BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20100_g1_i1 len=780 path=[795:0-121 2688:122-122 @917@!:123-564
20:565-779]

Length=780
                                                                      Score     E

emb|CDP00422.1|  unnamed protein product                                266   7e-85   
ref|XP_007045893.1|  General regulatory factor 12, IOTA isoform 1       254   5e-84   
gb|EYU28855.1|  hypothetical protein MIMGU_mgv1a012202mg                263   5e-84   
gb|EYU28854.1|  hypothetical protein MIMGU_mgv1a012202mg                263   5e-84   
ref|XP_004228408.1|  PREDICTED: 14-3-3-like protein GF14 iota           263   9e-84   
ref|XP_006365133.1|  PREDICTED: 14-3-3-like protein GF14 iota-like      263   9e-84   
ref|XP_009624793.1|  PREDICTED: 14-3-3-like protein GF14 iota           261   7e-83   
ref|XP_009794399.1|  PREDICTED: 14-3-3-like protein GF14 iota           261   8e-83   
ref|XP_010258087.1|  PREDICTED: 14-3-3-like protein GF14 iota           261   8e-83   
ref|XP_010320874.1|  PREDICTED: 14-3-3-like protein GF14 iota           260   9e-83   
ref|XP_006348703.1|  PREDICTED: 14-3-3-like protein GF14 iota-lik...    260   2e-82   
gb|ABO15467.1|  14-3-3 protein Lil 1433-2                               258   3e-82   Lilium longiflorum [Easter lily]
ref|XP_010259579.1|  PREDICTED: 14-3-3-like protein GF14 iota           258   9e-82   
ref|XP_010680716.1|  PREDICTED: 14-3-3-like protein GF14 iota           258   1e-81   
ref|XP_011070948.1|  PREDICTED: 14-3-3-like protein GF14 iota           257   2e-81   
gb|ABO15468.1|  14-3-3 protein Lil 1433-3                               257   2e-81   Lilium longiflorum [Easter lily]
gb|KDP41292.1|  hypothetical protein JCGZ_15699                         256   4e-81   
gb|AIJ04693.1|  14-3-3d                                                 256   6e-81   
ref|XP_002512093.1|  14-3-3 protein, putative                           255   8e-81   Ricinus communis
ref|XP_010939378.1|  PREDICTED: 14-3-3-like protein GF14 iota           255   1e-80   
ref|XP_003607800.1|  14-3-3-like protein                                255   2e-80   
gb|AES89997.2|  general regulatory factor 2                             254   3e-80   
ref|XP_007157838.1|  hypothetical protein PHAVU_002G102500g             254   3e-80   
ref|XP_010066851.1|  PREDICTED: 14-3-3-like protein GF14 iota           254   3e-80   
ref|XP_007045894.1|  General regulatory factor 12, IOTA isoform 2       254   4e-80   
ref|XP_011018466.1|  PREDICTED: 14-3-3-like protein GF14 iota iso...    253   6e-80   
ref|XP_008221499.1|  PREDICTED: 14-3-3-like protein GF14 iota           253   6e-80   
ref|XP_002311335.1|  14-3-3-like protein GF14 iota                      253   6e-80   Populus trichocarpa [western balsam poplar]
gb|KHN20521.1|  14-3-3-like protein GF14 iota                           253   7e-80   
emb|CDY24128.1|  BnaC03g57490D                                          244   8e-80   
ref|XP_007227176.1|  hypothetical protein PRUPE_ppa020788mg             253   8e-80   
ref|XP_002269100.1|  PREDICTED: 14-3-3-like protein GF14 iota           253   9e-80   Vitis vinifera
ref|XP_006605542.1|  PREDICTED: 14-3-3-like protein GF14 iota-like      253   1e-79   
ref|XP_003528560.2|  PREDICTED: 14-3-3-like protein GF14 iota-like      252   1e-79   
gb|KHN42946.1|  14-3-3-like protein GF14 iota                           252   2e-79   
ref|XP_008807823.1|  PREDICTED: 14-3-3-like protein GF14 iota iso...    252   2e-79   
ref|XP_008807824.1|  PREDICTED: 14-3-3-like protein GF14 iota iso...    251   2e-79   
ref|XP_002316091.1|  14-3-3-like protein GF14 iota                      251   3e-79   Populus trichocarpa [western balsam poplar]
ref|XP_004505365.1|  PREDICTED: 14-3-3-like protein GF14 iota-like      251   5e-79   
ref|XP_009356399.1|  PREDICTED: 14-3-3-like protein GF14 iota           251   6e-79   
ref|XP_006837122.1|  hypothetical protein AMTR_s00110p00124430          250   7e-79   
ref|XP_008785970.1|  PREDICTED: 14-3-3-like protein GF14 iota iso...    250   1e-78   
ref|XP_008785973.1|  PREDICTED: 14-3-3-like protein GF14 iota iso...    250   1e-78   
ref|XP_008785971.1|  PREDICTED: 14-3-3-like protein GF14 iota iso...    249   1e-78   
ref|XP_006484187.1|  PREDICTED: 14-3-3-like protein GF14 iota-like      249   2e-78   
gb|KDO39380.1|  hypothetical protein CISIN_1g044502mg                   249   2e-78   
ref|XP_008350899.1|  PREDICTED: 14-3-3-like protein GF14 iota           249   2e-78   
gb|ABK23368.1|  unknown                                                 249   3e-78   Picea sitchensis
ref|XP_010923604.1|  PREDICTED: 14-3-3-like protein GF14 iota           249   3e-78   
gb|ACN40863.1|  unknown                                                 248   5e-78   Picea sitchensis
ref|XP_008446428.1|  PREDICTED: 14-3-3-like protein GF14 iota iso...    248   5e-78   
ref|XP_008360091.1|  PREDICTED: 14-3-3-like protein GF14 iota           249   6e-78   
ref|XP_004155296.1|  PREDICTED: 14-3-3-like protein GF14 iota-like      248   6e-78   
ref|XP_008446429.1|  PREDICTED: 14-3-3-like protein GF14 iota iso...    248   6e-78   
ref|XP_004298381.1|  PREDICTED: 14-3-3-like protein GF14 iota-like      248   7e-78   
gb|ABK24279.1|  unknown                                                 248   1e-77   Picea sitchensis
gb|KGN51972.1|  hypothetical protein Csa_5G606630                       248   1e-77   
ref|XP_011075592.1|  PREDICTED: 14-3-3-like protein GF14 iota           248   1e-77   
ref|XP_006437949.1|  hypothetical protein CICLE_v10033402mg             249   1e-77   
ref|XP_001761013.1|  predicted protein                                  246   2e-77   
ref|XP_008339820.1|  PREDICTED: 14-3-3-like protein GF14 iota           247   2e-77   
ref|XP_004490160.1|  PREDICTED: 14-3-3-like protein GF14 iota-like      246   3e-77   
gb|KHN03645.1|  14-3-3-like protein GF14 iota                           246   3e-77   
ref|NP_001238423.1|  14-3-3 protein SGF14e                              246   3e-77   
ref|XP_004144174.1|  PREDICTED: 14-3-3-like protein GF14 iota-like      246   3e-77   
ref|XP_003614051.1|  14-3-3-like protein GF14 iota                      246   3e-77   
gb|AFK49338.1|  unknown                                                 246   4e-77   
ref|XP_009110014.1|  PREDICTED: 14-3-3-like protein GF14 iota           246   4e-77   
ref|XP_007153530.1|  hypothetical protein PHAVU_003G043200g             246   4e-77   
gb|ACU19643.1|  unknown                                                 246   4e-77   Glycine max [soybeans]
ref|XP_008445452.1|  PREDICTED: 14-3-3-like protein GF14 iota           246   4e-77   
emb|CDY16161.1|  BnaA09g28950D                                          246   6e-77   
ref|XP_001782995.1|  predicted protein                                  243   7e-77   
gb|AFK34571.1|  unknown                                                 245   7e-77   
ref|XP_011012118.1|  PREDICTED: 14-3-3-like protein GF14 iota iso...    245   7e-77   
ref|XP_009115367.1|  PREDICTED: 14-3-3-like protein GF14 iota           246   7e-77   
gb|EYU22375.1|  hypothetical protein MIMGU_mgv1a012051mg                245   1e-76   
gb|ADY68781.1|  14-3-3-like protein                                     244   1e-76   
gb|AEN70723.1|  14-3-3-like protein                                     244   2e-76   
gb|ABD63905.1|  14-3-3-like protein                                     244   2e-76   Gossypium hirsutum [American cotton]
ref|NP_001238407.1|  14-3-3 protein SGF14f                              244   2e-76   
gb|ADY68778.1|  14-3-3-like protein                                     244   2e-76   
gb|ADY68779.1|  14-3-3-like protein                                     244   2e-76   
gb|AEN70731.1|  14-3-3-like protein                                     244   2e-76   
gb|AEN70728.1|  14-3-3-like protein                                     244   2e-76   
emb|CDY61631.1|  BnaA08g19740D                                          246   3e-76   
gb|KHG17568.1|  Uncharacterized protein F383_07573                      243   4e-76   
ref|XP_006433976.1|  hypothetical protein CICLE_v10002186mg             243   4e-76   
ref|XP_010551389.1|  PREDICTED: 14-3-3-like protein GF14 iota           243   5e-76   
ref|XP_006415927.1|  hypothetical protein EUTSA_v10008445mg             243   6e-76   
gb|AEN70741.1|  14-3-3-like protein                                     243   7e-76   
ref|XP_001782988.1|  predicted protein                                  243   7e-76   
ref|XP_006433977.1|  hypothetical protein CICLE_v10002186mg             242   8e-76   
gb|AEN70742.1|  14-3-3-like protein                                     242   8e-76   
emb|CDX85023.1|  BnaC05g20320D                                          243   8e-76   
ref|XP_001764363.1|  predicted protein                                  243   9e-76   
gb|AEN70739.1|  14-3-3-like protein                                     242   1e-75   
gb|KDO80975.1|  hypothetical protein CISIN_1g025437mg                   242   1e-75   
ref|XP_006303557.1|  hypothetical protein CARUB_v10011021mg             242   1e-75   
gb|AEN70726.1|  14-3-3-like protein                                     241   2e-75   
gb|ABK21097.1|  unknown                                                 242   2e-75   Picea sitchensis
ref|XP_001776144.1|  predicted protein                                  241   2e-75   
ref|XP_010543950.1|  PREDICTED: 14-3-3 protein 7 isoform X1             238   2e-75   
ref|XP_006433978.1|  hypothetical protein CICLE_v10002186mg             242   2e-75   
ref|XP_002962509.1|  hypothetical protein SELMODRAFT_77993              241   2e-75   
ref|XP_002890655.1|  hypothetical protein ARALYDRAFT_313341             242   2e-75   
gb|KDP41387.1|  hypothetical protein JCGZ_15794                         239   2e-75   
ref|NP_564249.1|  14-3-3-like protein GF14 iota                         241   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002962780.1|  hypothetical protein SELMODRAFT_230088             241   3e-75   
gb|KFK44572.1|  hypothetical protein AALP_AA1G275000                    241   5e-75   
ref|XP_010538942.1|  PREDICTED: 14-3-3 protein 7                        238   5e-75   
ref|XP_010499034.1|  PREDICTED: 14-3-3-like protein GF14 iota iso...    241   6e-75   
ref|XP_010477849.1|  PREDICTED: 14-3-3-like protein GF14 iota           241   6e-75   
gb|ABK24180.1|  unknown                                                 240   6e-75   Picea sitchensis
gb|ACU22928.1|  unknown                                                 240   6e-75   Glycine max [soybeans]
ref|XP_010460303.1|  PREDICTED: 14-3-3-like protein GF14 iota iso...    241   7e-75   
gb|AAF98570.1|AC013427_13  Strong similarity to GF14 mu from Arab...    241   8e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010924614.1|  PREDICTED: 14-3-3-like protein D                   240   1e-74   
gb|ABY65000.1|  14-3-3a protein                                         239   2e-74   Gossypium hirsutum [American cotton]
ref|XP_010925645.1|  PREDICTED: 14-3-3 protein 9 isoform X1             239   2e-74   
ref|XP_010925646.1|  PREDICTED: 14-3-3-like protein D isoform X2        239   2e-74   
ref|XP_007018760.1|  General regulatory factor 11, OMICRON,RHS5         239   3e-74   
ref|XP_010919994.1|  PREDICTED: 14-3-3-like protein D isoform X1        239   3e-74   
emb|CBI27277.3|  unnamed protein product                                238   3e-74   
ref|XP_009408618.1|  PREDICTED: 14-3-3-like protein GF14 iota           230   3e-74   
ref|XP_010920003.1|  PREDICTED: 14-3-3-like protein D isoform X2        239   3e-74   
ref|XP_006446784.1|  hypothetical protein CICLE_v10016299mg             236   4e-74   
ref|XP_006446785.1|  hypothetical protein CICLE_v10016299mg             237   6e-74   
gb|KDO63353.1|  hypothetical protein CISIN_1g024539mg                   237   7e-74   
ref|XP_006446782.1|  hypothetical protein CICLE_v10016299mg             238   8e-74   
ref|XP_006446783.1|  hypothetical protein CICLE_v10016299mg             238   8e-74   
ref|XP_006469020.1|  PREDICTED: 14-3-3-like protein D-like isofor...    237   1e-73   
ref|XP_010277038.1|  PREDICTED: 14-3-3-like protein D                   237   1e-73   
ref|XP_011004796.1|  PREDICTED: 14-3-3 protein 7-like                   237   1e-73   
ref|XP_002306573.1|  14-3-3-like protein GF14 omicron                   237   1e-73   Populus trichocarpa [western balsam poplar]
ref|NP_001234637.1|  14-3-3 protein 7                                   237   1e-73   
ref|XP_006370164.1|  hypothetical protein POPTR_0001s40270g             238   1e-73   
ref|XP_002513928.1|  14-3-3 protein, putative                           236   2e-73   Ricinus communis
ref|XP_006383497.1|  hypothetical protein POPTR_0005s17120g             236   2e-73   
ref|XP_006370162.1|  hypothetical protein POPTR_0001s40270g             236   2e-73   
emb|CDY69181.1|  BnaAnng29600D                                          236   2e-73   
ref|XP_002893851.1|  hypothetical protein ARALYDRAFT_473646             233   2e-73   
ref|XP_006370161.1|  14-3-3 brain family protein                        236   2e-73   
ref|XP_009145353.1|  PREDICTED: 14-3-3-like protein GF14 epsilon        236   2e-73   
ref|XP_008777420.1|  PREDICTED: 14-3-3-like protein D                   236   3e-73   
ref|XP_009785724.1|  PREDICTED: 14-3-3 protein 7                        233   3e-73   
ref|XP_006370163.1|  hypothetical protein POPTR_0001s40270g             236   3e-73   
ref|XP_010459979.1|  PREDICTED: 14-3-3-like protein GF14 epsilon ...    236   4e-73   
ref|XP_004136830.1|  PREDICTED: 14-3-3-like protein D-like              236   4e-73   
ref|XP_008455307.1|  PREDICTED: 14-3-3-like protein D                   236   4e-73   
ref|XP_010459978.1|  PREDICTED: 14-3-3-like protein GF14 epsilon ...    235   4e-73   
emb|CDY38227.1|  BnaC05g17440D                                          235   5e-73   
ref|XP_002523376.1|  14-3-3 protein, putative                           235   5e-73   Ricinus communis
ref|XP_011016523.1|  PREDICTED: 14-3-3 protein 7                        235   6e-73   
ref|XP_008813767.1|  PREDICTED: 14-3-3-like protein D isoform X1        235   6e-73   
ref|XP_002302299.1|  14-3-3-like protein GF14 omicron                   235   6e-73   Populus trichocarpa [western balsam poplar]
ref|XP_008813768.1|  PREDICTED: 14-3-3-like protein D isoform X2        235   6e-73   
ref|XP_009588303.1|  PREDICTED: 14-3-3 protein 7                        231   7e-73   
ref|XP_010532565.1|  PREDICTED: 14-3-3-like protein GF14 iota           235   7e-73   
emb|CAA65150.1|  14-3-3 protein                                         234   1e-72   Solanum lycopersicum
ref|XP_002285787.1|  PREDICTED: 14-3-3 protein 7                        234   1e-72   Vitis vinifera
ref|XP_006416211.1|  hypothetical protein EUTSA_v10008554mg             234   1e-72   
gb|AAD27824.2|  14-3-3 protein                                          234   1e-72   Populus tremula x Populus alba [gray poplar]
