
             W+RR +++WESCTHKK +   +F L WNLSS +ARIWA F+L VAFRYYQQ L+ E   
Sbjct  653  FWVRRFRDAWESCTHKKPLTIAVFLLVWNLSSVVARIWAAFILLVAFRYYQQKLVAEEWA  712

Query  186  SKPVDS  203
             +  D+
Sbjct  713  EESDDT  718



>ref|XP_010443510.1| PREDICTED: reticulon-like protein B21 [Camelina sativa]
Length=633

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            WIRR +++WESC HKKA+A  +FTL WNLSS  AR+WA FML+VA RYYQQ+++
Sbjct  531  WIRRFRDAWESCNHKKAVALALFTLVWNLSSVTARVWAAFMLFVALRYYQQNMI  584



>ref|XP_009358458.1| PREDICTED: reticulon-like protein B21 isoform X2 [Pyrus x bretschneideri]
Length=710

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVG  185
             W+RR +++WESCTHKK +   +F L WNLSS +ARIWA F+L VAFRYYQQ L+ E   
Sbjct  614  FWVRRFRDAWESCTHKKPLTIAVFLLVWNLSSVVARIWAAFILLVAFRYYQQKLVAEEWA  673

Query  186  SKPVDS  203
             +  D+
Sbjct  674  EESDDT  679



>ref|XP_010483359.1| PREDICTED: reticulon-like protein B21 [Camelina sativa]
Length=590

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
              WIRR +++WESC HKKA+A  +FTL WNLSS  AR+WA FML+VA RYYQQ+++
Sbjct  485  NFWIRRFRDAWESCNHKKAVALALFTLVWNLSSVTARVWAAFMLFVALRYYQQNMV  540



>ref|XP_007203773.1| hypothetical protein PRUPE_ppa002580mg [Prunus persica]
 gb|EMJ04972.1| hypothetical protein PRUPE_ppa002580mg [Prunus persica]
Length=656

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
            WIRR +++WESCTHKKA+   IF L WNLSS +ARIWA F+L VAFRYYQQ L+ E
Sbjct  550  WIRRFRDAWESCTHKKALTVAIFLLVWNLSSVVARIWAAFILVVAFRYYQQKLVTE  605



>ref|XP_003518216.1| PREDICTED: reticulon-like protein B21-like [Glycine max]
Length=608

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRES  179
              WIRR +++W SC+HKKA+A GIF L WNLSS +ARIW+VF+L+VAFRYYQQ  L+R+ 
Sbjct  508  NFWIRRFRDAWVSCSHKKAVALGIFGLVWNLSSVVARIWSVFVLFVAFRYYQQHYLVRDG  567



>gb|KHN42814.1| Reticulon-like protein B21 [Glycine soja]
Length=608

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS-LMRES  179
              WIRR +++W SC+HKKA+A GIF L WNLSS +ARIW+VF+L+VAFRYYQQ  L+R+ 
Sbjct  508  NFWIRRFRDAWVSCSHKKAVALGIFGLVWNLSSVVARIWSVFVLFVAFRYYQQHYLVRDG  567



>dbj|BAB08870.1| unnamed protein product [Arabidopsis thaliana]
Length=1065

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
             W+RR +++WESC HKKA+A  +FTL WNLSS  AR+WA FML VAFRYYQ  ++
Sbjct  489  FWMRRFRDAWESCNHKKAVALALFTLVWNLSSVTARVWAAFMLLVAFRYYQHKMI  543



>ref|XP_008242972.1| PREDICTED: reticulon-like protein B21 [Prunus mume]
Length=670

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            WIRR +++WESCTHKKA+   IF L WNLSS +ARIWA F+L VAFRYYQQ L+
Sbjct  562  WIRRFRDAWESCTHKKALTVAIFLLVWNLSSVVARIWAAFILVVAFRYYQQKLV  615



>ref|XP_006279606.1| hypothetical protein CARUB_v10026138mg [Capsella rubella]
 gb|EOA12504.1| hypothetical protein CARUB_v10026138mg [Capsella rubella]
Length=586

