BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20108_g1_i1 len=712 path=[3924:0-110 2763:111-711]

Length=712
                                                                      Score     E

ref|XP_009798205.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    347   4e-114   
ref|XP_009798204.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    347   1e-113   
ref|XP_010320983.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    352   7e-112   
ref|XP_009622053.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X5    348   4e-111   
ref|XP_010320982.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    352   4e-111   
ref|XP_009622052.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X4    347   6e-111   
ref|XP_006341743.1|  PREDICTED: DNA topoisomerase 3-alpha-like          350   1e-110   
ref|XP_009622050.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    348   5e-110   
ref|XP_009622049.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    348   8e-110   
ref|XP_010649353.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    344   4e-108   
ref|XP_010649355.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    343   4e-108   
ref|XP_010649354.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    343   4e-108   
ref|XP_011100133.1|  PREDICTED: DNA topoisomerase 3-alpha               343   6e-108   
gb|EPS73635.1|  hypothetical protein M569_01118                         337   1e-106   
ref|XP_007213059.1|  hypothetical protein PRUPE_ppa020488mg             328   9e-106   
ref|XP_007137778.1|  hypothetical protein PHAVU_009G154800g             332   1e-105   
gb|KDP29471.1|  hypothetical protein JCGZ_19300                         327   9e-105   
ref|XP_006432122.1|  hypothetical protein CICLE_v10003112mg             332   1e-104   
ref|XP_004502963.1|  PREDICTED: DNA topoisomerase 3-alpha-like          332   9e-104   
ref|XP_006465105.1|  PREDICTED: DNA topoisomerase 3-alpha-like          332   2e-103   
gb|EYU20574.1|  hypothetical protein MIMGU_mgv1a000984mg                331   2e-103   
ref|XP_010025763.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    330   4e-103   
ref|XP_010025764.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    330   4e-103   
ref|XP_004289288.1|  PREDICTED: DNA topoisomerase 3-alpha-like          330   5e-103   
ref|XP_008367818.1|  PREDICTED: LOW QUALITY PROTEIN: DNA topoisom...    320   1e-102   
gb|KHG06667.1|  DNA topoisomerase 3                                     319   1e-102   
ref|XP_003602653.1|  DNA topoisomerase                                  321   2e-102   
ref|XP_008227548.1|  PREDICTED: DNA topoisomerase 3-alpha               328   2e-102   
ref|XP_010270299.1|  PREDICTED: DNA topoisomerase 3-alpha               328   3e-102   
ref|XP_011031137.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    327   9e-102   
ref|XP_011031138.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    327   1e-101   
ref|XP_011011406.1|  PREDICTED: DNA topoisomerase 3-alpha-like is...    327   1e-101   
ref|XP_011011407.1|  PREDICTED: DNA topoisomerase 3-alpha-like is...    327   1e-101   
ref|XP_004167550.1|  PREDICTED: DNA topoisomerase 3-like                319   1e-101   
ref|XP_010674423.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    324   1e-100   
ref|XP_010674422.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    324   2e-100   
ref|XP_007048481.1|  Topoisomerase 3alpha isoform 2                     322   2e-100   
ref|XP_003526873.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    323   2e-100   
ref|XP_006581777.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    323   2e-100   
ref|XP_008807900.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    322   2e-100   
gb|AIC82458.1|  topoisomerase 3alpha                                    323   3e-100   
ref|XP_008443146.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    322   3e-100   
ref|XP_008807899.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    322   6e-100   
ref|XP_008807898.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    322   7e-100   
ref|XP_007048480.1|  Topoisomerase 3alpha isoform 1                     322   7e-100   
ref|XP_008443145.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    322   9e-100   
ref|XP_002527391.1|  prokaryotic DNA topoisomerase, putative            320   1e-99    Ricinus communis
ref|XP_008443143.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    322   2e-99    
gb|AES72904.2|  DNA topoisomerase                                       322   2e-99    
ref|XP_002307047.1|  hypothetical protein POPTR_0005s06810g             320   4e-99    Populus trichocarpa [western balsam poplar]
ref|XP_009355843.1|  PREDICTED: DNA topoisomerase 3-alpha               320   1e-98    
gb|KGN59360.1|  hypothetical protein Csa_3G813290                       319   1e-98    
ref|XP_010907414.1|  PREDICTED: DNA topoisomerase 3-alpha               317   8e-98    
ref|XP_009403000.1|  PREDICTED: DNA topoisomerase 3-alpha               317   9e-98    
emb|CDP04613.1|  unnamed protein product                                313   2e-96    
ref|XP_004136599.1|  PREDICTED: DNA topoisomerase 3-alpha-like          310   2e-95    
ref|XP_010229158.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    304   3e-94    
ref|XP_010229157.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    305   3e-94    
ref|XP_006649448.1|  PREDICTED: DNA topoisomerase 3-alpha-like          306   6e-94    
ref|XP_002465810.1|  hypothetical protein SORBIDRAFT_01g046210          303   2e-93    Sorghum bicolor [broomcorn]
gb|AAM15783.1|AC104428_4  Putative DNA topoisomerase III                304   3e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008667766.1|  PREDICTED: hypothetical protein isoform X4         302   3e-93    
ref|XP_010546323.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    304   4e-93    
gb|EEC74578.1|  hypothetical protein OsI_10148                          304   7e-93    Oryza sativa Indica Group [Indian rice]
ref|NP_001173278.1|  Os03g0165000                                       303   8e-93    
ref|XP_010546322.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    303   8e-93    
ref|XP_010229156.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    304   8e-93    
gb|EEE58379.1|  hypothetical protein OsJ_09535                          304   1e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008667757.1|  PREDICTED: hypothetical protein isoform X2         303   1e-92    
ref|XP_008667755.1|  PREDICTED: hypothetical protein isoform X1         302   1e-92    
ref|XP_008667760.1|  PREDICTED: hypothetical protein isoform X3         302   2e-92    
ref|XP_006829322.1|  hypothetical protein AMTR_s00202p00033660          302   6e-92    
ref|XP_002864876.1|  hypothetical protein ARALYDRAFT_496584             300   1e-91    
ref|NP_201197.1|  topoisomerase 3alpha                                  299   5e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KFK28084.1|  hypothetical protein AALP_AA8G470200                    298   6e-91    
ref|XP_004985595.1|  PREDICTED: DNA topoisomerase 3-alpha-like          297   1e-90    
ref|XP_010484154.1|  PREDICTED: DNA topoisomerase 3-alpha-like          297   2e-90    
ref|XP_010444313.1|  PREDICTED: LOW QUALITY PROTEIN: DNA topoisom...    296   3e-90    
gb|EMT33584.1|  DNA topoisomerase 3-alpha                               293   3e-90    
gb|EEC84165.1|  hypothetical protein OsI_30540                          295   7e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_006279975.1|  hypothetical protein CARUB_v10025845mg             295   1e-89    
emb|CDY39837.1|  BnaC02g42810D                                          295   1e-89    
emb|CDY31345.1|  BnaA02g33960D                                          294   2e-89    
ref|XP_009130424.1|  PREDICTED: DNA topoisomerase 3-alpha               293   3e-89    
ref|XP_006394227.1|  hypothetical protein EUTSA_v10003618mg             292   1e-88    
ref|XP_010103452.1|  DNA topoisomerase 3-alpha                          286   8e-85    
ref|XP_006581778.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X4    275   3e-82    
ref|XP_002985109.1|  hypothetical protein SELMODRAFT_121488             269   7e-81    
ref|XP_002970788.1|  hypothetical protein SELMODRAFT_94303              266   1e-79    
ref|XP_001785482.1|  predicted protein                                  263   6e-78    
gb|KHN09630.1|  DNA topoisomerase 3-alpha                               239   3e-72    
ref|XP_006798035.1|  PREDICTED: DNA topoisomerase 3-alpha-like          218   2e-61    
ref|XP_005468449.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    217   2e-61    
ref|XP_005468447.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    218   2e-61    
ref|XP_005752308.1|  PREDICTED: DNA topoisomerase 3-alpha-like is...    217   2e-61    
ref|XP_005947077.1|  PREDICTED: DNA topoisomerase 3-alpha-like is...    217   3e-61    
ref|XP_004575543.1|  PREDICTED: DNA topoisomerase 3-alpha-like is...    217   3e-61    
ref|XP_005752307.1|  PREDICTED: DNA topoisomerase 3-alpha-like is...    217   3e-61    
ref|XP_004575542.1|  PREDICTED: DNA topoisomerase 3-alpha-like is...    217   3e-61    
ref|XP_005947076.1|  PREDICTED: DNA topoisomerase 3-alpha-like is...    217   3e-61    
gb|KFQ18375.1|  DNA topoisomerase 3-alpha                               212   2e-59    
ref|XP_008937408.1|  PREDICTED: DNA topoisomerase 3-alpha               212   2e-59    
gb|KFP49074.1|  DNA topoisomerase 3-alpha                               209   3e-59    
gb|KFQ64986.1|  DNA topoisomerase 3-alpha                               211   4e-59    
ref|XP_009487964.1|  PREDICTED: DNA topoisomerase 3-alpha               211   4e-59    
ref|XP_008328483.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    211   5e-59    
ref|XP_008328484.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    211   6e-59    
ref|XP_009919078.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    210   8e-59    
gb|KFQ05538.1|  DNA topoisomerase 3-alpha                               210   9e-59    
ref|XP_010568690.1|  PREDICTED: DNA topoisomerase 3-alpha               210   1e-58    
ref|XP_009919077.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    210   1e-58    
ref|XP_004071982.1|  PREDICTED: DNA topoisomerase 3-alpha-like          210   1e-58    
ref|XP_002947763.1|  hypothetical protein VOLCADRAFT_79791              209   1e-58    
gb|KFM12436.1|  DNA topoisomerase 3-alpha                               209   1e-58    
gb|KFR08069.1|  DNA topoisomerase 3-alpha                               209   2e-58    
gb|KFV20288.1|  DNA topoisomerase 3-alpha                               209   2e-58    
ref|XP_009988506.1|  PREDICTED: DNA topoisomerase 3-alpha               209   2e-58    
ref|XP_009930649.1|  PREDICTED: DNA topoisomerase 3-alpha               209   2e-58    
gb|KFP42710.1|  DNA topoisomerase 3-alpha                               209   2e-58    
gb|KFO07060.1|  DNA topoisomerase 3-alpha                               209   2e-58    
gb|KFQ99903.1|  DNA topoisomerase 3-alpha                               209   2e-58    
ref|XP_005017065.1|  PREDICTED: DNA topoisomerase 3-alpha               209   2e-58    
ref|XP_009284732.1|  PREDICTED: DNA topoisomerase 3-alpha               209   2e-58    
ref|XP_009807307.1|  PREDICTED: DNA topoisomerase 3-alpha               209   2e-58    
gb|KFW09486.1|  DNA topoisomerase 3-alpha                               209   2e-58    
ref|XP_010120298.1|  PREDICTED: DNA topoisomerase 3-alpha               209   2e-58    
ref|XP_010196093.1|  PREDICTED: LOW QUALITY PROTEIN: DNA topoisom...    208   2e-58    
gb|KFV51470.1|  DNA topoisomerase 3-alpha                               209   3e-58    
gb|KFP11629.1|  DNA topoisomerase 3-alpha                               209   3e-58    
ref|XP_010300310.1|  PREDICTED: DNA topoisomerase 3-alpha               209   3e-58    
gb|KFZ62874.1|  DNA topoisomerase 3-alpha                               209   3e-58    
ref|XP_010138219.1|  PREDICTED: DNA topoisomerase 3-alpha               208   3e-58    
ref|XP_008413798.1|  PREDICTED: DNA topoisomerase 3-alpha               209   3e-58    
ref|XP_009581158.1|  PREDICTED: DNA topoisomerase 3-alpha               209   3e-58    
ref|XP_009466099.1|  PREDICTED: DNA topoisomerase 3-alpha               209   3e-58    
gb|KGL96157.1|  DNA topoisomerase 3-alpha                               209   3e-58    
gb|KFQ81468.1|  DNA topoisomerase 3-alpha                               208   3e-58    
ref|XP_009647736.1|  PREDICTED: DNA topoisomerase 3-alpha               209   4e-58    
ref|XP_009886830.1|  PREDICTED: DNA topoisomerase 3-alpha               208   4e-58    
ref|XP_010170981.1|  PREDICTED: DNA topoisomerase 3-alpha               208   5e-58    
ref|XP_010291976.1|  PREDICTED: DNA topoisomerase 3-alpha               208   5e-58    
gb|KFP04783.1|  DNA topoisomerase 3-alpha                               208   5e-58    
gb|KFQ89960.1|  DNA topoisomerase 3-alpha                               208   5e-58    
ref|XP_007574411.1|  PREDICTED: DNA topoisomerase 3-alpha               208   6e-58    
gb|KFV77823.1|  DNA topoisomerase 3-alpha                               207   6e-58    
gb|KFP65450.1|  DNA topoisomerase 3-alpha                               207   6e-58    
gb|KFQ02639.1|  DNA topoisomerase 3-alpha                               207   7e-58    
ref|XP_009946177.1|  PREDICTED: DNA topoisomerase 3-alpha               207   7e-58    
ref|XP_009666303.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    207   7e-58    
gb|KFQ33210.1|  DNA topoisomerase 3-alpha                               207   7e-58    
ref|XP_008497098.1|  PREDICTED: DNA topoisomerase 3-alpha               207   7e-58    
ref|XP_009699312.1|  PREDICTED: DNA topoisomerase 3-alpha               207   8e-58    
ref|XP_010180235.1|  PREDICTED: DNA topoisomerase 3-alpha               207   8e-58    
ref|XP_009666302.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    207   8e-58    
ref|NP_001025807.1|  DNA topoisomerase 3-alpha isoform 1                207   1e-57    Gallus gallus [bantam]
ref|XP_010717866.1|  PREDICTED: DNA topoisomerase 3-alpha               207   1e-57    
gb|KFQ53766.1|  DNA topoisomerase 3-alpha                               207   1e-57    
ref|XP_010017397.1|  PREDICTED: DNA topoisomerase 3-alpha               207   1e-57    
ref|XP_010211313.1|  PREDICTED: DNA topoisomerase 3-alpha               205   1e-57    
gb|KFZ67856.1|  DNA topoisomerase 3-alpha                               207   1e-57    
ref|XP_005229069.1|  PREDICTED: DNA topoisomerase 3-alpha               207   2e-57    
ref|XP_005504604.1|  PREDICTED: DNA topoisomerase 3-alpha               207   2e-57    
gb|KFW84487.1|  DNA topoisomerase 3-alpha                               206   2e-57    
gb|EMC88455.1|  DNA topoisomerase 3-alpha                               206   2e-57    
ref|XP_005350344.1|  PREDICTED: DNA topoisomerase 3-alpha               205   3e-57    
ref|XP_008926440.1|  PREDICTED: DNA topoisomerase 3-alpha               206   3e-57    
gb|KFO77141.1|  DNA topoisomerase 3-alpha                               206   3e-57    
ref|XP_009560480.1|  PREDICTED: DNA topoisomerase 3-alpha               206   3e-57    
ref|XP_006973659.1|  PREDICTED: DNA topoisomerase 3-alpha               206   4e-57    
gb|KFV90869.1|  DNA topoisomerase 3-alpha                               205   4e-57    
gb|KFV08617.1|  DNA topoisomerase 3-alpha                               206   4e-57    
ref|XP_005808881.1|  PREDICTED: DNA topoisomerase 3-alpha-like          206   4e-57    
ref|XP_010159682.1|  PREDICTED: DNA topoisomerase 3-alpha               205   5e-57    
gb|KFU94117.1|  DNA topoisomerase 3-alpha                               205   6e-57    
ref|XP_010073739.1|  PREDICTED: DNA topoisomerase 3-alpha               205   7e-57    
gb|KFV61393.1|  DNA topoisomerase 3-alpha                               205   7e-57    
ref|XP_008120113.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X4    204   7e-57    
ref|XP_009894971.1|  PREDICTED: DNA topoisomerase 3-alpha               205   7e-57    
ref|XP_003228350.2|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    204   8e-57    
ref|XP_010001864.1|  PREDICTED: DNA topoisomerase 3-alpha               205   8e-57    
dbj|BAE37792.1|  unnamed protein product                                202   8e-57    Mus musculus [mouse]
ref|XP_008120112.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    204   9e-57    
emb|CAF95297.1|  unnamed protein product                                204   1e-56    Tetraodon nigroviridis
ref|XP_008120111.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    204   1e-56    
ref|XP_008301573.1|  PREDICTED: DNA topoisomerase 3-alpha               204   1e-56    
ref|XP_007060121.1|  PREDICTED: DNA topoisomerase 3-alpha               204   1e-56    
gb|KFW93790.1|  DNA topoisomerase 3-alpha                               204   1e-56    
ref|XP_008684206.1|  PREDICTED: LOW QUALITY PROTEIN: DNA topoisom...    202   1e-56    
ref|XP_009508111.1|  PREDICTED: DNA topoisomerase 3-alpha               204   1e-56    
ref|XP_005054687.1|  PREDICTED: DNA topoisomerase 3-alpha               204   2e-56    
gb|KFP87266.1|  DNA topoisomerase 3-alpha                               204   2e-56    
ref|XP_009966981.1|  PREDICTED: DNA topoisomerase 3-alpha               203   2e-56    
ref|XP_004713017.1|  PREDICTED: DNA topoisomerase 3-alpha               204   2e-56    
ref|XP_009079665.1|  PREDICTED: DNA topoisomerase 3-alpha               204   2e-56    
ref|XP_005494942.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    202   2e-56    
pdb|4CGY|A  Chain A, Crystal Structure Of The Human Topoisomerase...    202   3e-56    
ref|XP_008162976.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    202   3e-56    
pdb|4CHT|A  Chain A, Crystal Structure Of The Human Topoisomerase...    202   3e-56    
ref|XP_009090020.1|  PREDICTED: DNA topoisomerase 3-alpha               203   3e-56    
ref|XP_005997515.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    203   3e-56    
ref|XP_010366068.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    202   3e-56    
ref|XP_005426049.1|  PREDICTED: DNA topoisomerase 3-alpha               203   4e-56    
ref|XP_002189800.1|  PREDICTED: DNA topoisomerase 3-alpha               203   4e-56    Taeniopygia guttata
ref|XP_005997514.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    203   4e-56    
ref|XP_005997513.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    203   4e-56    
ref|XP_008162975.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    203   5e-56    
ref|XP_005494941.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    203   5e-56    
dbj|BAC26718.1|  unnamed protein product                                201   6e-56    Mus musculus [mouse]
gb|KFO58976.1|  DNA topoisomerase 3-alpha                               202   6e-56    
gb|ERE67718.1|  DNA topoisomerase 3-alpha                               201   6e-56    
ref|XP_007617066.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X4    201   7e-56    
ref|XP_005145100.1|  PREDICTED: DNA topoisomerase 3-alpha               202   7e-56    
ref|XP_007617065.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    202   8e-56    
ref|XP_008631835.1|  PREDICTED: DNA topoisomerase 3-alpha               202   8e-56    
dbj|BAE20515.1|  unnamed protein product                                201   9e-56    Mus musculus [mouse]
ref|XP_010390949.1|  PREDICTED: DNA topoisomerase 3-alpha               202   9e-56    
ref|XP_005620201.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    201   1e-55    
ref|XP_007617064.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    202   1e-55    
ref|XP_007617063.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    202   1e-55    
ref|XP_546656.2|  PREDICTED: DNA topoisomerase 3-alpha isoform X2       201   1e-55    Canis lupus familiaris [dogs]
ref|XP_010366052.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    201   1e-55    
ref|XP_002923167.1|  PREDICTED: LOW QUALITY PROTEIN: DNA topoisom...    201   1e-55    
gb|EHH57787.1|  DNA topoisomerase 3-alpha                               200   1e-55    
ref|XP_004896709.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    201   2e-55    
ref|NP_033436.1|  DNA topoisomerase 3-alpha                             201   2e-55    Mus musculus [mouse]
dbj|BAE42369.1|  unnamed protein product                                199   2e-55    Mus musculus [mouse]
ref|XP_004612924.1|  PREDICTED: DNA topoisomerase 3-alpha               201   2e-55    
ref|XP_004433056.1|  PREDICTED: DNA topoisomerase 3-alpha               201   2e-55    
ref|XP_008564436.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    200   2e-55    
ref|XP_005256833.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    200   2e-55    
ref|XP_005583131.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    201   2e-55    
ref|XP_006637312.1|  PREDICTED: DNA topoisomerase 3-alpha-like          200   2e-55    
ref|XP_004776596.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    201   2e-55    
ref|XP_010366045.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    201   2e-55    
ref|XP_007080858.1|  PREDICTED: DNA topoisomerase 3-alpha               200   2e-55    
ref|XP_009188109.1|  PREDICTED: DNA topoisomerase 3-alpha               201   2e-55    
ref|XP_004896708.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    201   2e-55    
ref|XP_006126683.1|  PREDICTED: DNA topoisomerase 3-alpha               201   2e-55    
ref|XP_008008772.1|  PREDICTED: DNA topoisomerase 3-alpha               201   2e-55    
gb|AAB03695.1|  DNA topoisomerase III                                   201   2e-55    Homo sapiens [man]
ref|XP_005583130.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    201   3e-55    
ref|XP_004776595.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    201   3e-55    
ref|XP_004640343.1|  PREDICTED: DNA topoisomerase 3-alpha               201   3e-55    
ref|XP_010745514.1|  PREDICTED: DNA topoisomerase 3-alpha               201   3e-55    
ref|XP_006908498.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    199   3e-55    
ref|XP_007939652.1|  PREDICTED: DNA topoisomerase 3-alpha               200   3e-55    
ref|XP_004776594.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    200   3e-55    
ref|NP_004609.1|  DNA topoisomerase 3-alpha                             200   3e-55    Homo sapiens [man]
ref|XP_006272770.1|  PREDICTED: DNA topoisomerase 3-alpha               200   3e-55    
ref|XP_008564435.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    200   3e-55    
ref|XP_003964491.1|  PREDICTED: DNA topoisomerase 3-alpha-like          200   3e-55    
ref|XP_006024099.1|  PREDICTED: DNA topoisomerase 3-alpha               200   3e-55    
ref|XP_007448453.1|  PREDICTED: DNA topoisomerase 3-alpha               200   3e-55    
ref|XP_005402336.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    199   3e-55    
ref|XP_010786073.1|  PREDICTED: DNA topoisomerase 3-alpha-like          196   4e-55    
ref|XP_010635743.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    198   4e-55    
ref|XP_688695.4|  PREDICTED: DNA topoisomerase 3-alpha                  200   5e-55    Danio rerio [leopard danio]
ref|XP_009430919.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    199   6e-55    
ref|XP_003279919.1|  PREDICTED: DNA topoisomerase 3-alpha isoform 2     199   6e-55    
ref|XP_005694304.1|  PREDICTED: DNA topoisomerase 3-alpha               199   6e-55    
ref|XP_006908497.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    199   7e-55    
ref|XP_003996416.1|  PREDICTED: DNA topoisomerase 3-alpha               199   7e-55    
ref|XP_010338329.1|  PREDICTED: DNA topoisomerase 3-alpha               199   8e-55    
ref|XP_003809826.1|  PREDICTED: DNA topoisomerase 3-alpha               199   8e-55    
ref|XP_511323.2|  PREDICTED: DNA topoisomerase 3-alpha isoform X1       199   8e-55    Pan troglodytes
ref|XP_001510142.2|  PREDICTED: DNA topoisomerase 3-alpha               199   8e-55    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_008060813.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    198   8e-55    
ref|XP_004599449.1|  PREDICTED: DNA topoisomerase 3-alpha               198   8e-55    
ref|XP_003763121.1|  PREDICTED: DNA topoisomerase 3-alpha               198   9e-55    
ref|XP_005402335.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    199   9e-55    
ref|XP_007647350.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X4    198   9e-55    
ref|XP_004669092.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    198   1e-54    
ref|XP_003279918.1|  PREDICTED: DNA topoisomerase 3-alpha isoform 1     199   1e-54    
ref|XP_008248583.1|  PREDICTED: LOW QUALITY PROTEIN: DNA topoisom...    199   1e-54    
ref|XP_001918241.2|  PREDICTED: LOW QUALITY PROTEIN: DNA topoisom...    199   1e-54    Equus caballus [domestic horse]
ref|XP_007497919.1|  PREDICTED: DNA topoisomerase 3-alpha               199   1e-54    
gb|ELV14017.1|  DNA topoisomerase 3-alpha                               198   1e-54    
ref|XP_004684598.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    198   1e-54    
ref|XP_006161709.1|  PREDICTED: DNA topoisomerase 3-alpha               199   1e-54    
ref|XP_008060812.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    199   1e-54    
ref|XP_007247893.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    196   1e-54    
ref|XP_008530670.1|  PREDICTED: DNA topoisomerase 3-alpha               198   1e-54    
ref|XP_003496375.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    199   1e-54    
ref|XP_010598538.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    198   1e-54    
ref|XP_004684597.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    199   1e-54    
ref|XP_004669091.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    199   1e-54    
ref|XP_006901251.1|  PREDICTED: DNA topoisomerase 3-alpha               198   2e-54    
ref|XP_007647342.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    198   2e-54    
ref|XP_004684596.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    198   2e-54    
gb|EHH24591.1|  DNA topoisomerase 3-alpha                               198   2e-54    
ref|XP_003420711.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    198   3e-54    
ref|XP_005339524.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    197   3e-54    
ref|XP_010635741.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    197   4e-54    
ref|XP_004266833.1|  PREDICTED: DNA topoisomerase 3-alpha               197   4e-54    
ref|XP_005339523.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    197   4e-54    
ref|XP_008820178.1|  PREDICTED: DNA topoisomerase 3-alpha               197   4e-54    
ref|XP_004312664.1|  PREDICTED: DNA topoisomerase 3-alpha               197   4e-54    
gb|KFH09698.1|  DNA topoisomerase family protein                        196   5e-54    
ref|XP_003465949.1|  PREDICTED: DNA topoisomerase 3-alpha               197   6e-54    
ref|XP_004481477.1|  PREDICTED: DNA topoisomerase 3-alpha               197   6e-54    
ref|XP_006175691.1|  PREDICTED: DNA topoisomerase 3-alpha               195   7e-54    
gb|KFG42645.1|  DNA topoisomerase family protein                        194   7e-54    
ref|XP_002366301.1|  DNA topoisomerase III alpha, putative              194   8e-54    
ref|XP_010841206.1|  PREDICTED: DNA topoisomerase 3-alpha               196   8e-54    
ref|XP_007174215.1|  PREDICTED: DNA topoisomerase 3-alpha               196   9e-54    
ref|XP_005887347.1|  PREDICTED: DNA topoisomerase 3-alpha               196   9e-54    
ref|XP_004381056.1|  PREDICTED: DNA topoisomerase 3-alpha isoform 2     195   1e-53    
gb|KFG51780.1|  DNA topoisomerase family protein                        194   1e-53    
ref|XP_005523120.1|  PREDICTED: DNA topoisomerase 3-alpha               196   1e-53    
ref|XP_006048918.1|  PREDICTED: DNA topoisomerase 3-alpha               196   1e-53    
ref|XP_010902673.1|  PREDICTED: DNA topoisomerase 3-alpha               196   1e-53    
gb|EPY87767.1|  DNA topoisomerase 3-alpha                               194   2e-53    
ref|XP_003702899.1|  PREDICTED: DNA topoisomerase 3-alpha-like          196   2e-53    
ref|XP_006875592.1|  PREDICTED: DNA topoisomerase 3-alpha               195   2e-53    
ref|XP_007121076.1|  PREDICTED: DNA topoisomerase 3-alpha               194   2e-53    
ref|XP_007425114.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    195   2e-53    
ref|XP_004381055.1|  PREDICTED: DNA topoisomerase 3-alpha isoform 1     195   2e-53    
ref|NP_001085699.1|  topoisomerase (DNA) III alpha                      195   2e-53    
ref|XP_007425113.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    194   2e-53    
ref|XP_007425112.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    195   2e-53    
ref|XP_005964996.1|  PREDICTED: DNA topoisomerase 3-alpha               195   3e-53    
ref|XP_004012784.1|  PREDICTED: DNA topoisomerase 3-alpha               195   3e-53    
ref|XP_010971510.1|  PREDICTED: DNA topoisomerase 3-alpha               194   3e-53    
ref|XP_010991894.1|  PREDICTED: DNA topoisomerase 3-alpha               194   4e-53    
ref|XP_007834111.1|  hypothetical protein PFICI_07339                   192   4e-53    
ref|NP_001071443.1|  DNA topoisomerase 3-alpha                          194   4e-53    
ref|XP_010814336.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    194   5e-53    
tpg|DAA18705.1|  TPA: topoisomerase (DNA) III alpha                     194   5e-53    
gb|EPT27143.1|  DNA topoisomerase family protein                        193   5e-53    
ref|XP_008994684.1|  PREDICTED: DNA topoisomerase 3-alpha               194   5e-53    
gb|ESS32637.1|  DNA topoisomerase family protein                        193   5e-53    
gb|EPR62253.1|  DNA topoisomerase family protein                        193   5e-53    
ref|XP_006774025.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    194   5e-53    
ref|XP_007247892.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    194   6e-53    
ref|XP_006774024.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    194   9e-53    
ref|XP_005870226.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    193   1e-52    
ref|XP_008154451.1|  PREDICTED: DNA topoisomerase 3-alpha               193   1e-52    
ref|XP_005870225.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    193   1e-52    
ref|XP_005870224.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    193   1e-52    
ref|XP_006103914.1|  PREDICTED: DNA topoisomerase 3-alpha               193   1e-52    
ref|XP_005652066.1|  prokaryotic type I DNA topoisomerase               192   2e-52    
ref|XP_002935889.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    193   2e-52    
ref|XP_007910121.1|  PREDICTED: DNA topoisomerase 3-alpha               193   2e-52    
gb|EPQ10148.1|  DNA topoisomerase 3-alpha                               193   2e-52    
ref|XP_006213913.1|  PREDICTED: LOW QUALITY PROTEIN: DNA topoisom...    191   3e-52    
ref|XP_009064575.1|  hypothetical protein LOTGIDRAFT_236127             189   7e-52    
ref|XP_009869553.1|  PREDICTED: DNA topoisomerase 3-alpha               191   7e-52    
gb|KFP89839.1|  DNA topoisomerase 3-alpha                               191   7e-52    
ref|XP_002732450.2|  PREDICTED: DNA topoisomerase 3-alpha-like          191   8e-52    
ref|XP_001417013.1|  predicted protein                                  188   8e-52    
ref|XP_001804860.1|  hypothetical protein SNOG_14677                    188   1e-51    
ref|XP_005842005.1|  hypothetical protein GUITHDRAFT_156833             188   1e-51    
ref|XP_009217839.1|  DNA topoisomerase III                              188   1e-51    
ref|XP_003713792.1|  DNA topoisomerase III                              188   1e-51    
ref|XP_007792536.1|  putative dna topoisomerase iii protein             186   2e-51    
emb|CCF38971.1|  DNA topoisomerase                                      184   2e-51    
ref|XP_003662864.1|  hypothetical protein MYCTH_2303986                 187   2e-51    
ref|XP_009657191.1|  DNA topoisomerase                                  187   3e-51    
ref|XP_009266901.1|  DNA topoisomerase 3                                188   3e-51    
gb|ELQ44463.1|  DNA topoisomerase 3                                     187   3e-51    
gb|EFN70830.1|  DNA topoisomerase 3-alpha                               189   3e-51    
ref|XP_002175891.1|  DNA topoisomerase III                              186   4e-51    
gb|KFW70897.1|  DNA topoisomerase 3-alpha                               189   4e-51    
ref|XP_009327672.1|  PREDICTED: DNA topoisomerase 3-alpha               189   5e-51    
ref|XP_001441837.1|  hypothetical protein                               188   5e-51    
ref|XP_003400391.1|  PREDICTED: DNA topoisomerase 3-alpha-like          189   7e-51    
ref|XP_003001061.1|  DNA topoisomerase                                  186   7e-51    
gb|EXK41406.1|  DNA topoisomerase III                                   186   7e-51    
emb|CBI37517.3|  unnamed protein product                                185   7e-51    
gb|EXA49324.1|  DNA topoisomerase III                                   186   8e-51    
ref|XP_001605592.2|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    189   8e-51    
gb|EXM37235.1|  DNA topoisomerase III                                   186   8e-51    
gb|EWZ44037.1|  DNA topoisomerase III                                   186   8e-51    
gb|EXK41405.1|  DNA topoisomerase III                                   186   9e-51    
gb|EGU85855.1|  hypothetical protein FOXB_03703                         186   9e-51    
gb|EWY97961.1|  DNA topoisomerase III                                   186   9e-51    
gb|ELT93762.1|  hypothetical protein CAPTEDRAFT_193082                  187   9e-51    
gb|EGZ71954.1|  prokaryotic type I DNA topoisomerase                    186   9e-51    
gb|EMT64088.1|  DNA topoisomerase 3                                     186   1e-50    
ref|XP_008203894.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X3    188   1e-50    
gb|ETO34020.1|  DNA topoisomerase III                                   184   1e-50    
ref|XP_009850867.1|  hypothetical protein NEUTE1DRAFT_81659             186   1e-50    
gb|EWY97960.1|  DNA topoisomerase III                                   186   1e-50    
gb|EXL85446.1|  DNA topoisomerase III                                   185   1e-50    
gb|EXA49323.1|  DNA topoisomerase III                                   185   1e-50    
ref|XP_008203893.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    188   1e-50    
gb|EGI59663.1|  DNA topoisomerase 3-alpha                               188   1e-50    
ref|XP_007290021.1|  DNA topoisomerase                                  185   1e-50    
emb|CCE30983.1|  related to DNA topoisomerase III                       185   1e-50    
ref|XP_003051867.1|  predicted protein                                  185   1e-50    
ref|XP_011063790.1|  PREDICTED: DNA topoisomerase 3-alpha-like          187   2e-50    
ref|XP_003655718.1|  hypothetical protein THITE_2119715                 185   2e-50    
ref|XP_011144136.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    187   2e-50    
ref|XP_011144135.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    187   2e-50    
ref|XP_005098681.1|  PREDICTED: DNA topoisomerase 3-alpha-like          187   2e-50    
ref|XP_007913893.1|  putative dna topoisomerase iii protein             184   2e-50    
gb|EFN81542.1|  DNA topoisomerase 3-alpha                               187   2e-50    
gb|EKC32429.1|  DNA topoisomerase 3-alpha                               189   2e-50    
ref|XP_009252924.1|  hypothetical protein FPSE_01529                    184   3e-50    
ref|XP_003386887.1|  PREDICTED: DNA topoisomerase 3-alpha-like          186   3e-50    
ref|XP_956391.2|  hypothetical protein NCU00081                         184   4e-50    
gb|EYB28185.1|  hypothetical protein FG05_06716                         184   4e-50    
ref|NP_986566.1|  AGL101Cp                                              183   4e-50    
ref|XP_008556752.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X2    186   4e-50    
gb|KEQ84462.1|  DNA topoisomerase III                                   184   4e-50    
ref|XP_008556751.1|  PREDICTED: DNA topoisomerase 3-alpha isoform X1    186   4e-50    
emb|CEF84269.1|  unnamed protein product                                184   4e-50    
ref|XP_003492591.1|  PREDICTED: DNA topoisomerase 3-alpha-like          186   5e-50    
gb|ETS05640.1|  prokaryotic type I DNA topoisomerase                    183   5e-50    
gb|EWG44273.1|  DNA topoisomerase III                                   183   6e-50    
ref|XP_006963403.1|  DNA topoisomerase                                  183   6e-50    
gb|EFZ22300.1|  hypothetical protein SINV_07705                         186   6e-50    
ref|XP_386892.1|  hypothetical protein FG06716.1                        183   7e-50    
gb|EAA27155.3|  DNA topoisomerase 3-beta                                183   7e-50    
gb|EFX74474.1|  hypothetical protein DAPPUDRAFT_324341                  186   7e-50    
ref|XP_011167166.1|  PREDICTED: DNA topoisomerase 3-alpha               186   7e-50    
ref|XP_007703913.1|  hypothetical protein COCSADRAFT_163916             183   8e-50    
ref|XP_003078306.1|  DNA topoisomerase III alpha, putative (ISS)        184   8e-50    
ref|XP_002672722.1|  predicted protein                                  185   8e-50    
dbj|GAM88847.1|  hypothetical protein ANO11243_068810                   183   9e-50    
ref|XP_008882019.1|  DNA topoisomerase family protein                   184   9e-50    
gb|KEQ73906.1|  DNA topoisomerase                                       183   1e-49    
ref|XP_004932606.1|  PREDICTED: DNA topoisomerase 3-alpha-like          185   1e-49    
ref|XP_007511027.1|  predicted protein                                  183   1e-49    
gb|AGO13768.1|  AaceriAGL101Cp                                          182   1e-49    
ref|NP_596761.1|  DNA topoisomerase III                                 182   1e-49    
ref|XP_002584806.1|  conserved hypothetical protein                     181   1e-49    
gb|KEQ61046.1|  DNA topoisomerase                                       182   2e-49    
ref|XP_003351627.1|  TOP3 protein                                       181   2e-49    
ref|XP_001453271.1|  hypothetical protein                               183   2e-49    
ref|XP_001950527.2|  PREDICTED: DNA topoisomerase 3-alpha               184   2e-49    
ref|XP_002004036.1|  GI18230                                            185   2e-49    
ref|XP_394050.4|  PREDICTED: DNA topoisomerase 3-alpha-like             184   3e-49    
gb|KIL88989.1|  dna topoisomerase iii                                   181   3e-49    
emb|CCT66255.1|  related to DNA topoisomerase III                       181   3e-49    
ref|XP_006624158.1|  PREDICTED: DNA topoisomerase 3-alpha-like          184   4e-49    
gb|EPX73237.1|  DNA topoisomerase III                                   180   6e-49    
ref|XP_006667060.1|  DNA topoisomerase III                              180   6e-49    
ref|XP_782119.2|  PREDICTED: DNA topoisomerase 3-alpha                  183   6e-49    
ref|XP_008605361.1|  hypothetical protein SDRG_01605                    183   6e-49    
gb|KIK69127.1|  hypothetical protein GYMLUDRAFT_637030                  180   7e-49    
gb|KFM25533.1|  DNA topoisomerase 3-alpha                               181   7e-49    
emb|CDP32445.1|  Putative DNA topoisomerase 3                           180   7e-49    
ref|XP_007743880.1|  DNA topoisomerase III                              180   8e-49    
ref|XP_007712903.1|  hypothetical protein COCCADRAFT_97731              180   8e-49    
ref|XP_008721029.1|  hypothetical protein HMPREF1541_08488              180   9e-49    
gb|EUN24653.1|  hypothetical protein COCVIDRAFT_28628                   180   9e-49    
ref|XP_006692995.1|  DNA topoisomerase-like protein                     180   9e-49    
ref|XP_007688143.1|  hypothetical protein COCMIDRAFT_95795              180   9e-49    
ref|XP_001908297.1|  hypothetical protein                               180   1e-48    
gb|KEQ96187.1|  hypothetical protein AUEXF2481DRAFT_39274               180   1e-48    
gb|ENH85237.1|  DNA topoisomerase                                       180   1e-48    
ref|XP_003852710.1|  DNA topoisomerase 3                                179   1e-48    
ref|XP_001448873.1|  hypothetical protein                               181   1e-48    
gb|KIK37763.1|  hypothetical protein CY34DRAFT_442041                   182   1e-48    
gb|KEY70272.1|  hypothetical protein S7711_04380                        179   1e-48    
gb|KFA55839.1|  hypothetical protein S40293_01958                       179   1e-48    
gb|EHK41268.1|  hypothetical protein TRIATDRAFT_249816                  179   2e-48    
gb|EEH22345.2|  hypothetical protein PABG_04556                         179   2e-48    
ref|XP_003646048.1|  hypothetical protein Ecym_4154                     179   2e-48    
ref|XP_010760449.1|  hypothetical protein PADG_04954                    179   2e-48    
ref|XP_002023181.1|  GL21219                                            182   2e-48    
gb|KFA79578.1|  hypothetical protein S40288_01117                       179   2e-48    
gb|EMD90238.1|  hypothetical protein COCHEDRAFT_1104554                 179   2e-48    
ref|XP_643754.2|  DNA topoisomerase III                                 180   2e-48    
gb|KFA62655.1|  hypothetical protein S40285_07851                       179   2e-48    
gb|KIN06022.1|  hypothetical protein OIDMADRAFT_154733                  179   2e-48    
gb|EFQ27204.1|  DNA topoisomerase                                       179   2e-48    
ref|XP_009026009.1|  hypothetical protein HELRODRAFT_114559             181   2e-48    
ref|XP_011107696.1|  hypothetical protein H072_1705                     178   3e-48    
ref|XP_002057453.1|  GJ18138                                            182   3e-48    
gb|KFH49040.1|  DNA topoisomerase-like protein                          178   4e-48    
gb|EZA48833.1|  DNA topoisomerase 3-alpha                               180   4e-48    
ref|XP_001356254.2|  GA10090                                            181   4e-48    
ref|XP_001988332.1|  GH11108                                            181   4e-48    
ref|XP_007595647.1|  DNA topoisomerase                                  178   4e-48    
emb|CCD54091.1|  similar to DNA topoisomerase III                       178   5e-48    
ref|XP_003694833.1|  PREDICTED: LOW QUALITY PROTEIN: DNA topoisom...    180   5e-48    
gb|KIL66374.1|  hypothetical protein M378DRAFT_185976                   179   6e-48    
emb|CCI50569.1|  unnamed protein product                                177   6e-48    
emb|CCU75651.1|  DNA topoisomerase III                                  178   6e-48    
ref|XP_001556935.1|  hypothetical protein BC1G_04651                    177   6e-48    
gb|EMR88145.1|  putative dna topoisomerase iii protein                  177   8e-48    
ref|XP_002139350.1|  DNA topoisomerase family protein                   178   8e-48    
ref|XP_004202802.1|  Piso0_001663                                       177   8e-48    
ref|XP_011119958.1|  hypothetical protein AOL_s00054g340                177   9e-48    
gb|KDO57496.1|  hypothetical protein CISIN_1g0469972mg                  174   1e-47    
gb|EPQ63710.1|  hypothetical protein BGT96224_3051                      177   1e-47    
ref|XP_002111020.1|  hypothetical protein TRIADDRAFT_22834              176   1e-47    
gb|KID82071.1|  DNA topoisomerase III                                   177   1e-47    
ref|XP_007801474.1|  hypothetical protein EPUS_08478                    176   1e-47    
gb|KIE02804.1|  DNA topoisomerase III                                   177   1e-47    
gb|EQB54737.1|  DNA topoisomerase                                       177   1e-47    
gb|KHJ32120.1|  putative dna topoisomerase iii                          176   1e-47    
gb|EEQ85821.1|  DNA topoisomerase III                                   176   2e-47    
ref|XP_003065470.1|  DNA topoisomerase family protein                   176   2e-47    
gb|EPY50273.1|  DNA topoisomerase III                                   176   2e-47    
gb|EGE85001.1|  DNA topoisomerase                                       176   2e-47    
ref|XP_007275049.1|  DNA topoisomerase                                  176   2e-47    
gb|EQL02720.1|  DNA topoisomerase                                       176   2e-47    