gb|ADO95305.1|  14-3-3-like protein GF14 Epsilon                        234   1e-72   
ref|XP_006397422.1|  hypothetical protein EUTSA_v10001836mg             234   2e-72   
gb|ADO95307.1|  14-3-3-like protein GF14 Omicron                        234   2e-72   
ref|XP_010060009.1|  PREDICTED: 14-3-3 protein 7                        234   2e-72   
ref|XP_006304125.1|  hypothetical protein CARUB_v10010075mg             234   2e-72   
ref|XP_006593482.1|  PREDICTED: SGF14D isoform X1                       234   2e-72   
ref|XP_010279115.1|  PREDICTED: 14-3-3-like protein D isoform X1        234   3e-72   
ref|XP_011029567.1|  PREDICTED: 14-3-3-like protein D isoform X2        234   3e-72   
ref|NP_001237065.1|  14-3-3-like protein D                              234   3e-72   
ref|XP_010279116.1|  PREDICTED: 14-3-3-like protein D isoform X2        234   3e-72   
ref|XP_011029566.1|  PREDICTED: 14-3-3-like protein D isoform X1        233   3e-72   
gb|KCW66530.1|  hypothetical protein EUGRSUZ_F00330                     233   3e-72   
ref|XP_007048686.1|  General regulatory factor 9, MU isoform 3          234   3e-72   
ref|XP_007048685.1|  General regulatory factor 9, MU isoform 2          233   3e-72   
ref|XP_006853182.1|  hypothetical protein AMTR_s00038p00201030          228   3e-72   
ref|XP_006591886.1|  PREDICTED: uncharacterized protein LOC100801...    233   4e-72   
ref|XP_010915526.1|  PREDICTED: 14-3-3-like protein D isoform X1        233   5e-72   
ref|XP_010915527.1|  PREDICTED: 14-3-3-like protein D isoform X2        233   5e-72   
ref|XP_010267591.1|  PREDICTED: 14-3-3 protein 7-like isoform X4        228   5e-72   
ref|XP_002316863.1|  14-3-3 brain family protein                        233   5e-72   Populus trichocarpa [western balsam poplar]
ref|XP_008793009.1|  PREDICTED: 14-3-3-like protein D isoform X1        233   5e-72   
ref|XP_010267573.1|  PREDICTED: 14-3-3 protein 7-like isoform X1        228   6e-72   
ref|XP_009795721.1|  PREDICTED: 14-3-3 protein 9                        229   6e-72   
ref|XP_009409399.1|  PREDICTED: 14-3-3-like protein D                   232   7e-72   
ref|XP_008793010.1|  PREDICTED: 14-3-3-like protein D isoform X2        233   7e-72   
ref|XP_010267584.1|  PREDICTED: 14-3-3 protein 7-like isoform X3        228   7e-72   
ref|XP_010498698.1|  PREDICTED: 14-3-3-like protein GF14 epsilon ...    232   7e-72   
ref|XP_002893217.1|  hypothetical protein ARALYDRAFT_313117             232   7e-72   
ref|XP_010655514.1|  PREDICTED: 14-3-3-like protein D isoform X1        232   8e-72   
ref|XP_002273375.2|  PREDICTED: 14-3-3-like protein D isoform X2        232   8e-72   Vitis vinifera
ref|XP_010057095.1|  PREDICTED: 14-3-3-like protein D                   232   8e-72   
emb|CDP01064.1|  unnamed protein product                                232   1e-71   
ref|XP_010689898.1|  PREDICTED: 14-3-3-like protein D                   232   1e-71   
ref|XP_004487160.1|  PREDICTED: 14-3-3-like protein B-like isofor...    232   1e-71   
gb|KCW74108.1|  hypothetical protein EUGRSUZ_E02747                     233   1e-71   
ref|XP_009613251.1|  PREDICTED: 14-3-3 protein 9                        228   2e-71   
ref|NP_001242151.1|  uncharacterized protein LOC100801348               231   2e-71   
ref|XP_009389896.1|  PREDICTED: 14-3-3-like protein D                   231   2e-71   
gb|AAD46005.1|AC007894_3  Similar to gb|X95905 14-3-3 protein (TF...    228   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KHN27939.1|  14-3-3-like protein D                                   232   3e-71   
gb|KFK44327.1|  hypothetical protein AALP_AA1G243900                    231   3e-71   
ref|NP_564451.2|  14-3-3-like protein GF14 omicron                      228   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011100204.1|  PREDICTED: 14-3-3 protein 9                        231   3e-71   
ref|NP_001077649.1|  14-3-3-like protein GF14 omicron                   228   3e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CBI30682.3|  unnamed protein product                                231   4e-71   
ref|XP_007149742.1|  hypothetical protein PHAVU_005G095500g             230   5e-71   
gb|AGV54290.1|  14-3-3 protein-like protein                             230   5e-71   
ref|XP_006449497.1|  hypothetical protein CICLE_v10016334mg             228   5e-71   
gb|KEH39277.1|  general regulatory factor 2                             230   6e-71   
ref|XP_010103033.1|  14-3-3-like protein B                              234   6e-71   
ref|XP_011074187.1|  PREDICTED: 14-3-3 protein 7 isoform X1             230   7e-71   
ref|NP_849698.1|  14-3-3-like protein GF14 epsilon                      230   7e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007048684.1|  General regulatory factor 9, MU isoform 1          233   7e-71   
ref|NP_564167.1|  14-3-3-like protein GF14 epsilon                      229   8e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32536.1|  hypothetical protein JCGZ_14739                         223   8e-71   
emb|CDP15929.1|  unnamed protein product                                230   9e-71   
dbj|BAD12555.1|  T(S)14-3-3 protein                                     224   9e-71   Nicotiana tabacum [American tobacco]
gb|AAM62569.1|  14-3-3-like protein GF14 iota (General regulatory...    229   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973884.1|  14-3-3-like protein GF14 epsilon                      229   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416511.1|  PREDICTED: 14-3-3 protein 9-like isoform X1        229   1e-70   
ref|XP_007211873.1|  hypothetical protein PRUPE_ppa010158mg             229   1e-70   
ref|XP_009416512.1|  PREDICTED: 14-3-3 protein 9-like isoform X2        229   1e-70   
ref|XP_008228912.1|  PREDICTED: 14-3-3-like protein D                   229   2e-70   
gb|AAF27931.1|AF222805_1  14-3-3-like protein                           229   2e-70   Euphorbia esula [wolf's milk]
ref|XP_006449498.1|  hypothetical protein CICLE_v10016334mg             229   2e-70   
ref|XP_006467653.1|  PREDICTED: 14-3-3-like protein D-like              229   2e-70   
dbj|BAF02188.1|  hypothetical protein                                   225   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AFK39898.1|  unknown                                                 229   2e-70   
ref|XP_003531255.1|  PREDICTED: 14-3-3-like protein C-like isofor...    228   2e-70   
gb|AAC15418.1|  14-3-3 protein homolog                                  228   2e-70   Maackia amurensis
ref|XP_009103246.1|  PREDICTED: 14-3-3-like protein GF14 epsilon        228   3e-70   
emb|CDY46640.1|  BnaA07g10560D                                          228   3e-70   
ref|XP_002285427.1|  PREDICTED: 14-3-3-like protein D                   228   4e-70   Vitis vinifera
ref|XP_003629763.1|  14-3-3-like protein gf14-6                         228   4e-70   
gb|ACU19187.1|  unknown                                                 228   4e-70   Glycine max [soybeans]
gb|AFK41067.1|  unknown                                                 228   5e-70   
ref|XP_009349095.1|  PREDICTED: 14-3-3-like protein D                   228   5e-70   
ref|XP_010686202.1|  PREDICTED: 14-3-3-like protein D                   221   5e-70   
ref|XP_004162232.1|  PREDICTED: 14-3-3 protein 7-like                   224   6e-70   
ref|XP_008371470.1|  PREDICTED: 14-3-3-like protein D                   228   6e-70   
sp|P42654.1|1433B_VICFA  RecName: Full=14-3-3-like protein B; Alt...    228   6e-70   Vicia faba [broad bean]
gb|ACJ85000.1|  unknown                                                 228   6e-70   Medicago truncatula
emb|CDY00444.1|  BnaC07g13820D                                          227   8e-70   
ref|XP_006350030.1|  PREDICTED: 14-3-3 protein 8-like isoform X2        227   9e-70   
emb|CBI20197.3|  unnamed protein product                                228   9e-70   
gb|KFK23383.1|  hypothetical protein AALP_AAs59400U000500               223   1e-69   
ref|XP_006350029.1|  PREDICTED: 14-3-3 protein 8-like isoform X1        227   1e-69   
ref|XP_007159445.1|  hypothetical protein PHAVU_002G238300g             227   1e-69   
gb|ABN13161.1|  14-3-3 protein                                          227   1e-69   Solanum berthaultii
ref|XP_006348856.1|  PREDICTED: 14-3-3 protein 9-like isoform X1        226   1e-69   
gb|AGV54308.1|  14-3-3 protein                                          226   2e-69   
ref|XP_008225282.1|  PREDICTED: 14-3-3-like protein C                   226   2e-69   
ref|XP_006348857.1|  PREDICTED: 14-3-3 protein 9-like isoform X2        226   2e-69   
ref|XP_007211874.1|  hypothetical protein PRUPE_ppa010162mg             226   2e-69   
ref|XP_003596411.1|  14-3-3-like protein GF14                           223   2e-69   
ref|XP_008383928.1|  PREDICTED: 14-3-3 protein 7-like                   226   2e-69   
ref|XP_008444837.1|  PREDICTED: LOW QUALITY PROTEIN: 14-3-3 prote...    224   3e-69   
ref|NP_001234272.1|  14-3-3 protein 9                                   226   3e-69   
gb|ACU17765.1|  unknown                                                 224   3e-69   Glycine max [soybeans]
ref|NP_001234267.1|  14-3-3 protein 8                                   225   4e-69   
ref|XP_010553125.1|  PREDICTED: 14-3-3-like protein D isoform X1        220   4e-69   
ref|XP_009614106.1|  PREDICTED: 14-3-3 protein 8 isoform X1             225   4e-69   
ref|XP_009614107.1|  PREDICTED: 14-3-3 protein 8 isoform X2             224   4e-69   
gb|ACN73532.1|  1433-1                                                  225   6e-69   Brassica napus [oilseed rape]
ref|NP_001235679.1|  14-3-3-like protein C                              225   6e-69   
ref|XP_006579480.1|  PREDICTED: 14-3-3 protein SGF14c isoform X4        224   8e-69   
ref|XP_009415239.1|  PREDICTED: 14-3-3-like protein B                   224   9e-69   
gb|EYU41131.1|  hypothetical protein MIMGU_mgv1a012156mg                224   9e-69   
ref|XP_009352778.1|  PREDICTED: 14-3-3-like protein D isoform X2        224   9e-69   
gb|AHB33319.1|  14-3-3b protein                                         224   1e-68   
ref|XP_009352777.1|  PREDICTED: 14-3-3-like protein D isoform X1        224   1e-68   
ref|XP_004300649.1|  PREDICTED: 14-3-3 protein 7-like                   225   1e-68   
gb|EYU41130.1|  hypothetical protein MIMGU_mgv1a012156mg                224   1e-68   
ref|XP_009357177.1|  PREDICTED: 14-3-3-like protein D                   224   1e-68   
ref|XP_009626513.1|  PREDICTED: 14-3-3 protein 9-like isoform X2        223   1e-68   
ref|XP_004152638.1|  PREDICTED: LOW QUALITY PROTEIN: 14-3-3 prote...    224   1e-68   
ref|XP_009334350.1|  PREDICTED: 14-3-3 protein 7-like isoform X2        224   1e-68   
ref|XP_009626512.1|  PREDICTED: 14-3-3 protein 9-like isoform X1        223   2e-68   
gb|AFK40493.1|  unknown                                                 224   2e-68   
gb|EYU36497.1|  hypothetical protein MIMGU_mgv1a012317mg                223   2e-68   
gb|EYU36496.1|  hypothetical protein MIMGU_mgv1a012317mg                223   2e-68   
ref|XP_009354259.1|  PREDICTED: 14-3-3-like protein D isoform X2        224   2e-68   
ref|XP_009354261.1|  PREDICTED: 14-3-3-like protein B isoform X4        224   2e-68   
ref|XP_009354258.1|  PREDICTED: 14-3-3-like protein D isoform X1        224   2e-68   
ref|XP_009354260.1|  PREDICTED: 14-3-3-like protein B isoform X3        224   2e-68   
sp|Q41246.1|1433_TOBAC  RecName: Full=14-3-3-like protein               216   2e-68   
ref|XP_009334349.1|  PREDICTED: 14-3-3 protein 7-like isoform X1        224   2e-68   
ref|XP_009766076.1|  PREDICTED: 14-3-3 protein 9-like isoform X2        223   2e-68   
ref|XP_008362405.1|  PREDICTED: 14-3-3-like protein B isoform X2        223   2e-68   
ref|XP_009406238.1|  PREDICTED: 14-3-3-like protein C                   223   2e-68   
ref|XP_009766075.1|  PREDICTED: 14-3-3 protein 9-like isoform X1        223   3e-68   
ref|XP_008362404.1|  PREDICTED: 14-3-3-like protein B isoform X1        223   3e-68   
ref|XP_008362407.1|  PREDICTED: 14-3-3-like protein B isoform X4        223   3e-68   
ref|XP_008362406.1|  PREDICTED: 14-3-3-like protein B isoform X3        223   3e-68   
ref|XP_010109371.1|  14-3-3-like protein GF14 iota                      224   4e-68   
ref|XP_003596410.1|  14-3-3-like protein GF14                           223   5e-68   
ref|XP_003596409.1|  14-3-3-like protein GF14                           223   5e-68   
ref|XP_009387885.1|  PREDICTED: 14-3-3-like protein B                   220   5e-68   
ref|XP_008362976.1|  PREDICTED: 14-3-3-like protein D                   222   5e-68   
gb|AFK48194.1|  unknown                                                 219   5e-68   
sp|Q96452.1|1433C_SOYBN  RecName: Full=14-3-3-like protein C; Alt...    222   6e-68   
gb|ACJ84536.1|  unknown                                                 223   6e-68   
ref|XP_009792761.1|  PREDICTED: 14-3-3 protein 9-like isoform X2        221   7e-68   
ref|XP_009792760.1|  PREDICTED: 14-3-3 protein 9-like isoform X1        220   8e-68   
ref|XP_006411523.1|  hypothetical protein EUTSA_v10017098mg             213   1e-67   
ref|XP_007894696.1|  PREDICTED: 14-3-3 protein epsilon isoform X2       217   1e-67   
ref|XP_007894695.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       217   1e-67   
ref|XP_010524058.1|  PREDICTED: 14-3-3-like protein B isoform X2        221   1e-67   
ref|XP_010524059.1|  PREDICTED: 14-3-3-like protein B isoform X3        221   2e-67   
ref|XP_010524057.1|  PREDICTED: 14-3-3-like protein B isoform X1        221   2e-67   
gb|KHG26282.1|  hypothetical protein F383_02677                         222   3e-67   
ref|XP_007025387.1|  General regulatory factor 9, MU isoform 2          217   3e-67   
ref|XP_007025386.1|  General regulatory factor 9, MU isoform 1          217   3e-67   
ref|XP_010553205.1|  PREDICTED: 14-3-3-like protein D isoform X2        221   4e-67   
ref|XP_010553282.1|  PREDICTED: 14-3-3-like protein D isoform X3        220   4e-67   
ref|XP_004160280.1|  PREDICTED: 14-3-3 protein 7-like                   214   4e-67   
ref|XP_007025388.1|  General regulatory factor 12, IOTA isoform 3       217   5e-67   
ref|XP_007222185.1|  hypothetical protein PRUPE_ppa009645mg             221   5e-67   
gb|ABL84200.1|  14-3-3-like protein                                     219   5e-67   
ref|XP_008812074.1|  PREDICTED: 14-3-3-like protein D isoform X1        219   6e-67   
ref|XP_006348704.1|  PREDICTED: 14-3-3-like protein GF14 iota-lik...    220   6e-67   
emb|CDO77021.1|  hypothetical protein BN946_scf184380.g7                214   6e-67   
ref|XP_009372768.1|  PREDICTED: 14-3-3 protein 7 isoform X1             214   6e-67   
ref|XP_006294817.1|  hypothetical protein CARUB_v10023868mg             211   6e-67   
ref|XP_008812075.1|  PREDICTED: 14-3-3-like protein D isoform X2        219   7e-67   