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
              W+RR +++WESC HKKA+A  +FTL WNLSS  AR+WA FML+VA RYYQQ ++
Sbjct  483  NFWMRRFRDAWESCNHKKAVALALFTLVWNLSSVTARVWAAFMLFVALRYYQQKMI  538



>ref|XP_002864543.1| hypothetical protein ARALYDRAFT_332090 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40802.1| hypothetical protein ARALYDRAFT_332090 [Arabidopsis lyrata subsp. 
lyrata]
Length=1006

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
             W+RR +++WESC HKKA++  +FTL WNLSS  AR+WA FML VAFRYYQ  ++
Sbjct  414  FWMRRFRDAWESCNHKKAVSLALFTLVWNLSSVTARVWAAFMLLVAFRYYQHKMI  468



>dbj|BAD93974.1| putative protein [Arabidopsis thaliana]
Length=487

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
              W+RR +++WESC HKKA+A  +FTL WNLSS  AR+WA FML VAFRYYQ  ++
Sbjct  386  NFWMRRFRDAWESCNHKKAVALALFTLVWNLSSVTARVWAAFMLLVAFRYYQHKMI  441



>ref|NP_200608.3| reticulon-like protein B21 [Arabidopsis thaliana]
 sp|Q56X72.2|RTNLS_ARATH RecName: Full=Reticulon-like protein B21; Short=AtRTNLB21 [Arabidopsis 
thaliana]
 gb|AED96983.1| reticulon-like protein B21 [Arabidopsis thaliana]
Length=487

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
              W+RR +++WESC HKKA+A  +FTL WNLSS  AR+WA FML VAFRYYQ  ++
Sbjct  386  NFWMRRFRDAWESCNHKKAVALALFTLVWNLSSVTARVWAAFMLLVAFRYYQHKMI  441



>ref|XP_004288712.1| PREDICTED: reticulon-like protein B21-like [Fragaria vesca subsp. 
vesca]
Length=671

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
             W+RR +++W+SCTHK+A+   IF L WNLSS  ARIWA F+L VAFRYYQQ L+ E
Sbjct  578  FWVRRFRDAWDSCTHKRAVTIAIFLLVWNLSSVGARIWAAFILVVAFRYYQQKLVAE  634



>ref|XP_009395289.1| PREDICTED: reticulon-like protein B21 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=589

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
              W+ R+++ WESC+HKKA+A  IFTL WN+SS +ARIWAVFML VA +YYQQ +  E
Sbjct  484  NFWVERIRDGWESCSHKKAVAAAIFTLIWNISSTVARIWAVFMLVVAVKYYQQCVAEE  541



>ref|XP_009395290.1| PREDICTED: reticulon-like protein B21 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=568

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
              W+ R+++ WESC+HKKA+A  IFTL WN+SS +ARIWAVFML VA +YYQQ +  E
Sbjct  463  NFWVERIRDGWESCSHKKAVAAAIFTLIWNISSTVARIWAVFMLVVAVKYYQQCVAEE  520



>gb|EAZ06360.1| hypothetical protein OsI_28590 [Oryza sativa Indica Group]
Length=137

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
             W+ R ++ WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ +M
Sbjct  5    FWLERFRDGWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMM  59



>ref|XP_006659255.1| PREDICTED: reticulon-like protein B21-like [Oryza brachyantha]
Length=467

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS  188
            W+ RL++ WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ +M     S
Sbjct  343  WLERLRDGWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMMEYGWSS  402

Query  189  KPVDSRQLGRRTNLTVNANKLKKPM*ELLHMCYKFSTLAK  308
               D+++ G      V       P     H    F   A 
Sbjct  403  TVEDAQEAGDDEPPQVETPARSSPAKAQDHEAQAFGAAAP  442



>gb|EEE68393.1| hypothetical protein OsJ_26729 [Oryza sativa Japonica Group]
Length=673

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVG  185
             W+ R ++ WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ +M     
Sbjct  541  FWLERFRDGWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMMEYGWS  600