>ref|XP_009798205.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Nicotiana sylvestris]
Length=474

 Score =   347 bits (890),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 181/201 (90%), Gaps = 2/201 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TCAV IYEMC+Q+PTATV+KV+QQEKLKYPPHPL+TIELEKRASRYFRM
Sbjct  269  FNWMRGHLFDYTCAVTIYEMCIQEPTATVSKVKQQEKLKYPPHPLSTIELEKRASRYFRM  328

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ GHPVWGSYAQRLLD +
Sbjct  329  SSEQTMKVAEDLYQNGFISYPRTETDCFSEK--TDLRTMVQEQGGHPVWGSYAQRLLDPQ  386

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE  WSQDHH+VYELVVRHFLACVS+PA GAET
Sbjct  387  SGLWRNPSGGGHDDKAHPPIHPTKFSAGESRWSQDHHRVYELVVRHFLACVSKPAVGAET  446

Query  171  IVEIDIAGESFSACGRVIIAV  109
             VEIDIAGESF ACGRVI+AV
Sbjct  447  TVEIDIAGESFFACGRVILAV  467



>ref|XP_009798204.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Nicotiana sylvestris]
Length=515

 Score =   347 bits (890),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 182/203 (90%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TCAV IYEMC+Q+PTATV+KV+QQEKLKYPPHPL+TIELEKRASRYFRM
Sbjct  269  FNWMRGHLFDYTCAVTIYEMCIQEPTATVSKVKQQEKLKYPPHPLSTIELEKRASRYFRM  328

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ GHPVWGSYAQRLLD +
Sbjct  329  SSEQTMKVAEDLYQNGFISYPRTETDCFSEK--TDLRTMVQEQGGHPVWGSYAQRLLDPQ  386

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE  WSQDHH+VYELVVRHFLACVS+PA GAET
Sbjct  387  SGLWRNPSGGGHDDKAHPPIHPTKFSAGESRWSQDHHRVYELVVRHFLACVSKPAVGAET  446

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGESF ACGRVI+A ++
Sbjct  447  TVEIDIAGESFFACGRVILAKNY  469



>ref|XP_010320983.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Solanum lycopersicum]
Length=831

 Score =   352 bits (902),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 183/203 (90%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TC V+IYEMC+Q+P ATVTKV+QQEKLKYPPHPL+TIELEKRASRYFRM
Sbjct  181  FNWMRGHLFDYTCGVMIYEMCIQEPIATVTKVKQQEKLKYPPHPLSTIELEKRASRYFRM  240

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ GHPVWG+YAQRLLD +
Sbjct  241  SSEQTMKVAEDLYQNGFISYPRTETDCFSDK--TDLRTMVQEQEGHPVWGTYAQRLLDPQ  298

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE  WSQDHH+VYELVVRHFLACVSQPA GAET
Sbjct  299  SGLWRNPSGGGHDDKAHPPIHPTKFSAGETRWSQDHHRVYELVVRHFLACVSQPAVGAET  358

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIAGESFSACGRVI+A ++
Sbjct  359  IVEIDIAGESFSACGRVILAKNY  381



>ref|XP_009622053.1| PREDICTED: DNA topoisomerase 3-alpha isoform X5 [Nicotiana tomentosiformis]
Length=754

 Score =   348 bits (892),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 182/203 (90%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TCAV IYEMC+Q+PTATV+KV+QQEKLKYPPHPL+TIELEKRASRYFRM
Sbjct  267  FNWMRGHLFDYTCAVTIYEMCIQEPTATVSKVKQQEKLKYPPHPLSTIELEKRASRYFRM  326

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ GHPVWGSYAQRLLD +
Sbjct  327  SSEQTMKVAEDLYQNGFISYPRTETDCFSEK--TDLRTMVQEQGGHPVWGSYAQRLLDPQ  384

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE  WSQDHH+VYELVVRHFLACVS+PA GAET
Sbjct  385  SGLWRNPSGGGHDDKAHPPIHPTKFSAGESRWSQDHHRVYELVVRHFLACVSKPAVGAET  444

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGESF ACGRVI+A ++
Sbjct  445  TVEIDIAGESFFACGRVILAKNY  467



>ref|XP_010320982.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Solanum lycopersicum]
Length=915

 Score =   352 bits (902),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 183/203 (90%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TC V+IYEMC+Q+P ATVTKV+QQEKLKYPPHPL+TIELEKRASRYFRM
Sbjct  265  FNWMRGHLFDYTCGVMIYEMCIQEPIATVTKVKQQEKLKYPPHPLSTIELEKRASRYFRM  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ GHPVWG+YAQRLLD +
Sbjct  325  SSEQTMKVAEDLYQNGFISYPRTETDCFSDK--TDLRTMVQEQEGHPVWGTYAQRLLDPQ  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE  WSQDHH+VYELVVRHFLACVSQPA GAET
Sbjct  383  SGLWRNPSGGGHDDKAHPPIHPTKFSAGETRWSQDHHRVYELVVRHFLACVSQPAVGAET  442

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIAGESFSACGRVI+A ++
Sbjct  443  IVEIDIAGESFSACGRVILAKNY  465



>ref|XP_009622052.1| PREDICTED: DNA topoisomerase 3-alpha isoform X4 [Nicotiana tomentosiformis]
Length=764

 Score =   347 bits (891),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 182/203 (90%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TCAV IYEMC+Q+PTATV+KV+QQEKLKYPPHPL+TIELEKRASRYFRM
Sbjct  267  FNWMRGHLFDYTCAVTIYEMCIQEPTATVSKVKQQEKLKYPPHPLSTIELEKRASRYFRM  326

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ GHPVWGSYAQRLLD +
Sbjct  327  SSEQTMKVAEDLYQNGFISYPRTETDCFSEK--TDLRTMVQEQGGHPVWGSYAQRLLDPQ  384

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE  WSQDHH+VYELVVRHFLACVS+PA GAET
Sbjct  385  SGLWRNPSGGGHDDKAHPPIHPTKFSAGESRWSQDHHRVYELVVRHFLACVSKPAVGAET  444

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGESF ACGRVI+A ++
Sbjct  445  TVEIDIAGESFFACGRVILAKNY  467



>ref|XP_006341743.1| PREDICTED: DNA topoisomerase 3-alpha-like [Solanum tuberosum]
Length=915

 Score =   350 bits (898),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 181/203 (89%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TC V IYEMC+Q+P ATVTKV+QQEKLKYPPHPL+TIELEKRASRYFRM
Sbjct  265  FNWMRGHLFDYTCGVTIYEMCIQEPIATVTKVKQQEKLKYPPHPLSTIELEKRASRYFRM  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ GHPVWG YAQRLLD +
Sbjct  325  SSEQTMKVAEDLYQNGFISYPRTETDSFSEK--TDLRTMVQEQEGHPVWGIYAQRLLDPQ  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE  WSQDHH+VYELVVRHFLACVSQPA GAET
Sbjct  383  SGLWRNPSGGGHDDKAHPPIHPTKFSAGETRWSQDHHRVYELVVRHFLACVSQPAVGAET  442

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIAGESFSACGRVI+A ++
Sbjct  443  IVEIDIAGESFSACGRVILAKNY  465



>ref|XP_009622050.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Nicotiana tomentosiformis]
Length=900

 Score =   348 bits (893),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 182/203 (90%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TCAV IYEMC+Q+PTATV+KV+QQEKLKYPPHPL+TIELEKRASRYFRM
Sbjct  267  FNWMRGHLFDYTCAVTIYEMCIQEPTATVSKVKQQEKLKYPPHPLSTIELEKRASRYFRM  326

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ GHPVWGSYAQRLLD +
Sbjct  327  SSEQTMKVAEDLYQNGFISYPRTETDCFSEK--TDLRTMVQEQGGHPVWGSYAQRLLDPQ  384

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE  WSQDHH+VYELVVRHFLACVS+PA GAET
Sbjct  385  SGLWRNPSGGGHDDKAHPPIHPTKFSAGESRWSQDHHRVYELVVRHFLACVSKPAVGAET  444

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGESF ACGRVI+A ++
Sbjct  445  TVEIDIAGESFFACGRVILAKNY  467



>ref|XP_009622049.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Nicotiana tomentosiformis]
Length=913

 Score =   348 bits (893),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 182/203 (90%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TCAV IYEMC+Q+PTATV+KV+QQEKLKYPPHPL+TIELEKRASRYFRM
Sbjct  267  FNWMRGHLFDYTCAVTIYEMCIQEPTATVSKVKQQEKLKYPPHPLSTIELEKRASRYFRM  326

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ GHPVWGSYAQRLLD +
Sbjct  327  SSEQTMKVAEDLYQNGFISYPRTETDCFSEK--TDLRTMVQEQGGHPVWGSYAQRLLDPQ  384

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE  WSQDHH+VYELVVRHFLACVS+PA GAET
Sbjct  385  SGLWRNPSGGGHDDKAHPPIHPTKFSAGESRWSQDHHRVYELVVRHFLACVSKPAVGAET  444

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGESF ACGRVI+A ++
Sbjct  445  TVEIDIAGESFFACGRVILAKNY  467



>ref|XP_010649353.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Vitis vinifera]
Length=919

 Score =   344 bits (882),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 180/203 (89%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMR +LFD+TCAVIIYEMC+Q+PTATVTKVRQQEKLKYPPHPLNTIELEKRASRYF M
Sbjct  255  FNWMRAHLFDYTCAVIIYEMCIQEPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFHM  314

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ+GHP+WGSYAQRLLD  
Sbjct  315  SSEHTMKVAEDLYQTGFISYPRTETDYFSER--TDLHGIVQEQLGHPIWGSYAQRLLDPG  372

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+PS G +DDKAHPPIHPT+FSAGE GWSQDH ++YELVVRHFLACVSQPA GAET
Sbjct  373  AGLWRNPSNGGHDDKAHPPIHPTKFSAGESGWSQDHQRLYELVVRHFLACVSQPAVGAET  432

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIAGESFS+ GRVIIA ++
Sbjct  433  IVEIDIAGESFSSSGRVIIAKNY  455



>ref|XP_010649355.1| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Vitis vinifera]
Length=916

 Score =   343 bits (881),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 180/203 (89%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMR +LFD+TCAVIIYEMC+Q+PTATVTKVRQQEKLKYPPHPLNTIELEKRASRYF M
Sbjct  255  FNWMRAHLFDYTCAVIIYEMCIQEPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFHM  314