ref|NP_001080705.1|  tyrosine 3-monooxygenase/tryptophan 5-monoox...    214   7e-67   
ref|XP_006641186.1|  PREDICTED: 14-3-3 protein epsilon-like             214   7e-67   
ref|XP_008466228.1|  PREDICTED: 14-3-3 protein 7-like isoform X1        212   7e-67   
ref|XP_008466229.1|  PREDICTED: 14-3-3 protein 7-like isoform X2        212   8e-67   
ref|XP_007862256.1|  DNA damage checkpoint protein rad24                213   8e-67   
gb|KDQ64461.1|  hypothetical protein JAAARDRAFT_28092                   212   8e-67   
gb|KDQ15383.1|  hypothetical protein BOTBODRAFT_31704                   214   9e-67   
ref|XP_010052638.1|  PREDICTED: 14-3-3-like protein D isoform X1        210   1e-66   
ref|XP_010892108.1|  PREDICTED: 14-3-3 protein epsilon isoform X3       215   1e-66   
ref|NP_001008156.1|  tyrosine 3-monooxygenase/tryptophan 5-monoox...    213   1e-66   
gb|EFX71844.1|  hypothetical protein DAPPUDRAFT_326737                  213   1e-66   
ref|XP_010892106.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       215   1e-66   
gb|EFA86448.1|  hypothetical protein PPL_00241                          219   1e-66   
gb|KCW89636.1|  hypothetical protein EUGRSUZ_A01913                     209   1e-66   
ref|XP_010892107.1|  PREDICTED: 14-3-3 protein epsilon isoform X2       215   1e-66   
ref|XP_007229714.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    215   1e-66   
ref|XP_010052648.1|  PREDICTED: 14-3-3-like protein D isoform X2        209   2e-66   
ref|XP_010517787.1|  PREDICTED: 14-3-3-like protein GF14 mu isofo...    210   2e-66   
emb|CCA66533.1|  probable BMH1-14-3-3 protein epsilon                   213   2e-66   
ref|XP_010506090.1|  PREDICTED: 14-3-3-like protein GF14 mu isofo...    210   2e-66   
ref|XP_007229712.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    215   2e-66   
gb|KFK37111.1|  hypothetical protein AALP_AA4G214200                    211   2e-66   
pdb|3UBW|A  Chain A, Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Ph...    213   2e-66   
gb|ADO27878.1|  14-3-3 protein epsilon                                  214   2e-66   
ref|XP_010506091.1|  PREDICTED: 14-3-3-like protein GF14 mu isofo...    210   2e-66   
ref|XP_004350709.1|  hypothetical protein DFA_11762                     220   2e-66   
gb|ACH70649.1|  tyrosine 3-monooxygenase/tryptophan 5-monooxygena...    214   2e-66   
gb|AIZ00512.1|  14-3-3g protein                                         218   2e-66   
ref|XP_010862491.1|  PREDICTED: 14-3-3 protein epsilon isoform X2       214   3e-66   
ref|XP_004136288.1|  PREDICTED: 14-3-3 protein 7-like                   211   3e-66   
gb|KEY67628.1|  hypothetical protein S7711_07825                        211   3e-66   
ref|XP_004489032.1|  PREDICTED: 14-3-3-like protein D-like              213   3e-66   
gb|AAS88432.1|  14-3-3 protein                                          214   3e-66   
gb|KFA61484.1|  hypothetical protein S40285_03417                       210   3e-66   
ref|XP_010862490.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       214   3e-66   
ref|XP_007149394.1|  hypothetical protein PHAVU_005G0666001g            218   3e-66   
emb|CAA64814.1|  14-3-3                                                 217   3e-66   
gb|KDP21092.1|  hypothetical protein JCGZ_21563                         218   3e-66   
ref|NP_001117944.1|  14-3-3E1 protein                                   214   4e-66   
ref|XP_002173783.1|  14-3-3 family protein Rad25                        218   4e-66   
ref|XP_008034805.1|  14-3-3                                             212   4e-66   
ref|XP_001134475.1|  hypothetical protein DDB_G0269138                  217   4e-66   
gb|AAL28067.1|AF426249_1  14-3-3 protein                                218   4e-66   
gb|ETS62470.1|  hypothetical protein PaG_03090                          213   4e-66   
ref|NP_997770.1|  14-3-3 protein epsilon                                216   4e-66   
ref|XP_004314501.1|  PREDICTED: 14-3-3 protein epsilon-like             211   4e-66   
emb|CDQ75182.1|  unnamed protein product                                213   4e-66   
ref|XP_005458551.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    211   4e-66   
gb|KGN60214.1|  hypothetical protein Csa_3G889710                       211   5e-66   
ref|XP_007392314.1|  hypothetical protein PHACADRAFT_250466             211   5e-66   
ref|NP_001238592.1|  14-3-3 protein SGF14n                              218   5e-66   
ref|XP_003453757.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    210   5e-66   
gb|KFM70452.1|  14-3-3 protein epsilon                                  211   5e-66   
pdb|2BR9|A  Chain A, 14-3-3 Protein Epsilon (human) Complexed To ...    211   5e-66   
ref|XP_010571908.1|  PREDICTED: 14-3-3 protein epsilon isoform X4       211   6e-66   
ref|XP_002196990.2|  PREDICTED: 14-3-3 protein epsilon isoform 1        211   6e-66   
gb|ADK93081.1|  14-3-3h protein                                         217   6e-66   
gb|EJU06666.1|  hypothetical protein DACRYDRAFT_19722                   213   6e-66   
ref|XP_007365004.1|  14-3-3-domain-containing protein                   211   6e-66   
ref|XP_567951.1|  14-3-3 protein                                        212   7e-66   
gb|AAP36544.1|  Homo sapiens tyrosine 3-monooxygenase/tryptophan ...    211   7e-66   
ref|XP_009249385.1|  PREDICTED: 14-3-3 protein epsilon                  211   7e-66   
pdb|3UAL|A  Chain A, Crystal Structure Of 14-3-3 Epsilon With Mlf...    211   8e-66   
gb|AEX07732.1|  YWHAE/FAM22A fusion protein                             211   8e-66   
ref|XP_002747869.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       211   8e-66   
ref|NP_006752.1|  14-3-3 protein epsilon                                211   8e-66   
ref|XP_004177047.1|  PREDICTED: 14-3-3 protein epsilon isoform 2        211   8e-66   
emb|CDQ58881.1|  unnamed protein product                                213   8e-66   
ref|XP_003280374.1|  PREDICTED: 14-3-3 protein epsilon                  211   8e-66   
ref|XP_009155816.1|  14-3-3 family protein                              214   8e-66   
gb|AEX07733.1|  YWHAE/FAM22B fusion protein                             211   8e-66   
ref|XP_001823993.1|  14-3-3 protein                                     215   9e-66   
ref|XP_003543215.1|  PREDICTED: 14-3-3-like protein D-like              217   1e-65   
ref|XP_004293939.1|  PREDICTED: 14-3-3-like protein D-like              216   1e-65   
gb|KDQ29680.1|  hypothetical protein PLEOSDRAFT_1093096                 211   1e-65   
gb|AEE62187.1|  unknown                                                 212   1e-65   
ref|XP_004058272.1|  PREDICTED: 14-3-3 protein epsilon isoform 1        210   1e-65   
emb|CEJ95020.1|  Putative DNA damage checkpoint protein rad24           210   1e-65   
gb|ERL94057.1|  hypothetical protein D910_11340                         212   1e-65   
ref|XP_003294400.1|  hypothetical protein DICPUDRAFT_51485              216   1e-65   
ref|XP_008269159.1|  PREDICTED: 14-3-3 protein epsilon isoform X2       210   1e-65   
ref|XP_007354963.1|  14-3-3 1 protein                                   210   1e-65   
ref|XP_007315837.1|  hypothetical protein SERLADRAFT_461711             213   1e-65   
gb|EMS20698.1|  protein of 14-3-4 protein family                        217   1e-65   
ref|XP_757513.1|  hypothetical protein UM01366.1                        211   1e-65   
gb|EST06061.1|  DNA damage checkpoint protein rad24                     211   1e-65   
ref|XP_002718936.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       210   1e-65   
gb|EMD40415.1|  hypothetical protein CERSUDRAFT_91137                   210   1e-65   
gb|EKD02257.1|  hypothetical protein A1Q2_03404                         211   1e-65   
ref|XP_007245995.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    214   1e-65   
dbj|GAK64924.1|  14-3-3 protein                                         211   2e-65   
emb|CDI52261.1|  probable BMH1-14-3-3 protein epsilon                   211   2e-65   
gb|ENN78875.1|  hypothetical protein YQE_04664                          211   2e-65   
gb|AAX82172.1|  14-3-3 1 protein                                        209   2e-65   
ref|XP_001837506.1|  hypothetical protein CC1G_01418                    211   2e-65   
ref|XP_010571907.1|  PREDICTED: 14-3-3 protein epsilon isoform X3       210   2e-65   
dbj|GAM21685.1|  hypothetical protein SAMD00019534_048600               215   2e-65   
ref|XP_002381065.1|  14-3-3 family protein ArtA, putative               214   2e-65   
ref|XP_010543953.1|  PREDICTED: 14-3-3 protein 7 isoform X2             205   2e-65   
ref|XP_010571904.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       210   2e-65   
gb|EHK15391.1|  hypothetical protein TRIVIDRAFT_217216                  207   2e-65   
gb|AAY18904.1|  tyrosine 3-monooxygenase/tryptophan 5-monooxygena...    209   2e-65   
gb|ESA21533.1|  hypothetical protein GLOINDRAFT_343118                  215   2e-65   
gb|KDR84063.1|  hypothetical protein GALMADRAFT_236701                  210   2e-65   
gb|KDN38648.1|  14-3-3 protein                                          211   2e-65   
ref|XP_003036618.1|  14-3-3 protein                                     210   2e-65   
ref|XP_007879742.1|  hypothetical protein PFL1_04027                    210   2e-65   
ref|XP_005313494.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       209   2e-65   
ref|XP_001876996.1|  14-3-3 protein                                     210   2e-65   
ref|XP_007725242.1|  14-3-3 family protein                              212   2e-65   
dbj|GAA85416.1|  DNA damage checkpoint protein Rad24                    214   3e-65   
gb|KHN36880.1|  14-3-3-like protein D                                   217   3e-65   
ref|XP_007245994.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    213   3e-65   
ref|XP_008276579.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       211   3e-65   
emb|CCF54339.1|  probable BMH1-14-3-3 protein epsilon                   210   3e-65   
gb|ACU19305.1|  unknown                                                 216   3e-65   
ref|XP_001391851.1|  14-3-3 protein                                     214   3e-65   
gb|EHK40845.1|  hypothetical protein TRIATDRAFT_301609                  207   3e-65   
ref|XP_002411773.1|  multifunctional chaperone, putative                209   3e-65   
ref|XP_007302409.1|  14-3-3 protein                                     210   3e-65   
dbj|BAC36106.1|  unnamed protein product                                209   3e-65   
ref|XP_007382290.1|  14-3-3 1 protein                                   209   3e-65   
emb|CCL98276.1|  predicted protein                                      209   3e-65   
gb|KFG81876.1|  TH14-3-3                                                207   3e-65   
ref|XP_009268374.1|  14-3-3 protein-like protein                        212   3e-65   
ref|XP_010729410.1|  PREDICTED: 14-3-3 protein epsilon isoform X2       210   3e-65   
gb|ABD49711.1|  TH14-3-3                                                207   3e-65   
ref|XP_010729409.1|  PREDICTED: 14-3-3 protein epsilon isoform X1       210   3e-65   
ref|XP_008276580.1|  PREDICTED: 14-3-3 protein epsilon isoform X2       211   3e-65   
ref|XP_002918088.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    211   3e-65   
ref|XP_006901375.1|  PREDICTED: 14-3-3 protein epsilon-like             208   3e-65   
ref|XP_007853881.1|  14-3-3 protein                                     209   3e-65   
ref|XP_004684862.1|  PREDICTED: 14-3-3 protein epsilon                  208   3e-65   
ref|NP_001117945.1|  14-3-3E2 protein                                   214   3e-65   
gb|EKG18152.1|  14-3-3 protein                                          215   3e-65   
dbj|BAA89421.1|  14-3-3                                                 208   4e-65   
gb|EJT53079.1|  hypothetical protein A1Q1_00086                         209   4e-65   
emb|CCE27930.1|  probable 14-3-3-like protein                           204   4e-65   
gb|KEP48927.1|  DNA damage checkpoint protein rad24                     209   4e-65   
ref|XP_010099385.1|  14-3-3-like protein D                              225   4e-65   
gb|ENH87503.1|  DNA damage checkpoint protein rad24                     207   4e-65   
ref|XP_001218186.1|  DNA damage checkpoint protein rad24                215   4e-65   
ref|XP_007734132.1|  14-3-3 family protein                              212   4e-65   
ref|XP_006963731.1|  predicted protein                                  207   4e-65   
ref|XP_008219443.1|  PREDICTED: 14-3-3 protein 7                        215   4e-65   
ref|XP_006167597.1|  PREDICTED: 14-3-3 protein epsilon-like             208   5e-65   
emb|CAC20377.1|  14-3-3-like protein                                    206   5e-65   
ref|XP_003005304.1|  DNA damage checkpoint protein rad24                207   5e-65   
ref|XP_003051723.1|  predicted protein                                  207   5e-65   
gb|KHN96284.1|  th14-3-3-like protein                                   206   5e-65   
emb|CAF88979.1|  unnamed protein product                                209   5e-65   
gb|EPS98788.1|  hypothetical protein FOMPIDRAFT_1031284                 209   5e-65   
gb|EGU89051.1|  hypothetical protein FOXB_00463                         206   5e-65   
gb|KDN34974.1|  14-3-3 protein                                          209   5e-65   
emb|CBQ70776.1|  probable BMH1-14-3-3 protein epsilon                   209   5e-65   
gb|EXL95296.1|  tyrosine 3-monooxygenase/tryptophan 5-monooxygena...    206   5e-65   
ref|XP_007773520.1|  14-3-3 protein                                     210   5e-65   
ref|XP_009372776.1|  PREDICTED: 14-3-3 protein 7 isoform X2             214   5e-65   
gb|EMT63821.1|  14-3-3 protein like protein                             206   5e-65   
gb|ENH64510.1|  14-3-3 protein like protein                             206   6e-65   
ref|XP_007748463.1|  14-3-3 family protein                              211   6e-65   
ref|XP_006959179.1|  14-3-3 protein                                     211   7e-65   
gb|KID80139.1|  14-3-3 protein                                          206   7e-65   
emb|CCO32840.1|  14-3-3 protein homolog AltName: Full=Th1433            209   7e-65   
ref|XP_007563009.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    209   7e-65   
ref|XP_001272853.1|  14-3-3 family protein ArtA, putative               214   8e-65   
ref|XP_007097494.1|  PREDICTED: 14-3-3 protein epsilon-like             208   8e-65   
ref|NP_001013359.1|  tyrosine 3-monooxygenase/tryptophan 5-monoox...    207   8e-65   
ref|XP_007577122.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    209   8e-65   
ref|XP_006456745.1|  14-3-3 protein                                     208   8e-65   
emb|CDR45889.1|  CYFA0S20e01332g1_1                                     207   8e-65   
ref|XP_007563008.1|  PREDICTED: 14-3-3 protein epsilon-like isofo...    209   8e-65   