Query  186  SKPVDSRQ  209
            S   DS++
Sbjct  601  STVEDSQE  608



>gb|EEC83262.1| hypothetical protein OsI_28591 [Oryza sativa Indica Group]
Length=740

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVG  185
             W+ R ++ WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ +M     
Sbjct  608  FWLERFRDGWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMMEYGWS  667

Query  186  SKPVDSRQ  209
            S   DS++
Sbjct  668  STVEDSQE  675



>ref|XP_008802355.1| PREDICTED: reticulon-like protein B21 [Phoenix dactylifera]
Length=526

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
            W+ R ++ WE+CTHKKA+A  IFTL WN+SS +ARIWAVFML VA ++YQQ +  E
Sbjct  426  WLERFRDGWETCTHKKAVAAAIFTLVWNISSTVARIWAVFMLVVAVKFYQQHVADE  481



>ref|NP_001061443.1| Os08g0280600 [Oryza sativa Japonica Group]
 dbj|BAC99407.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23357.1| Os08g0280600 [Oryza sativa Japonica Group]
Length=182

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVG  185
             W+ R ++ WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ +M     
Sbjct  50   FWLERFRDGWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMMEYGWS  109

Query  186  SKPVDSRQ  209
            S   DS++
Sbjct  110  STVEDSQE  117



>ref|XP_008790667.1| PREDICTED: reticulon-like protein B21 [Phoenix dactylifera]
Length=533

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            W+ R ++ WESCTHKKA+   IFTL WNLSS +ARIWAVFML VA ++YQQ ++
Sbjct  436  WLERTRDGWESCTHKKAVVAAIFTLIWNLSSIVARIWAVFMLVVAVKFYQQCIV  489



>emb|CDM82451.1| unnamed protein product [Triticum aestivum]
Length=576

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            W+ R +++WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ LM
Sbjct  452  WLERFRDAWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRLM  505



>dbj|BAK07265.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=606

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            W+ R +++WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ +M
Sbjct  482  WLERFRDAWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMM  535



>ref|XP_002445424.1| hypothetical protein SORBIDRAFT_07g018020 [Sorghum bicolor]
 gb|EES14919.1| hypothetical protein SORBIDRAFT_07g018020 [Sorghum bicolor]
Length=591

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            W+ RL+++WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ ++
Sbjct  471  WLERLRDAWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAIKCYQQRMV  524



>ref|XP_007149094.1| hypothetical protein PHAVU_005G040700g [Phaseolus vulgaris]
 gb|ESW21088.1| hypothetical protein PHAVU_005G040700g [Phaseolus vulgaris]
Length=613

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  161
              WI R +++W+SC+HKK +A  IF L WNLSS +AR+W+VF+L+VAFRYYQQ
Sbjct  513  NFWIGRFRDAWDSCSHKKLVALAIFGLVWNLSSFVARVWSVFVLFVAFRYYQQ  565



>gb|EMT20841.1| Reticulon-like protein B21 [Aegilops tauschii]
Length=431

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
             W+ R +++WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ +M
Sbjct  306  FWLERFRDAWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMM  360



>ref|XP_010234545.1| PREDICTED: reticulon-like protein B21 [Brachypodium distachyon]
Length=618

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            W+ R +++WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ +M
Sbjct  498  WLERFRDAWESCSHKKAVVAAMFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMM  551



>gb|EMS49286.1| Reticulon-like protein B21 [Triticum urartu]
Length=694

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            W+ R +++WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ +M
Sbjct  491  WLERFRDAWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAMKCYQQRMM  544



>ref|XP_010912152.1| PREDICTED: reticulon-like protein B21 isoform X1 [Elaeis guineensis]
Length=536

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS  188
            W+ R ++ WE+CTHKKA+A  +FTL WNLSS +ARIWAVFML V  + YQQ +  E  G 
Sbjct  436  WLERFRDGWETCTHKKAVAAAMFTLIWNLSSTVARIWAVFMLVVVVKCYQQHVADEWNGQ  495