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ+GHP+WGSYAQRLLD  
Sbjct  315  SSEHTMKVAEDLYQTGFISYPRTETDYFSER--TDLHGIVQEQLGHPIWGSYAQRLLDPG  372

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+PS G +DDKAHPPIHPT+FSAGE GWSQDH ++YELVVRHFLACVSQPA GAET
Sbjct  373  AGLWRNPSNGGHDDKAHPPIHPTKFSAGESGWSQDHQRLYELVVRHFLACVSQPAVGAET  432

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIAGESFS+ GRVIIA ++
Sbjct  433  IVEIDIAGESFSSSGRVIIAKNY  455



>ref|XP_010649354.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Vitis vinifera]
Length=918

 Score =   343 bits (881),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 180/203 (89%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMR +LFD+TCAVIIYEMC+Q+PTATVTKVRQQEKLKYPPHPLNTIELEKRASRYF M
Sbjct  255  FNWMRAHLFDYTCAVIIYEMCIQEPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFHM  314

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ+GHP+WGSYAQRLLD  
Sbjct  315  SSEHTMKVAEDLYQTGFISYPRTETDYFSER--TDLHGIVQEQLGHPIWGSYAQRLLDPG  372

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+PS G +DDKAHPPIHPT+FSAGE GWSQDH ++YELVVRHFLACVSQPA GAET
Sbjct  373  AGLWRNPSNGGHDDKAHPPIHPTKFSAGESGWSQDHQRLYELVVRHFLACVSQPAVGAET  432

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIAGESFS+ GRVIIA ++
Sbjct  433  IVEIDIAGESFSSSGRVIIAKNY  455



>ref|XP_011100133.1| PREDICTED: DNA topoisomerase 3-alpha [Sesamum indicum]
Length=906

 Score =   343 bits (880),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 179/203 (88%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TCA I+YEMCVQ+PTATVT VRQQEK KYPPHPL+TIELEKRASRYFRM
Sbjct  256  FNWMRGHLFDYTCATILYEMCVQEPTATVTNVRQQEKPKYPPHPLSTIELEKRASRYFRM  315

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQ+Q  HP+WGSYAQRLLD E
Sbjct  316  SSEQTMKVAEDLYQAGFISYPRTETDCFSER--TDLHRIVQDQQAHPIWGSYAQRLLDPE  373

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FS+GE GWSQDHHKVYELVVRHFLACVSQPA GAET
Sbjct  374  SGLWRNPSGGGHDDKAHPPIHPTKFSSGESGWSQDHHKVYELVVRHFLACVSQPAIGAET  433

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRVIIA ++
Sbjct  434  TVEIDIAGEQFSASGRVIIAKNY  456



>gb|EPS73635.1| hypothetical protein M569_01118, partial [Genlisea aurea]
Length=813

 Score =   337 bits (865),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 176/203 (87%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TCA I+YEMCVQ+PTATVT VRQQEKLKYPP+PL+TIELEKRASRYFRM
Sbjct  164  FNWMRGHLFDYTCATILYEMCVQEPTATVTSVRQQEKLKYPPYPLSTIELEKRASRYFRM  223

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ GHP WGSYAQRLLD E
Sbjct  224  SSEQTMKVAEDLYQAGFISYPRTETDCFSER--TDLRTIVQEQQGHPAWGSYAQRLLDPE  281

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLW++P  G +DDKAHPPIHPT+FS+GE GWSQDHHKVYELVVRHFLACVSQPA GAET
Sbjct  282  TGLWKNPGAGGHDDKAHPPIHPTKFSSGESGWSQDHHKVYELVVRHFLACVSQPAIGAET  341

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E FSA GR IIA ++
Sbjct  342  TVEIDIASEQFSASGRAIIAKNY  364



>ref|XP_007213059.1| hypothetical protein PRUPE_ppa020488mg, partial [Prunus persica]
 gb|EMJ14258.1| hypothetical protein PRUPE_ppa020488mg, partial [Prunus persica]
Length=542

 Score =   328 bits (840),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+ FD+TCAVIIYEMCV++PTATVTKVRQQEKLKY P PLNTI+LEKRAS YFRM
Sbjct  255  FNWMRGHFFDYTCAVIIYEMCVEEPTATVTKVRQQEKLKYAPAPLNTIQLEKRASIYFRM  314

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     NL   VQEQ GHP WGSYAQRLLD  
Sbjct  315  SSEHTMKVAEELYQAGFISYPRTETDSFSER--TNLHAIVQEQQGHPGWGSYAQRLLDPA  372

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+P  G +DDKAHPPIHPT+FS+GE GWSQDHH++YELVVRHFLACVSQPA GAET
Sbjct  373  SGLWRNPRNGGHDDKAHPPIHPTKFSSGESGWSQDHHRLYELVVRHFLACVSQPAVGAET  432

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F A GRVI+A ++
Sbjct  433  TVEIDIAGELFFASGRVIVAKNY  455



>ref|XP_007137778.1| hypothetical protein PHAVU_009G154800g [Phaseolus vulgaris]
 gb|ESW09772.1| hypothetical protein PHAVU_009G154800g [Phaseolus vulgaris]
Length=693

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 177/218 (81%), Gaps = 9/218 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F WMRG+LFD+TCAVIIYEMCV++PTATVT VR QEK KYPPHPLNTIELEKRASRYFRM
Sbjct  255  FGWMRGHLFDYTCAVIIYEMCVEEPTATVTNVRHQEKPKYPPHPLNTIELEKRASRYFRM  314

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ GHP WG YAQRLLD  
Sbjct  315  SSEHTMKVAEELYQAGFISYPRTETDNFS--SRTDLHTIVQEQQGHPEWGVYAQRLLDPG  372

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+P GG +DDKAHPPIHPT+FS GE GWSQDH K+YELVVRHFLACVS+PA GAET
Sbjct  373  TGLWRNPRGGGHDDKAHPPIHPTKFSTGESGWSQDHRKLYELVVRHFLACVSKPAIGAET  432

Query  171  IVEIDIAGESFSACGRVIIAVSF*LHQQYITL-HYRDW  61
             VEIDIAGE FSACGRVI      L + Y+ + HY  W
Sbjct  433  TVEIDIAGELFSACGRVI------LEKNYLDVYHYESW  464



>gb|KDP29471.1| hypothetical protein JCGZ_19300 [Jatropha curcas]
Length=610

 Score =   327 bits (839),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 171/196 (87%), Gaps = 2/196 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+T AV++YEMCVQ+PTATVTKV+QQEK KYPP+PL+TIELEKRASRYFRM
Sbjct  258  FNWMRGHLFDYTSAVVLYEMCVQEPTATVTKVQQQEKNKYPPYPLSTIELEKRASRYFRM  317

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ  HP+WGSYAQRLLDH 
Sbjct  318  SSEHTMKVAEDLYQAGFISYPRTETDCFS--SRTDLQTIVQEQQPHPIWGSYAQRLLDHG  375

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             GLWR+PS G +DDKAHPPIHPT+FSAGE GWSQDHH+VYELVVRHFLACVSQPA GAET
Sbjct  376  EGLWRNPSSGGHDDKAHPPIHPTKFSAGETGWSQDHHRVYELVVRHFLACVSQPAIGAET  435

Query  171  IVEIDIAGESFSACGR  124
             VEIDIAGE FSA GR
Sbjct  436  TVEIDIAGEQFSASGR  451



>ref|XP_006432122.1| hypothetical protein CICLE_v10003112mg, partial [Citrus clementina]
 gb|ESR45362.1| hypothetical protein CICLE_v10003112mg, partial [Citrus clementina]
Length=794

 Score =   332 bits (851),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 177/203 (87%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T AVIIYEMCVQ+PTATVTKVRQQEKLKYPP+PL+TIELEKRASRYFRM
Sbjct  261  FSWMRGHLFDYTSAVIIYEMCVQEPTATVTKVRQQEKLKYPPYPLSTIELEKRASRYFRM  320

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     NL   VQEQ+GHP WG YAQRLLDH 
Sbjct  321  SSEHTMKVAEDLYQAGFISYPRTETDSFSSG--TNLHGIVQEQIGHPDWGPYAQRLLDHA  378

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+P  G +DDKAHPPIHPT+FS+GE  WSQDH+K+YELVVRHFLACVSQPA GAET
Sbjct  379  AGLWRNPGSGGHDDKAHPPIHPTKFSSGESRWSQDHYKLYELVVRHFLACVSQPAVGAET  438

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEI+IAGE FS  GRVI+A ++
Sbjct  439  IVEINIAGEVFSTSGRVILAKNY  461



>ref|XP_004502963.1| PREDICTED: DNA topoisomerase 3-alpha-like [Cicer arietinum]
Length=920

 Score =   332 bits (852),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 180/218 (83%), Gaps = 9/218 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W RG+LFD+TCAVIIYEMC ++PTATVT VRQQEKLKYPPHPL+TIELEKRASRYFRM
Sbjct  260  FSWGRGHLFDYTCAVIIYEMCTEEPTATVTNVRQQEKLKYPPHPLSTIELEKRASRYFRM  319

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ GHP WG YAQRLLD E
Sbjct  320  SSEHTMKVAEELYQSGFISYPRTETDNFSSR--TDLHAIVQEQQGHPQWGVYAQRLLDPE  377

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+P GG +DDKAHPPIHPT+FSAGE GWSQDH K+YELVVRHFLACVS+PA GAET
Sbjct  378  AGLWRNPRGGGHDDKAHPPIHPTKFSAGESGWSQDHRKLYELVVRHFLACVSKPAVGAET  437

Query  171  IVEIDIAGESFSACGRVIIAVSF*LHQQYITLH-YRDW  61
             VEIDIAGE FSACGRVI      L + Y+ ++ Y  W
Sbjct  438  TVEIDIAGELFSACGRVI------LEKNYLDVYQYESW  469



>ref|XP_006465105.1| PREDICTED: DNA topoisomerase 3-alpha-like [Citrus sinensis]
Length=940

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 177/203 (87%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T AVIIYEMCVQ+PTATVTKVRQQEKLKYPP+PL+TIELEKRASRYFRM
Sbjct  291  FSWMRGHLFDYTSAVIIYEMCVQEPTATVTKVRQQEKLKYPPYPLSTIELEKRASRYFRM  350

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     NL   VQEQ+GHP WG YAQRLLDH 
Sbjct  351  SSEHTMKVAEDLYQAGFISYPRTETDSFSSG--TNLHGIVQEQIGHPDWGPYAQRLLDHA  408

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+P  G +DDKAHPPIHPT+FS+GE  WSQDH+K+YELVVRHFLACVSQPA GAET
Sbjct  409  AGLWRNPGSGGHDDKAHPPIHPTKFSSGESRWSQDHYKLYELVVRHFLACVSQPAVGAET  468

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEI+IAGE FS  GRVI+A ++
Sbjct  469  IVEINIAGEVFSTSGRVILAKNY  491



>gb|EYU20574.1| hypothetical protein MIMGU_mgv1a000984mg [Erythranthe guttata]
Length=923

 Score =   331 bits (849),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+TCA IIYEMCV +P ATVT VR QEK +YPPHPL+TIELEKRASRYFRM
Sbjct  266  FSWMRGHLFDYTCATIIYEMCVLEPNATVTNVRNQEKPRYPPHPLSTIELEKRASRYFRM  325

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FSV    +L   VQEQ GHP WGSYAQRLLD E
Sbjct  326  SSEQTMKVAEDLYQAGFISYPRTETDSFSVR--TDLHTIVQEQQGHPTWGSYAQRLLDPE  383

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+PS G +DDKAHPPIHPT+FSAGE GWSQDHHKVYELVVRHFLACVSQPA GA T
Sbjct  384  AGLWRNPSSGGHDDKAHPPIHPTKFSAGESGWSQDHHKVYELVVRHFLACVSQPAIGAVT  443

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             V+IDIAGE FSA G VI+A ++
Sbjct  444  TVDIDIAGEQFSASGTVILAKNY  466



>ref|XP_010025763.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Eucalyptus grandis]
 gb|KCW62500.1| hypothetical protein EUGRSUZ_H05141 [Eucalyptus grandis]
Length=915

 Score =   330 bits (847),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW RG+LFD+TCAVIIYEMCV++P ATV  VRQQEK KYPPHPL+TIELEKRASRYFRM
Sbjct  262  FNWTRGHLFDYTCAVIIYEMCVEEPPATVAGVRQQEKYKYPPHPLSTIELEKRASRYFRM  321

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ GHPVWGSYAQRLLD  
Sbjct  322  SSEHTMKVAEELYQAGFISYPRTETDNFSAR--TDLHAIVQEQRGHPVWGSYAQRLLDPS  379

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PS G +DDKAHPPIHPT+FS GE  WSQDHH++YELVVRHFLACVSQPA GAET
Sbjct  380  SGLWRNPSNGGHDDKAHPPIHPTKFSGGERNWSQDHHRLYELVVRHFLACVSQPAVGAET  439

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRVIIA ++
Sbjct  440  TVEIDIAGEQFAASGRVIIAKNY  462



>ref|XP_010025764.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Eucalyptus grandis]
 gb|KCW62501.1| hypothetical protein EUGRSUZ_H05141 [Eucalyptus grandis]
Length=914

 Score =   330 bits (847),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW RG+LFD+TCAVIIYEMCV++P ATV  VRQQEK KYPPHPL+TIELEKRASRYFRM
Sbjct  262  FNWTRGHLFDYTCAVIIYEMCVEEPPATVAGVRQQEKYKYPPHPLSTIELEKRASRYFRM  321

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ GHPVWGSYAQRLLD  
Sbjct  322  SSEHTMKVAEELYQAGFISYPRTETDNFSAR--TDLHAIVQEQRGHPVWGSYAQRLLDPS  379

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PS G +DDKAHPPIHPT+FS GE  WSQDHH++YELVVRHFLACVSQPA GAET
Sbjct  380  SGLWRNPSNGGHDDKAHPPIHPTKFSGGERNWSQDHHRLYELVVRHFLACVSQPAVGAET  439

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRVIIA ++
Sbjct  440  TVEIDIAGEQFAASGRVIIAKNY  462



>ref|XP_004289288.1| PREDICTED: DNA topoisomerase 3-alpha-like [Fragaria vesca subsp. 
vesca]
Length=908

 Score =   330 bits (846),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F WMRG+LFDH CAVIIYEMCV+DP ATVTKVRQQEK KYPP+PLNTIELEKRASRYFRM
Sbjct  256  FGWMRGHLFDHACAVIIYEMCVEDPIATVTKVRQQEKPKYPPYPLNTIELEKRASRYFRM  315

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ GHP WGSYAQRLLD  
Sbjct  316  SSEHTMKVAEELYQAGFISYPRTETDGFSPR--TDLHAIVQEQQGHPGWGSYAQRLLDPA  373

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PS G +DDKAHPPIHPT+FSAGE  WSQDH+++YELVVRHFLACVSQPA GAET
Sbjct  374  SGLWRNPSSGGHDDKAHPPIHPTKFSAGESNWSQDHNRLYELVVRHFLACVSQPAVGAET  433

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRVI+A ++
Sbjct  434  TVEIDIAGEMFSASGRVILAKNY  456



>ref|XP_008367818.1| PREDICTED: LOW QUALITY PROTEIN: DNA topoisomerase 3-alpha-like 
[Malus domestica]
Length=538

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 175/203 (86%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+ CAV+IYEMCV++PTATVTKVRQQEKLK PP+PLNTI+LE+RAS YFRM
Sbjct  261  FHWMRGHLFDYACAVVIYEMCVEEPTATVTKVRQQEKLKKPPNPLNTIQLEQRASIYFRM  320

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WGSYAQRLLD  
Sbjct  321  SSEHTMKVAEELYQAGFISYPRTETDGFSER--TDLRAIVEEQQRHPGWGSYAQRLLDPA  378

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLW++PS G +DDKAHPPIHPT+FS+GE GWSQDHH++YELVVRHFLACVSQPA GAET
Sbjct  379  SGLWKNPSNGGHDDKAHPPIHPTKFSSGESGWSQDHHRLYELVVRHFLACVSQPAVGAET  438

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRVI+A ++
Sbjct  439  TVEIDIAGELFSASGRVILAKNY  461



>gb|KHG06667.1| DNA topoisomerase 3 [Gossypium arboreum]
Length=514

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 168/196 (86%), Gaps = 2/196 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TCAVI+YEMCVQ+PTATVTKV+ +EKLKYPP+PLNTIELEKRASRYFRM
Sbjct  287  FNWMRGHLFDYTCAVIVYEMCVQEPTATVTKVQHKEKLKYPPYPLNTIELEKRASRYFRM  346

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ  HP WGSYAQRLLD E
Sbjct  347  SSEHTMKVAEELYQSGFISYPRTETDCFS--SRTDLHAIVQEQQEHPDWGSYAQRLLDLE  404

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+P  G +DDKAHPPIHPT+FS GE GWSQDH  +YELVVRHFLACVSQPA GAET
Sbjct  405  TGLWRNPGSGGHDDKAHPPIHPTKFSTGEHGWSQDHRTLYELVVRHFLACVSQPAVGAET  464

Query  171  IVEIDIAGESFSACGR  124
             VEIDIAGE FSA GR
Sbjct  465  TVEIDIAGELFSASGR  480



>ref|XP_003602653.1| DNA topoisomerase [Medicago truncatula]
Length=587

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W RG+LFD+TCAVIIYEMC+++PTATVTKV  +EK KYPPHPL+TIELEKRASRYFRM
Sbjct  260  FSWERGHLFDYTCAVIIYEMCIEEPTATVTKVTPKEKPKYPPHPLSTIELEKRASRYFRM  319

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS +TMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ GHP WG YAQRLLD  
Sbjct  320  SSERTMKVAEELYQGGFISYPRTETDNFS--SRTDLHAIVQEQQGHPEWGIYAQRLLDPG  377

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+P GG +DD+AHPPIHPT+FSAGE GWSQDH K+YELVVRHFLACVS+PA GAET
Sbjct  378  AGLWRNPRGGGHDDQAHPPIHPTKFSAGESGWSQDHRKLYELVVRHFLACVSKPALGAET  437

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSACGRVI+  ++
Sbjct  438  TVEIDIAGERFSACGRVILERNY  460



>ref|XP_008227548.1| PREDICTED: DNA topoisomerase 3-alpha [Prunus mume]
Length=910

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+ FD+TCAVIIYEMCV++PTATVTKVRQQEKLKY P PLNTI+LEKRAS YFRM
Sbjct  256  FNWMRGHFFDYTCAVIIYEMCVEEPTATVTKVRQQEKLKYAPAPLNTIQLEKRASIYFRM  315

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     NL   VQEQ GHP WGSYAQRLLD  
Sbjct  316  SSEHTMKVAEELYQAGFISYPRTETDSFSER--TNLHAIVQEQQGHPGWGSYAQRLLDPA  373

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+P  G +DDKAHPPIHPT+FS+GE GWSQDHH++YELVVRHFLACVSQPA GAET
Sbjct  374  SGLWRNPRNGGHDDKAHPPIHPTKFSSGESGWSQDHHRLYELVVRHFLACVSQPAVGAET  433

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F A GRVI+A ++
Sbjct  434  TVEIDIAGELFFASGRVIVAKNY  456



>ref|XP_010270299.1| PREDICTED: DNA topoisomerase 3-alpha [Nelumbo nucifera]
Length=921

 Score =   328 bits (841),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG++FD+T AVIIYEMC  +PTATVTKV+ QEKLKYPPHPLNTIELEKRASRYFRM
Sbjct  261  FNWMRGHIFDYTYAVIIYEMCTLEPTATVTKVKNQEKLKYPPHPLNTIELEKRASRYFRM  320

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ GHP+WGSYAQRLLD E
Sbjct  321  SSEHTMKVAEELYQSGFISYPRTETDCFSAR--TDLHAMVQEQQGHPLWGSYAQRLLDPE  378

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR PS G +DDKAHPPIHPT++SAGE GWSQDHH++YELVVRHFLACVSQPA GAET
Sbjct  379  ARLWRSPSNGGHDDKAHPPIHPTKYSAGESGWSQDHHRLYELVVRHFLACVSQPAIGAET  438

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIAGE FS  GRVI+  ++
Sbjct  439  IVEIDIAGEQFSVSGRVILQKNY  461



>ref|XP_011031137.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Populus euphratica]
Length=919

 Score =   327 bits (838),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 178/203 (88%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T +VI+YEMCV++PTATVTKV+QQEKLKYPP+PL+TIELEKRASRYFRM
Sbjct  255  FSWMRGHLFDYTSSVILYEMCVEEPTATVTKVQQQEKLKYPPYPLSTIELEKRASRYFRM  314

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQE   HPVWGSYAQRLLD  
Sbjct  315  SSEQTMKVAEDLYQAGFISYPRTETDSFS--SRTDLHTIVQEHQEHPVWGSYAQRLLDPG  372

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+PS G +DDKAHPPIHPT+FS+GE  WSQDHH++YELVVRHFLACVSQPA GAET
Sbjct  373  AGLWRNPSSGGHDDKAHPPIHPTKFSSGESRWSQDHHRLYELVVRHFLACVSQPAVGAET  432

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            +VEIDIAGE FSA GRVI+A ++
Sbjct  433  VVEIDIAGERFSASGRVILAKNY  455



>ref|XP_011031138.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Populus euphratica]
Length=918

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 178/203 (88%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T +VI+YEMCV++PTATVTKV+QQEKLKYPP+PL+TIELEKRASRYFRM
Sbjct  255  FSWMRGHLFDYTSSVILYEMCVEEPTATVTKVQQQEKLKYPPYPLSTIELEKRASRYFRM  314

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQE   HPVWGSYAQRLLD  
Sbjct  315  SSEQTMKVAEDLYQAGFISYPRTETDSFS--SRTDLHTIVQEHQEHPVWGSYAQRLLDPG  372

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+PS G +DDKAHPPIHPT+FS+GE  WSQDHH++YELVVRHFLACVSQPA GAET
Sbjct  373  AGLWRNPSSGGHDDKAHPPIHPTKFSSGESRWSQDHHRLYELVVRHFLACVSQPAVGAET  432

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            +VEIDIAGE FSA GRVI+A ++
Sbjct  433  VVEIDIAGERFSASGRVILAKNY  455



>ref|XP_011011406.1| PREDICTED: DNA topoisomerase 3-alpha-like isoform X1 [Populus 
euphratica]
Length=919

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 178/203 (88%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T +VI+YEMCV++PTATVTKV+QQEKLKYPP+PL+TIELEKRASRYFRM
Sbjct  255  FSWMRGHLFDYTSSVILYEMCVEEPTATVTKVQQQEKLKYPPYPLSTIELEKRASRYFRM  314

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQE   HPVWGSYAQRLLD  
Sbjct  315  SSEQTMKVAEDLYQAGFISYPRTETDSFS--SRTDLHTIVQEHQEHPVWGSYAQRLLDPG  372

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+PS G +DDKAHPPIHPT+FS+GE  WSQDHH++YELVVRHFLACVSQPA GAET
Sbjct  373  AGLWRNPSSGGHDDKAHPPIHPTKFSSGESRWSQDHHRLYELVVRHFLACVSQPAVGAET  432

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            +VEIDIAGE FSA GRVI+A ++
Sbjct  433  VVEIDIAGERFSASGRVILAKNY  455



>ref|XP_011011407.1| PREDICTED: DNA topoisomerase 3-alpha-like isoform X2 [Populus 
euphratica]
Length=918

 Score =   327 bits (837),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 178/203 (88%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T +VI+YEMCV++PTATVTKV+QQEKLKYPP+PL+TIELEKRASRYFRM
Sbjct  255  FSWMRGHLFDYTSSVILYEMCVEEPTATVTKVQQQEKLKYPPYPLSTIELEKRASRYFRM  314

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQE   HPVWGSYAQRLLD  
Sbjct  315  SSEQTMKVAEDLYQAGFISYPRTETDSFS--SRTDLHTIVQEHQEHPVWGSYAQRLLDPG  372

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+PS G +DDKAHPPIHPT+FS+GE  WSQDHH++YELVVRHFLACVSQPA GAET
Sbjct  373  AGLWRNPSSGGHDDKAHPPIHPTKFSSGESRWSQDHHRLYELVVRHFLACVSQPAVGAET  432

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            +VEIDIAGE FSA GRVI+A ++
Sbjct  433  VVEIDIAGERFSASGRVILAKNY  455



>ref|XP_004167550.1| PREDICTED: DNA topoisomerase 3-like, partial [Cucumis sativus]
Length=607

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 171/203 (84%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W RGNLFD+TCAV+ YEMCVQ+ TATV  VR+QE LKYPPHPLNTIELEKRASRYFRM
Sbjct  261  FSWTRGNLFDYTCAVVFYEMCVQESTATVVNVRRQETLKYPPHPLNTIELEKRASRYFRM  320

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   V+EQ  H +WG+YAQRLLD E
Sbjct  321  SSEHTMKVAEDLYQAGFISYPRTETDCFSQR--TDLHGIVREQQEHQIWGAYAQRLLDPE  378

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            S LWR+PSGG +DDKAHPPIHPT+FSAGE GWSQDHH++YELVVRHFLACVSQPA GA T
Sbjct  379  SRLWRNPSGGGHDDKAHPPIHPTKFSAGERGWSQDHHRLYELVVRHFLACVSQPAVGAVT  438

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FS  GR+I+A ++
Sbjct  439  TVEIDIAGELFSTSGRMILARNY  461



>ref|XP_010674423.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=918

 Score =   324 bits (830),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG++FD+TCAV IYEMCV++P ATVT VRQQEKLKYPP+PL+TIELEKRASRYFRM
Sbjct  260  FSWMRGHIFDYTCAVSIYEMCVEEPIATVTMVRQQEKLKYPPYPLSTIELEKRASRYFRM  319

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ  HPVWGSYAQRLLD E
Sbjct  320  SSEQTMKVAEELYQSGFISYPRTETDSFSAR--TDLHTIVQEQQAHPVWGSYAQRLLDPE  377

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LW++P  G +DDKAHPPIHPT+FSAGE  WSQDHHKVYELVVRHFLACVSQPA  AET
Sbjct  378  AALWKNPGSGGHDDKAHPPIHPTKFSAGESRWSQDHHKVYELVVRHFLACVSQPAVSAET  437

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRVI++ ++
Sbjct  438  TVEIDIAGELFSASGRVILSKNY  460



>ref|XP_010674422.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=930

 Score =   324 bits (830),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 178/218 (82%), Gaps = 9/218 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG++FD+TCAV IYEMCV++P ATVT VRQQEKLKYPP+PL+TIELEKRASRYFRM
Sbjct  260  FSWMRGHIFDYTCAVSIYEMCVEEPIATVTMVRQQEKLKYPPYPLSTIELEKRASRYFRM  319