>emb|CDP00422.1| unnamed protein product [Coffea canephora]
Length=253

 Score =   266 bits (679),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE HVYLAKL+EQAERY+EMVE MKQ+AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETHVYLAKLAEQAERYEEMVESMKQVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVKLI+ YRQKVEDELSKIC+DIL II+KHL+PSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNEHNVKLIKGYRQKVEDELSKICSDILTIIDKHLIPSSGSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDYFRYLAEFK DQ++K   
Sbjct  121  TVFYYKMKGDYFRYLAEFKTDQDRKEAA  148


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 44/57 (77%), Gaps = 6/57 (11%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAF------AAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEA+F      A ANTELPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQDRKEAAEQSLKGYEASFTLIAASATANTELPSTHPIRLGLALNFSVFYY  191



>ref|XP_007045893.1| General regulatory factor 12, IOTA isoform 1 [Theobroma cacao]
 gb|EOY01725.1| General regulatory factor 12, IOTA isoform 1 [Theobroma cacao]
Length=307

 Score =   254 bits (650),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +EK+RE HVY+AKL+EQAERY+EMVE MKQ+AKL  ELTVEERNLLSVGYKNVIGARRAS
Sbjct  4    TEKERETHVYMAKLAEQAERYEEMVETMKQVAKLGCELTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE NVKLI+ YRQKVE+ELSKIC DIL II+KHL+PSS SGEATV
Sbjct  64   WRIMSSIEQKEESKGNEENVKLIKGYRQKVEEELSKICTDILGIIDKHLIPSSNSGEATV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKK  124
            F+YKMKGDY+RY+AEFK DQE+K
Sbjct  124  FYYKMKGDYYRYVAEFKTDQERK  146


 Score = 84.7 bits (208),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -2

Query  146  LRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +  + +KEAAEQSLKGYEAA AAANT+LPSTHPIRLGLALNFSVF+Y
Sbjct  139  FKTDQERKEAAEQSLKGYEAASAAANTDLPSTHPIRLGLALNFSVFHY  186



>gb|EYU28855.1| hypothetical protein MIMGU_mgv1a012202mg [Erythranthe guttata]
Length=257

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE+HVYLAKL+EQAERYDEMVE MKQ+AKLDVEL+V+ERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESHVYLAKLAEQAERYDEMVESMKQVAKLDVELSVDERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNEN+VKLI+ YRQKVEDELSKIC DIL +I+KHL+PSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNENHVKLIKGYRQKVEDELSKICQDILSVIDKHLIPSSGSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK DQEKK
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQEKK  145


 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + KKE AE+SLK YEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQEKKEIAEESLKSYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>gb|EYU28854.1| hypothetical protein MIMGU_mgv1a012202mg [Erythranthe guttata]
Length=258

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE+HVYLAKL+EQAERYDEMVE MKQ+AKLDVEL+V+ERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESHVYLAKLAEQAERYDEMVESMKQVAKLDVELSVDERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNEN+VKLI+ YRQKVEDELSKIC DIL +I+KHL+PSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNENHVKLIKGYRQKVEDELSKICQDILSVIDKHLIPSSGSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK DQEKK
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQEKK  145


 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + KKE AE+SLK YEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQEKKEIAEESLKSYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_004228408.1| PREDICTED: 14-3-3-like protein GF14 iota [Solanum lycopersicum]
Length=274

 Score =   263 bits (673),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M  EK+RE HVY AKL+EQAERYDEMVE MK++AKLD ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSKEKERETHVYTAKLAEQAERYDEMVESMKKVAKLDAELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNENNVKLI+ YRQKVE+ELSKIC+DILEII+KHL+PSS +GEA
Sbjct  61   ASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICHDILEIIDKHLIPSSGTGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDYFRYLAEFK DQEKK   
Sbjct  121  TVFYYKMKGDYFRYLAEFKTDQEKKEAS  148


 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + KKEA+E SLKGYEAA A AN++LPSTHPIRLGLALN+SVFYY
Sbjct  135  LAEFKTDQEKKEASELSLKGYEAATATANSDLPSTHPIRLGLALNYSVFYY  185



>ref|XP_006365133.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Solanum tuberosum]
Length=274

 Score =   263 bits (673),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M  EK+RE HVY AKL+EQAERYDEMVE MK++AKLD ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSKEKERETHVYTAKLAEQAERYDEMVESMKKVAKLDAELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNENNVKLI+ YRQKVE+ELSKIC+DILEII+KHL+PSS +GEA
Sbjct  61   ASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICHDILEIIDKHLIPSSGTGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDYFRYLAEFK DQEKK   
Sbjct  121  TVFYYKMKGDYFRYLAEFKTDQEKKEAS  148


 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + KKEA+E SLKGYEAA A AN++LPSTHPIRLGLALN+SVFYY
Sbjct  135  LAEFKTDQEKKEASELSLKGYEAATATANSDLPSTHPIRLGLALNYSVFYY  185



>ref|XP_009624793.1| PREDICTED: 14-3-3-like protein GF14 iota [Nicotiana tomentosiformis]
Length=275

 Score =   261 bits (667),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+K+RE HVY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQKERETHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVKLI+ YRQKVE+ELSKIC+DILEII+KHL+PS+ +GEA
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKLIKGYRQKVEEELSKICSDILEIIDKHLIPSAGTGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK D E+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDSERKEAA  148


 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAEQSLKGYEAA A ANT+L STHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDSERKEAAEQSLKGYEAATATANTDLSSTHPIRLGLALNFSVFYY  185



>ref|XP_009794399.1| PREDICTED: 14-3-3-like protein GF14 iota [Nicotiana sylvestris]
Length=275