Query  189  KPV  197
            + V
Sbjct  496  EEV  498



>ref|XP_006857216.1| hypothetical protein AMTR_s00065p00202980 [Amborella trichopoda]
 gb|ERN18683.1| hypothetical protein AMTR_s00065p00202980 [Amborella trichopoda]
Length=596

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            W RR +++W SC+HKKA+A   F + WNLSS +ARIWA F+L VA RYYQQSL+
Sbjct  493  WFRRFRDAWNSCSHKKAVAIAAFMVIWNLSSVVARIWAAFILIVAVRYYQQSLI  546



>ref|XP_004973157.1| PREDICTED: reticulon-like protein B21-like [Setaria italica]
Length=651

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            W+ R  ++WESC+HKKA+   +FTL WN+SS +AR+WAVFML VA + YQQ ++
Sbjct  523  WLERFSDAWESCSHKKAVVAAVFTLVWNVSSTVARVWAVFMLVVAMKLYQQRMV  576



>ref|XP_009385004.1| PREDICTED: reticulon-like protein B21 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385013.1| PREDICTED: reticulon-like protein B21 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=503

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  161
            W+ RL + WESCTHKKA+A  IF L WN+SS +ARIWA FM+ VA + YQQ
Sbjct  395  WLERLGDGWESCTHKKAVATAIFALVWNISSTVARIWAFFMVVVAVKLYQQ  445



>ref|XP_008678514.1| PREDICTED: reticulon-like protein B21 isoform X3 [Zea mays]
Length=653

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  161
            W+ RL+++WESCTHKKA+    FTL WN+SS  +R+WAVFML VA + Y Q
Sbjct  529  WLERLRDAWESCTHKKAVVAAAFTLVWNVSSTASRVWAVFMLAVAVKCYHQ  579



>ref|XP_009396755.1| PREDICTED: reticulon-like protein B21 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=491

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  161
            W+ RL++ WESCTHK+A A  IF L WN+SSA+ARIWA FML VA + YQQ
Sbjct  376  WLDRLRDGWESCTHKRAAAAAIFALIWNISSAVARIWAFFMLVVAVKLYQQ  426



>gb|AFW61968.1| hypothetical protein ZEAMMB73_167181 [Zea mays]
Length=616

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  161
            W+ RL+++WESCTHKKA+    FTL WN+SS  +R+WAVFML VA + Y Q
Sbjct  492  WLERLRDAWESCTHKKAVVAAAFTLVWNVSSTASRVWAVFMLAVAVKCYHQ  542



>ref|XP_006424681.1| hypothetical protein CICLE_v10028046mg [Citrus clementina]
 gb|ESR37921.1| hypothetical protein CICLE_v10028046mg [Citrus clementina]
Length=539

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVF  128
             WIRR +++W+SC+HKKA+A GIFTL WNLSS IARIWAV+
Sbjct  496  FWIRRFRDAWDSCSHKKAVAVGIFTLVWNLSSMIARIWAVY  536



>ref|XP_004169596.1| PREDICTED: reticulon-like protein B21-like [Cucumis sativus]
Length=188

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 4/83 (5%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS  188
            W++   +SW+ C+HK+ +   IF L WN SS + R+WA F++ V+FRYYQ+S  R+    
Sbjct  108  WLKLCGSSWKLCSHKRGVFIAIFFLVWNFSSTLYRVWAAFIVLVSFRYYQESPERDVW--  165

Query  189  KPVDSRQLGRRTNLTVNANKLKK  257
              V + ++  R      ++KLKK
Sbjct  166  --VKNGEVASRNKTMSTSSKLKK  186



>ref|XP_008456496.1| PREDICTED: reticulon-like protein B21 [Cucumis melo]
Length=447

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 4/83 (5%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGS  188
            W++   +SW+ C+HK+ +   IF L WN SS + R+WA F++ V+FRYYQ+S  R+    
Sbjct  367  WLKLCGSSWKLCSHKRGVFVAIFFLVWNFSSTLYRVWAAFIVLVSFRYYQESPERDVW--  424