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ  HPVWGSYAQRLLD E
Sbjct  320  SSEQTMKVAEELYQSGFISYPRTETDSFSAR--TDLHTIVQEQQAHPVWGSYAQRLLDPE  377

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LW++P  G +DDKAHPPIHPT+FSAGE  WSQDHHKVYELVVRHFLACVSQPA  AET
Sbjct  378  AALWKNPGSGGHDDKAHPPIHPTKFSAGESRWSQDHHKVYELVVRHFLACVSQPAVSAET  437

Query  171  IVEIDIAGESFSACGRVIIAVSF*LHQQYITLH-YRDW  61
             VEIDIAGE FSA GRVI      L + Y+ ++ Y  W
Sbjct  438  TVEIDIAGELFSASGRVI------LSKNYLDIYRYESW  469



>ref|XP_007048481.1| Topoisomerase 3alpha isoform 2, partial [Theobroma cacao]
 gb|EOX92638.1| Topoisomerase 3alpha isoform 2, partial [Theobroma cacao]
Length=845

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 170/203 (84%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFDHTCAVI+YEMCVQ+P ATVTKVR QEKLKYPP+PL+TIELEKRASRYFRM
Sbjct  259  FNWMRGHLFDHTCAVIVYEMCVQEPNATVTKVRHQEKLKYPPYPLSTIELEKRASRYFRM  318

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ  HP WGSYAQRLLD  
Sbjct  319  SSEHTMKVAEDLYQAGFISYPRTETDCFS--SRTDLHAIVQEQQDHPEWGSYAQRLLDPG  376

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FSAGE  WSQDH K+YELVVRHFLACVSQPA GAET
Sbjct  377  TSLWRNPSSGGHDDKAHPPIHPTKFSAGEHNWSQDHRKLYELVVRHFLACVSQPAVGAET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E FS  GRVI+  ++
Sbjct  437  TVEIDIADEQFSTSGRVILERNY  459



>ref|XP_003526873.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Glycine max]
 ref|XP_006581776.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Glycine max]
Length=913

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG LFD+TCAVIIYEMCV++PTATVT +RQQEK KYPP PLNTIEL+KRASRYFRM
Sbjct  256  FSWMRGRLFDYTCAVIIYEMCVEEPTATVTNIRQQEKPKYPPFPLNTIELQKRASRYFRM  315

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ GHP WG YAQRL+D E
Sbjct  316  SSDHTMKVAEELYQAGFISYPRTETDSFSPG--TDLHTIVQEQQGHPEWGIYAQRLMDPE  373

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+P GG +DDKAHPPI+PT+FS GE GWSQDH K+YELVVRHFLACVS+PA GAET
Sbjct  374  AGLWRNPRGGGHDDKAHPPIYPTKFSTGESGWSQDHRKLYELVVRHFLACVSKPALGAET  433

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEI+IAGE FSACGRVI+  ++
Sbjct  434  TVEINIAGELFSACGRVILEKNY  456



>ref|XP_006581777.1| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Glycine max]
Length=910

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG LFD+TCAVIIYEMCV++PTATVT +RQQEK KYPP PLNTIEL+KRASRYFRM
Sbjct  256  FSWMRGRLFDYTCAVIIYEMCVEEPTATVTNIRQQEKPKYPPFPLNTIELQKRASRYFRM  315

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ GHP WG YAQRL+D E
Sbjct  316  SSDHTMKVAEELYQAGFISYPRTETDSFSPG--TDLHTIVQEQQGHPEWGIYAQRLMDPE  373

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+P GG +DDKAHPPI+PT+FS GE GWSQDH K+YELVVRHFLACVS+PA GAET
Sbjct  374  AGLWRNPRGGGHDDKAHPPIYPTKFSTGESGWSQDHRKLYELVVRHFLACVSKPALGAET  433

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEI+IAGE FSACGRVI+  ++
Sbjct  434  TVEINIAGELFSACGRVILEKNY  456



>ref|XP_008807900.1| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Phoenix dactylifera]
Length=865

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 177/203 (87%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T AVI+YEMCV++ TATV  VR QEKLKYPP+PL+T+EL+KRASRYFRM
Sbjct  265  FSWMRGHLFDYTSAVIVYEMCVEESTATVMNVRNQEKLKYPPYPLSTVELQKRASRYFRM  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ G+ISYPRTETD FSV+   +L   V EQVGHP WGSYAQRLLD E
Sbjct  325  SSEHTMKVAEELYQAGYISYPRTETDSFSVN--TDLHAIVGEQVGHPAWGSYAQRLLDPE  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G ++DKAHPPIHPT+FSAGEPGWSQDH+++YELVVRHFLACVS+PA GAET
Sbjct  383  ASLWRNPSNGGHNDKAHPPIHPTKFSAGEPGWSQDHNRLYELVVRHFLACVSKPAVGAET  442

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRVIIA ++
Sbjct  443  TVEIDIAGEQFSASGRVIIAKNY  465



>gb|AIC82458.1| topoisomerase 3alpha [Cocos nucifera]
Length=916

 Score =   323 bits (827),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 176/203 (87%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T AVI+YEMCV++PTATV  VR QEKLKYPP+PLNT+EL+KRASRYFRM
Sbjct  265  FSWMRGHLFDYTSAVIVYEMCVEEPTATVMNVRNQEKLKYPPYPLNTVELQKRASRYFRM  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ G+ISYPRTETD+FS +   +L   V EQVGHP WGSYAQRLLD E
Sbjct  325  SSEHTMKVAEELYQAGYISYPRTETDKFSEN--TDLHAIVGEQVGHPAWGSYAQRLLDPE  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+P  G +DDKAHPPIHPT+FSAGEP WSQDH+++YELVVRHFLACVSQPA GAET
Sbjct  383  ARLWRNPGNGGHDDKAHPPIHPTKFSAGEPRWSQDHNRLYELVVRHFLACVSQPAVGAET  442

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRVIIA ++
Sbjct  443  TVEIDIAGEQFSASGRVIIAKNY  465



>ref|XP_008443146.1| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Cucumis melo]
Length=847

 Score =   322 bits (824),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W RGNLFD+TCAV+ YEMCVQ+ TATV  VR+QE LKYPPHPLNTIELEKRASRYFRM
Sbjct  261  FSWTRGNLFDYTCAVVFYEMCVQESTATVVNVRRQETLKYPPHPLNTIELEKRASRYFRM  320

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   V+EQ  H +WG+YAQRLLD E
Sbjct  321  SSEHTMKVAEDLYQAGFISYPRTETDCFSQR--TDLHGIVREQQEHQIWGAYAQRLLDPE  378

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE GWSQDHH++YELVVRHFLACVSQPA GA T
Sbjct  379  SGLWRNPSGGGHDDKAHPPIHPTKFSAGERGWSQDHHRLYELVVRHFLACVSQPAVGAVT  438

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FS  GR+I+A ++
Sbjct  439  TVEIDIAGELFSTSGRMILARNY  461



>ref|XP_008807899.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Phoenix dactylifera]
Length=917

 Score =   322 bits (825),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 177/203 (87%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T AVI+YEMCV++ TATV  VR QEKLKYPP+PL+T+EL+KRASRYFRM
Sbjct  265  FSWMRGHLFDYTSAVIVYEMCVEESTATVMNVRNQEKLKYPPYPLSTVELQKRASRYFRM  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ G+ISYPRTETD FSV+   +L   V EQVGHP WGSYAQRLLD E
Sbjct  325  SSEHTMKVAEELYQAGYISYPRTETDSFSVN--TDLHAIVGEQVGHPAWGSYAQRLLDPE  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G ++DKAHPPIHPT+FSAGEPGWSQDH+++YELVVRHFLACVS+PA GAET
Sbjct  383  ASLWRNPSNGGHNDKAHPPIHPTKFSAGEPGWSQDHNRLYELVVRHFLACVSKPAVGAET  442

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRVIIA ++
Sbjct  443  TVEIDIAGEQFSASGRVIIAKNY  465



>ref|XP_008807898.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Phoenix dactylifera]
Length=920

 Score =   322 bits (825),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 177/203 (87%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T AVI+YEMCV++ TATV  VR QEKLKYPP+PL+T+EL+KRASRYFRM
Sbjct  265  FSWMRGHLFDYTSAVIVYEMCVEESTATVMNVRNQEKLKYPPYPLSTVELQKRASRYFRM  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ G+ISYPRTETD FSV+   +L   V EQVGHP WGSYAQRLLD E
Sbjct  325  SSEHTMKVAEELYQAGYISYPRTETDSFSVN--TDLHAIVGEQVGHPAWGSYAQRLLDPE  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G ++DKAHPPIHPT+FSAGEPGWSQDH+++YELVVRHFLACVS+PA GAET
Sbjct  383  ASLWRNPSNGGHNDKAHPPIHPTKFSAGEPGWSQDHNRLYELVVRHFLACVSKPAVGAET  442

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRVIIA ++
Sbjct  443  TVEIDIAGEQFSASGRVIIAKNY  465



>ref|XP_007048480.1| Topoisomerase 3alpha isoform 1 [Theobroma cacao]
 gb|EOX92637.1| Topoisomerase 3alpha isoform 1 [Theobroma cacao]
Length=914

 Score =   322 bits (825),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 175/218 (80%), Gaps = 9/218 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFDHTCAVI+YEMCVQ+P ATVTKVR QEKLKYPP+PL+TIELEKRASRYFRM
Sbjct  259  FNWMRGHLFDHTCAVIVYEMCVQEPNATVTKVRHQEKLKYPPYPLSTIELEKRASRYFRM  318

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   VQEQ  HP WGSYAQRLLD  
Sbjct  319  SSEHTMKVAEDLYQAGFISYPRTETDCFS--SRTDLHAIVQEQQDHPEWGSYAQRLLDPG  376

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FSAGE  WSQDH K+YELVVRHFLACVSQPA GAET
Sbjct  377  TSLWRNPSSGGHDDKAHPPIHPTKFSAGEHNWSQDHRKLYELVVRHFLACVSQPAVGAET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF*LHQQYITLH-YRDW  61
             VEIDIA E FS  GRVI      L + Y+ ++ Y  W
Sbjct  437  TVEIDIADEQFSTSGRVI------LERNYLDVYRYESW  468



>ref|XP_008443145.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Cucumis melo]
Length=922

 Score =   322 bits (825),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W RGNLFD+TCAV+ YEMCVQ+ TATV  VR+QE LKYPPHPLNTIELEKRASRYFRM
Sbjct  261  FSWTRGNLFDYTCAVVFYEMCVQESTATVVNVRRQETLKYPPHPLNTIELEKRASRYFRM  320

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   V+EQ  H +WG+YAQRLLD E
Sbjct  321  SSEHTMKVAEDLYQAGFISYPRTETDCFSQR--TDLHGIVREQQEHQIWGAYAQRLLDPE  378

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE GWSQDHH++YELVVRHFLACVSQPA GA T
Sbjct  379  SGLWRNPSGGGHDDKAHPPIHPTKFSAGERGWSQDHHRLYELVVRHFLACVSQPAVGAVT  438

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FS  GR+I+A ++
Sbjct  439  TVEIDIAGELFSTSGRMILARNY  461



>ref|XP_002527391.1| prokaryotic DNA topoisomerase, putative [Ricinus communis]
 gb|EEF34998.1| prokaryotic DNA topoisomerase, putative [Ricinus communis]
Length=833

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 175/203 (86%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T AVI+YE+CV +PTATVTKV+Q+EK KYPP+PL+TIELEKRASRYF M
Sbjct  258  FSWMRGHLFDYTSAVILYELCVLEPTATVTKVQQKEKQKYPPYPLSTIELEKRASRYFHM  317

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS QTMKVAEDLYQ GFISYPRTETD FS     +L   V++Q  HP+WGSYAQRLLD  
Sbjct  318  SSEQTMKVAEDLYQSGFISYPRTETDGFS--SRTDLHTIVRDQQAHPIWGSYAQRLLDPG  375

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+PS G +DDKAHPPIHPT+FS GE GWSQDHH+VYELVVRHFLACVSQPA GAET
Sbjct  376  TGLWRNPSTGGHDDKAHPPIHPTKFSPGETGWSQDHHRVYELVVRHFLACVSQPAVGAET  435

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRVI+A ++
Sbjct  436  TVEIDIAGEQFSASGRVILAKNY  458



>ref|XP_008443143.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Cucumis melo]
Length=938

 Score =   322 bits (824),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W RGNLFD+TCAV+ YEMCVQ+ TATV  VR+QE LKYPPHPLNTIELEKRASRYFRM
Sbjct  261  FSWTRGNLFDYTCAVVFYEMCVQESTATVVNVRRQETLKYPPHPLNTIELEKRASRYFRM  320

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   V+EQ  H +WG+YAQRLLD E
Sbjct  321  SSEHTMKVAEDLYQAGFISYPRTETDCFSQR--TDLHGIVREQQEHQIWGAYAQRLLDPE  378

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+PSGG +DDKAHPPIHPT+FSAGE GWSQDHH++YELVVRHFLACVSQPA GA T
Sbjct  379  SGLWRNPSGGGHDDKAHPPIHPTKFSAGERGWSQDHHRLYELVVRHFLACVSQPAVGAVT  438

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FS  GR+I+A ++
Sbjct  439  TVEIDIAGELFSTSGRMILARNY  461



>gb|AES72904.2| DNA topoisomerase [Medicago truncatula]
Length=956

 Score =   322 bits (824),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W RG+LFD+TCAVIIYEMC+++PTATVTKV  +EK KYPPHPL+TIELEKRASRYFRM
Sbjct  260  FSWERGHLFDYTCAVIIYEMCIEEPTATVTKVTPKEKPKYPPHPLSTIELEKRASRYFRM  319

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS +TMKVAE+LYQ GFISYPRTETD FS     +L   VQEQ GHP WG YAQRLLD  
Sbjct  320  SSERTMKVAEELYQGGFISYPRTETDNFS--SRTDLHAIVQEQQGHPEWGIYAQRLLDPG  377

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+P GG +DD+AHPPIHPT+FSAGE GWSQDH K+YELVVRHFLACVS+PA GAET
Sbjct  378  AGLWRNPRGGGHDDQAHPPIHPTKFSAGESGWSQDHRKLYELVVRHFLACVSKPALGAET  437

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSACGRVI+  ++
Sbjct  438  TVEIDIAGERFSACGRVILERNY  460



>ref|XP_002307047.1| hypothetical protein POPTR_0005s06810g [Populus trichocarpa]
 gb|EEE94043.1| hypothetical protein POPTR_0005s06810g [Populus trichocarpa]
Length=910

 Score =   320 bits (820),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 176/204 (86%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVT-KVRQQEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+T +VI+YEMCV++PTATV+ +  QQEKLKYPP+PL+TIELEKRASRYFR
Sbjct  255  FNWMRGHLFDYTSSVILYEMCVEEPTATVSNRNHQQEKLKYPPYPLSTIELEKRASRYFR  314

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            MSS QTMKVAEDLYQ GFISYPRTETD FS     +L   VQE   HPVWGSYAQRLLD 
Sbjct  315  MSSEQTMKVAEDLYQAGFISYPRTETDSFS--SRTDLHTIVQEHQEHPVWGSYAQRLLDP  372

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
             +GLWR+PS G +DDKAHPPIHPT+FSAGE  WSQDHH++YELVVRHFLACVSQPA GAE
Sbjct  373  GAGLWRNPSNGGHDDKAHPPIHPTKFSAGESRWSQDHHRLYELVVRHFLACVSQPAVGAE  432

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T+VEIDIAGE FSA GRVI+A ++
Sbjct  433  TVVEIDIAGERFSASGRVILAKNY  456



>ref|XP_009355843.1| PREDICTED: DNA topoisomerase 3-alpha [Pyrus x bretschneideri]
Length=972

 Score =   320 bits (820),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 175/203 (86%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+ CAV+IYEMCV++PTATVTKVRQQEKLK PP+PLNTI+LE+RAS YFRM
Sbjct  264  FHWMRGHLFDYACAVVIYEMCVEEPTATVTKVRQQEKLKKPPNPLNTIQLEQRASIYFRM  323

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WGSYAQRLLD  
Sbjct  324  SSEHTMKVAEELYQAGFISYPRTETDGFSER--TDLHAIVEEQQRHPGWGSYAQRLLDPA  381

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLW++PS G +DDKAHPPIHPT+FS+GE GWSQDHH++YELVVRHFLACVSQPA GAET
Sbjct  382  SGLWKNPSNGGHDDKAHPPIHPTKFSSGESGWSQDHHRLYELVVRHFLACVSQPAVGAET  441

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRVI+A ++
Sbjct  442  TVEIDIAGELFSASGRVILAKNY  464



>gb|KGN59360.1| hypothetical protein Csa_3G813290 [Cucumis sativus]
Length=924

 Score =   319 bits (817),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 171/203 (84%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W RGNLFD+TCAV+ YEMCVQ+ TATV  VR+QE LKYPPHPLNTIELEKRASRYFRM
Sbjct  261  FSWTRGNLFDYTCAVVFYEMCVQESTATVVNVRRQETLKYPPHPLNTIELEKRASRYFRM  320

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   V+EQ  H +WG+YAQRLLD E
Sbjct  321  SSEHTMKVAEDLYQAGFISYPRTETDCFSQR--TDLHGIVREQQEHQIWGAYAQRLLDPE  378

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            S LWR+PSGG +DDKAHPPIHPT+FSAGE GWSQDHH++YELVVRHFLACVSQPA GA T
Sbjct  379  SRLWRNPSGGGHDDKAHPPIHPTKFSAGERGWSQDHHRLYELVVRHFLACVSQPAVGAVT  438

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FS  GR+I+A ++
Sbjct  439  TVEIDIAGELFSTSGRMILARNY  461



>ref|XP_010907414.1| PREDICTED: DNA topoisomerase 3-alpha [Elaeis guineensis]
Length=917

 Score =   317 bits (811),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG+LFD+T AVI YEMCV++PTATV  VR QEKLKYPP+PL+T+EL+KRASRYFRM
Sbjct  265  FSWMRGHLFDYTSAVIAYEMCVEEPTATVMTVRNQEKLKYPPYPLSTVELQKRASRYFRM  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            S+  TMKVAE+LYQ G+ISYPRTETD FS +   +L   V EQVGHP WGSYAQRLLD E
Sbjct  325  SAEHTMKVAEELYQAGYISYPRTETDNFSAN--TDLHAIVGEQVGHPAWGSYAQRLLDPE  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+F AGEPGWSQ+H+++YELVVRHFLACVSQPA GAET
Sbjct  383  ARLWRNPSNGGHDDKAHPPIHPTKFFAGEPGWSQNHNRLYELVVRHFLACVSQPAVGAET  442

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F A GRVIIA ++
Sbjct  443  TVEIDIAGEQFFASGRVIIAKNY  465



>ref|XP_009403000.1| PREDICTED: DNA topoisomerase 3-alpha [Musa acuminata subsp. malaccensis]
Length=920

 Score =   317 bits (811),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 176/203 (87%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F WMRG+LFD+T AV+IYEMCV++P ATV  V+ QEKLKYPP+PL+T+EL+KRASR+FRM
Sbjct  266  FIWMRGHLFDYTSAVVIYEMCVEEPAATVKNVKHQEKLKYPPYPLSTVELQKRASRFFRM  325

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMK+AE+LYQ GFISYPRTETD FSV+   +L   V+EQV HP+WGSYAQ+LLD E
Sbjct  326  SSEHTMKIAEELYQAGFISYPRTETDGFSVN--TDLHAIVREQVTHPIWGSYAQQLLDVE  383

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FSAGE GWSQDH+++YELVVRHFLACVSQPA GAET
Sbjct  384  ARLWRNPSNGGHDDKAHPPIHPTKFSAGETGWSQDHNRLYELVVRHFLACVSQPAVGAET  443

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRVIIA ++
Sbjct  444  TVEIDIAGEQFSASGRVIIAKNY  466



>emb|CDP04613.1| unnamed protein product [Coffea canephora]
Length=925

 Score =   313 bits (802),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F WMRG+ FD+TCA I+YEMC+Q+PT TVT++++QEKLKYPP PL+T+ELEKRASR+F M
Sbjct  273  FKWMRGHFFDYTCAAIVYEMCIQEPTVTVTEIKEQEKLKYPPLPLSTLELEKRASRFFHM  332

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            S A TMKVAEDLYQ GFISYPRTETD FS     +L   V EQ GHP+WGSYAQ LL+ E
Sbjct  333  SPAHTMKVAEDLYQAGFISYPRTETDGFSEK--TDLRAIVFEQQGHPLWGSYAQLLLNPE  390

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+PS G +DDKAHPPIHPTRFS GE GWS+DHH++YELVVRHFLACVSQPAK AET
Sbjct  391  AGLWRNPSSGRHDDKAHPPIHPTRFSPGESGWSRDHHRLYELVVRHFLACVSQPAKAAET  450

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE+FS+ GRVI A ++
Sbjct  451  SVEIDIAGEAFSSSGRVIHAKNY  473



>ref|XP_004136599.1| PREDICTED: DNA topoisomerase 3-alpha-like [Cucumis sativus]
Length=925

 Score =   310 bits (795),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 164/196 (84%), Gaps = 2/196 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W RGNLFD+TCAV+ YEMCVQ+ TATV  VR+QE LKYPPHPLNTIELEKRASRYFRM
Sbjct  261  FSWTRGNLFDYTCAVVFYEMCVQESTATVVNVRRQETLKYPPHPLNTIELEKRASRYFRM  320

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS     +L   V+EQ  H +WG+YAQRLLD E
Sbjct  321  SSEHTMKVAEDLYQAGFISYPRTETDCFSQR--TDLHGIVREQQEHQIWGAYAQRLLDPE  378

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            S LWR+PSGG +DDKAHPPIHPT+FSAGE GWSQDHH++YELVVRHFLACVSQPA GA T
Sbjct  379  SRLWRNPSGGGHDDKAHPPIHPTKFSAGERGWSQDHHRLYELVVRHFLACVSQPAVGAVT  438

Query  171  IVEIDIAGESFSACGR  124
             VEIDIAGE FS   R
Sbjct  439  TVEIDIAGELFSTSKR  454



>ref|XP_010229158.1| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Brachypodium 
distachyon]
Length=769

 Score =   304 bits (778),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++ A++IYEMCVQ+P ATV  VR QEKLKYPP+PL+T+EL+KRASR  RM
Sbjct  64   FGWIRGHLFDYSSAIVIYEMCVQEPMATVQNVRNQEKLKYPPYPLSTLELQKRASRCCRM  123

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L     EQV HPVWGSYAQRLL+ E
Sbjct  124  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHAIAHEQVPHPVWGSYAQRLLNPE  181

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
              LWR+PS G +DDKAHPPIHPT+F+AGE  WSQDHHKVYELVVRHFLAC SQPA GAET
Sbjct  182  ERLWRNPSNGGHDDKAHPPIHPTKFTAGESNWSQDHHKVYELVVRHFLACCSQPAVGAET  241

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRV++A ++
Sbjct  242  TVEIDIAGEQFNASGRVVLAKNY  264



>ref|XP_010229157.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Brachypodium 
distachyon]
Length=794

 Score =   305 bits (780),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++ A++IYEMCVQ+P ATV  VR QEKLKYPP+PL+T+EL+KRASR  RM
Sbjct  89   FGWIRGHLFDYSSAIVIYEMCVQEPMATVQNVRNQEKLKYPPYPLSTLELQKRASRCCRM  148

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L     EQV HPVWGSYAQRLL+ E
Sbjct  149  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHAIAHEQVPHPVWGSYAQRLLNPE  206

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
              LWR+PS G +DDKAHPPIHPT+F+AGE  WSQDHHKVYELVVRHFLAC SQPA GAET
Sbjct  207  ERLWRNPSNGGHDDKAHPPIHPTKFTAGESNWSQDHHKVYELVVRHFLACCSQPAVGAET  266

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRV++A ++
Sbjct  267  TVEIDIAGEQFNASGRVVLAKNY  289



>ref|XP_006649448.1| PREDICTED: DNA topoisomerase 3-alpha-like [Oryza brachyantha]
Length=923

 Score =   306 bits (785),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 170/203 (84%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++ AV+IYEMCV++P ATV  VR QEKLKYPP+PL+TIEL+KRASRYFRM
Sbjct  265  FGWIRGHLFDYSSAVVIYEMCVEEPMATVQNVRNQEKLKYPPYPLSTIELQKRASRYFRM  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   VQEQ  HPVWG+YAQRLLD E
Sbjct  325  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHSIVQEQTAHPVWGTYAQRLLDPE  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FSAGE  WS +H K+YELVVRHFLAC SQPA GAET
Sbjct  383  ARLWRNPSNGGHDDKAHPPIHPTKFSAGETNWSDNHKKLYELVVRHFLACCSQPAVGAET  442

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRV+++ ++
Sbjct  443  TVEIDIAGEQFNASGRVVLSKNY  465



>ref|XP_002465810.1| hypothetical protein SORBIDRAFT_01g046210 [Sorghum bicolor]
 gb|EER92808.1| hypothetical protein SORBIDRAFT_01g046210 [Sorghum bicolor]
Length=860

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++CA+ IYEMCV +P ATV  VR QEKLKYPP+PL+T+EL+KRASRYFRM
Sbjct  262  FGWIRGHLFDYSCAISIYEMCVSEPMATVQNVRNQEKLKYPPYPLSTVELQKRASRYFRM  321

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V+EQV HPVWG+YAQRLL+ E
Sbjct  322  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHAIVREQVNHPVWGAYAQRLLNPE  379

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FS GE  WS DH ++YELVVRHFLAC SQPA GAET
Sbjct  380  ARLWRNPSNGGHDDKAHPPIHPTKFSEGERNWSPDHIRLYELVVRHFLACCSQPAVGAET  439

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRVI+A ++
Sbjct  440  TVEIDIAGEQFNASGRVILAKNY  462



>gb|AAM15783.1|AC104428_4 Putative DNA topoisomerase III [Oryza sativa Japonica Group]
 gb|ABF94145.1| DNA topoisomerase family protein, expressed [Oryza sativa Japonica 
Group]
Length=912

 Score =   304 bits (779),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++ AV+IYEMCV++P ATV  VR QEKLKYPP+PL+TIEL+KRASRYFRM
Sbjct  363  FGWIRGHLFDYSSAVVIYEMCVEEPMATVQNVRNQEKLKYPPYPLSTIELQKRASRYFRM  422

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V EQV HP WG+YAQRLLD E
Sbjct  423  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHSIVHEQVAHPNWGTYAQRLLDPE  480

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FSAGE  W+ +H K+YELVVRHFLAC SQPA GAET
Sbjct  481  ARLWRNPSNGGHDDKAHPPIHPTKFSAGETNWTDNHKKLYELVVRHFLACCSQPAVGAET  540

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRV++A ++
Sbjct  541  TVEIDIAGEQFNASGRVVLAKNY  563



>ref|XP_008667766.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
Length=818