 Score =   261 bits (667),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+K+RE HVY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQKERETHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVKLI+ YRQKVE+ELSKIC+DILEII+KHL+PS+ +GEA
Sbjct  61   ASWRIMSSIEQKEESKGNEHNVKLIKGYRQKVEEELSKICSDILEIIDKHLIPSAGTGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK D E+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDSERKEAA  148


 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAEQSLKGYEAA A ANT+L STHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDSERKEAAEQSLKGYEAATATANTDLSSTHPIRLGLALNFSVFYY  185



>ref|XP_010258087.1| PREDICTED: 14-3-3-like protein GF14 iota [Nelumbo nucifera]
Length=259

 Score =   261 bits (666),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RENHVY+AKL+EQAERYDEMVE MK++AKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERENHVYMAKLAEQAERYDEMVESMKKVAKLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVKLI+AYRQKVEDEL+ ICNDIL II++HL+PSS SGE+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKLIKAYRQKVEDELANICNDILTIIDEHLIPSSASGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKDAA  148


 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +K+AAEQSLKGYEAA   ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKDAAEQSLKGYEAASNTANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_010320874.1| PREDICTED: 14-3-3-like protein GF14 iota [Solanum lycopersicum]
Length=244

 Score =   260 bits (664),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+K+RE HVY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQKERETHVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVKLI+ YRQKVE+ELSKIC+DIL+II+KHL+PS+ +GEA
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKLIKGYRQKVEEELSKICSDILDIIDKHLIPSAGTGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRG  118
            TVF+YKMKGDYFRYLAEFK D E+K  
Sbjct  121  TVFYYKMKGDYFRYLAEFKTDSERKEA  147


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEA+EQSLKGYEAA A ANT+L STHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDSERKEASEQSLKGYEAATATANTDLSSTHPIRLGLALNFSVFYY  185



>ref|XP_006348703.1| PREDICTED: 14-3-3-like protein GF14 iota-like isoform X1 [Solanum 
tuberosum]
Length=285

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+K+RE HVY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQKERETHVYMAKLAEQAERYDEMVESMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVKLI+ YRQKVE+ELSKIC+DILEII+KHL+PS+ +GEA
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKLIKGYRQKVEEELSKICSDILEIIDKHLIPSAGTGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDYFRYLAEFK D E+K   
Sbjct  121  TVFYYKMKGDYFRYLAEFKTDLERKEAS  148


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEA+EQSLKGYEAA A ANT+L STHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDLERKEASEQSLKGYEAATATANTDLSSTHPIRLGLALNFSVFYY  185



>gb|ABO15467.1| 14-3-3 protein Lil 1433-2 [Lilium longiflorum]
Length=260

 Score =   258 bits (660),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RENHVYLAKL+EQAERYDEMVE MK +AKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MATEKERENHVYLAKLAEQAERYDEMVEYMKYVAKLDMELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVKLI+ YRQKVEDEL+KICNDIL II++HL+PSS SGE+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKLIKGYRQKVEDELAKICNDILTIIDQHLIPSSGSGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFKN+ E+K
Sbjct  121  TVFYYKMKGDYYRYLAEFKNELERK  145


 Score = 74.7 bits (182),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +K+AA+QSLK Y+AA   ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  143  ERKDAADQSLKAYQAASNTANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_010259579.1| PREDICTED: 14-3-3-like protein GF14 iota [Nelumbo nucifera]
Length=259

 Score =   258 bits (658),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE HVY+AKL+EQAERYDEMVE MK++AKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETHVYMAKLAEQAERYDEMVECMKKVAKLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVK+I+AYRQKVE+ELSKICNDIL II++HL+PSS SGE+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKMIKAYRQKVEEELSKICNDILTIIDEHLIPSSGSGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK DQE+K
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERK  145


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +K+A++QSLKGY+AA   AN++LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKDASDQSLKGYQAASNTANSDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_010680716.1| PREDICTED: 14-3-3-like protein GF14 iota [Beta vulgaris subsp. 
vulgaris]
Length=261

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VYLAKL+EQAERY+EMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETQVYLAKLAEQAERYEEMVECMKTVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNENNVKLI+ YRQKVEDELSKIC DIL II+ HLVP S SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEDELSKICQDILAIIDAHLVPHSGSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDYFRYLAEFK+DQE+K   
Sbjct  121  TVFYYKMKGDYFRYLAEFKSDQERKEAA  148


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAE SLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKSDQERKEAAEHSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_011070948.1| PREDICTED: 14-3-3-like protein GF14 iota [Sesamum indicum]
Length=260

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +E +RENHVY+AKL+EQAERYDEMVE MK++AKLDVEL+V+ERNLLSVGYKNVIGARR
Sbjct  1    MSTENERENHVYMAKLAEQAERYDEMVESMKKVAKLDVELSVDERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NV LI+ YRQKVEDELS IC+DIL +I+KHL+PSS+SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNESNVNLIKGYRQKVEDELSNICHDILSVIDKHLIPSSRSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRG  118
            TVF+YKMKGDY+RYLAEFK DQE+K  
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEA  147


 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEA+EQSLKGYEAA A A+T+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEASEQSLKGYEAASATASTDLPSTHPIRLGLALNFSVFYY  185



>gb|ABO15468.1| 14-3-3 protein Lil 1433-3 [Lilium longiflorum]
Length=260

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RENHVYLAKL+EQAERYDEMVE MK +A+LD++LTVEERNLLSVGYKNVIGARR
Sbjct  1    MTTEKERENHVYLAKLAEQAERYDEMVESMKNVARLDLDLTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGN+ NVKLI+ YR KVE+ELSKICNDIL +I+KHL+PSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNDQNVKLIKGYRHKVEEELSKICNDILTVIDKHLIPSSGSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFKN+ E+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKNEHERKEAA  148


 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QS+K Y+AA   ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKNEHERKEAADQSMKAYQAASNTANTDLPSTHPIRLGLALNFSVFYY  185



>gb|KDP41292.1| hypothetical protein JCGZ_15699 [Jatropha curcas]
Length=262

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE+HVY+AKL+EQAERY+EMVE MK++A+LD ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESHVYMAKLAEQAERYEEMVECMKKVARLDCELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEE+KGNENNVKLI+ YRQKVE+EL+ ICNDIL II+KHLVPSS SGEA
Sbjct  61   ASWRIMSSIEQKEETKGNENNVKLIKGYRQKVEEELANICNDILSIIDKHLVPSSTSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEAA  148


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>gb|AIJ04693.1| 14-3-3d [Morus alba var. atropurpurea]
Length=260

 Score =   256 bits (653),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +EK+RE  VYLAKL+EQAERY+EMVE MK++AKLDVELTVEERNLLSVGYKNVIGARRAS
Sbjct  4    AEKERETQVYLAKLAEQAERYEEMVESMKKLAKLDVELTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNENNVKLI+ YRQKVEDELSKIC+DIL II+KHL+PSS SGEATV
Sbjct  64   WRIMSSIEQKEESKGNENNVKLIKGYRQKVEDELSKICSDILTIIDKHLIPSSASGEATV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +Q++K   
Sbjct  124  FYYKMKGDYYRYLAEFKTEQDRKEAA  149


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA + AN ELPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTEQDRKEAAEQSLKGYEAASSTANAELPSTHPIRLGLALNFSVFYY  186



>ref|XP_002512093.1| 14-3-3 protein, putative [Ricinus communis]
 gb|EEF50762.1| 14-3-3 protein, putative [Ricinus communis]
Length=262

 Score =   255 bits (652),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE HVYLAKL+EQAERYDEMVE MK++AKLD ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETHVYLAKLAEQAERYDEMVECMKKVAKLDCELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEE+KGNENNVKLI+ YR KVE+ELS ICNDIL II+KHL+PSS SGEA
Sbjct  61   ASWRIMSSIEQKEETKGNENNVKLIKGYRNKVEEELSNICNDILSIIDKHLIPSSSSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQ++K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKADQDRKEAA  148


 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKADQDRKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_010939378.1| PREDICTED: 14-3-3-like protein GF14 iota [Elaeis guineensis]
Length=262

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE+HVY+AKL+EQAERYDEMVE MK++AKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESHVYMAKLAEQAERYDEMVESMKKVAKLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVK I+ YRQKVE+EL++ICNDIL II++HL+PSS SGE+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKQIKGYRQKVEEELTQICNDILTIIDQHLIPSSGSGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE++   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERREAA  148


 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + ++EAAEQSLKGY+AA   ANT+LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERREAAEQSLKGYQAATNTANTDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_003607800.1| 14-3-3-like protein [Medicago truncatula]
Length=282

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VY+AKL+EQAERY+EMVE MK IAKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETQVYMAKLAEQAERYEEMVECMKTIAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEE+KGNENNVKLI++Y QKVE+ELSKIC+DILEII+KHL+PSS +GEA
Sbjct  61   ASWRIMSSIEQKEEAKGNENNVKLIKSYCQKVEEELSKICSDILEIIDKHLIPSSTTGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFKNDQ++K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKNDQDRKEAA  148


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLK YEAA A A+T+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKNDQDRKEAADQSLKAYEAASATASTDLPSTHPIRLGLALNFSVFYY  185



>gb|AES89997.2| general regulatory factor 2 [Medicago truncatula]
Length=285

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VY+AKL+EQAERY+EMVE MK IAKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETQVYMAKLAEQAERYEEMVECMKTIAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEE+KGNENNVKLI++Y QKVE+ELSKIC+DILEII+KHL+PSS +GEA
Sbjct  61   ASWRIMSSIEQKEEAKGNENNVKLIKSYCQKVEEELSKICSDILEIIDKHLIPSSTTGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRG  118
            TVF+YKMKGDY+RYLAEFKNDQ++K  
Sbjct  121  TVFYYKMKGDYYRYLAEFKNDQDRKEA  147


 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLK YEAA A A+T+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKNDQDRKEAADQSLKAYEAASATASTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_007157838.1| hypothetical protein PHAVU_002G102500g [Phaseolus vulgaris]
 gb|ESW29832.1| hypothetical protein PHAVU_002G102500g [Phaseolus vulgaris]
Length=258

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VY+AKLSEQAERY+EMVE MK IAKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSAEKERETQVYIAKLSEQAERYEEMVECMKAIAKLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNENN K+I+ YRQKVE+ELSKIC+DIL II+KHLVPSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNENNAKMIKNYRQKVEEELSKICSDILSIIDKHLVPSSTSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEAA  148


 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKGYEAALATANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_010066851.1| PREDICTED: 14-3-3-like protein GF14 iota [Eucalyptus grandis]
 gb|KCW64893.1| hypothetical protein EUGRSUZ_G02455 [Eucalyptus grandis]
Length=259

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M SEK+R+ HVYLAKL+EQAERYDEMVE MK++AKLD++LTVEERNLLSVGYKNVIGARR
Sbjct  1    MSSEKERDAHVYLAKLAEQAERYDEMVECMKKVAKLDLDLTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVKL+R YRQKVE+ELSKIC+DIL II+KHL+PSS +GEA
Sbjct  61   ASWRIMSSIEQKEESKGNEHNVKLVRDYRQKVEEELSKICSDILSIIDKHLIPSSNAGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKIDQERKEAA  148


 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   ++ + +KEAAEQSLKGYEAA + ANTELPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKIDQERKEAAEQSLKGYEAASSTANTELPSTHPIRLGLALNFSVFYY  185



>ref|XP_007045894.1| General regulatory factor 12, IOTA isoform 2 [Theobroma cacao]
 gb|EOY01726.1| General regulatory factor 12, IOTA isoform 2 [Theobroma cacao]
Length=261

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +EK+RE HVY+AKL+EQAERY+EMVE MKQ+AKL  ELTVEERNLLSVGYKNVIGARRAS
Sbjct  4    TEKERETHVYMAKLAEQAERYEEMVETMKQVAKLGCELTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE NVKLI+ YRQKVE+ELSKIC DIL II+KHL+PSS SGEATV
Sbjct  64   WRIMSSIEQKEESKGNEENVKLIKGYRQKVEEELSKICTDILGIIDKHLIPSSNSGEATV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RY+AEFK DQE+K   
Sbjct  124  FYYKMKGDYYRYVAEFKTDQERKEAA  149


 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -2

Query  146  LRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +  + +KEAAEQSLKGYEAA AAANT+LPSTHPIRLGLALNFSVF+Y
Sbjct  139  FKTDQERKEAAEQSLKGYEAASAAANTDLPSTHPIRLGLALNFSVFHY  186



>ref|XP_011018466.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X2 [Populus 
euphratica]
Length=261

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE HVY+AKL+EQAERYDEMVE MK +AKL+ +LTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETHVYMAKLAEQAERYDEMVESMKNVAKLNCDLTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGN++NVKLI+ YRQKVE+ELSKICNDIL II+ HL+PSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNDSNVKLIKGYRQKVEEELSKICNDILSIIDDHLIPSSASGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK DQE+K
Sbjct  121  TVFYYKMKGDYYRYLAEFKADQERK  145


 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +K+AA+QSLKGYEAA A A+T+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKADQERKDAADQSLKGYEAASATASTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_008221499.1| PREDICTED: 14-3-3-like protein GF14 iota [Prunus mume]
Length=263

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VY+AKL+EQAERY+EMVE MK++AKLD+ELTVEERNLLSVGYKNVIGARRASW
Sbjct  5    EKERETQVYMAKLAEQAERYEEMVECMKKVAKLDLELTVEERNLLSVGYKNVIGARRASW  64