Query  189  KPVDSRQLGRRTNLTVNANKLKK  257
              V + ++  R N    ++KLK+
Sbjct  425  --VKNGEVASRNNTVSTSSKLKR  445



>ref|XP_004139257.1| PREDICTED: uncharacterized protein LOC101208213 [Cucumis sativus]
 gb|KGN60763.1| hypothetical protein Csa_2G009500 [Cucumis sativus]
Length=444

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
            W++   +SW+ C+HK+ +   IF L WN SS + R+WA F++ V+FRYYQ+S  R+
Sbjct  364  WLKLCGSSWKLCSHKRGVFIAIFFLVWNFSSTLYRVWAAFIVLVSFRYYQESPERD  419



>ref|XP_006600547.1| PREDICTED: reticulon-like protein B21-like isoform X2 [Glycine 
max]
Length=556

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWA  122
              WIRR +++W+SC+HKKA+A GIF L WNLSS +ARIW+
Sbjct  509  NFWIRRFRDAWDSCSHKKAVALGIFGLVWNLSSVVARIWS  548



>ref|XP_010047117.1| PREDICTED: reticulon-like protein B21 [Eucalyptus grandis]
 gb|KCW78916.1| hypothetical protein EUGRSUZ_C00355 [Eucalyptus grandis]
Length=601

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVG  185
            + I+  ++SW  C+HKK IA   F++ W+ SS + R+W VF  Y+AFRYY+Q+    S G
Sbjct  508  VLIQLFRDSWGVCSHKKVIAAITFSIFWSFSSIVGRVWGVFFAYIAFRYYEQTTRDGSAG  567

Query  186  S  188
            +
Sbjct  568  N  568



>gb|KCW78915.1| hypothetical protein EUGRSUZ_C00355 [Eucalyptus grandis]
Length=607

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVG  185
            + I+  ++SW  C+HKK IA   F++ W+ SS + R+W VF  Y+AFRYY+Q+    S G
Sbjct  508  VLIQLFRDSWGVCSHKKVIAAITFSIFWSFSSIVGRVWGVFFAYIAFRYYEQTTRDGSAG  567

Query  186  S  188
            +
Sbjct  568  N  568



>gb|KCW78917.1| hypothetical protein EUGRSUZ_C00355 [Eucalyptus grandis]
Length=579

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  6    LWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVG  185
            + I+  ++SW  C+HKK IA   F++ W+ SS + R+W VF  Y+AFRYY+Q+    S G
Sbjct  486  VLIQLFRDSWGVCSHKKVIAAITFSIFWSFSSIVGRVWGVFFAYIAFRYYEQTTRDGSAG  545

Query  186  S  188
            +
Sbjct  546  N  546



>ref|XP_009587029.1| PREDICTED: reticulon-like protein B21 isoform X3 [Nicotiana tomentosiformis]
Length=553

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    TLWIRRLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWA  122
            T + R ++++WESC+HKKA+ F IFTL WN SS IARIWA
Sbjct  513  TFFTRCVRDAWESCSHKKAVGFAIFTLVWNFSSIIARIWA  552



>ref|XP_001764750.1| predicted protein [Physcomitrella patens]
 gb|EDQ70449.1| predicted protein [Physcomitrella patens]
Length=922

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS  164
            R + +W+S THKKAI  G F LAWN SS  +R W  F+L V  + YQQS
Sbjct  604  RGRATWDSFTHKKAILLGGFLLAWNTSSYSSRFWGGFILMVWLKLYQQS  652



>gb|KEH39173.1| reticulon-like protein B2 [Medicago truncatula]
Length=394

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +3

Query  27   NSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE-SVGSKPVDS  203
            ++W +CTHKK +   +    WNLSS   RI+  FML V FRY +Q ++++   G   VD 
Sbjct  301  DTWCACTHKKKLMVSVLLTFWNLSSIKTRIFTAFMLLVLFRYLKQHVVQQLQDGEAQVDE  360