 Score =   302 bits (774),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++CA+ IYEMCV +P ATV  VR QEKLKYPP+PL+T+EL+KRASRYFRM
Sbjct  165  FGWIRGHLFDYSCAISIYEMCVSEPMATVQNVRNQEKLKYPPYPLSTVELQKRASRYFRM  224

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V+EQV HPVWG+YAQRLL+ E
Sbjct  225  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHAIVREQVNHPVWGAYAQRLLNPE  282

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FS GE  WS DH ++YE VVRHFLAC SQPA GAET
Sbjct  283  ARLWRNPSNGGHDDKAHPPIHPTKFSEGERNWSPDHTRLYEFVVRHFLACCSQPAVGAET  342

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRVI+A ++
Sbjct  343  TVEIDIAGEQFNASGRVILAKNY  365



>ref|XP_010546323.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Tarenaya hassleriana]
Length=906

 Score =   304 bits (778),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQ-QEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  A I+YEMCV++PTATV  V Q +E+ KYPP+PLNTIELEKRASRYFR
Sbjct  262  FNWMRGHLFDYAAAAILYEMCVEEPTATVMNVPQPRERFKYPPYPLNTIELEKRASRYFR  321

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            MSS QTMKVAEDLYQ G+ SYPRTETD FS     +L   V EQV HP WGSYAQRLL+ 
Sbjct  322  MSSEQTMKVAEDLYQAGYTSYPRTETDSFS--SRTDLRAIVDEQVRHPAWGSYAQRLLNP  379

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E GLWR+P  G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRHFLACVSQPA GAE
Sbjct  380  EEGLWRNPGNGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHFLACVSQPAVGAE  439

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDIAGE FSA GR I+A ++
Sbjct  440  TTVEIDIAGERFSASGRAILAKNY  463



>gb|EEC74578.1| hypothetical protein OsI_10148 [Oryza sativa Indica Group]
Length=981

 Score =   304 bits (779),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++ AV+IYEMCV++P ATV  VR QEKLKYPP+PL+TIEL+KRASRYFRM
Sbjct  363  FGWIRGHLFDYSSAVVIYEMCVEEPMATVQNVRNQEKLKYPPYPLSTIELQKRASRYFRM  422

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V EQV HP WG+YAQRLLD E
Sbjct  423  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHSIVHEQVAHPNWGTYAQRLLDPE  480

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FSAGE  W+ +H K+YELVVRHFLAC SQPA GAET
Sbjct  481  ARLWRNPSNGGHDDKAHPPIHPTKFSAGETNWTDNHKKLYELVVRHFLACCSQPAVGAET  540

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRV++A ++
Sbjct  541  TVEIDIAGEQFNASGRVVLAKNY  563



>ref|NP_001173278.1| Os03g0165000 [Oryza sativa Japonica Group]
 sp|C7J0A2.1|TOP3A_ORYSJ RecName: Full=DNA topoisomerase 3-alpha [Oryza sativa Japonica 
Group]
 dbj|BAH92006.1| Os03g0165000 [Oryza sativa Japonica Group]
Length=928

 Score =   303 bits (777),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++ AV+IYEMCV++P ATV  VR QEKLKYPP+PL+TIEL+KRASRYFRM
Sbjct  265  FGWIRGHLFDYSSAVVIYEMCVEEPMATVQNVRNQEKLKYPPYPLSTIELQKRASRYFRM  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V EQV HP WG+YAQRLLD E
Sbjct  325  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHSIVHEQVAHPNWGTYAQRLLDPE  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FSAGE  W+ +H K+YELVVRHFLAC SQPA GAET
Sbjct  383  ARLWRNPSNGGHDDKAHPPIHPTKFSAGETNWTDNHKKLYELVVRHFLACCSQPAVGAET  442

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRV++A ++
Sbjct  443  TVEIDIAGEQFNASGRVVLAKNY  465



>ref|XP_010546322.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Tarenaya hassleriana]
Length=930

 Score =   303 bits (777),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQ-QEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  A I+YEMCV++PTATV  V Q +E+ KYPP+PLNTIELEKRASRYFR
Sbjct  262  FNWMRGHLFDYAAAAILYEMCVEEPTATVMNVPQPRERFKYPPYPLNTIELEKRASRYFR  321

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            MSS QTMKVAEDLYQ G+ SYPRTETD FS     +L   V EQV HP WGSYAQRLL+ 
Sbjct  322  MSSEQTMKVAEDLYQAGYTSYPRTETDSFS--SRTDLRAIVDEQVRHPAWGSYAQRLLNP  379

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E GLWR+P  G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRHFLACVSQPA GAE
Sbjct  380  EEGLWRNPGNGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHFLACVSQPAVGAE  439

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDIAGE FSA GR I+A ++
Sbjct  440  TTVEIDIAGERFSASGRAILAKNY  463



>ref|XP_010229156.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Brachypodium 
distachyon]
Length=969

 Score =   304 bits (779),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++ A++IYEMCVQ+P ATV  VR QEKLKYPP+PL+T+EL+KRASR  RM
Sbjct  264  FGWIRGHLFDYSSAIVIYEMCVQEPMATVQNVRNQEKLKYPPYPLSTLELQKRASRCCRM  323

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L     EQV HPVWGSYAQRLL+ E
Sbjct  324  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHAIAHEQVPHPVWGSYAQRLLNPE  381

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
              LWR+PS G +DDKAHPPIHPT+F+AGE  WSQDHHKVYELVVRHFLAC SQPA GAET
Sbjct  382  ERLWRNPSNGGHDDKAHPPIHPTKFTAGESNWSQDHHKVYELVVRHFLACCSQPAVGAET  441

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRV++A ++
Sbjct  442  TVEIDIAGEQFNASGRVVLAKNY  464



>gb|EEE58379.1| hypothetical protein OsJ_09535 [Oryza sativa Japonica Group]
Length=983

 Score =   304 bits (778),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++ AV+IYEMCV++P ATV  VR QEKLKYPP+PL+TIEL+KRASRYFRM
Sbjct  363  FGWIRGHLFDYSSAVVIYEMCVEEPMATVQNVRNQEKLKYPPYPLSTIELQKRASRYFRM  422

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V EQV HP WG+YAQRLLD E
Sbjct  423  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHSIVHEQVAHPNWGTYAQRLLDPE  480

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FSAGE  W+ +H K+YELVVRHFLAC SQPA GAET
Sbjct  481  ARLWRNPSNGGHDDKAHPPIHPTKFSAGETNWTDNHKKLYELVVRHFLACCSQPAVGAET  540

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRV++A ++
Sbjct  541  TVEIDIAGEQFNASGRVVLAKNY  563



>ref|XP_008667757.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=913

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++CA+ IYEMCV +P ATV  VR QEKLKYPP+PL+T+EL+KRASRYFRM
Sbjct  262  FGWIRGHLFDYSCAISIYEMCVSEPMATVQNVRNQEKLKYPPYPLSTVELQKRASRYFRM  321

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V+EQV HPVWG+YAQRLL+ E
Sbjct  322  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHAIVREQVNHPVWGAYAQRLLNPE  379

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FS GE  WS DH ++YE VVRHFLAC SQPA GAET
Sbjct  380  ARLWRNPSNGGHDDKAHPPIHPTKFSEGERNWSPDHTRLYEFVVRHFLACCSQPAVGAET  439

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRVI+A ++
Sbjct  440  TVEIDIAGEQFNASGRVILAKNY  462



>ref|XP_008667755.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA43538.1| TPA: hypothetical protein ZEAMMB73_751776 [Zea mays]
Length=915

 Score =   302 bits (774),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++CA+ IYEMCV +P ATV  VR QEKLKYPP+PL+T+EL+KRASRYFRM
Sbjct  262  FGWIRGHLFDYSCAISIYEMCVSEPMATVQNVRNQEKLKYPPYPLSTVELQKRASRYFRM  321

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V+EQV HPVWG+YAQRLL+ E
Sbjct  322  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHAIVREQVNHPVWGAYAQRLLNPE  379

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FS GE  WS DH ++YE VVRHFLAC SQPA GAET
Sbjct  380  ARLWRNPSNGGHDDKAHPPIHPTKFSEGERNWSPDHTRLYEFVVRHFLACCSQPAVGAET  439

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRVI+A ++
Sbjct  440  TVEIDIAGEQFNASGRVILAKNY  462



>ref|XP_008667760.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=890

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 166/200 (83%), Gaps = 2/200 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++CA+ IYEMCV +P ATV  VR QEKLKYPP+PL+T+EL+KRASRYFRM
Sbjct  262  FGWIRGHLFDYSCAISIYEMCVSEPMATVQNVRNQEKLKYPPYPLSTVELQKRASRYFRM  321

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V+EQV HPVWG+YAQRLL+ E
Sbjct  322  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHAIVREQVNHPVWGAYAQRLLNPE  379

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FS GE  WS DH ++YE VVRHFLAC SQPA GAET
Sbjct  380  ARLWRNPSNGGHDDKAHPPIHPTKFSEGERNWSPDHTRLYEFVVRHFLACCSQPAVGAET  439

Query  171  IVEIDIAGESFSACGRVIIA  112
             VEIDIAGE F+A GRVI+A
Sbjct  440  TVEIDIAGEQFNASGRVILA  459



>ref|XP_006829322.1| hypothetical protein AMTR_s00202p00033660 [Amborella trichopoda]
 gb|ERM96738.1| hypothetical protein AMTR_s00202p00033660 [Amborella trichopoda]
Length=988

 Score =   302 bits (773),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 168/203 (83%), Gaps = 3/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW RG+LFD++CA+IIYEMCV++PTATV KV  QE+ KYPPHPL+T+EL+KRAS+YFRM
Sbjct  334  FNWTRGHLFDYSCALIIYEMCVEEPTATVKKVSHQERRKYPPHPLSTLELQKRASQYFRM  393

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAEDLYQ GFISYPRTETD FS +   +L   V+EQ GHP WGSYAQRLL  E
Sbjct  394  SSEHTMKVAEDLYQAGFISYPRTETDSFSPN--TDLQALVREQQGHPEWGSYAQRLLSPE  451

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             GLWR+PS G +DDKAHPPIHPT+FSAGE  WS DHH++YELVVRHFLACVSQPA GA T
Sbjct  452  -GLWRNPSSGGHDDKAHPPIHPTKFSAGESSWSPDHHRLYELVVRHFLACVSQPAIGAGT  510

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F A G +II  ++
Sbjct  511  TVEIDIAGEVFVASGLMIIEKNY  533



>ref|XP_002864876.1| hypothetical protein ARALYDRAFT_496584 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41135.1| hypothetical protein ARALYDRAFT_496584 [Arabidopsis lyrata subsp. 
lyrata]
Length=923

 Score =   300 bits (768),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKV-RQQEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  AVI+YEMCV++PTATV  V   +E+ KYPP+PLNTIELEKRASRYFR
Sbjct  262  FNWMRGHLFDYASAVILYEMCVEEPTATVMNVPHPRERFKYPPYPLNTIELEKRASRYFR  321

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            +SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WGSYAQRLL+ 
Sbjct  322  LSSEHTMKVAEELYQAGFISYPRTETDSFS--SRTDLCAMVEEQRRHPAWGSYAQRLLEP  379

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E GLWR+P  G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRH+LACVSQPAK AE
Sbjct  380  EGGLWRNPGNGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHYLACVSQPAKAAE  439

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDIAGE FSA GR I+A ++
Sbjct  440  TTVEIDIAGERFSASGRAILAKNY  463



>ref|NP_201197.1| topoisomerase 3alpha [Arabidopsis thaliana]
 sp|Q9LVP1.1|TOP3A_ARATH RecName: Full=DNA topoisomerase 3-alpha [Arabidopsis thaliana]
 dbj|BAA96895.1| DNA topoisomerase III [Arabidopsis thaliana]
 gb|ACA50279.1| topoisomerase 3 alpha [Arabidopsis thaliana]
 gb|AED97816.1| topoisomerase 3alpha [Arabidopsis thaliana]
Length=926

 Score =   299 bits (765),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKV-RQQEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  AVI+YEMCV++PTATV  V   +E+ KYPP+PLNTIELEKRASRYFR
Sbjct  262  FNWMRGHLFDYASAVILYEMCVEEPTATVMNVPHPRERFKYPPYPLNTIELEKRASRYFR  321

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            +SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WGSYAQRLL+ 
Sbjct  322  LSSEHTMKVAEELYQAGFISYPRTETDSFS--SRTDLRAMVEEQTRHPAWGSYAQRLLEP  379

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E GLWR+P+ G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRH+LACVSQPA  AE
Sbjct  380  EGGLWRNPANGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHYLACVSQPAVAAE  439

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDIAGE FSA GR I+A ++
Sbjct  440  TTVEIDIAGERFSASGRAILAKNY  463



>gb|KFK28084.1| hypothetical protein AALP_AA8G470200 [Arabis alpina]
Length=924

 Score =   298 bits (763),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 164/204 (80%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKV-RQQEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  AVI+YEMCVQ+PTATV  V   +EK KYPP+PLNTIELEKRASRYFR
Sbjct  265  FNWMRGHLFDYASAVILYEMCVQEPTATVMNVPHPREKFKYPPYPLNTIELEKRASRYFR  324

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            +SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WG YAQRLL+ 
Sbjct  325  LSSEHTMKVAEELYQAGFISYPRTETDSFSSR--TDLRAMVEEQTRHPAWGPYAQRLLEP  382

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E GLWR+P  G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRH+LACVSQPA  AE
Sbjct  383  EGGLWRNPGNGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHYLACVSQPAVAAE  442

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDIAGE FSA GR I+A ++
Sbjct  443  TTVEIDIAGERFSASGRAILAKNY  466



>ref|XP_004985595.1| PREDICTED: DNA topoisomerase 3-alpha-like [Setaria italica]
Length=917

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD+  AVI+YEMCV++P ATV  VR QEKLKYPP+PL+T+EL+KRASRYFRM
Sbjct  263  FGWIRGHLFDYPSAVILYEMCVEEPMATVQNVRNQEKLKYPPYPLSTLELQKRASRYFRM  322

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V+EQV HPVWG+YA RLL  E
Sbjct  323  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--TDLHAIVREQVEHPVWGAYAHRLLTPE  380

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
              LWR+PS G +DDKAHPPIHPT+FS GE  WS DH+++YELVVRHFLAC SQPA GAET
Sbjct  381  ERLWRNPSNGGHDDKAHPPIHPTKFSRGENNWSPDHNRLYELVVRHFLACCSQPAVGAET  440

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE F+A GRV++A ++
Sbjct  441  TVEIDIAGEQFNASGRVVLAKNY  463



>ref|XP_010484154.1| PREDICTED: DNA topoisomerase 3-alpha-like [Camelina sativa]
Length=920

 Score =   297 bits (760),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 165/204 (81%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKV-RQQEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  AVI+YEMCV++PTATV  V   +E+ KYPP+PLNTIELEKRASRYFR
Sbjct  262  FNWMRGHLFDYASAVILYEMCVEEPTATVMNVPHPRERFKYPPYPLNTIELEKRASRYFR  321

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            +SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WGSYAQRLL+ 
Sbjct  322  LSSEHTMKVAEELYQAGFISYPRTETDSFS--SRTDLRAMVEEQTRHPAWGSYAQRLLEP  379

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E GLWR+P  G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRH+LACVSQPA  AE
Sbjct  380  EGGLWRNPGNGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHYLACVSQPAVAAE  439

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDI+GE FSA GR I+A ++
Sbjct  440  TTVEIDISGERFSASGRAILAKNY  463



>ref|XP_010444313.1| PREDICTED: LOW QUALITY PROTEIN: DNA topoisomerase 3-alpha-like 
[Camelina sativa]
Length=920

 Score =   296 bits (759),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 165/204 (81%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKV-RQQEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  AVI+YEMCV++PTATV  V   +E+ KYPP+PLNTIELEKRASRYFR
Sbjct  262  FNWMRGHLFDYASAVILYEMCVEEPTATVMNVPHPRERFKYPPYPLNTIELEKRASRYFR  321

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            +SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WGSYAQRLL+ 
Sbjct  322  LSSEHTMKVAEELYQAGFISYPRTETDSFS--SRTDLRAMVEEQTRHPAWGSYAQRLLEP  379

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E GLWR+P  G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRH+LACVSQPA  AE
Sbjct  380  EGGLWRNPGNGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHYLACVSQPAVAAE  439

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDI+GE FSA GR I+A ++
Sbjct  440  TTVEIDISGERFSAYGRAILAKNY  463



>gb|EMT33584.1| DNA topoisomerase 3-alpha [Aegilops tauschii]
Length=745

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 165/203 (81%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++ AV+IYEMCV +P ATV  VR QEKLKYPP+PL+T+EL+KRASR  RM
Sbjct  230  FIWIRGHLFDYSSAVVIYEMCVHEPMATVQNVRNQEKLKYPPYPLSTVELQKRASRCCRM  289

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V+EQV HP WG+YAQRLL+ E
Sbjct  290  SSEHTMKVAEELYQAGFISYPRTETDSFSPN--TDLHAIVREQVDHPDWGTYAQRLLNPE  347

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
              LWR+PS G +DDKAHPPIHPT+FS GE  WS DH KVYELVVRHFLAC SQPA GAET
Sbjct  348  ERLWRNPSNGGHDDKAHPPIHPTKFSTGENNWSPDHKKVYELVVRHFLACCSQPAVGAET  407

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VE+DIAGE F+A GRV++A ++
Sbjct  408  TVEVDIAGEQFNASGRVVLAKNY  430



>gb|EEC84165.1| hypothetical protein OsI_30540 [Oryza sativa Indica Group]
Length=897

 Score =   295 bits (755),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W+RG+LFD++ AV+IYEMCV++P ATV  VR QEKLKYPP+PL+TIEL+KRASRYFRM
Sbjct  265  FGWIRGHLFDYSSAVVIYEMCVKEPMATVQNVRNQEKLKYPPYPLSTIELQKRASRYFRM  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMKVAE+LYQ GFISYPRTETD FS +   +L   V EQV HP  G YAQRLLD E
Sbjct  325  SSEHTMKVAEELYQAGFISYPRTETDNFSPN--IDLHSIVHEQVAHPNRGIYAQRLLDPE  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            + LWR+PS G +DDKAHPPIHPT+FSAGE  W+ +H K+YELVVRHFLAC SQPA GAET
Sbjct  383  ARLWRNPSNGGHDDKAHPPIHPTKFSAGETNWTDNHKKLYELVVRHFLACCSQPAVGAET  442

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEI+IAGE F+A GRV++A ++
Sbjct  443  TVEINIAGEQFNASGRVVLAKNY  465



>ref|XP_006279975.1| hypothetical protein CARUB_v10025845mg [Capsella rubella]
 gb|EOA12873.1| hypothetical protein CARUB_v10025845mg [Capsella rubella]
Length=919

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 165/204 (81%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKV-RQQEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  AVI+YEMCV++PTATV  V   +E+ KYPP+PLNTIELEKRASRYFR
Sbjct  262  FNWMRGHLFDYASAVILYEMCVEEPTATVMNVPHPRERFKYPPYPLNTIELEKRASRYFR  321

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            +SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WG+YAQRLL+ 
Sbjct  322  LSSEHTMKVAEELYQAGFISYPRTETDAFS--SRTDLRAMVEEQTRHPEWGAYAQRLLEP  379

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E GLWR+P  G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRH+LACVSQPA  AE
Sbjct  380  EGGLWRNPGNGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHYLACVSQPAVAAE  439

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDI+GE FSA GR I+A ++
Sbjct  440  TTVEIDISGERFSASGRAILAKNY  463



>emb|CDY39837.1| BnaC02g42810D [Brassica napus]
Length=924

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 162/204 (79%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKV-RQQEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  A I+YEMCV +PTATV  V   +EK KYPP+PLNTIELEKRASRYFR
Sbjct  263  FNWMRGHLFDYASAAILYEMCVMEPTATVMNVPHPREKFKYPPYPLNTIELEKRASRYFR  322

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            +SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WG YAQRLL+ 
Sbjct  323  LSSEHTMKVAEELYQAGFISYPRTETDSFS--SRTDLRAMVEEQTRHPAWGPYAQRLLEP  380

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E GLWR+P  G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRH+LACVSQPA  AE
Sbjct  381  EGGLWRNPGNGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHYLACVSQPAVAAE  440

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDIAGE FSA GR I+A ++
Sbjct  441  TTVEIDIAGERFSASGRAILAKNY  464



>emb|CDY31345.1| BnaA02g33960D [Brassica napus]
Length=921

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 162/204 (79%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKV-RQQEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  A I+YEMCV +PTATV  V   +EK KYPP+PLNTIELEKRASRYFR
Sbjct  263  FNWMRGHLFDYASAAILYEMCVLEPTATVMNVPHPREKFKYPPYPLNTIELEKRASRYFR  322

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            +SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WG YAQRLL+ 
Sbjct  323  LSSEHTMKVAEELYQAGFISYPRTETDSFS--SRTDLRAMVEEQTRHPAWGPYAQRLLEP  380

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E GLWR+P  G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRH+LACVSQPA  AE
Sbjct  381  EGGLWRNPGNGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHYLACVSQPAVAAE  440

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDIAGE FSA GR I+A ++
Sbjct  441  TTVEIDIAGERFSASGRAILAKNY  464



>ref|XP_009130424.1| PREDICTED: DNA topoisomerase 3-alpha [Brassica rapa]
Length=921

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 162/204 (79%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKV-RQQEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  A I+YEMCV +PTATV  V   +EK KYPP+PLNTIELEKRASRYFR
Sbjct  263  FNWMRGHLFDYASAAILYEMCVLEPTATVMNVPHPREKFKYPPYPLNTIELEKRASRYFR  322

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            +SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WG YAQRLL+ 
Sbjct  323  LSSEHTMKVAEELYQAGFISYPRTETDSFS--SRTDLRAMVEEQTRHPAWGPYAQRLLEP  380

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E GLWR+P  G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRH+LACVSQPA  AE
Sbjct  381  EGGLWRNPGNGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHYLACVSQPAVAAE  440

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDIAGE FSA GR I+A ++
Sbjct  441  TTVEIDIAGERFSASGRAILAKNY  464



>ref|XP_006394227.1| hypothetical protein EUTSA_v10003618mg [Eutrema salsugineum]
 gb|ESQ31513.1| hypothetical protein EUTSA_v10003618mg [Eutrema salsugineum]
Length=930

 Score =   292 bits (748),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 162/204 (79%), Gaps = 3/204 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKV-RQQEKLKYPPHPLNTIELEKRASRYFR  535
            FNWMRG+LFD+  AVI+YEMCV +PTATV  V   +EK KYPP+PLNTIELEKRASRYFR
Sbjct  263  FNWMRGHLFDYVSAVILYEMCVLEPTATVMNVPHPREKFKYPPYPLNTIELEKRASRYFR  322

Query  534  MSSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDH  355
            +SS  TMKVAE+LYQ GFISYPRTETD FS     +L   V+EQ  HP WG YAQRLL+ 
Sbjct  323  LSSEHTMKVAEELYQAGFISYPRTETDSFSSR--TDLRAMVEEQTRHPAWGPYAQRLLEP  380

Query  354  ESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAE  175
            E G WR+P  G +DDKAHPPIHPT+FS+GE  WS+DH  VYELVVRH+LACVSQPA  AE
Sbjct  381  EGGHWRNPGNGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHYLACVSQPAIAAE  440

Query  174  TIVEIDIAGESFSACGRVIIAVSF  103
            T VEIDIAGE FSA GR I+A ++
Sbjct  441  TTVEIDIAGERFSASGRAILAKNY  464



>ref|XP_010103452.1| DNA topoisomerase 3-alpha [Morus notabilis]
 gb|EXB95897.1| DNA topoisomerase 3-alpha [Morus notabilis]
Length=1580

 Score =   286 bits (733),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 155/203 (76%), Gaps = 30/203 (15%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNWMRG+LFD+TCAV+IYEMCV++PTATVT VR+QEKLKYPP+PLNTIELEKRASRYFRM
Sbjct  263  FNWMRGHLFDYTCAVVIYEMCVEEPTATVTNVRKQEKLKYPPYPLNTIELEKRASRYFRM  322

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMK                                V+EQ GHP+WGSYAQRLLD  
Sbjct  323  SSEHTMKA------------------------------IVEEQQGHPIWGSYAQRLLDPG  352

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            SGLWR+P  G +DDKAHPPIHPT+FSAGEP WSQDH ++YELVVRHFLACVSQPA GAET
Sbjct  353  SGLWRNPGNGGHDDKAHPPIHPTKFSAGEPAWSQDHLRLYELVVRHFLACVSQPAVGAET  412

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIAGE FSA GRV++A ++
Sbjct  413  TVEIDIAGELFSASGRVVLAKNY  435



>ref|XP_006581778.1| PREDICTED: DNA topoisomerase 3-alpha isoform X4 [Glycine max]
Length=885

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 156/218 (72%), Gaps = 37/218 (17%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG LFD+TCAVIIYEMCV++PTATVT +RQQEK KYPP PLNTIEL+KRASRYFRM
Sbjct  256  FSWMRGRLFDYTCAVIIYEMCVEEPTATVTNIRQQEKPKYPPFPLNTIELQKRASRYFRM  315

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            SS  TMK                                VQEQ GHP WG YAQRL+D E
Sbjct  316  SSDHTMKT------------------------------IVQEQQGHPEWGIYAQRLMDPE  345

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+P GG +DDKAHPPI+PT+FS GE GWSQDH K+YELVVRHFLACVS+PA GAET
Sbjct  346  AGLWRNPRGGGHDDKAHPPIYPTKFSTGESGWSQDHRKLYELVVRHFLACVSKPALGAET  405

Query  171  IVEIDIAGESFSACGRVIIAVSF*LHQQYITLH-YRDW  61
             VEI+IAGE FSACGRVI      L + Y+ ++ Y  W
Sbjct  406  TVEINIAGELFSACGRVI------LEKNYLDVYRYESW  437



>ref|XP_002985109.1| hypothetical protein SELMODRAFT_121488 [Selaginella moellendorffii]
 gb|EFJ13984.1| hypothetical protein SELMODRAFT_121488 [Selaginella moellendorffii]
Length=791

 Score =   269 bits (688),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 150/203 (74%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W RG+LFD+  AV IYEMCV++P ATV  V  +E  K PPHPLNT+EL KRASR+ R+
Sbjct  255  FKWARGHLFDYVAAVAIYEMCVEEPLATVFSVTGRETRKNPPHPLNTVELVKRASRFLRL  314

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
             S +TMK AE+LYQQGFISYPRTETD FS +   +L   V+EQ  HPVWG+YA RLLD  
Sbjct  315  GSQETMKAAEELYQQGFISYPRTETDYFSEN--TDLRRMVEEQTRHPVWGNYAHRLLDSR  372