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RIMSSIEQKEESKGNE+NVKLI+ YRQKVE+ELSKICNDIL II+KHL+PSS SGEATVF
Sbjct  65   RIMSSIEQKEESKGNEHNVKLIKGYRQKVEEELSKICNDILSIIDKHLIPSSTSGEATVF  124

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK DQ++K   
Sbjct  125  YYKMKGDYYRYLAEFKTDQDRKEAA  149


 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTDQDRKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  186



>ref|XP_002311335.1| 14-3-3-like protein GF14 iota [Populus trichocarpa]
 ref|XP_011018458.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X1 [Populus 
euphratica]
 gb|ABK94048.1| unknown [Populus trichocarpa]
 gb|EEE88702.1| 14-3-3-like protein GF14 iota [Populus trichocarpa]
Length=261

 Score =   253 bits (646),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE HVY+AKL+EQAERYDEMVE MK +AKL+ +LTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETHVYMAKLAEQAERYDEMVESMKNVAKLNCDLTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGN++NVKLI+ YRQKVE+ELSKICNDIL II+ HL+PSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNDSNVKLIKGYRQKVEEELSKICNDILSIIDDHLIPSSASGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK DQE+K
Sbjct  121  TVFYYKMKGDYYRYLAEFKADQERK  145


 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +K+AA+QSLKGYEAA A A+T+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKADQERKDAADQSLKGYEAASATASTDLPSTHPIRLGLALNFSVFYY  185



>gb|KHN20521.1| 14-3-3-like protein GF14 iota [Glycine soja]
Length=249

 Score =   253 bits (645),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VYLAKLSEQAERY+EMVE MK IAKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETQVYLAKLSEQAERYEEMVECMKTIAKLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+N KLI+ YRQKVE+ELSKIC+DIL II++HLVPSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNESNAKLIKNYRQKVEEELSKICSDILSIIDQHLVPSSTSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQ++K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQDRKEAA  148


 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A A+T+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQDRKEAAEQSLKGYEAALATASTDLPSTHPIRLGLALNFSVFYY  185



>emb|CDY24128.1| BnaC03g57490D [Brassica napus]
Length=328

 Score =   244 bits (624),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+KDRE  VYLAKLSEQAERYDEMVE MK++AK+D ELTVEERNLLSVGYKNVIGARRAS
Sbjct  5    SDKDRETFVYLAKLSEQAERYDEMVETMKKVAKVDSELTVEERNLLSVGYKNVIGARRAS  64

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  65   WRIMSSIEQKEESKGNESNVKQIKGYRQKVEDELADICKDILTIIDQHLIPHATSGEATV  124

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRG  118
            F+YKMKGDY+RY AEFK +QE+K  
Sbjct  125  FYYKMKGDYYRYFAEFKTEQERKEA  149


 Score = 80.5 bits (197),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -2

Query  134  KRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            + +KEA+EQSLKGYEAA  AA+T+LPSTHPIRLGLALNFSVFYY
Sbjct  144  QERKEASEQSLKGYEAATQAASTDLPSTHPIRLGLALNFSVFYY  187



>ref|XP_007227176.1| hypothetical protein PRUPE_ppa020788mg, partial [Prunus persica]
 gb|EMJ28375.1| hypothetical protein PRUPE_ppa020788mg, partial [Prunus persica]
Length=262

 Score =   253 bits (646),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VY+AKL+EQAERY+EMVE MK++AKLD+ELTVEERNLLSVGYKNVIGARRASW
Sbjct  5    EKERETQVYMAKLAEQAERYEEMVECMKKVAKLDLELTVEERNLLSVGYKNVIGARRASW  64

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RIMSSIEQKEESKGNE+NVKLI+ YRQKVE+ELSKICNDIL II+KHL+PSS SGEATVF
Sbjct  65   RIMSSIEQKEESKGNEHNVKLIKGYRQKVEEELSKICNDILSIIDKHLIPSSTSGEATVF  124

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK DQ++K   
Sbjct  125  YYKMKGDYYRYLAEFKTDQDRKEAA  149


 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTDQDRKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  186



>ref|XP_002269100.1| PREDICTED: 14-3-3-like protein GF14 iota [Vitis vinifera]
Length=260

 Score =   253 bits (645),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VY+AKL+EQAERY+EMVE MK +AKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETQVYMAKLAEQAERYEEMVECMKTVAKLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVKLI+ YRQKVE+ELSKIC DIL II+KHL+PSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKLIKGYRQKVEEELSKICGDILTIIDKHLIPSSGSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRG  118
            TVF+YKMKGDY+RYLAEFK DQE+K  
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEA  147


 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEA+EQSLKGYEAA + ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEASEQSLKGYEAASSTANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_006605542.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Glycine max]
Length=260

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VYLAKLSEQAERY+EMVE MK IAKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETQVYLAKLSEQAERYEEMVECMKTIAKLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+N KLI+ YRQKVE+ELSKIC+DIL II++HLVPSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNESNAKLIKNYRQKVEEELSKICSDILSIIDQHLVPSSTSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQ++K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQDRKEAA  148


 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A A+TELPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQDRKEAAEQSLKGYEAALATASTELPSTHPIRLGLALNFSVFYY  185



>ref|XP_003528560.2| PREDICTED: 14-3-3-like protein GF14 iota-like [Glycine max]
Length=259

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VYLAKLSEQAERY+EMVE MK IAKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETQVYLAKLSEQAERYEEMVECMKTIAKLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+N KLI+ YRQKVE+ELSKIC+DIL II++HLVPSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNESNAKLIKNYRQKVEEELSKICSDILSIIDQHLVPSSTSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQ++K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQDRKEAA  148


 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A A+T+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQDRKEAAEQSLKGYEAALATASTDLPSTHPIRLGLALNFSVFYY  185



>gb|KHN42946.1| 14-3-3-like protein GF14 iota [Glycine soja]
Length=261

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VYLAKLSEQAERY+EMVE MK IAKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETQVYLAKLSEQAERYEEMVECMKTIAKLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+N KLI+ YRQKVE+ELSKIC+DIL II++HLVPSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNESNAKLIKNYRQKVEEELSKICSDILSIIDQHLVPSSTSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQ++K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQDRKEAA  148


 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A A+T+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQDRKEAAEQSLKGYEAALATASTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_008807823.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X1 [Phoenix 
dactylifera]
Length=260

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE+HVY+AKL+EQAERYDEMVE MK++A+LD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESHVYMAKLAEQAERYDEMVESMKKVARLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVK+I+ Y QKVE+EL++ICNDIL II++HL+PSS SGE+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKVIKGYCQKVEEELTQICNDILAIIDEHLIPSSGSGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEAA  148


 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGY+AA   ANT+LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKGYQAATNTANTDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_008807824.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X2 [Phoenix 
dactylifera]
Length=260

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE+HVY+AKL+EQAERYDEMVE MK++A+LD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESHVYMAKLAEQAERYDEMVESMKKVARLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVK+I+ Y QKVE+EL++ICNDIL II++HL+PSS SGE+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKVIKGYCQKVEEELTQICNDILAIIDEHLIPSSGSGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEAA  148


 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGY+AA   ANT+LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKGYQAATNTANTDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_002316091.1| 14-3-3-like protein GF14 iota [Populus trichocarpa]
 gb|EEF02262.1| 14-3-3-like protein GF14 iota [Populus trichocarpa]
Length=261

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M ++K+RE HVY+AKL+EQAERYDEMVE MK++AKL+ ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTDKERETHVYMAKLAEQAERYDEMVESMKKVAKLNCELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGN++NVKLI+ Y QKVEDELSKICNDIL II+++LVPSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNDSNVKLIKGYCQKVEDELSKICNDILSIIDEYLVPSSTSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEAA  148


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAE SLKGYEAA A A+T+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAELSLKGYEAASATASTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_004505365.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Cicer arietinum]
Length=258

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VY+AKL+EQAERY+EMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETQVYMAKLAEQAERYEEMVECMKTVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNENNVKLI+ Y QKVE+ELSKIC+DIL II++HL+PSS +GEA
Sbjct  61   ASWRIMSSIEQKEESKGNENNVKLIKNYCQKVEEELSKICSDILTIIDQHLIPSSTAGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFKNDQ++K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKNDQDRKEAA  148


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLK YEAA A A+T+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKNDQDRKEAAEQSLKAYEAASATASTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_009356399.1| PREDICTED: 14-3-3-like protein GF14 iota [Pyrus x bretschneideri]
Length=263

 Score =   251 bits (640),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE+ VY+AKL+EQAERY+EMVE MK++AKLD+ELTVEERNLLSVGYKNVIGARRASW
Sbjct  5    EKERESQVYMAKLAEQAERYEEMVECMKKVAKLDLELTVEERNLLSVGYKNVIGARRASW  64

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RIMSSIEQKEESKGNE+NVKLI+AYR KVE+ELSKICNDIL II+KHL+PSS SGEATVF
Sbjct  65   RIMSSIEQKEESKGNEHNVKLIKAYRVKVEEELSKICNDILSIIDKHLIPSSNSGEATVF  124

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYL+EFK DQ+KK   
Sbjct  125  YYKMKGDYYRYLSEFKTDQDKKEAA  149


 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + KKEAA+QSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  136  LSEFKTDQDKKEAADQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  186



>ref|XP_006837122.1| hypothetical protein AMTR_s00110p00124430 [Amborella trichopoda]
 gb|ERM99975.1| hypothetical protein AMTR_s00110p00124430 [Amborella trichopoda]
Length=258

 Score =   250 bits (639),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE+HVY+AKL+EQAERYDEMVE MK++AKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MTTEKERESHVYMAKLAEQAERYDEMVESMKKVAKLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEE+KGNE NVK I++YRQKVE+ELSKIC DIL II++HL+PSS SGE+
Sbjct  61   ASWRIMSSIEQKEETKGNEQNVKRIKSYRQKVEEELSKICYDILTIIDEHLIPSSASGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK D ++K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDHDRKEAA  148


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSL+ Y+AA   ANT+L STHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDHDRKEAADQSLRAYQAASNTANTDLASTHPIRLGLALNFSVFYY  185



>ref|XP_008785970.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X1 [Phoenix 
dactylifera]
Length=262

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE+HVY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESHVYMAKLAEQAERYDEMVEIMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE N KLI+ Y QKVE+EL++ICNDIL II++HL+PSS S EA
Sbjct  61   ASWRIMSSIEQKEESKGNEQNAKLIKGYCQKVEEELTRICNDILTIIDQHLIPSSSSVEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEAA  148


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLKGY+AA   AN++LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAADQSLKGYQAASNTANSDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_008785973.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X3 [Phoenix 
dactylifera]
Length=260

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE+HVY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESHVYMAKLAEQAERYDEMVEIMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE N KLI+ Y QKVE+EL++ICNDIL II++HL+PSS S EA
Sbjct  61   ASWRIMSSIEQKEESKGNEQNAKLIKGYCQKVEEELTRICNDILTIIDQHLIPSSSSVEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEAA  148


 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLKGY+AA   AN++LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAADQSLKGYQAASNTANSDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_008785971.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X2 [Phoenix 
dactylifera]
Length=260

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE+HVY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESHVYMAKLAEQAERYDEMVEIMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE N KLI+ Y QKVE+EL++ICNDIL II++HL+PSS S EA
Sbjct  61   ASWRIMSSIEQKEESKGNEQNAKLIKGYCQKVEEELTRICNDILTIIDQHLIPSSSSVEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEAA  148


 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLKGY+AA   AN++LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAADQSLKGYQAASNTANSDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_006484187.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Citrus sinensis]
Length=261

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +EK+RE HVY+AKL+EQAERY+EMVE MK++AKL  E+TVEERNLLSVGYKNVIGARRAS
Sbjct  4    TEKERETHVYMAKLAEQAERYEEMVESMKKVAKLGCEMTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVKLI+ YR KVE+ELSKIC DIL II+KHL+PSS SGEATV
Sbjct  64   WRIMSSIEQKEESKGNEHNVKLIKGYRHKVEEELSKICGDILTIIDKHLIPSSTSGEATV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK DQE+K   
Sbjct  124  FYYKMKGDYYRYLAEFKVDQERKEAA  149


 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   ++ + +KEAAEQSLKGYEAA A AN +LPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKVDQERKEAAEQSLKGYEAASATANKDLPSTHPIRLGLALNFSVFYY  186



>gb|KDO39380.1| hypothetical protein CISIN_1g044502mg [Citrus sinensis]
Length=262

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +EK+RE HVY+AKL+EQAERY+EMVE MK++AKL  E+TVEERNLLSVGYKNVIGARRAS
Sbjct  4    TEKERETHVYMAKLAEQAERYEEMVESMKKVAKLGCEMTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVKLI+ YR KVE+ELSKIC DIL II+KHL+PSS SGEATV
Sbjct  64   WRIMSSIEQKEESKGNEHNVKLIKGYRHKVEEELSKICGDILTIIDKHLIPSSTSGEATV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK DQE+K   
Sbjct  124  FYYKMKGDYYRYLAEFKVDQERKEAA  149


 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   ++ + +KEAAEQSLKGYEAA A AN +LPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKVDQERKEAAEQSLKGYEAASATANKDLPSTHPIRLGLALNFSVFYY  186



>ref|XP_008350899.1| PREDICTED: 14-3-3-like protein GF14 iota [Malus domestica]
Length=263

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE+ VY+AKL+EQAERY+EMVE MK++AKLD+ELTVEERNLLSVGYKNVIGARRASW
Sbjct  5    EKERESQVYMAKLAEQAERYEEMVECMKKVAKLDLELTVEERNLLSVGYKNVIGARRASW  64