Query  204  RQLGRRTNLTVNANK  248
            ++  ++  + V   +
Sbjct  361  KEQQKKEPVVVKTEE  375



>gb|EPS63768.1| hypothetical protein M569_11016, partial [Genlisea aurea]
Length=214

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  9    WIRRLKNSWESCTHKKAIAFGIFTLAWN-LSSAIARIWAVFMLYVAFRYYQQS  164
            W RR +++WESC+HKK +AF +F L WN +   + R+W  FML+VAF+ Y++S
Sbjct  162  WTRRFRDAWESCSHKKVVAFVVFALVWNSMMPLVTRLWTAFMLFVAFKNYRES  214



>ref|XP_010467796.1| PREDICTED: reticulon-like protein B17 isoform X2 [Camelina sativa]
Length=451

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPV  197
            R+  +W  C+HKK +A    T  WNL+S   RI+AVF++ V FRY +Q+L       KPV
Sbjct  330  RIGEAWGVCSHKKILAASAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLEINPEEVKPV  389

Query  198  DSRQ  209
            ++ +
Sbjct  390  ENEK  393



>ref|XP_010467795.1| PREDICTED: reticulon-like protein B17 isoform X1 [Camelina sativa]
Length=454

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPV  197
            R+  +W  C+HKK +A    T  WNL+S   RI+AVF++ V FRY +Q+L       KPV
Sbjct  333  RIGEAWGVCSHKKILAASAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLEINPEEVKPV  392

Query  198  DSRQ  209
            ++ +
Sbjct  393  ENEK  396



>ref|XP_001772106.1| predicted protein [Physcomitrella patens]
 gb|EDQ63050.1| predicted protein [Physcomitrella patens]
Length=857

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  30   SWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS  164
            +W+S THKKAI  G F  AWN+SS  +R+W  F+L V F+ YQQS
Sbjct  660  TWDSFTHKKAILIGGFIFAWNISSYSSRLWGGFILVVWFKLYQQS  704



>ref|XP_010490286.1| PREDICTED: reticulon-like protein B17, partial [Camelina sativa]
Length=293

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPV  197
            R+  +W  C+HKK +A    T  WNL+S   RI+A+F++ V FRY +Q+L       +PV
Sbjct  178  RIGEAWGVCSHKKILAASAVTAFWNLTSIRTRIFAIFIILVIFRYRRQNLELNPEEDEPV  237

Query  198  DSRQ  209
            ++ +
Sbjct  238  ENEK  241



>ref|XP_010490285.1| PREDICTED: reticulon-like protein B17 [Camelina sativa]
Length=290

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPV  197
            R+  +W  C+HKK +A    T  WNL+S   RI+A+F++ V FRY +Q+L       +PV
Sbjct  175  RIGEAWGVCSHKKILAASAVTAFWNLTSIRTRIFAIFIILVIFRYRRQNLELNPEEDEPV  234

Query  198  DSRQ  209
            ++ +
Sbjct  235  ENEK  238



>ref|XP_010489015.1| PREDICTED: reticulon-like protein B17 isoform X2 [Camelina sativa]
Length=421

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPV  197
            R+  +W  C+HKK +A    T  WNL+S   RI+A+F++ V FRY +Q+L       +PV
Sbjct  306  RIGEAWGVCSHKKILAASAVTAFWNLTSIRTRIFAIFIILVIFRYRRQNLELNPEEDEPV  365

Query  198  DSRQ  209
            ++ +
Sbjct  366  ENEK  369



>ref|XP_010489014.1| PREDICTED: reticulon-like protein B17 isoform X1 [Camelina sativa]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPV  197
            R+  +W  C+HKK +A    T  WNL+S   RI+A+F++ V FRY +Q+L       +PV
Sbjct  309  RIGEAWGVCSHKKILAASAVTAFWNLTSIRTRIFAIFIILVIFRYRRQNLELNPEEDEPV  368