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
              LWR PS G +DDKAHPPIHPTRFS GEP W  DH  VYELVVRHFLACVSQPA G  T
Sbjct  373  ENLWRHPSNGGHDDKAHPPIHPTRFSDGEPQWRNDHKAVYELVVRHFLACVSQPAVGYAT  432

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
               IDIAGE FSA G ++ A ++
Sbjct  433  KAMIDIAGEQFSANGLMVTARNY  455



>ref|XP_002970788.1| hypothetical protein SELMODRAFT_94303 [Selaginella moellendorffii]
 gb|EFJ28114.1| hypothetical protein SELMODRAFT_94303 [Selaginella moellendorffii]
Length=794

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W RG+LFD+  AV IYEMCV++P ATV  V  +E  K PPHPLNT+EL KRASR+ R 
Sbjct  255  FKWTRGHLFDYVAAVSIYEMCVEEPLATVFSVTGRETRKNPPHPLNTVELVKRASRFLRF  314

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
             S +TMK AE+LYQQGFISYPRTETD FS +   +L   V+EQ  HPVWG+YA RL+D  
Sbjct  315  GSQETMKAAEELYQQGFISYPRTETDYFSEN--TDLRRMVEEQTRHPVWGNYAHRLVDPR  372

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
              LWR PS G +DDKAHPPIHPTRFS GEP W  DH  VYELVVRHFLACVSQPA G  T
Sbjct  373  ENLWRHPSNGGHDDKAHPPIHPTRFSDGEPQWRNDHKAVYELVVRHFLACVSQPAVGYAT  432

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
               IDIAGE FSA G ++ A ++
Sbjct  433  KAMIDIAGEQFSANGLMVTARNY  455



>ref|XP_001785482.1| predicted protein [Physcomitrella patens]
 gb|EDQ49689.1| predicted protein [Physcomitrella patens]
Length=915

 Score =   263 bits (672),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 153/211 (73%), Gaps = 10/211 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W RG LFD   A IIYEMC++ PTATV +V  QEK K+PP PLNT+EL+KRASRYFRM
Sbjct  258  FSWARGRLFDELAAFIIYEMCMERPTATVCQVTGQEKRKFPPVPLNTVELQKRASRYFRM  317

Query  531  S--------SAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSY  376
                      +Q ++VAE+LYQ GFISYPRTETD+FS +   +L   V EQ+GH  WG Y
Sbjct  318  GYILNYEAVRSQFLQVAEELYQAGFISYPRTETDKFSEN--QDLQSIVNEQIGHSAWGQY  375

Query  375  AQRLLDHESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVS  196
            AQRLLD +  LW+ P  G +DDKAHPPIHPTRFS GE  W+ DH ++YELVVRHFLACVS
Sbjct  376  AQRLLDPQQQLWKQPGDGGHDDKAHPPIHPTRFSEGEGNWTNDHARIYELVVRHFLACVS  435

Query  195  QPAKGAETIVEIDIAGESFSACGRVIIAVSF  103
            QPA G  T   IDIAGE F+A G +I A ++
Sbjct  436  QPAIGYGTTATIDIAGERFTATGLMITAKNY  466



>gb|KHN09630.1| DNA topoisomerase 3-alpha [Glycine soja]
Length=499

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 139/203 (68%), Gaps = 41/203 (20%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+WMRG LFD+TCAVIIYEMCV++PTATV                               
Sbjct  246  FSWMRGRLFDYTCAVIIYEMCVEEPTATV-------------------------------  274

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
                    AE+LYQ GFISYPRTETD FS     +L   VQEQ GHP WG YAQRL+D E
Sbjct  275  --------AEELYQAGFISYPRTETDSFSPG--TDLHTIVQEQQGHPEWGIYAQRLMDPE  324

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
            +GLWR+P GG +DDKAHPPI+PT+FS GE GWSQDH K+YELVVRHFLACVS+PA GAET
Sbjct  325  AGLWRNPRGGGHDDKAHPPIYPTKFSTGESGWSQDHRKLYELVVRHFLACVSKPALGAET  384

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEI+IAGE FSACGRVI+  ++
Sbjct  385  TVEINIAGELFSACGRVILEKNY  407



>ref|XP_006798035.1| PREDICTED: DNA topoisomerase 3-alpha-like [Neolamprologus brichardi]
Length=1037

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  300  FNWKRNRLFNHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  359

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            S+ +TMK+AE LY QGFISYPRTET+ F     ANL +T  V++Q   PVWG++AQR+LD
Sbjct  360  SAKRTMKIAEKLYTQGFISYPRTETNIFP----ANLALTPLVEQQAHSPVWGAFAQRVLD  415

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+F+    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  416  QPGG--PNPRQGKNSDQAHPPIHPTKFTNALQG---NEGRVYEFIVRHFLACVSQDALGQ  470

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+V+IDIA E FS  G +IIA ++
Sbjct  471  ETVVDIDIAQEKFSVSGLMIIARNY  495



>ref|XP_005468449.1| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Oreochromis 
niloticus]
Length=957

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  220  FNWKRNRLFNHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  279

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            S+ +TMK+AE LY QGFISYPRTET+ F      NL +T  V++Q   PVWG++AQR+LD
Sbjct  280  SAKETMKIAEKLYTQGFISYPRTETNIFP----PNLALTPLVEQQTHSPVWGAFAQRVLD  335

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+F+    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  336  QPGG--PNPRQGKNSDQAHPPIHPTKFTNALQG---NEGRVYEFIVRHFLACVSQDALGQ  390

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+V+IDIA E FSA G +IIA ++
Sbjct  391  ETVVDIDIAQEKFSASGLMIIARNY  415



>ref|XP_005468447.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Oreochromis 
niloticus]
 ref|XP_005468448.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Oreochromis 
niloticus]
Length=1037

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  300  FNWKRNRLFNHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  359

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            S+ +TMK+AE LY QGFISYPRTET+ F      NL +T  V++Q   PVWG++AQR+LD
Sbjct  360  SAKETMKIAEKLYTQGFISYPRTETNIFP----PNLALTPLVEQQTHSPVWGAFAQRVLD  415

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+F+    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  416  QPGG--PNPRQGKNSDQAHPPIHPTKFTNALQG---NEGRVYEFIVRHFLACVSQDALGQ  470

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+V+IDIA E FSA G +IIA ++
Sbjct  471  ETVVDIDIAQEKFSASGLMIIARNY  495



>ref|XP_005752308.1| PREDICTED: DNA topoisomerase 3-alpha-like isoform X2 [Pundamilia 
nyererei]
Length=957

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  220  FNWKRNRLFNHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  279

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            S+ +TMK+AE LY QGFISYPRTET+ F     ANL +T  V++Q   PVWG++AQR+LD
Sbjct  280  SAKETMKIAEKLYTQGFISYPRTETNIFP----ANLALTPLVEQQAHSPVWGAFAQRVLD  335

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+F+    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  336  QPGG--PNPRQGKNSDQAHPPIHPTKFTNTLQG---NEGRVYEFIVRHFLACVSQDALGQ  390

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+V+IDIA E FS  G +IIA ++
Sbjct  391  ETVVDIDIAQEKFSVSGLMIIARNY  415



>ref|XP_005947077.1| PREDICTED: DNA topoisomerase 3-alpha-like isoform X2 [Haplochromis 
burtoni]
Length=957

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  220  FNWKRNRLFNHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  279

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            S+ +TMK+AE LY QGFISYPRTET+ F     ANL +T  V++Q   PVWG++AQR+LD
Sbjct  280  SAKETMKIAEKLYTQGFISYPRTETNIFP----ANLALTPLVEQQAHSPVWGAFAQRVLD  335

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+F+    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  336  QPGG--PNPRQGKNSDQAHPPIHPTKFTNTLQG---NEGRVYEFIVRHFLACVSQDALGQ  390

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+V+IDIA E FS  G +IIA ++
Sbjct  391  ETVVDIDIAQEKFSVSGLMIIARNY  415



>ref|XP_004575543.1| PREDICTED: DNA topoisomerase 3-alpha-like isoform X2 [Maylandia 
zebra]
Length=957

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  220  FNWKRNRLFNHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  279

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            S+ +TMK+AE LY QGFISYPRTET+ F     ANL +T  V++Q   PVWG++AQR+LD
Sbjct  280  SAKETMKIAEKLYTQGFISYPRTETNIFP----ANLALTPLVEQQAHSPVWGAFAQRVLD  335

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+F+    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  336  QPGG--PNPRQGKNSDQAHPPIHPTKFTNTLQG---NEGRVYEFIVRHFLACVSQDALGQ  390

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+V+IDIA E FS  G +IIA ++
Sbjct  391  ETVVDIDIAQEKFSVSGLMIIARNY  415



>ref|XP_005752307.1| PREDICTED: DNA topoisomerase 3-alpha-like isoform X1 [Pundamilia 
nyererei]
Length=1037

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  300  FNWKRNRLFNHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  359

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            S+ +TMK+AE LY QGFISYPRTET+ F     ANL +T  V++Q   PVWG++AQR+LD
Sbjct  360  SAKETMKIAEKLYTQGFISYPRTETNIFP----ANLALTPLVEQQAHSPVWGAFAQRVLD  415

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+F+    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  416  QPGG--PNPRQGKNSDQAHPPIHPTKFTNTLQG---NEGRVYEFIVRHFLACVSQDALGQ  470

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+V+IDIA E FS  G +IIA ++
Sbjct  471  ETVVDIDIAQEKFSVSGLMIIARNY  495



>ref|XP_004575542.1| PREDICTED: DNA topoisomerase 3-alpha-like isoform X1 [Maylandia 
zebra]
Length=1037

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  300  FNWKRNRLFNHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  359

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            S+ +TMK+AE LY QGFISYPRTET+ F     ANL +T  V++Q   PVWG++AQR+LD
Sbjct  360  SAKETMKIAEKLYTQGFISYPRTETNIFP----ANLALTPLVEQQAHSPVWGAFAQRVLD  415

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+F+    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  416  QPGG--PNPRQGKNSDQAHPPIHPTKFTNTLQG---NEGRVYEFIVRHFLACVSQDALGQ  470

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+V+IDIA E FS  G +IIA ++
Sbjct  471  ETVVDIDIAQEKFSVSGLMIIARNY  495



>ref|XP_005947076.1| PREDICTED: DNA topoisomerase 3-alpha-like isoform X1 [Haplochromis 
burtoni]
Length=1037

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 145/205 (71%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  300  FNWKRNRLFNHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  359

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            S+ +TMK+AE LY QGFISYPRTET+ F     ANL +T  V++Q   PVWG++AQR+LD
Sbjct  360  SAKETMKIAEKLYTQGFISYPRTETNIFP----ANLALTPLVEQQAHSPVWGAFAQRVLD  415

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+F+    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  416  QPGG--PNPRQGKNSDQAHPPIHPTKFTNTLQG---NEGRVYEFIVRHFLACVSQDALGQ  470

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+V+IDIA E FS  G +IIA ++
Sbjct  471  ETVVDIDIAQEKFSVSGLMIIARNY  495



>gb|KFQ18375.1| DNA topoisomerase 3-alpha, partial [Merops nubicus]
Length=982

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  258  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  317

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  318  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPSWGAFAQRILDQG  375

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++AG  G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  376  GPT---PRNGTKSDQAHPPIHPTKYTAGLQG---NEQRLYEFIVRHFLACCSQDAKGQET  429

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  430  TVEIDIANERFIAQGLMILARNY  452



>ref|XP_008937408.1| PREDICTED: DNA topoisomerase 3-alpha, partial [Merops nubicus]
Length=988

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  257  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  316

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  317  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPSWGAFAQRILDQG  374

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++AG  G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  375  GPT---PRNGTKSDQAHPPIHPTKYTAGLQG---NEQRLYEFIVRHFLACCSQDAKGQET  428

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  429  TVEIDIANERFIAQGLMILARNY  451



>gb|KFP49074.1| DNA topoisomerase 3-alpha, partial [Cathartes aura]
Length=693

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  12   FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  71

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  72   NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  129

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  130  GP---TPRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  183

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIA E F A G +I+A ++
Sbjct  184  IVEIDIANERFIAQGLMILARNY  206



>gb|KFQ64986.1| DNA topoisomerase 3-alpha, partial [Pelecanus crispus]
Length=998

 Score =   211 bits (537),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++AG  G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRSGTKSDQAHPPIHPTKYTAGLQG---NEQRLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>ref|XP_009487964.1| PREDICTED: DNA topoisomerase 3-alpha [Pelecanus crispus]
Length=1019

 Score =   211 bits (537),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++AG  G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRSGTKSDQAHPPIHPTKYTAGLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>ref|XP_008328483.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Cynoglossus 
semilaevis]
Length=1032

 Score =   211 bits (537),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 144/205 (70%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  300  FNWKRNRLFNHTACLVLYQICMEDPMATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  359

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            ++ +TMKVAE LY QG ISYPRTET+ F     ANLP++  V++Q   PVWG++AQR+L+
Sbjct  360  TAKETMKVAEKLYTQGLISYPRTETNIFP----ANLPLSPLVEQQTQSPVWGTFAQRVLE  415

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G   D+AHPPIHP ++S+   G   +  ++YE +VRHFLACVSQ A G 
Sbjct  416  QPGG--PNPRQGKKSDQAHPPIHPIKYSSNLQG---NEGRLYEFIVRHFLACVSQDALGQ  470

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+V+IDIA E FS  G +IIA ++
Sbjct  471  ETMVDIDIAQEKFSTAGLMIIARNY  495



>ref|XP_008328484.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Cynoglossus 
semilaevis]
Length=1030

 Score =   211 bits (537),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 144/205 (70%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  300  FNWKRNRLFNHTACLVLYQICMEDPMATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  359

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            ++ +TMKVAE LY QG ISYPRTET+ F     ANLP++  V++Q   PVWG++AQR+L+
Sbjct  360  TAKETMKVAEKLYTQGLISYPRTETNIFP----ANLPLSPLVEQQTQSPVWGTFAQRVLE  415

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G   D+AHPPIHP ++S+   G   +  ++YE +VRHFLACVSQ A G 
Sbjct  416  QPGG--PNPRQGKKSDQAHPPIHPIKYSSNLQG---NEGRLYEFIVRHFLACVSQDALGQ  470

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+V+IDIA E FS  G +IIA ++
Sbjct  471  ETMVDIDIAQEKFSTAGLMIIARNY  495



>ref|XP_009919078.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Haliaeetus albicilla]
Length=941

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  207  FNWKRNRLFNHTACLVLYHMCMEDPAATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  266

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  267  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSTLVQQQTQDPNWGAFAQRILDQG  324

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  325  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  378

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIA E F A G +I+A ++
Sbjct  379  IVEIDIANERFIAQGLMILARNY  401



>gb|KFQ05538.1| DNA topoisomerase 3-alpha, partial [Haliaeetus albicilla]
Length=995

 Score =   210 bits (534),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYHMCMEDPAATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSTLVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIA E F A G +I+A ++
Sbjct  437  IVEIDIANERFIAQGLMILARNY  459



>ref|XP_010568690.1| PREDICTED: DNA topoisomerase 3-alpha [Haliaeetus leucocephalus]
Length=1013

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  279  FNWKRNRLFNHTACLVLYHMCMEDPAATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  338

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  339  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSTLVQQQTQDPNWGAFAQRILDQG  396

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  397  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  450

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIA E F A G +I+A ++
Sbjct  451  IVEIDIANERFIAQGLMILARNY  473



>ref|XP_009919077.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Haliaeetus albicilla]
Length=1005

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  271  FNWKRNRLFNHTACLVLYHMCMEDPAATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  330

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  331  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSTLVQQQTQDPNWGAFAQRILDQG  388

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  389  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  442

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIA E F A G +I+A ++
Sbjct  443  IVEIDIANERFIAQGLMILARNY  465



>ref|XP_004071982.1| PREDICTED: DNA topoisomerase 3-alpha-like [Oryzias latipes]
Length=987

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 142/203 (70%), Gaps = 7/203 (3%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HTC +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  301  FSWKRNRLFNHTCCLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  360

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TMK+AE LY QGFISYPRTET+ F  + +  L   V++Q     WG++AQR+LD  
Sbjct  361  NAKETMKIAEKLYTQGFISYPRTETNIFPANLV--LAPLVEQQTHSSTWGTFAQRVLDQP  418

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G   +P  G   D+AHPPIHPT++++   G   +  +VYE +VRHFLACVSQ A G ET
Sbjct  419  GG--PNPRQGKKSDQAHPPIHPTKYTSSLQG---NEARVYEFIVRHFLACVSQDALGQET  473

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            +V+IDIA E FS  G +IIA ++
Sbjct  474  VVDIDIAQEKFSTSGLMIIARNY  496



>ref|XP_002947763.1| hypothetical protein VOLCADRAFT_79791 [Volvox carteri f. nagariensis]
 gb|EFJ51296.1| hypothetical protein VOLCADRAFT_79791 [Volvox carteri f. nagariensis]
Length=936

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 130/199 (65%), Gaps = 4/199 (2%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F W RG LFD   A + YE+C +  TA V  VR   + +  P PL+T+E++KRA+   RM
Sbjct  269  FEWARGRLFDEAVAEMYYEICEEAGTAVVVSVRGTTRTRQAPAPLSTLEMQKRATAKLRM  328

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            S  + MK+AE+LYQ GFISYPRTETD F  D   +L   V E  G P WG +AQR+L  E
Sbjct  329  SGERIMKLAEELYQAGFISYPRTETDVF--DPGMDLQGIVTEHTGDPRWGRHAQRILSGE  386

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
              LWR P  G +DDKAHPPIHPTR S GE  WS D  ++YE VVRHFLAC S+ A G+ET
Sbjct  387  --LWRQPRPGGHDDKAHPPIHPTRHSLGEHDWSHDKRQLYEFVVRHFLACCSKDAVGSET  444

Query  171  IVEIDIAGESFSACGRVII  115
             VEIDI GE F   G +++
Sbjct  445  QVEIDIGGERFRTTGLMVL  463



>gb|KFM12436.1| DNA topoisomerase 3-alpha, partial [Aptenodytes forsteri]
Length=992

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPSWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GP---TPRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>gb|KFR08069.1| DNA topoisomerase 3-alpha, partial [Opisthocomus hoazin]
Length=995

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GP---TPRSGTKSDQAHPPIHPTKYTANLQGSEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>gb|KFV20288.1| DNA topoisomerase 3-alpha, partial [Tauraco erythrolophus]
Length=946

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 141/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  224  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  283

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD E
Sbjct  284  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSSLVQQQTQDPNWGAFAQRILD-E  340

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  341  GG--PTPRSGTKTDQAHPPIHPTKYAANLQGSEQ---RLYEFIVRHFLACCSQDAKGQET  395

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  396  TVEIDIANERFIAQGLMILARNY  418



>ref|XP_009988506.1| PREDICTED: DNA topoisomerase 3-alpha, partial [Tauraco erythrolophus]
Length=951

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 141/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  223  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  282

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD E
Sbjct  283  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSSLVQQQTQDPNWGAFAQRILD-E  339

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  340  GG--PTPRSGTKTDQAHPPIHPTKYAANLQGSEQ---RLYEFIVRHFLACCSQDAKGQET  394

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  395  TVEIDIANERFIAQGLMILARNY  417



>ref|XP_009930649.1| PREDICTED: DNA topoisomerase 3-alpha [Opisthocomus hoazin]
Length=1019

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GP---TPRSGTKSDQAHPPIHPTKYTANLQGSEQ---RLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>gb|KFP42710.1| DNA topoisomerase 3-alpha, partial [Chlamydotis macqueenii]
Length=995

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNDQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFVAQGLMILARNY  459



>gb|KFO07060.1| DNA topoisomerase 3-alpha, partial [Balearica regulorum gibbericeps]
Length=991

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GP---TPRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>gb|KFQ99903.1| DNA topoisomerase 3-alpha, partial [Nipponia nippon]
Length=991

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFVAQGLMILARNY  459



>ref|XP_005017065.1| PREDICTED: DNA topoisomerase 3-alpha [Anas platyrhynchos]
 gb|EOB03181.1| DNA topoisomerase 3-alpha, partial [Anas platyrhynchos]
Length=1020

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TMK+AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMKIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>ref|XP_009284732.1| PREDICTED: DNA topoisomerase 3-alpha [Aptenodytes forsteri]
Length=1019

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPSWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GP---TPRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>ref|XP_009807307.1| PREDICTED: DNA topoisomerase 3-alpha [Gavia stellata]
Length=990

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  256  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  315

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  316  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  373

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  374  GPT---PRSGTKSDQAHPPIHPTKYTASLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  427

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  428  TVEIDIANERFIAQGLMILARNY  450



>gb|KFW09486.1| DNA topoisomerase 3-alpha, partial [Fulmarus glacialis]
Length=990

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP AT+ +V  + K K+ P PL T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATIVEVGSKPKSKWRPLPLETVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNVFPKE--LNLSALVQQQTQDPSWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GP---TPRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFVAQGLMILARNY  459



>ref|XP_010120298.1| PREDICTED: DNA topoisomerase 3-alpha [Chlamydotis macqueenii]
Length=1019

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNDQ---RLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFVAQGLMILARNY  479



>ref|XP_010196093.1| PREDICTED: LOW QUALITY PROTEIN: DNA topoisomerase 3-alpha [Colius 
striatus]
Length=951

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  281  FNWKRNRLFSHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  340

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  341  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  398

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  399  GP---TPRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  452

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  453  TVEIDIANERFIAQGLMILARNY  475



>gb|KFV51470.1| DNA topoisomerase 3-alpha, partial [Gavia stellata]
Length=991

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  263  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  322

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  323  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  380

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  381  GP---TPRSGTKSDQAHPPIHPTKYTASLQG---NEQRLYEFIVRHFLACCSQDAKGQET  434

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  435  TVEIDIANERFIAQGLMILARNY  457



>gb|KFP11629.1| DNA topoisomerase 3-alpha, partial [Egretta garzetta]
Length=989

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GP---TPRSGTKSDQAHPPIHPTKYAANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>ref|XP_010300310.1| PREDICTED: DNA topoisomerase 3-alpha [Balearica regulorum gibbericeps]
Length=1019

 Score =   209 bits (532),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GP---TPRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>gb|KFZ62874.1| DNA topoisomerase 3-alpha, partial [Caprimulgus carolinensis]
Length=992

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD E
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILD-E  381

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  382  GG--PTPRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>ref|XP_010138219.1| PREDICTED: DNA topoisomerase 3-alpha, partial [Buceros rhinoceros 
silvestris]
Length=956

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  223  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  282

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  283  NAKETMRIAEKLYTQGFISYPRTETNVFPKE--LNLSTLVQQQTQDPNWGAFAQRILDQG  340

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  341  GPT---PRSGTKSDQAHPPIHPTKYAANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  394

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  395  TVEIDIANERFIAQGLMILARNY  417



>ref|XP_008413798.1| PREDICTED: DNA topoisomerase 3-alpha [Poecilia reticulata]
Length=1019

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 142/205 (69%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  294  FSWKRNRLFHHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  353

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            ++ +TMK+AE LY QG ISYPRTET+ F     ANLP+   V++Q   P WG++AQR+LD
Sbjct  354  NAKETMKIAEKLYTQGLISYPRTETNIFP----ANLPLAPLVEQQAQSPEWGTFAQRVLD  409

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+++    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  410  QPGG--PNPRQGKNSDQAHPPIHPTKYTNALQG---NEARVYEFIVRHFLACVSQDALGQ  464

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+VEI+IA E FS  G +IIA ++
Sbjct  465  ETVVEIEIAQEKFSTSGLMIIARNY  489



>ref|XP_009581158.1| PREDICTED: DNA topoisomerase 3-alpha [Fulmarus glacialis]
Length=1018

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP AT+ +V  + K K+ P PL T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATIVEVGSKPKSKWRPLPLETVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNVFPKE--LNLSALVQQQTQDPSWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GP---TPRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFVAQGLMILARNY  479



>ref|XP_009466099.1| PREDICTED: DNA topoisomerase 3-alpha [Nipponia nippon]
Length=1019

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GP---TPRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFVAQGLMILARNY  479



>gb|KGL96157.1| DNA topoisomerase 3-alpha, partial [Charadrius vociferus]
Length=998

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPMATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>gb|KFQ81468.1| DNA topoisomerase 3-alpha, partial [Phaethon lepturus]
Length=991

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 144/218 (66%), Gaps = 15/218 (7%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRLAEKLYTQGFISYPRTETNIFPKE--MNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF*LHQQYITLH-YRDW  61
             VEIDIA E F A G +I+A      Q Y+ ++ Y  W
Sbjct  437  TVEIDIANERFIAQGLMILA------QNYLEVYPYEKW  468



>ref|XP_009647736.1| PREDICTED: DNA topoisomerase 3-alpha [Egretta garzetta]
Length=1021

 Score =   209 bits (531),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GP---TPRSGTKSDQAHPPIHPTKYAANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>ref|XP_009886830.1| PREDICTED: DNA topoisomerase 3-alpha [Charadrius vociferus]
Length=1019

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPMATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>ref|XP_010170981.1| PREDICTED: DNA topoisomerase 3-alpha [Caprimulgus carolinensis]
Length=1020

 Score =   208 bits (530),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD E
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILD-E  401

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  402  GG--PTPRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>ref|XP_010291976.1| PREDICTED: DNA topoisomerase 3-alpha [Phaethon lepturus]
Length=1019

 Score =   208 bits (530),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 144/218 (66%), Gaps = 15/218 (7%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRLAEKLYTQGFISYPRTETNIFPKE--MNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF*LHQQYITLH-YRDW  61
             VEIDIA E F A G +I+A      Q Y+ ++ Y  W
Sbjct  457  TVEIDIANERFIAQGLMILA------QNYLEVYPYEKW  488



>gb|KFP04783.1| DNA topoisomerase 3-alpha, partial [Calypte anna]
Length=989

 Score =   208 bits (529),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRNGTKSDQAHPPIHPTKYTSNLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>gb|KFQ89960.1| DNA topoisomerase 3-alpha, partial [Phoenicopterus ruber ruber]
Length=993

 Score =   208 bits (529),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GP---TPRSGTKSDQAHPPIHPTKYAANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>ref|XP_007574411.1| PREDICTED: DNA topoisomerase 3-alpha [Poecilia formosa]
Length=1025

 Score =   208 bits (529),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 142/205 (69%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  298  FSWKRNRLFHHTACLVLYQICMEDPMATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  357

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            ++ +TMK+AE LY QG ISYPRTET+ F     ANLP+   V++Q   P WG++AQR+LD
Sbjct  358  NAKETMKIAEKLYTQGLISYPRTETNIFP----ANLPLAPLVEQQAQSPEWGTFAQRVLD  413

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+++    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  414  QPGG--PNPRQGKNSDQAHPPIHPTKYTNTLQG---NEARVYEFIVRHFLACVSQDALGQ  468

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+VEI+IA E FS  G +IIA ++
Sbjct  469  ETVVEIEIAQEKFSTSGLMIIARNY  493