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RIMSSIEQKEESKGNE+NVKLI+ YR KVE+ELSKICNDIL II+KHL+PSS SGEATVF
Sbjct  65   RIMSSIEQKEESKGNEHNVKLIKGYRVKVEEELSKICNDILSIIDKHLIPSSNSGEATVF  124

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYL+EFK DQ+KK   
Sbjct  125  YYKMKGDYYRYLSEFKTDQDKKEAA  149


 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + KKEAA+QSLKGYEAA A ANT+LPSTHPI LGLALNFSVFYY
Sbjct  136  LSEFKTDQDKKEAADQSLKGYEAASATANTDLPSTHPIXLGLALNFSVFYY  186



>gb|ABK23368.1| unknown [Picea sitchensis]
 gb|ABK23976.1| unknown [Picea sitchensis]
 gb|ACN40116.1| unknown [Picea sitchensis]
 gb|ACN40708.1| unknown [Picea sitchensis]
 gb|ACN40832.1| unknown [Picea sitchensis]
 gb|ACN40893.1| unknown [Picea sitchensis]
Length=260

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+K+RENHVY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSSDKERENHVYMAKLAEQAERYDEMVEAMKRVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEE+KGNE+NVK IR YRQKVE ELSKIC+DI+ II++HL+PSS  GE+
Sbjct  61   ASWRIMSSIEQKEEAKGNEHNVKRIREYRQKVEAELSKICHDIMTIIDEHLIPSSNIGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDYFRYLAEFK   E+K   
Sbjct  121  TVFYYKMKGDYFRYLAEFKTGNERKEAA  148


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK Y+ A + A ++L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNERKEAADQSLKAYQTASSTAESDLAPTHPIRLGLALNFSVFYY  185



>ref|XP_010923604.1| PREDICTED: 14-3-3-like protein GF14 iota [Elaeis guineensis]
Length=260

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE HVYLAKL+EQAERYDEMVE MK +A+LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERERHVYLAKLAEQAERYDEMVESMKNVARLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVKLI+ Y QKVE+EL++ICNDIL II++HL+PSS S E+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKLIKNYCQKVEEELTRICNDILSIIDQHLIPSSSSVES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEAA  148


 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLKGY+AA   ANT+LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAADQSLKGYQAASNTANTDLPPTHPIRLGLALNFSVFYY  185



>gb|ACN40863.1| unknown [Picea sitchensis]
Length=259

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+K+RENHVY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSSDKERENHVYMAKLAEQAERYDEMVEAMKRVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEE+KGNE+NVK IR YRQKVE ELSKIC+DI+ II++HL+PSS  GE+
Sbjct  61   ASWRIMSSIEQKEEAKGNEHNVKRIREYRQKVEAELSKICHDIMTIIDEHLIPSSNIGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDYFRYLAEFK   E+K   
Sbjct  121  TVFYYKMKGDYFRYLAEFKTGNERKEAA  148


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK Y+ A + A ++L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNERKEAADQSLKAYQTASSTAESDLAPTHPIRLGLALNFSVFYY  185



>ref|XP_008446428.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X1 [Cucumis 
melo]
Length=263

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +E++RE  VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARRAS
Sbjct  4    AERERETQVYMAKLAEQAERYDEMVECMKKVAKLDVELTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESK NENNVKLI++YRQKVE+ELSKIC DIL II+KHL+PSS S EA+V
Sbjct  64   WRIMSSIEQKEESKSNENNVKLIKSYRQKVEEELSKICIDILTIIDKHLIPSSTSSEASV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK DQE+K   
Sbjct  124  FYYKMKGDYYRYLAEFKTDQERKEAA  149


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLKGYE A + ANTELPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTDQERKEAADQSLKGYETAASTANTELPSTHPIRLGLALNFSVFYY  186



>ref|XP_008360091.1| PREDICTED: 14-3-3-like protein GF14 iota [Malus domestica]
Length=288

 Score =   249 bits (636),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE+ VY+AKL+EQAERY+EMVE MK++AKLD+ELTVEERNLLSVGYKNVIGARRASW
Sbjct  5    EKERESQVYMAKLAEQAERYEEMVECMKKVAKLDLELTVEERNLLSVGYKNVIGARRASW  64

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RIMSSIEQKEESKGNE+NVKLI+ YR KVE+ELSKICNDIL II+KHL+PSS SGEATVF
Sbjct  65   RIMSSIEQKEESKGNEHNVKLIKGYRVKVEEELSKICNDILSIIDKHLIPSSNSGEATVF  124

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYL+EFK DQ+KK   
Sbjct  125  YYKMKGDYYRYLSEFKTDQDKKEAA  149


 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + KKEAA+QSLKGYEAA A ANT+LPSTHPI LGLALNFSVFYY
Sbjct  136  LSEFKTDQDKKEAADQSLKGYEAASATANTDLPSTHPIXLGLALNFSVFYY  186



>ref|XP_004155296.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Cucumis sativus]
Length=267

 Score =   248 bits (634),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +E++RE  VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARRAS
Sbjct  4    AERERETQVYMAKLAEQAERYDEMVECMKKVAKLDVELTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESK NENNVKLI++YRQKVE+ELSKIC DIL II+KHL+PSS S EA+V
Sbjct  64   WRIMSSIEQKEESKSNENNVKLIKSYRQKVEEELSKICIDILTIIDKHLIPSSTSSEASV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK DQE+K   
Sbjct  124  FYYKMKGDYYRYLAEFKTDQERKEAA  149


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLKGYE A + ANTELPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTDQERKEAADQSLKGYETAASTANTELPSTHPIRLGLALNFSVFYY  186



>ref|XP_008446429.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X2 [Cucumis 
melo]
Length=262

 Score =   248 bits (633),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +E++RE  VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARRAS
Sbjct  4    AERERETQVYMAKLAEQAERYDEMVECMKKVAKLDVELTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESK NENNVKLI++YRQKVE+ELSKIC DIL II+KHL+PSS S EA+V
Sbjct  64   WRIMSSIEQKEESKSNENNVKLIKSYRQKVEEELSKICIDILTIIDKHLIPSSTSSEASV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK DQE+K   
Sbjct  124  FYYKMKGDYYRYLAEFKTDQERKEAA  149


 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLKGYE A + ANTELPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTDQERKEAADQSLKGYETAASTANTELPSTHPIRLGLALNFSVFYY  186



>ref|XP_004298381.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   248 bits (634),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VY+AKL+EQAERY+EMVE MK++AKLD+ELTVEERNLLSVGYKNVIGARRASW
Sbjct  5    EKERETQVYMAKLAEQAERYEEMVECMKKVAKLDLELTVEERNLLSVGYKNVIGARRASW  64

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RIMSSIEQKEESKGNE+NVKLI++YRQKVE+ELSKIC+DIL II+KHL+PSS SGEATVF
Sbjct  65   RIMSSIEQKEESKGNEHNVKLIKSYRQKVEEELSKICSDILTIIDKHLIPSSSSGEATVF  124

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK +Q++K   
Sbjct  125  YYKMKGDYYRYLAEFKTEQDRKEAA  149


 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTEQDRKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  186



>gb|ABK24279.1| unknown [Picea sitchensis]
 gb|ABK26478.1| unknown [Picea sitchensis]
Length=258

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  555  LSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRA  376
            ++EK+RENHVY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYKNVIGARRA
Sbjct  1    MTEKERENHVYMAKLAEQAERYDEMVDSMKKVAKLDVELTVEERNLLSVGYKNVIGARRA  60

Query  375  SWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEAT  196
            SWRIMSSIEQKEE+KGNE NVK I+ YR KVEDELS+ICNDIL II++HL+PSS +GE+T
Sbjct  61   SWRIMSSIEQKEEAKGNELNVKRIKEYRHKVEDELSRICNDILTIIDEHLIPSSSTGEST  120

Query  195  VFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            VF+YKMKGDY+RYLAEFK   E+K   
Sbjct  121  VFYYKMKGDYYRYLAEFKTGNERKEAA  147


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK Y+AA   A T+L  THPIRLGLALNFSVFYY
Sbjct  134  LAEFKTGNERKEAADQSLKAYQAASNTATTDLAPTHPIRLGLALNFSVFYY  184



>gb|KGN51972.1| hypothetical protein Csa_5G606630 [Cucumis sativus]
Length=277

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +E++RE  VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARRAS
Sbjct  4    AERERETQVYMAKLAEQAERYDEMVECMKKVAKLDVELTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESK NENNVKLI++YRQKVE+ELSKIC DIL II+KHL+PSS S EA+V
Sbjct  64   WRIMSSIEQKEESKSNENNVKLIKSYRQKVEEELSKICIDILTIIDKHLIPSSTSSEASV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK DQE+K   
Sbjct  124  FYYKMKGDYYRYLAEFKTDQERKEAA  149


 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLKGYE A + ANTELPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTDQERKEAADQSLKGYETAASTANTELPSTHPIRLGLALNFSVFYY  186



>ref|XP_011075592.1| PREDICTED: 14-3-3-like protein GF14 iota [Sesamum indicum]
Length=265

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  531  HVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASWRIMSSI  352
            HVY+AKL+EQAERYDEMVE MK++AKLDVEL+V+ERNLLSVGYKNVIGARRASWRIMSSI
Sbjct  16   HVYMAKLAEQAERYDEMVESMKKVAKLDVELSVDERNLLSVGYKNVIGARRASWRIMSSI  75

Query  351  EQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVFFYKMKG  172
            EQKEESKGNE+NVKLI+ YRQKVEDELSKIC DIL +I+KHL+PSS SGEATVF+YKMKG
Sbjct  76   EQKEESKGNESNVKLIKDYRQKVEDELSKICYDILSVIDKHLIPSSGSGEATVFYYKMKG  135

Query  171  DYFRYLAEFKNDQEKKRGC  115
            DY+RYLAEFK DQ+KK   
Sbjct  136  DYYRYLAEFKTDQDKKEAA  154


 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + KKEAAEQSLKGYEAA AAA+TELPSTHPIRLGLALNFSVFYY
Sbjct  141  LAEFKTDQDKKEAAEQSLKGYEAASAAASTELPSTHPIRLGLALNFSVFYY  191



>ref|XP_006437949.1| hypothetical protein CICLE_v10033402mg [Citrus clementina]
 gb|ESR51189.1| hypothetical protein CICLE_v10033402mg [Citrus clementina]
Length=311

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +EK+RE HVY+AKL+EQAERY+EMVE MK++AKL  E+TVEERNLLSVGYKNVIGARRAS
Sbjct  4    TEKERETHVYMAKLAEQAERYEEMVESMKKVAKLGCEMTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVKLI+ YR KVE+ELSKIC DIL II+KHL+PSS SGEATV
Sbjct  64   WRIMSSIEQKEESKGNEHNVKLIKGYRHKVEEELSKICGDILTIIDKHLIPSSTSGEATV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK DQE+K   
Sbjct  124  FYYKMKGDYYRYLAEFKVDQERKEAA  149


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   ++ + +KEAAEQSLKGYEAA A AN +LPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKVDQERKEAAEQSLKGYEAASATANKDLPSTHPIRLGLALNFSVFYY  186



>ref|XP_001761013.1| predicted protein [Physcomitrella patens]
 gb|EDQ74080.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE++VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESYVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVK I+ YR KVE+ELSKICNDIL II+ HL+PSS +GE+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKRIKDYRHKVEEELSKICNDILSIIDGHLIPSSSTGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   E+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGNERKEAA  148


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK Y+AA + A T+L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNERKEAADQSLKAYQAASSTAVTDLAPTHPIRLGLALNFSVFYY  185



>ref|XP_008339820.1| PREDICTED: 14-3-3-like protein GF14 iota [Malus domestica]
Length=263

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  546  KDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASWR  367
            K+RE  VYLAKL+EQAERY+EMVE MK++AKLD+ELTVEERNLLSVGYKNVIGARRASWR
Sbjct  6    KERETQVYLAKLAEQAERYEEMVECMKKVAKLDLELTVEERNLLSVGYKNVIGARRASWR  65

Query  366  IMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVFF  187
            IMSSIEQKEESKGNE+NVKLI+ YR KVE+ELSKIC+DIL II+KHL+PSS SGEATVF+
Sbjct  66   IMSSIEQKEESKGNEHNVKLIKGYRVKVEEELSKICDDILSIIDKHLIPSSSSGEATVFY  125

Query  186  YKMKGDYFRYLAEFKNDQEKKRGC  115
            YKMKGDY+RYLAEFK DQ++K   
Sbjct  126  YKMKGDYYRYLAEFKTDQDRKEAA  149


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A AN +LPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTDQDRKEAAEQSLKGYEAASATANKDLPSTHPIRLGLALNFSVFYY  186



>ref|XP_004490160.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Cicer arietinum]
Length=259

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VYLAKLSEQAERY+EMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSAEKERETQVYLAKLSEQAERYEEMVECMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVKLI++Y QKVE+ELSKIC+DIL II++HLVPSS S EA
Sbjct  61   ASWRIMSSIEQKEESKGNEHNVKLIKSYCQKVEEELSKICSDILTIIDQHLVPSSTSAEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
             VF++KMKGDYFRYLAEFK DQ++K   
Sbjct  121  NVFYHKMKGDYFRYLAEFKTDQDRKEAA  148


 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQDRKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>gb|KHN03645.1| 14-3-3-like protein GF14 iota [Glycine soja]
Length=262