Query  198  DSRQ  209
            ++ +
Sbjct  369  ENEK  372



>gb|KFK40434.1| hypothetical protein AALP_AA3G372800 [Arabis alpina]
Length=425

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM  170
            R+  +WE C+HKK +A    T  WNL+S   RI+AVF++ V FRY +Q+L 
Sbjct  326  RIGEAWEMCSHKKILAGSAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLQ  376



>ref|XP_004487260.1| PREDICTED: reticulon-like protein B17-like [Cicer arietinum]
Length=402

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +3

Query  21   LKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE-SVGSKPV  197
            L  +W +CTHKK +   I    WNLSS   RI+  FML V FRY +Q ++++   G   V
Sbjct  301  LLETWCACTHKKKVMASILLTFWNLSSVKTRIFTAFMLLVLFRYLKQRVVQQLQDGEAQV  360

Query  198  DSRQLGRRTNLTVNANK  248
              ++  ++ ++ V   +
Sbjct  361  GEKEQQKKESVVVETEE  377



>ref|XP_011100409.1| PREDICTED: reticulon-like protein B17 [Sesamum indicum]
Length=444

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +3

Query  27   NSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  161
            N+WESCTHKK +A    T  WNL+S   RI+A F+  V  RY +Q
Sbjct  352  NAWESCTHKKVVAASAVTAFWNLTSIRTRIFAAFLCLVILRYRRQ  396



>emb|CDX81970.1| BnaC08g36310D [Brassica napus]
Length=437

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
            R+  +W+ C+HKK +A    T  WNL+S   RI+AVF++ V FRY +Q+L++
Sbjct  339  RIGEAWQVCSHKKILAGSAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLVQ  390



>emb|CDY13866.1| BnaA09g43680D [Brassica napus]
Length=451

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
            R+  +W+ C+HKK +A    T  WNL+S   RI+AVF++ V FRY +Q+L++
Sbjct  339  RIGEAWQVCSHKKILAGSAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLVQ  390



>ref|XP_009117478.1| PREDICTED: reticulon-like protein B17 [Brassica rapa]
Length=513

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
            R+  +W+ C+HKK +A    T  WNL+S   RI+AVF++ V FRY +Q+L++
Sbjct  401  RIGEAWQVCSHKKILAGSAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNLVQ  452



>ref|XP_006297644.1| hypothetical protein CARUB_v10013662mg [Capsella rubella]
 gb|EOA30542.1| hypothetical protein CARUB_v10013662mg [Capsella rubella]
Length=458

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 6/75 (8%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQS--LMRESV---  182
            R+  +W  C+HKK +A    T  WNL+S   RI+AVF++ V FRY +Q+  L  E V   
Sbjct  341  RIGEAWGVCSHKKILAGSAVTAFWNLTSIRTRIFAVFIILVIFRYKRQNIELYPEEVEPV  400

Query  183  -GSKPVDSRQLGRRT  224
               KPV+  +  + T
Sbjct  401  EDDKPVEDDKPEKET  415



>ref|XP_006408990.1| hypothetical protein EUTSA_v10001984mg [Eutrema salsugineum]
 gb|ESQ50443.1| hypothetical protein EUTSA_v10001984mg [Eutrema salsugineum]
Length=456

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRESVGSKPV  197
            R+  +W  C+HKK +A    T  WNL+S   RI+AVF++ V  RY +Q+L       +PV
Sbjct  353  RIGEAWGVCSHKKILAGSAVTAFWNLTSIRTRIFAVFIILVILRYRRQNLQLNPDEVEPV  412

Query  198  DSRQ  209
            ++ +
Sbjct  413  ENEK  416



>gb|KHN01107.1| Reticulon-like protein B17 [Glycine soja]
Length=282

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
            RL ++W +CTHKK +   +    WNLS+   RI+  F+L V  RY+++++M+
Sbjct  189  RLLDTWSACTHKKIVIASVLIAFWNLSTIKTRIFTAFILLVILRYFRETIMQ  240



>ref|XP_003526265.1| PREDICTED: reticulon-like protein B17-like isoform X1 [Glycine 
max]
Length=430