>gb|KFV77823.1| DNA topoisomerase 3-alpha, partial [Struthio camelus australis]
Length=994

 Score =   207 bits (528),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVASKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIAKERFIAQGLMILARNY  459



>gb|KFP65450.1| DNA topoisomerase 3-alpha, partial [Cariama cristata]
Length=994

 Score =   207 bits (528),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GP---TPRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>gb|KFQ02639.1| DNA topoisomerase 3-alpha, partial [Leptosomus discolor]
Length=956

 Score =   207 bits (527),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  223  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  282

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  283  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDRG  340

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC S+ AKG ET
Sbjct  341  GP---TPRSGTKSDQAHPPIHPTKYAANLQGSEQ---RLYEFIVRHFLACCSEDAKGQET  394

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  395  TVEIDIANERFIAQGLMILARNY  417



>ref|XP_009946177.1| PREDICTED: DNA topoisomerase 3-alpha, partial [Leptosomus discolor]
Length=957

 Score =   207 bits (527),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  223  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  282

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  283  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDRG  340

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC S+ AKG ET
Sbjct  341  GP---TPRSGTKSDQAHPPIHPTKYAANLQGSEQ---RLYEFIVRHFLACCSEDAKGQET  394

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  395  TVEIDIANERFIAQGLMILARNY  417



>ref|XP_009666303.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Struthio camelus 
australis]
 ref|XP_009666304.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Struthio camelus 
australis]
Length=943

 Score =   207 bits (527),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  207  FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVASKPKSKWRPLPLDTVELEKLASRKLKI  266

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  267  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  324

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  325  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  378

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  379  TVEIDIAKERFIAQGLMILARNY  401



>gb|KFQ33210.1| DNA topoisomerase 3-alpha, partial [Mesitornis unicolor]
Length=910

 Score =   207 bits (526),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  178  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  237

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD E
Sbjct  238  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPHWGAFAQRILD-E  294

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT+++    G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  295  GG--PTPRNGSKSDQAHPPIHPTKYTGNLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  349

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  350  TVEIDIANERFIAQGLMILARNY  372



>ref|XP_008497098.1| PREDICTED: DNA topoisomerase 3-alpha [Calypte anna]
Length=1016

 Score =   207 bits (528),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRNGTKSDQAHPPIHPTKYTSNLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>ref|XP_009699312.1| PREDICTED: DNA topoisomerase 3-alpha [Cariama cristata]
Length=1014

 Score =   207 bits (528),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GP---TPRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>ref|XP_010180235.1| PREDICTED: DNA topoisomerase 3-alpha, partial [Mesitornis unicolor]
Length=932

 Score =   207 bits (526),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  196  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  255

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD E
Sbjct  256  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPHWGAFAQRILD-E  312

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT+++    G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  313  GG--PTPRNGSKSDQAHPPIHPTKYTGNLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  367

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  368  TVEIDIANERFIAQGLMILARNY  390



>ref|XP_009666302.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Struthio camelus 
australis]
Length=1021

 Score =   207 bits (528),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVASKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIAKERFIAQGLMILARNY  479



>ref|NP_001025807.1| DNA topoisomerase 3-alpha isoform 1 [Gallus gallus]
 dbj|BAD99110.1| topoisomerase III alpha [Gallus gallus]
Length=1020

 Score =   207 bits (528),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYHMCMEDPIATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQHQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRNGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFVAQGLMILARNY  479



>ref|XP_010717866.1| PREDICTED: DNA topoisomerase 3-alpha [Meleagris gallopavo]
 ref|XP_010717867.1| PREDICTED: DNA topoisomerase 3-alpha [Meleagris gallopavo]
Length=1020

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQHQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRNGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>gb|KFQ53766.1| DNA topoisomerase 3-alpha, partial [Nestor notabilis]
Length=998

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  268  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  327

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM+++E LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  328  NAKETMRISEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  385

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  386  GPT---PRSGSKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  439

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  440  TVEIDIASERFIAQGLMILARNY  462



>ref|XP_010017397.1| PREDICTED: DNA topoisomerase 3-alpha [Nestor notabilis]
Length=1006

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  273  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  332

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM+++E LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  333  NAKETMRISEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  390

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  391  GPT---PRSGSKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  444

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  445  TVEIDIASERFIAQGLMILARNY  467



>ref|XP_010211313.1| PREDICTED: DNA topoisomerase 3-alpha [Tinamus guttatus]
Length=760

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC+++P ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYHMCMENPVATVAEVISKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL + VQ+Q   P WG++AQR+L+  
Sbjct  345  NAKETMRLAEKLYTQGFISYPRTETNIFPKE--LNLSVLVQQQTQDPNWGAFAQRILEQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GP---TPRSGTKSDQAHPPIHPTKYAANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANEQFMAQGLMILARNY  479



>gb|KFZ67856.1| DNA topoisomerase 3-alpha, partial [Podiceps cristatus]
Length=988

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   +L   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LSLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRSGTKSDQAHPPIHPTKYAANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>ref|XP_005229069.1| PREDICTED: DNA topoisomerase 3-alpha [Falco peregrinus]
 ref|XP_005435732.1| PREDICTED: DNA topoisomerase 3-alpha [Falco cherrug]
Length=1015

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYHMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQEQ+  P WG++AQR+LD  
Sbjct  345  NAKETMRIAEVLYTQGFISYPRTETNIFPKE--LNLSALVQEQIQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC S+ AKG ET
Sbjct  403  GPT---PRSGNKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSEDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>ref|XP_005504604.1| PREDICTED: DNA topoisomerase 3-alpha [Columba livia]
Length=1020

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  283  FNWKRNRLFNHTACLVLYQICMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  343  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  401  GP---TPRRGTKSDQAHPPIHPTKYAANLQGSEQ---RLYEFIVRHFLACCSQDAKGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIANERFIAQGLMILARNY  477



>gb|KFW84487.1| DNA topoisomerase 3-alpha, partial [Manacus vitellinus]
Length=951

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  223  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  282

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  283  NAKETMTIAEKLYTKGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  340

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  341  GPT---PRSGTKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  394

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  395  TVEIDIANERFIAQGLMILARNY  417



>gb|EMC88455.1| DNA topoisomerase 3-alpha [Columba livia]
Length=1016

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  283  FNWKRNRLFNHTACLVLYQICMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  343  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  401  GP---TPRRGTKSDQAHPPIHPTKYAANLQGSEQ---RLYEFIVRHFLACCSQDAKGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIANERFIAQGLMILARNY  477



>ref|XP_005350344.1| PREDICTED: DNA topoisomerase 3-alpha [Microtus ochrogaster]
Length=898

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  ++IY++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  178  FNWKRYRLFNHTACLVIYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  237

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  238  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLAALVEQQTQDPHWGAFAQNILERG  295

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++S+G  G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  296  GPT---PRNGNKSDQAHPPIHPTKYSSGLQG---DERRLYEFIVRHFLACCSQDAQGQET  349

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  350  TVEIDIAQERFVAHGLVILARNY  372



>ref|XP_008926440.1| PREDICTED: DNA topoisomerase 3-alpha [Manacus vitellinus]
Length=991

 Score =   206 bits (524),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  263  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVVSKPKSKWRPLPLDTVELEKLASRKLKI  322

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  323  NAKETMTIAEKLYTKGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  380

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  381  GPT---PRSGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  434

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  435  TVEIDIANERFIAQGLMILARNY  457



>gb|KFO77141.1| DNA topoisomerase 3-alpha, partial [Cuculus canorus]
Length=1000

 Score =   206 bits (524),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+H   +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHIACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRNGNKSDQAHPPIHPTKYAANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>ref|XP_009560480.1| PREDICTED: DNA topoisomerase 3-alpha [Cuculus canorus]
Length=1020

 Score =   206 bits (524),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+H   +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHIACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRNGNKSDQAHPPIHPTKYAANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>ref|XP_006973659.1| PREDICTED: DNA topoisomerase 3-alpha [Peromyscus maniculatus 
bairdii]
Length=998

 Score =   206 bits (523),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++CV+DPTATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRYRLFNHTACLVLYQLCVEDPTATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG +AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLVALVEQQTLDPHWGGFAQNILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++G  G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGCKSDQAHPPIHPTKYTSGLQG---DERRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  455  TVEIDIAQERFVAHGLVILARNY  477



>gb|KFV90869.1| DNA topoisomerase 3-alpha, partial [Eurypyga helias]
Length=952

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +++Y+MCV+DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FSWKRNRLFNHTACLVLYQMCVEDPVATVVEVGSKPKTKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG ISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGLISYPRTETNIFPKE--LNLSALVQQQTPDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRSGNKSDQAHPPIHPTKYAANLQGNDQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>gb|KFV08617.1| DNA topoisomerase 3-alpha, partial [Pterocles gutturalis]
Length=994

 Score =   206 bits (523),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P  L+T+ELEK ASR  ++
Sbjct  265  FSWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLALDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   D  ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRNGTKSDQAHPPIHPTKYTANLQG---DEQRLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>ref|XP_005808881.1| PREDICTED: DNA topoisomerase 3-alpha-like [Xiphophorus maculatus]
Length=1020

 Score =   206 bits (523),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 142/205 (69%), Gaps = 11/205 (5%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF HT  +++Y++C++DP ATVT V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  298  FSWKRNRLFHHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLRI  357

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMT--VQEQVGHPVWGSYAQRLLD  358
            ++ +TMK+AE LY +G ISYPRTET+ F     ANLP+   V++Q   P WG++AQR+LD
Sbjct  358  NAKETMKIAEKLYTRGLISYPRTETNIFP----ANLPLAPLVEQQAQSPEWGTFAQRVLD  413

Query  357  HESGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGA  178
               G   +P  G N D+AHPPIHPT+++    G   +  +VYE +VRHFLACVSQ A G 
Sbjct  414  QPGG--PNPRQGKNSDQAHPPIHPTKYTNTLQG---NEARVYEFIVRHFLACVSQDALGH  468

Query  177  ETIVEIDIAGESFSACGRVIIAVSF  103
            ET+VEI+IA E FS  G +IIA ++
Sbjct  469  ETVVEIEIAQEKFSTSGLMIIARNY  493



>ref|XP_010159682.1| PREDICTED: DNA topoisomerase 3-alpha, partial [Eurypyga helias]
Length=964

 Score =   205 bits (522),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +++Y+MCV+DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FSWKRNRLFNHTACLVLYQMCVEDPVATVVEVGSKPKTKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG ISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGLISYPRTETNIFPKE--LNLSALVQQQTPDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRSGNKSDQAHPPIHPTKYAANLQGNDQ---RLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>gb|KFU94117.1| DNA topoisomerase 3-alpha, partial [Chaetura pelagica]
Length=987

 Score =   205 bits (521),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD E
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPSWGAFAQRILD-E  381

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT+ +    G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  382  GG--PTPRSGNKSDQAHPPIHPTKHTTSLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>ref|XP_010073739.1| PREDICTED: DNA topoisomerase 3-alpha [Pterocles gutturalis]
Length=1019

 Score =   205 bits (522),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P  L+T+ELEK ASR  ++
Sbjct  285  FSWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLALDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   D  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRNGTKSDQAHPPIHPTKYTANLQG---DEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>gb|KFV61393.1| DNA topoisomerase 3-alpha, partial [Picoides pubescens]
Length=997

 Score =   205 bits (521),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVASKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHP +++A   G   +  ++YE +VRHFLAC S+ AKG ET
Sbjct  383  GP---TPRSGAKSDQAHPPIHPIKYTANLQG---NEQRLYEFIVRHFLACCSEDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VE+DIA E F A G +I+A ++
Sbjct  437  TVEVDIANERFIAQGLMILARNY  459



>ref|XP_008120113.1| PREDICTED: DNA topoisomerase 3-alpha isoform X4 [Anolis carolinensis]
Length=940

 Score =   204 bits (520),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +I+Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  230  FSWKRNRLFNHTACLILYQMCMEDPLATVVEVGSRPKSKWRPLPLDTVELEKLASRKLKI  289

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TMK+AE LY QG+ISYPRTET+ F  D   NLP  VQ Q   P WG++AQR+LD  
Sbjct  290  NAKETMKIAEKLYTQGYISYPRTETNIFPKD--LNLPNLVQLQTLDPRWGAFAQRILDQG  347

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+ +    G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  348  GPT---PRSGTKSDQAHPPIHPTKHATNLQGNDQ---RLYEFIVRHFLACCSQDAKGQET  401

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEID+A E F A G +I+A ++
Sbjct  402  TVEIDVANERFVAHGLMILARNY  424



>ref|XP_009894971.1| PREDICTED: DNA topoisomerase 3-alpha [Picoides pubescens]
Length=1013

 Score =   205 bits (521),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVASKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHP +++A   G   +  ++YE +VRHFLAC S+ AKG ET
Sbjct  403  GP---TPRSGAKSDQAHPPIHPIKYTANLQG---NEQRLYEFIVRHFLACCSEDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VE+DIA E F A G +I+A ++
Sbjct  457  TVEVDIANERFIAQGLMILARNY  479



>ref|XP_003228350.2| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Anolis carolinensis]
Length=966

 Score =   204 bits (520),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +I+Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  256  FSWKRNRLFNHTACLILYQMCMEDPLATVVEVGSRPKSKWRPLPLDTVELEKLASRKLKI  315

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TMK+AE LY QG+ISYPRTET+ F  D   NLP  VQ Q   P WG++AQR+LD  
Sbjct  316  NAKETMKIAEKLYTQGYISYPRTETNIFPKD--LNLPNLVQLQTLDPRWGAFAQRILDQG  373

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+ +    G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  374  GPT---PRSGTKSDQAHPPIHPTKHATNLQGNDQ---RLYEFIVRHFLACCSQDAKGQET  427

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEID+A E F A G +I+A ++
Sbjct  428  TVEIDVANERFVAHGLMILARNY  450



>ref|XP_010001864.1| PREDICTED: DNA topoisomerase 3-alpha [Chaetura pelagica]
Length=1017

 Score =   205 bits (521),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD E
Sbjct  345  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPSWGAFAQRILD-E  401

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT+ +    G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  402  GG--PTPRSGNKSDQAHPPIHPTKHTTSLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>dbj|BAE37792.1| unnamed protein product [Mus musculus]
Length=694

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRYRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLVALVEQQTVDPHWGAFAQTILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++G  G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGSKSDQAHPPIHPTKYTSGLQG---DDRRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIAQERFVAHGLIILARNY  477



>ref|XP_008120112.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Anolis carolinensis]
Length=977

 Score =   204 bits (520),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +I+Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  267  FSWKRNRLFNHTACLILYQMCMEDPLATVVEVGSRPKSKWRPLPLDTVELEKLASRKLKI  326

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TMK+AE LY QG+ISYPRTET+ F  D   NLP  VQ Q   P WG++AQR+LD  
Sbjct  327  NAKETMKIAEKLYTQGYISYPRTETNIFPKD--LNLPNLVQLQTLDPRWGAFAQRILDQG  384

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+ +    G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  385  GPT---PRSGTKSDQAHPPIHPTKHATNLQGNDQ---RLYEFIVRHFLACCSQDAKGQET  438

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEID+A E F A G +I+A ++
Sbjct  439  TVEIDVANERFVAHGLMILARNY  461



>emb|CAF95297.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=984

 Score =   204 bits (520),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 7/203 (3%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +++Y++C+++P ATVT V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  201  FSWKRNRLFNHTACLVLYQICMENPIATVTSVTSKPKSKWRPLPLDTVELEKLASRKLKI  260

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            S+ +TMK+AE LY QGFISYPRTET+ F       L   V+EQ    VWG++AQR+LD  
Sbjct  261  SAKETMKIAEKLYTQGFISYPRTETNIFP--KTLALGSLVEEQTQSSVWGTFAQRVLDQP  318

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPTR S+   G   +  ++YE +VRHFLACVSQ A G ET
Sbjct  319  GG--PSPRQGKKSDQAHPPIHPTRHSSSLQG---NEGRLYEFIVRHFLACVSQDALGQET  373

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            +V++DIA E FSA G +IIA ++
Sbjct  374  VVDVDIAQEKFSASGLMIIARNY  396



>ref|XP_008120111.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Anolis carolinensis]
Length=997

 Score =   204 bits (520),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +I+Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  287  FSWKRNRLFNHTACLILYQMCMEDPLATVVEVGSRPKSKWRPLPLDTVELEKLASRKLKI  346

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TMK+AE LY QG+ISYPRTET+ F  D   NLP  VQ Q   P WG++AQR+LD  
Sbjct  347  NAKETMKIAEKLYTQGYISYPRTETNIFPKD--LNLPNLVQLQTLDPRWGAFAQRILDQG  404

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+ +    G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  405  GP---TPRSGTKSDQAHPPIHPTKHATNLQGNDQ---RLYEFIVRHFLACCSQDAKGQET  458

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEID+A E F A G +I+A ++
Sbjct  459  TVEIDVANERFVAHGLMILARNY  481



>ref|XP_008301573.1| PREDICTED: DNA topoisomerase 3-alpha [Stegastes partitus]
Length=1030

 Score =   204 bits (520),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 142/203 (70%), Gaps = 7/203 (3%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF HT  +++Y++C++DP ATVT V  + K K+ P PL+T+E+EK ASR  ++
Sbjct  297  FNWKRNRLFSHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDTVEMEKLASRKLKI  356

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ + M++AE LY QGFISYPRTET+ F  + +A  P+ V++Q   P WG++AQR+LD  
Sbjct  357  NAKEAMRIAEKLYTQGFISYPRTETNIFPAN-LALAPL-VEQQAQSPDWGTFAQRVLDQP  414

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G   +P  G N D+AHPPIHPT+++    G   +  ++YE +VRHFLACVSQ A G ET
Sbjct  415  GG--PNPRQGKNSDQAHPPIHPTKYTGTLQG---NEGRLYEFIVRHFLACVSQDALGQET  469

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            +V+IDIA E FS  G +IIA ++
Sbjct  470  VVDIDIAQEKFSTSGLMIIARNY  492



>ref|XP_007060121.1| PREDICTED: DNA topoisomerase 3-alpha [Chelonia mydas]
Length=1019

 Score =   204 bits (520),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DP ATV ++  + K K+ P  L+T+ELEK ASR  ++
Sbjct  285  FNWKRSRLFNHTACLVLYHMCMEDPVATVVEIGSKPKSKWRPLALDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TMK+AE LY QG+ISYPRTET+ F  D   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMKIAEKLYTQGYISYPRTETNIFPKD--LNLTSLVQQQTQDPSWGAFAQRILDRG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GP---TPRNGTKSDQAHPPIHPTKYTCNLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFVAHGLMILARNY  479



>gb|KFW93790.1| DNA topoisomerase 3-alpha, partial [Phalacrocorax carbo]
Length=994

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P  L+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLALDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  325  NAKETMRLAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GP---TPRNGTKSDQAHPPIHPTKYAANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIAYERFVAQGLMILARNY  459



>ref|XP_008684206.1| PREDICTED: LOW QUALITY PROTEIN: DNA topoisomerase 3-alpha [Ursus 
maritimus]
Length=682

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  250  FNWKRHRLFNHTACLVLYQLCMEDPRATVVEVRSKAKSKWRPQALDTVELEKLASRKLRI  309

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL M V++Q   P WG++AQ +L+  
Sbjct  310  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLTMLVEQQTQDPRWGAFAQSILERG  367

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  368  GP---TPRNGNKSDQAHPPIHPTKYTGSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  421

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDI  E F A G +I+A ++
Sbjct  422  TVEIDIVQERFVAHGLMILARNY  444



>ref|XP_009508111.1| PREDICTED: DNA topoisomerase 3-alpha [Phalacrocorax carbo]
Length=1018

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P  L+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLALDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ+Q   P WG++AQR+LD  
Sbjct  345  NAKETMRLAEKLYTQGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GP---TPRNGTKSDQAHPPIHPTKYAANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIAYERFVAQGLMILARNY  479



>ref|XP_005054687.1| PREDICTED: DNA topoisomerase 3-alpha [Ficedula albicollis]
Length=1032

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  283  FNWKRNRLFNHTACLVLYQMCMEDPVATVVDVVSKPKSKWRPLPLDTVELEKLASRKLKI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   V+EQ   P WG +AQR+LD  
Sbjct  343  NAKETMTIAEKLYTKGFISYPRTETNIFPKE--LNLSALVEEQTQDPNWGQFAQRILDQG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  401  GPT---PRSGTKSDQAHPPIHPTKYTSNLQG---NEQRLYEFIVRHFLACCSQDAKGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIANEQFIAQGLMILARNY  477



>gb|KFP87266.1| DNA topoisomerase 3-alpha, partial [Acanthisitta chloris]
Length=991

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   VQ+Q   P WG +AQR+LD  
Sbjct  325  NAKETMIIAEKLYTKGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGDFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRHGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANERFIAQGLMILARNY  459



>ref|XP_009966981.1| PREDICTED: DNA topoisomerase 3-alpha, partial [Tyto alba]
Length=966

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  229  FSWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  288

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QGFISYPRTET+ F  +   NL   VQ Q   P WG++AQR+LD  
Sbjct  289  NAKETMRIAEKLYTQGFISYPRTETNIFPKE--LNLSALVQHQTQDPNWGAFAQRILDQG  346

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHP +++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  347  GP---TPRSGTKSDQAHPPIHPIKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  400

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  401  TVEIDIANERFIAQGLMILARNY  423



>ref|XP_004713017.1| PREDICTED: DNA topoisomerase 3-alpha [Echinops telfairi]
Length=1007

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DPTATV  VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPTATVVDVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++QV  P WG++AQ +LD  
Sbjct  343  NAKETMRLAERLYTQGYISYPRTETNIFPKD--LNLMVLVEQQVPDPRWGAFAQSILDRG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTSSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +++A ++
Sbjct  455  TVEIDIAQERFVAHGLMVLARNY  477



>ref|XP_009079665.1| PREDICTED: DNA topoisomerase 3-alpha [Acanthisitta chloris]
Length=1011

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   VQ+Q   P WG +AQR+LD  
Sbjct  345  NAKETMIIAEKLYTKGFISYPRTETNIFPKE--LNLSALVQQQTQDPNWGDFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRHGTKSDQAHPPIHPTKYTANLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFIAQGLMILARNY  479



>ref|XP_005494942.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Zonotrichia 
albicollis]
Length=888

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  154  FNWKRNRLFNHTACLVLYQMCMEDPVATVVDVVSKPKSKWRPLPLDTVELEKLASRKLKI  213

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   V++Q   P WG +AQR+LD E
Sbjct  214  NAKETMTIAEKLYTKGFISYPRTETNIFPKE--LNLSALVEQQTQDPNWGGFAQRILD-E  270

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT++++   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  271  GG--PTPRSGTKSDQAHPPIHPTKYASNLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  325

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  326  TVEIDIANEQFIAQGLMILARNY  348



>pdb|4CGY|A Chain A, Crystal Structure Of The Human Topoisomerase Iii Alpha-rmi1 
Complex
Length=754

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++CV+DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  284  FNWKRHRLFNHTACLVLYQLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  343

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  344  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  401

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  402  GP---TPRNGNKSDQAHPPIHPTKYTNNLQG---DEQRLYEFIVRHFLACCSQDAQGQET  455

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  456  TVEIDIAQERFVAHGLMILARNY  478



>ref|XP_008162976.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Chrysemys picta 
bellii]
Length=930

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DPTATV ++  + K K+ P  L+T+ELEK ASR  ++
Sbjct  197  FNWKRNRLFNHTACLVLYHMCMEDPTATVVEIGSKPKSKWRPLALDTVELEKLASRKLKI  256

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TMK+AE LY QG+ISYPRTET+ F  D   NL   VQ+Q   P WG++AQ +LD  
Sbjct  257  NAKETMKIAEKLYTQGYISYPRTETNIFPKD--LNLSSLVQQQTEDPNWGAFAQGILDRG  314

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  315  GP---TPRNGTKSDQAHPPIHPTKYACNLQG---NEQRLYEFIVRHFLACCSQDAKGQET  368

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  369  TVEIDIANERFVAHGLMILARNY  391



>pdb|4CHT|A Chain A, Crystal Structure Of The Human Topoisomerase Iii Alpha-rmi1 
Complex With Bound Calcium Ion
Length=755

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++CV+DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  285  FNWKRHRLFNHTACLVLYQLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  345  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  403  GP---TPRNGNKSDQAHPPIHPTKYTNNLQG---DEQRLYEFIVRHFLACCSQDAQGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIAQERFVAHGLMILARNY  479



>ref|XP_009090020.1| PREDICTED: DNA topoisomerase 3-alpha [Serinus canaria]
Length=1010

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  283  FNWKRNRLFNHTACLVLYQMCMEDPVATVVDVVSKPKSKWRPLPLDTVELEKLASRKLKI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   V++Q   P WG +AQR+LD E
Sbjct  343  NAKETMTIAEKLYTKGFISYPRTETNIFPKE--LNLSALVEQQTQDPNWGGFAQRILD-E  399

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT++++   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  400  GG--PTPRSGTKSDQAHPPIHPTKYASNLQG---NEQRLYEFIVRHFLACCSQDAKGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIANEQFIAQGLMILARNY  477



>ref|XP_005997515.1| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Latimeria chalumnae]
Length=991

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  277  FNWKRNRLFNHTACLVLYQICMEDPVATVIDVTSKPKSKWRPLPLDTVELEKLASRKLKI  336

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
             + +TMK+AE LY QG+ISYPRTET+ F  D   NL   VQ+Q G   WG++AQ +LD  
Sbjct  337  GAKETMKIAEKLYTQGYISYPRTETNMFPPD--LNLSSLVQQQTGDQRWGAFAQGILDRG  394

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   +  ++YE +VRHFLAC SQ A+G ET
Sbjct  395  GP---TPRSGNKSDQAHPPIHPTKYTNALQG---NEQRLYEFIVRHFLACCSQDAQGQET  448

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIA E F A G +IIA ++
Sbjct  449  IVEIDIAKERFVAHGLMIIARNY  471



>ref|XP_010366068.1| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Rhinopithecus 
roxellana]
Length=883

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNSFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTNSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  455  TVEIDIAQERFVAHGLVILARNY  477



>ref|XP_005426049.1| PREDICTED: DNA topoisomerase 3-alpha [Geospiza fortis]
Length=1011

 Score =   203 bits (516),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  283  FNWKRNRLFNHTACLVLYQMCMEDPVATVVDVVSKPKSKWRPLPLDTVELEKLASRKLKI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   V++Q   P WG +AQR+LD E
Sbjct  343  NAKETMTIAEKLYTKGFISYPRTETNIFPKE--LNLSALVEQQTQDPNWGGFAQRILD-E  399

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT++++   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  400  GG--PTPRSGTKSDQAHPPIHPTKYASNLQG---NEQRLYEFIVRHFLACCSQDAKGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIANEQFIAQGLMILARNY  477



>ref|XP_002189800.1| PREDICTED: DNA topoisomerase 3-alpha [Taeniopygia guttata]
Length=1009

 Score =   203 bits (516),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  283  FNWKRNRLFNHTACLVLYQMCMEDPVATVVDVVSKPKSKWRPLPLDTVELEKLASRKLKI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   V++Q   P WG +AQR+LD  
Sbjct  343  NAKETMTIAEKLYTKGFISYPRTETNIFPKE--LNLSALVEQQTQDPNWGGFAQRILDQG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  401  GPT---PRSGTKSDQAHPPIHPTKYTSNLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIANEQFIAQGLMILARNY  477



>ref|XP_005997514.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Latimeria chalumnae]
Length=999

 Score =   203 bits (516),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  277  FNWKRNRLFNHTACLVLYQICMEDPVATVIDVTSKPKSKWRPLPLDTVELEKLASRKLKI  336

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
             + +TMK+AE LY QG+ISYPRTET+ F  D   NL   VQ+Q G   WG++AQ +LD  
Sbjct  337  GAKETMKIAEKLYTQGYISYPRTETNMFPPD--LNLSSLVQQQTGDQRWGAFAQGILDRG  394

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   +  ++YE +VRHFLAC SQ A+G ET
Sbjct  395  GP---TPRSGNKSDQAHPPIHPTKYTNALQG---NEQRLYEFIVRHFLACCSQDAQGQET  448

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIA E F A G +IIA ++
Sbjct  449  IVEIDIAKERFVAHGLMIIARNY  471



>ref|XP_005997513.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Latimeria chalumnae]
Length=1006

 Score =   203 bits (516),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  277  FNWKRNRLFNHTACLVLYQICMEDPVATVIDVTSKPKSKWRPLPLDTVELEKLASRKLKI  336

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
             + +TMK+AE LY QG+ISYPRTET+ F  D   NL   VQ+Q G   WG++AQ +LD  
Sbjct  337  GAKETMKIAEKLYTQGYISYPRTETNMFPPD--LNLSSLVQQQTGDQRWGAFAQGILDRG  394

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   +  ++YE +VRHFLAC SQ A+G ET
Sbjct  395  GP---TPRSGNKSDQAHPPIHPTKYTNALQG---NEQRLYEFIVRHFLACCSQDAQGQET  448

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IVEIDIA E F A G +IIA ++
Sbjct  449  IVEIDIAKERFVAHGLMIIARNY  471



>ref|XP_008162975.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Chrysemys picta 
bellii]
Length=1018

 Score =   203 bits (516),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y MC++DPTATV ++  + K K+ P  L+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYHMCMEDPTATVVEIGSKPKSKWRPLALDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TMK+AE LY QG+ISYPRTET+ F  D   NL   VQ+Q   P WG++AQ +LD  
Sbjct  345  NAKETMKIAEKLYTQGYISYPRTETNIFPKD--LNLSSLVQQQTEDPNWGAFAQGILDRG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRNGTKSDQAHPPIHPTKYACNLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFVAHGLMILARNY  479



>ref|XP_005494941.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Zonotrichia 
albicollis]
Length=1017

 Score =   203 bits (516),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  283  FNWKRNRLFNHTACLVLYQMCMEDPVATVVDVVSKPKSKWRPLPLDTVELEKLASRKLKI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   V++Q   P WG +AQR+LD E
Sbjct  343  NAKETMTIAEKLYTKGFISYPRTETNIFPKE--LNLSALVEQQTQDPNWGGFAQRILD-E  399

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G    P  G   D+AHPPIHPT++++   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  400  GG--PTPRSGTKSDQAHPPIHPTKYASNLQG---NEQRLYEFIVRHFLACCSQDAKGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIANEQFIAQGLMILARNY  477



>dbj|BAC26718.1| unnamed protein product [Mus musculus]
Length=839

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  168  FNWKRYRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  227

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  228  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLVALVEQQTVDPHWGAFAQTILERG  285

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++G  G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  286  GPT---PRNGSKSDQAHPPIHPTKYTSGLQG---DDRRLYEFIVRHFLACCSQDAQGQET  339

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  340  TVEIDIAQERFVAHGLIILARNY  362



>gb|KFO58976.1| DNA topoisomerase 3-alpha, partial [Corvus brachyrhynchos]
Length=992

 Score =   202 bits (514),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  265  FNWKRNRLFNHTACLVLYQMCMEDPVATVVDVVSKPKSKWRPLPLDTVELEKLASRKLKI  324

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   V++Q   P WG +AQR+LD  
Sbjct  325  NAKETMTLAEKLYTKGFISYPRTETNIFPKE--LNLSALVEQQTQDPNWGEFAQRILDQG  382

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  383  GPT---PRSGTKSDQAHPPIHPTKYTSNLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  436

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  437  TVEIDIANEQFIAQGLMILARNY  459



>gb|ERE67718.1| DNA topoisomerase 3-alpha [Cricetulus griseus]
Length=895

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DPTATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  263  FNWKRYRLFNHTACLVLYQLCMEDPTATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  322

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  323  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLVALVEQQTLDPHWGAFAQNILERG  380

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  381  GP---TPRNGNKSDQAHPPIHPTKYTSNLQG---DERRLYEFIVRHFLACCSQDAQGQET  434

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  435  TVEIDIAQERFIAHGLVILARNY  457



>ref|XP_007617066.1| PREDICTED: DNA topoisomerase 3-alpha isoform X4 [Cricetulus griseus]
Length=927

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DPTATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  206  FNWKRYRLFNHTACLVLYQLCMEDPTATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  265

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  266  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLVALVEQQTLDPHWGAFAQNILERG  323

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  324  GP---TPRNGNKSDQAHPPIHPTKYTSNLQG---DERRLYEFIVRHFLACCSQDAQGQET  377

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  378  TVEIDIAQERFIAHGLVILARNY  400



>ref|XP_005145100.1| PREDICTED: DNA topoisomerase 3-alpha [Melopsittacus undulatus]
Length=1020

 Score =   202 bits (514),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV +V  + K ++ P PL+T+ELEK ASR  R+
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEVGSKPKSRWRPLPLDTVELEKLASRKLRI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM+++E LY QGFISYPRTET+ F  +   +L   V++Q   P WG++AQR+LD  
Sbjct  345  NAKETMRISEKLYTQGFISYPRTETNIFPKE--LDLSALVRQQTQDPNWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++A   G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GPT---PRSGNKSDQAHPPIHPTKYTANLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIAHERFVAQGLMILARNY  479



>ref|XP_007617065.1| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Cricetulus griseus]
Length=979

 Score =   202 bits (513),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DPTATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  258  FNWKRYRLFNHTACLVLYQLCMEDPTATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  317

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  318  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLVALVEQQTLDPHWGAFAQNILERG  375

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  376  GP---TPRNGNKSDQAHPPIHPTKYTSNLQG---DERRLYEFIVRHFLACCSQDAQGQET  429

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  430  TVEIDIAQERFIAHGLVILARNY  452



>ref|XP_008631835.1| PREDICTED: DNA topoisomerase 3-alpha, partial [Corvus brachyrhynchos]
Length=997

 Score =   202 bits (513),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  266  FNWKRNRLFNHTACLVLYQMCMEDPVATVVDVVSKPKSKWRPLPLDTVELEKLASRKLKI  325

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   V++Q   P WG +AQR+LD  
Sbjct  326  NAKETMTLAEKLYTKGFISYPRTETNIFPKE--LNLSALVEQQTQDPNWGEFAQRILDQG  383

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  384  GPT---PRSGTKSDQAHPPIHPTKYTSNLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  437

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  438  TVEIDIANEQFIAQGLMILARNY  460



>dbj|BAE20515.1| unnamed protein product [Mus musculus]
Length=954

 Score =   201 bits (512),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRYRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLVALVEQQTVDPHWGAFAQTILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++G  G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGSKSDQAHPPIHPTKYTSGLQG---DDRRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIAQERFVAHGLIILARNY  477



>ref|XP_010390949.1| PREDICTED: DNA topoisomerase 3-alpha, partial [Corvus cornix 
cornix]
Length=999

 Score =   202 bits (513),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  268  FNWKRNRLFNHTACLVLYQMCMEDPVATVVDVVSKPKSKWRPLPLDTVELEKLASRKLKI  327

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM +AE LY +GFISYPRTET+ F  +   NL   V++Q   P WG +AQR+LD  
Sbjct  328  NAKETMTLAEKLYTKGFISYPRTETNIFPKE--LNLSALVEQQTQDPNWGEFAQRILDQG  385

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  386  GPT---PRSGTKSDQAHPPIHPTKYTSNLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  439

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  440  TVEIDIANEQFIAQGLMILARNY  462



>ref|XP_005620201.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Canis lupus 
familiaris]
Length=969

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DPTATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  263  FNWKRHRLFNHTACLVLYQLCMEDPTATVVEVRSKSKSKWRPQALDTVELEKLASRKLRI  322

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   +L + V++Q   P WG++AQ +L+  
Sbjct  323  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LDLTVLVEQQTPDPRWGAFAQSILERG  380

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  381  GP---TPRNGNKSDQAHPPIHPTKYTSSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  434

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  435  TVEIDIAQERFVAHGLMILARNY  457



>ref|XP_007617064.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Cricetulus griseus]
Length=1003

 Score =   202 bits (513),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DPTATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  282  FNWKRYRLFNHTACLVLYQLCMEDPTATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  341

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  342  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLVALVEQQTLDPHWGAFAQNILERG  399

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  400  GP---TPRNGNKSDQAHPPIHPTKYTSNLQG---DERRLYEFIVRHFLACCSQDAQGQET  453

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  454  TVEIDIAQERFIAHGLVILARNY  476



>ref|XP_007617063.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Cricetulus griseus]
Length=1004

 Score =   202 bits (513),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DPTATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRYRLFNHTACLVLYQLCMEDPTATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLVALVEQQTLDPHWGAFAQNILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTSNLQG---DERRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  455  TVEIDIAQERFIAHGLVILARNY  477



>ref|XP_546656.2| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Canis lupus 
familiaris]
Length=989

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DPTATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPTATVVEVRSKSKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   +L + V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LDLTVLVEQQTPDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTSSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIAQERFVAHGLMILARNY  477



>ref|XP_010366052.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Rhinopithecus 
roxellana]
 ref|XP_010366061.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Rhinopithecus 
roxellana]
Length=918

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  200  FNWKRHRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  259

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  260  NAKETMRIAEKLYTQGYISYPRTETNSFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  317

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  318  GPT---PRNGNKSDQAHPPIHPTKYTNSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  371

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  372  TVEIDIAQERFVAHGLVILARNY  394



>ref|XP_002923167.1| PREDICTED: LOW QUALITY PROTEIN: DNA topoisomerase 3-alpha-like 
[Ailuropoda melanoleuca]
Length=959

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPRATVVEVRSKAKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLTVLVEQQTQDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTGSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIAQERFVAHGLMILARNY  477



>gb|EHH57787.1| DNA topoisomerase 3-alpha, partial [Macaca fascicularis]
Length=839

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  121  FNWKRHRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  180

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  181  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  238

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  239  GPT---PRNGNKSDQAHPPIHPTKYTNSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  292

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  293  TVEIDIAQERFVAHGLVILARNY  315



>ref|XP_004896709.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Heterocephalus 
glaber]
 gb|EHB10639.1| DNA topoisomerase 3-alpha [Heterocephalus glaber]
Length=991

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLMALVEQQTQDPDWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YEL+VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTSNLQG---DEQRLYELIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIAQERFVARGLMILARNY  477



>ref|NP_033436.1| DNA topoisomerase 3-alpha [Mus musculus]
 sp|O70157.1|TOP3A_MOUSE RecName: Full=DNA topoisomerase 3-alpha; AltName: Full=DNA topoisomerase 
III alpha [Mus musculus]
 dbj|BAA25662.1| topoisomerase III [Mus musculus]
 gb|AAH99689.1| Topoisomerase (DNA) III alpha [Mus musculus]
Length=1003

 Score =   201 bits (512),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRYRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLVALVEQQTVDPHWGAFAQTILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++G  G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGSKSDQAHPPIHPTKYTSGLQG---DDRRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIAQERFVAHGLIILARNY  477



>dbj|BAE42369.1| unnamed protein product [Mus musculus]
 dbj|BAE41691.1| unnamed protein product [Mus musculus]
Length=773

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  258  FNWKRYRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  317

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  318  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLVALVEQQTVDPHWGAFAQTILERG  375

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  376  GP---TPRNGSKSDQAHPPIHPTKYTSSLQG---DDRRLYEFIVRHFLACCSQGAQGQET  429

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  430  TVEIDIAQERFVAHGLIILARNY  452



>ref|XP_004612924.1| PREDICTED: DNA topoisomerase 3-alpha [Sorex araneus]
Length=985

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV  VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  266  FNWKRHRLFNHTACLVLYQLCMEDPRATVVDVRSKPKSKWRPQALDTVELEKLASRKLRI  325

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TMK+AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  326  NAKETMKIAEKLYTQGYISYPRTETNIFPKD--LNLAVLVEQQTPDPRWGAFAQSILEQG  383

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  384  GP---TPRNGNKSDQAHPPIHPTKYASNLQG---DEQRLYEFIVRHFLACCSQDAQGQET  437

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  438  TVEIDIAQERFVAHGLMILARNY  460



>ref|XP_004433056.1| PREDICTED: DNA topoisomerase 3-alpha [Ceratotherium simum simum]
Length=1007

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPRATVVEVRSKAKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLTALVEQQTVDPRWGAFAQNILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE ++RHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTSNLQG---DEQRIYEFIIRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  455  TVEIDIAQERFMAHGLVILARNY  477



>ref|XP_008564436.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Galeopterus 
variegatus]
Length=820

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  96   FNWKRHRLFNHTACLVLYQLCMEDPMATVMEVRSKPKSKWRPQALDTVELEKLASRKLRI  155

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  156  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTRDPRWGAFAQSILEQG  213

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  214  GPT---PRNGNKTDQAHPPIHPTKYASNLQG---DEQRLYEFIVRHFLACCSQDAQGQET  267

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  268  TVEIDIAQERFVAHGLMILARNY  290



>ref|XP_005256833.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Homo sapiens]
 dbj|BAG59092.1| unnamed protein product [Homo sapiens]
Length=906

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++CV+DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  188  FNWKRHRLFNHTACLVLYQLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  247

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  248  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  305

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  306  GPT---PRNGNKSDQAHPPIHPTKYTNNLQG---DEQRLYEFIVRHFLACCSQDAQGQET  359

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  360  TVEIDIAQERFVAHGLMILARNY  382



>ref|XP_005583131.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Macaca fascicularis]
Length=953

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  235  FNWKRHRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  294

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  295  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  352

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  353  GP---TPRNGNKSDQAHPPIHPTKYTNSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  406

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  407  TVEIDIAQERFVAHGLVILARNY  429



>ref|XP_006637312.1| PREDICTED: DNA topoisomerase 3-alpha-like [Lepisosteus oculatus]
Length=835

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +++Y++C++DP ATV  V  + K K+ P PL+T+ELEK ASR  ++
Sbjct  289  FSWKRHRLFNHTACLVLYQICMEDPVATVIDVTSKPKSKWRPLPLDTVELEKLASRKLKI  348

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            S+ +TMK+AE LY QG+ISYPRTET+ F  D   NL   V++Q G   WG++AQ +L+  
Sbjct  349  SAKETMKIAEKLYTQGYISYPRTETNMFPRD--LNLTSLVEQQTGDNRWGAFAQGILERG  406

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G  +D+AHPPIHPT++++   G  Q   ++YE +VRHFLAC SQ A+G ET
Sbjct  407  GP---TPRNGTKNDQAHPPIHPTKYTSSLQGNEQ---RLYEFIVRHFLACCSQDAQGHET  460

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
            IV+IDI  E FSA G +IIA ++
Sbjct  461  IVDIDIGQEKFSAHGLMIIARNY  483



>ref|XP_004776596.1| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Mustela putorius 
furo]
 ref|XP_004822744.1| PREDICTED: DNA topoisomerase 3-alpha isoform X3 [Mustela putorius 
furo]
Length=948

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPRATVVEVRSKAKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q+  P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLTVLVEQQIPDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC S  A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTGSLQG---DEQRLYEFIVRHFLACCSHDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  455  TVEIDIAQERFVAHGLVILARNY  477



>ref|XP_010366045.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Rhinopithecus 
roxellana]
Length=1001

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNSFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTNSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  455  TVEIDIAQERFVAHGLVILARNY  477



>ref|XP_007080858.1| PREDICTED: DNA topoisomerase 3-alpha [Panthera tigris altaica]
Length=898

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +V+ + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPRATVVEVKSKAKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLTVLVEQQTPDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYASSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIAQERFVAHGLMILARNY  477



>ref|XP_009188109.1| PREDICTED: DNA topoisomerase 3-alpha [Papio anubis]
Length=993

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTNSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  455  TVEIDIAQERFVAHGLVILARNY  477



>ref|XP_004896708.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Heterocephalus 
glaber]
Length=1016

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLMALVEQQTQDPDWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YEL+VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTSNLQG---DEQRLYELIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIAQERFVARGLMILARNY  477



>ref|XP_006126683.1| PREDICTED: DNA topoisomerase 3-alpha [Pelodiscus sinensis]
Length=1023

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y+MC++DP ATV ++  + K K+ P  L+T+ELEK ASR  ++
Sbjct  285  FNWKRNRLFNHTACLVLYQMCMEDPVATVVEIGSKPKSKWRPVALDTVELEKLASRKLKI  344

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM+VAE LY QG+ISYPRTET+ F  D   NL   VQ+Q  +  WG++AQR+LD  
Sbjct  345  NAKETMRVAEKLYTQGYISYPRTETNIFPKD--LNLTSLVQQQTQNINWGAFAQRILDQG  402

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   +  ++YE +VRHFLAC SQ AKG ET
Sbjct  403  GP---TPRNGTKSDQAHPPIHPTKYTGDLQG---NEQRLYEFIVRHFLACCSQDAKGQET  456

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  457  TVEIDIANERFVAHGLMILARNY  479



>ref|XP_008008772.1| PREDICTED: DNA topoisomerase 3-alpha [Chlorocebus sabaeus]
Length=1000

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTNSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  455  TVEIDIAQERFVAHGLVILARNY  477



>gb|AAB03695.1| DNA topoisomerase III [Homo sapiens]
Length=976

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++CV+DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  258  FNWKRHRLFNHTACLVLYQLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  317

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  318  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  375

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  376  GPT---PRNGNKSDQAHPPIHPTKYTNNLQG---DEQRLYEFIVRHFLACCSQDAQGQET  429

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  430  TVEIDIAQERFVAHGLMILARNY  452



>ref|XP_005583130.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Macaca fascicularis]
Length=1001

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTNSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  455  TVEIDIAQERFVAHGLVILARNY  477



>ref|XP_004776595.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Mustela putorius 
furo]
 ref|XP_004822743.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Mustela putorius 
furo]
Length=994

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPRATVVEVRSKAKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q+  P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLTVLVEQQIPDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC S  A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTGSLQG---DEQRLYEFIVRHFLACCSHDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  455  TVEIDIAQERFVAHGLVILARNY  477



>ref|XP_004640343.1| PREDICTED: DNA topoisomerase 3-alpha [Octodon degus]
Length=1004

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  287  FNWKRHRLFNHTACLVLYQLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  346

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q   P WG++AQ +L+  
Sbjct  347  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLMALVEQQTQDPHWGAFAQSILERG  404

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  405  GP---TPRNGNKSDQAHPPIHPTKYTSNLQG---DERRLYEFIVRHFLACCSQDAQGQET  458

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  459  TVEIDIAQERFVAHGLIILARNY  481



>ref|XP_010745514.1| PREDICTED: DNA topoisomerase 3-alpha [Larimichthys crocea]
Length=1022

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 143/203 (70%), Gaps = 7/203 (3%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +++Y++C++DP AT+T V  + K K+ P PL+T+ELEK ASR  R+
Sbjct  288  FSWKRNRLFNHTACLVLYQICMEDPIATITSVTSKPKSKWRPLPLDTVELEKLASRKLRI  347

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TMK+AE LY QG+ISYPRTET+ F  + +A  P+ V++Q   P WG++AQR+L+  
Sbjct  348  NAKETMKIAEKLYTQGYISYPRTETNIFPPN-LALGPL-VEQQTQSPNWGAFAQRVLEQP  405

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G   +P  G   D+AHPPIHPT++S    G   +  ++YE +VRHFLACVSQ A G ET
Sbjct  406  GG--PNPRQGKKSDQAHPPIHPTKYSNSLQG---NEGRLYEFIVRHFLACVSQDALGQET  460

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             V+IDIA E+FS  G ++IA ++
Sbjct  461  TVDIDIARETFSTSGLMVIARNY  483



>ref|XP_006908498.1| PREDICTED: DNA topoisomerase 3-alpha isoform X2 [Pteropus alecto]
Length=840

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 141/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DPTATV +V  + K K+ P  L+T+ELEK ASR  ++
Sbjct  116  FNWKRHRLFNHTACLVLYQLCMEDPTATVVEVSSKAKSKWRPQALDTVELEKLASRKLKI  175

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL   V++Q+  P WG++AQ +L  E
Sbjct  176  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTALVEQQIPDPRWGAFAQSIL--E  231

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
             G+   P  G   D+AHPPIHPT++++   G  Q   ++YE +VRHFLAC SQ A+G ET
Sbjct  232  RGV-PTPRNGNKSDQAHPPIHPTKYTSSLQGEEQ---RLYEFIVRHFLACCSQDAQGQET  287

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  288  TVEIDIAQERFVAHGLVILARNY  310



>ref|XP_007939652.1| PREDICTED: DNA topoisomerase 3-alpha [Orycteropus afer afer]
Length=998

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 141/203 (69%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C+++P ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMENPLATVIEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q+  P WG++AQR+L+  
Sbjct  343  NAKETMRIAERLYTQGYISYPRTETNIFPRD--LNLVVLVEQQIRDPHWGAFAQRILEQG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTSSLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +++A ++
Sbjct  455  TVEIDIAQERFLAHGLMVLARNY  477



>ref|XP_004776594.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Mustela putorius 
furo]
 ref|XP_004822742.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Mustela putorius 
furo]
Length=996

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPRATVVEVRSKAKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q+  P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPKD--LNLTVLVEQQIPDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC S  A+G ET
Sbjct  401  GP---TPRNGNKSDQAHPPIHPTKYTGSLQG---DEQRLYEFIVRHFLACCSHDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G VI+A ++
Sbjct  455  TVEIDIAQERFVAHGLVILARNY  477



>ref|NP_004609.1| DNA topoisomerase 3-alpha [Homo sapiens]
 sp|Q13472.1|TOP3A_HUMAN RecName: Full=DNA topoisomerase 3-alpha; AltName: Full=DNA topoisomerase 
III alpha [Homo sapiens]
 gb|AAB03694.1| DNA topoisomerase III [Homo sapiens]
 gb|AAH51748.1| Topoisomerase (DNA) III alpha [Homo sapiens]
 gb|EAW55646.1| topoisomerase (DNA) III alpha, isoform CRA_a [Homo sapiens]
 gb|EAW55648.1| topoisomerase (DNA) III alpha, isoform CRA_a [Homo sapiens]
 gb|EAW55649.1| topoisomerase (DNA) III alpha, isoform CRA_a [Homo sapiens]
 dbj|BAF85615.1| unnamed protein product [Homo sapiens]
 gb|ADP90454.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90455.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90456.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90457.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90458.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90459.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90460.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90461.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90462.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90463.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90464.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90465.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90466.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90467.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90468.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90469.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90470.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90471.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90472.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90473.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90474.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90475.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90476.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90477.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90478.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90479.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90480.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90481.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90482.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90483.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90484.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90485.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90486.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90487.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90488.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90489.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90490.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90491.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90492.1| DNA topoisomerase 3-alpha [Homo sapiens]
 gb|ADP90493.1| DNA topoisomerase 3-alpha [Homo sapiens]
Length=1001

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++CV+DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTPDPRWGAFAQSILERG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GPT---PRNGNKSDQAHPPIHPTKYTNNLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIAQERFVAHGLMILARNY  477



>ref|XP_006272770.1| PREDICTED: DNA topoisomerase 3-alpha [Alligator mississippiensis]
Length=937

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            F+W R  LF+HT  +++Y+MC++DP ATV  +  + K K+ P PL+T+ELEK ASR  ++
Sbjct  200  FSWKRNRLFNHTACLVLYQMCMEDPVATVVMIGSKPKSKWRPLPLDTVELEKLASRKLKI  259

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM+VAE LY QG+ISYPRTET+ F  +   +L   VQ+Q   P WG++AQR+LD  
Sbjct  260  NAKETMRVAEKLYTQGYISYPRTETNMFPKE--LSLSALVQQQTQDPHWGAFAQRILDQG  317

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT+++    G  Q   ++YE +VRHFLAC SQ AKG ET
Sbjct  318  GPT---PRNGSKTDQAHPPIHPTKYTCNLQGNEQ---RLYEFIVRHFLACCSQDAKGQET  371

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  372  TVEIDIANERFIAQGLMILARNY  394



>ref|XP_008564435.1| PREDICTED: DNA topoisomerase 3-alpha isoform X1 [Galeopterus 
variegatus]
Length=1007

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = -2

Query  711  FNWMRGNLFDHTCAVIIYEMCVQDPTATVTKVRQQEKLKYPPHPLNTIELEKRASRYFRM  532
            FNW R  LF+HT  +++Y++C++DP ATV +VR + K K+ P  L+T+ELEK ASR  R+
Sbjct  283  FNWKRHRLFNHTACLVLYQLCMEDPMATVMEVRSKPKSKWRPQALDTVELEKLASRKLRI  342

Query  531  SSAQTMKVAEDLYQQGFISYPRTETDRFSVDGIANLPMTVQEQVGHPVWGSYAQRLLDHE  352
            ++ +TM++AE LY QG+ISYPRTET+ F  D   NL + V++Q   P WG++AQ +L+  
Sbjct  343  NAKETMRIAEKLYTQGYISYPRTETNIFPRD--LNLTVLVEQQTRDPRWGAFAQSILEQG  400

Query  351  SGLWRDPSGGVNDDKAHPPIHPTRFSAGEPGWSQDHHKVYELVVRHFLACVSQPAKGAET  172
                  P  G   D+AHPPIHPT++++   G   D  ++YE +VRHFLAC SQ A+G ET
Sbjct  401  GP---TPRNGNKTDQAHPPIHPTKYASNLQG---DEQRLYEFIVRHFLACCSQDAQGQET  454

Query  171  IVEIDIAGESFSACGRVIIAVSF  103
             VEIDIA E F A G +I+A ++
Sbjct  455  TVEIDIAQERFVAHGLMILARNY  477



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1181407783314