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
            RL ++W +CTHKK +   +    WNLS+   RI+  F+L V  RY+++++M+
Sbjct  337  RLLDTWSACTHKKIVIASVLIAFWNLSTIKTRIFTAFILLVILRYFRETIMQ  388



>ref|XP_006582310.1| PREDICTED: reticulon-like protein B17-like isoform X2 [Glycine 
max]
Length=429

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMR  173
            RL ++W +CTHKK +   +    WNLS+   RI+  F+L V  RY+++++M+
Sbjct  336  RLLDTWSACTHKKIVIASVLIAFWNLSTIKTRIFTAFILLVILRYFRETIMQ  387



>gb|KDP24091.1| hypothetical protein JCGZ_25748 [Jatropha curcas]
Length=431

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLMRE  176
            R+  +WE+C+HKK +A    T  WN+SS   RI+A F+  V  R ++Q L+ E
Sbjct  353  RILEAWEACSHKKIVAGSAITAFWNMSSVKTRIFAAFIFLVILRCFRQHLLPE  405



>gb|AAD21707.1| hypothetical protein [Arabidopsis thaliana]
Length=408

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  167
            R+  +W  C+HKK +A    T  WNL+S   RI+AVF++ V FRY +Q+L
Sbjct  304  RIGEAWGVCSHKKILAGSAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNL  353



>gb|AAO37135.1| hypothetical protein [Arabidopsis thaliana]
Length=431

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  167
            R+  +W  C+HKK +A    T  WNL+S   RI+AVF++ V FRY +Q+L
Sbjct  327  RIGEAWGVCSHKKILAGSAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNL  376



>ref|XP_008809421.1| PREDICTED: reticulon-like protein B17 isoform X1 [Phoenix dactylifera]
Length=467

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +3

Query  21   LKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM-RESVGSKPV  197
            ++ +WESC  K+ IA    T+ WNLSS  ARI+A F+  V  RY+ Q  M  E  G K  
Sbjct  395  IQEAWESCPRKRLIAASAATVLWNLSSVKARIFAAFISVVILRYHHQRRMGGEENGEK--  452

Query  198  DSRQ  209
            +SR+
Sbjct  453  ESRE  456



>ref|XP_008809498.1| PREDICTED: reticulon-like protein B18 isoform X2 [Phoenix dactylifera]
Length=439

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +3

Query  21   LKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSLM-RESVGSKPV  197
            ++ +WESC  K+ IA    T+ WNLSS  ARI+A F+  V  RY+ Q  M  E  G K  
Sbjct  367  IQEAWESCPRKRLIAASAATVLWNLSSVKARIFAAFISVVILRYHHQRRMGGEENGEK--  424

Query  198  DSRQ  209
            +SR+
Sbjct  425  ESRE  428



>ref|NP_179649.2| reticulon-like protein B17 [Arabidopsis thaliana]
 sp|Q6DR04.1|RTNLQ_ARATH RecName: Full=Reticulon-like protein B17; Short=AtRTNLB17 [Arabidopsis 
thaliana]
 gb|AAT69228.1| hypothetical protein At2g20590 [Arabidopsis thaliana]
 gb|AEC07036.1| reticulon-like protein B17 [Arabidopsis thaliana]
Length=431

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  18   RLKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQSL  167
            R+  +W  C+HKK +A    T  WNL+S   RI+AVF++ V FRY +Q+L
Sbjct  327  RIGEAWGVCSHKKILAGSAVTAFWNLTSIRTRIFAVFIILVIFRYRRQNL  376



>ref|XP_010260314.1| PREDICTED: reticulon-like protein B17 [Nelumbo nucifera]
Length=434

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  21   LKNSWESCTHKKAIAFGIFTLAWNLSSAIARIWAVFMLYVAFRYYQQ  161
            +K +WE+C+HKK +A    TL WNLSS   RI+  F+  V  R+++Q
Sbjct  342  MKETWEACSHKKIVAASAATLFWNLSSLKTRIFTAFISLVLLRFHRQ  388



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 984917279386