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VYLAKL+EQAERY+EMVE MK++AKLD++LTVEERNLLSVGYKNVIGARR
Sbjct  1    MSAEKERETQVYLAKLAEQAERYEEMVECMKKVAKLDLDLTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVKLI++Y QKVE+ELSKIC DIL II++HL+PSS S EA
Sbjct  61   ASWRIMSSIEQKEESKGNEHNVKLIKSYCQKVEEELSKICGDILTIIDQHLIPSSASAEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRG  118
            +VF+YKMKGDYFRYLAEFK DQE+K  
Sbjct  121  SVFYYKMKGDYFRYLAEFKTDQERKEA  147


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>ref|NP_001238423.1| 14-3-3 protein SGF14e [Glycine max]
 gb|ADU60529.1| SGF14e [Glycine max]
Length=259

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VYLAKL+EQAERY+EMVE MK++AKLD++LTVEERNLLSVGYKNVIGARR
Sbjct  1    MSAEKERETQVYLAKLAEQAERYEEMVECMKKVAKLDLDLTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVKLI++Y QKVE+ELSKIC DIL II++HL+PSS S EA
Sbjct  61   ASWRIMSSIEQKEESKGNEHNVKLIKSYCQKVEEELSKICGDILTIIDQHLIPSSASAEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDYFRYLAEFK DQE+K   
Sbjct  121  SVFYYKMKGDYFRYLAEFKTDQERKEAA  148


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_004144174.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Cucumis sativus]
 ref|XP_004158246.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Cucumis sativus]
 gb|KGN47650.1| hypothetical protein Csa_6G366480 [Cucumis sativus]
Length=264

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +EK+RE  VY+AKL+EQAERYDEMVE MK IAKLD+ELTVEERNLLSVGYKNVIGARRAS
Sbjct  4    AEKERETQVYMAKLAEQAERYDEMVECMKNIAKLDLELTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNEN VKLI+ YRQKVE+EL+KIC DIL II+KHLVP S S EATV
Sbjct  64   WRIMSSIEQKEESKGNENIVKLIKGYRQKVEEELTKICGDILSIIDKHLVPHSSSAEATV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK DQ++K   
Sbjct  124  FYYKMKGDYYRYLAEFKTDQDRKEAA  149


 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLKGYEAA   ANTELPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTDQDRKEAADQSLKGYEAASGTANTELPSTHPIRLGLALNFSVFYY  186



>ref|XP_003614051.1| 14-3-3-like protein GF14 iota [Medicago truncatula]
 gb|AES97009.1| 14-3-like protein GF14 [Medicago truncatula]
Length=259

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VYLAKLSEQAERY+EMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSAEKERETQVYLAKLSEQAERYEEMVECMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVK+I++Y QKVE+ELSKIC DIL II++HLVP+S S EA
Sbjct  61   ASWRIMSSIEQKEESKGNEHNVKMIKSYCQKVEEELSKICGDILTIIDQHLVPASTSAEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
             VF++KMKGDYFRYLAEFK DQE+K   
Sbjct  121  NVFYHKMKGDYFRYLAEFKTDQERKEAA  148


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>gb|AFK49338.1| unknown [Medicago truncatula]
Length=259

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VYLAKLSEQAERY+EMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSAEKERETQVYLAKLSEQAERYEEMVECMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVK+I++Y QKVE+ELSKIC DIL II++HLVP+S S EA
Sbjct  61   ASWRIMSSIEQKEESKGNEHNVKMIKSYCQKVEEELSKICGDILTIIDQHLVPASTSAEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
             VF++KMKGDYFRYLAEFK DQE+K   
Sbjct  121  NVFYHKMKGDYFRYLAEFKTDQERKEAA  148


 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEA  A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKGYEAVSATANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_009110014.1| PREDICTED: 14-3-3-like protein GF14 iota [Brassica rapa]
Length=267

 Score =   246 bits (629),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+KDRE  VYLAKLSEQAERYDEMVE MK++AK+D ELTVEERNLLSVGYKNVIGARRAS
Sbjct  5    SDKDRETFVYLAKLSEQAERYDEMVETMKKVAKVDSELTVEERNLLSVGYKNVIGARRAS  64

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  65   WRIMSSIEQKEESKGNESNVKHIKGYRQKVEDELADICKDILTIIDQHLIPHATSGEATV  124

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +QE+K   
Sbjct  125  FYYKMKGDYYRYLAEFKTEQERKEAS  150


 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEA+EQSLKGYEAA  AA+T+LPSTHPIRLGLALNFSVFYY
Sbjct  137  LAEFKTEQERKEASEQSLKGYEAATQAASTDLPSTHPIRLGLALNFSVFYY  187



>ref|XP_007153530.1| hypothetical protein PHAVU_003G043200g [Phaseolus vulgaris]
 gb|ESW25524.1| hypothetical protein PHAVU_003G043200g [Phaseolus vulgaris]
Length=259

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+R+  VYLAKL+EQAERY+EMVE MK++AKLD++LTVEERNLLSVGYKNVIGARR
Sbjct  1    MAAEKERDTQVYLAKLAEQAERYEEMVECMKKVAKLDLDLTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEE+K NE+NVKLI++YRQKVEDELSKIC DIL II+KHL+PSS S EA
Sbjct  61   ASWRIMSSIEQKEEAKSNEHNVKLIKSYRQKVEDELSKICGDILTIIDKHLIPSSASAEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            +VF+YKMKGDYFRYLAEFK DQE+K
Sbjct  121  SVFYYKMKGDYFRYLAEFKIDQERK  145


 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   ++ + +K+AAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKIDQERKDAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>gb|ACU19643.1| unknown [Glycine max]
Length=259

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VYLAKL+EQAERY+EMVE MK++AKLD++LTVEERNLLSVGYKNVIGARR
Sbjct  1    MSAEKERETQVYLAKLAEQAERYEEMVECMKKVAKLDLDLTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVKLI++Y QKVE+ELSKIC DIL II++HL+PSS S EA
Sbjct  61   ASWRIMSSIEQKEESKGNEHNVKLIKSYCQKVEEELSKICGDILTIIDQHLIPSSASAEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDYFRYLAEFK DQE+K   
Sbjct  121  SVFYYKMKGDYFRYLAEFKTDQERKEAA  148


 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_008445452.1| PREDICTED: 14-3-3-like protein GF14 iota [Cucumis melo]
Length=264

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            +EK+RE  VY+AKL+EQAERYDEMVE MK IAKLD+ELTVEERNLLSVGYKNVIGARRAS
Sbjct  4    AEKERETQVYMAKLAEQAERYDEMVECMKNIAKLDLELTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNEN VKLI++YRQKVE+EL+KIC DIL II+KHL+P S S EATV
Sbjct  64   WRIMSSIEQKEESKGNENIVKLIKSYRQKVEEELTKICGDILSIIDKHLIPHSSSAEATV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK DQ++K   
Sbjct  124  FYYKMKGDYYRYLAEFKTDQDRKEAA  149


 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLKGYEAA   AN ELPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTDQDRKEAADQSLKGYEAASGTANNELPSTHPIRLGLALNFSVFYY  186



>emb|CDY16161.1| BnaA09g28950D [Brassica napus]
Length=269

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+K+RE  VYLAKLSEQAERYDEMVE MK++AK+D ELTVEERNLLSVGYKNVIGARRAS
Sbjct  5    SDKERETFVYLAKLSEQAERYDEMVETMKKVAKVDSELTVEERNLLSVGYKNVIGARRAS  64

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  65   WRIMSSIEQKEESKGNESNVKTIKGYRQKVEDELANICQDILSIIDQHLIPHATSGEATV  124

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +QE+K   
Sbjct  125  FYYKMKGDYYRYLAEFKTEQERKEAS  150


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEA+EQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  137  LAEFKTEQERKEASEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  187



>ref|XP_001782995.1| predicted protein [Physcomitrella patens]
 gb|EDQ52194.1| predicted protein [Physcomitrella patens]
Length=193

 Score =   243 bits (620),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE++VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESYVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVK I+ YR KVE+ELSKIC DIL II++HL+PSS +GE+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKRIKEYRHKVEEELSKICQDILTIIDEHLIPSSSTGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF++KMKGDY+RYLAEFK   E+K   
Sbjct  121  TVFYFKMKGDYYRYLAEFKTGNERKEAA  148


 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK Y+AA   A T+L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNERKEAADQSLKAYQAASNTATTDLAPTHPIRLGLALNFSVFYY  185



>gb|AFK34571.1| unknown [Lotus japonicus]
Length=258

 Score =   245 bits (626),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE  VY+AKLSEQAERY+EMVE M  +AKLD+ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MAAEKERETQVYMAKLSEQAERYEEMVECMNAVAKLDLELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVKLI+ Y  KVE+ELSKIC DIL II++HL+PSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNESNVKLIKGYCHKVEEELSKICIDILTIIDQHLIPSSASGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEAA  148


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLK YEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKAYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_011012118.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X1 [Populus 
euphratica]
Length=261

 Score =   245 bits (626),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +E +RE +VY+ KL+EQAERYDEMVE MK++AKL+ ELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTENERETYVYMGKLAEQAERYDEMVESMKKVAKLNCELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGN++NVKLI+AY QKVEDELSKIC DIL II+ +LVPSS SGEA
Sbjct  61   ASWRIMSSIEQKEESKGNDSNVKLIKAYCQKVEDELSKICKDILSIIDDYLVPSSTSGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK DQE+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTDQERKEAA  148


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAE SLKGYEAA A A+T+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAELSLKGYEAASATASTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_009115367.1| PREDICTED: 14-3-3-like protein GF14 iota [Brassica rapa]
Length=267

 Score =   246 bits (627),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+K+RE  VYLAKLSEQAERYDEMVE MK++AK+D ELTVEERNLLSVGYKNVIGARRAS
Sbjct  5    SDKERETFVYLAKLSEQAERYDEMVETMKKVAKVDSELTVEERNLLSVGYKNVIGARRAS  64

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  65   WRIMSSIEQKEESKGNESNVKTIKGYRQKVEDELANICQDILSIIDQHLIPHATSGEATV  124

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +QE+K   
Sbjct  125  FYYKMKGDYYRYLAEFKTEQERKEAS  150


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEA+EQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  137  LAEFKTEQERKEASEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  187



>gb|EYU22375.1| hypothetical protein MIMGU_mgv1a012051mg [Erythranthe guttata]
Length=263

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE HVY AKLSEQAERYDEMVE MK++AKLDVEL+V+ERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERETHVYTAKLSEQAERYDEMVECMKKVAKLDVELSVDERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKE+SKGNENNVK+I+ YR+KVE+EL+KIC+DIL +I+KHL+PSS SGEA
Sbjct  61   ASWRIMSSIEQKEDSKGNENNVKIIKNYRRKVEEELAKICHDILSVIDKHLLPSSASGEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDYFRYLAEF+ ++ +K   
Sbjct  121  TVFYYKMKGDYFRYLAEFQAEEGRKEAA  148


 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAE+SLK YEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFQAEEGRKEAAEESLKSYEAALATANTDLPSTHPIRLGLALNFSVFYY  185



>gb|ADY68781.1| 14-3-3-like protein [Gossypium raimondii]
Length=253

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDELSKICNDIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKTGDDRKEAA  146


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKTGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>gb|AEN70723.1| 14-3-3-like protein, partial [Gossypium thurberi]
 gb|AEN70724.1| 14-3-3-like protein, partial [Gossypium laxum]
 gb|AEN70725.1| 14-3-3-like protein, partial [Gossypium schwendimanii]
 gb|AEN70727.1| 14-3-3-like protein, partial [Gossypium mustelinum]
 gb|AEN70729.1| 14-3-3-like protein, partial [Gossypium darwinii]
 gb|AEN70737.1| 14-3-3-like protein, partial [Gossypium hirsutum subsp. latifolium]
 gb|AEN70743.1| 14-3-3-like protein, partial [Gossypium aridum]
 gb|AEN70744.1| 14-3-3-like protein, partial [Gossypium gossypioides]
 gb|AEN70745.1| 14-3-3-like protein, partial [Gossypium lobatum]
 gb|AEN70746.1| 14-3-3-like protein, partial [Gossypium trilobum]
Length=252

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDELSKICNDIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKAGDDRKEAA  146


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>gb|ABD63905.1| 14-3-3-like protein [Gossypium hirsutum]
 gb|ADY68780.1| 14-3-3-like protein [Gossypium herbaceum subsp. africanum]
 gb|ADY68783.1| 14-3-3-like protein [Gossypium hirsutum]
Length=253

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDELSKICNDIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKAGDDRKEAA  146


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>ref|NP_001238407.1| 14-3-3 protein SGF14f [Glycine max]
 gb|ADU60527.1| SGF14f [Glycine max]
 gb|KHN29996.1| 14-3-3-like protein GF14 iota [Glycine soja]
Length=259

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M  EK+RE  VYLAKL+EQAERY+EMVE MK++AKLD++LTVEERNLLSVGYKNVIGARR
Sbjct  1    MSVEKERETQVYLAKLAEQAERYEEMVECMKKVAKLDLDLTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVKLI++Y QKVE+ELSKIC DIL II++HL+PSS S EA
Sbjct  61   ASWRIMSSIEQKEESKGNEHNVKLIKSYCQKVEEELSKICGDILTIIDQHLIPSSGSAEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDYFRYLAEFK DQE+K   
Sbjct  121  SVFYYKMKGDYFRYLAEFKTDQERKEAA  148


 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>gb|ADY68778.1| 14-3-3-like protein [Gossypium barbadense]
Length=253

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDELSKICNDIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKAGDDRKEAA  146


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>gb|ADY68779.1| 14-3-3-like protein [Gossypium barbadense]
 gb|ADY68782.1| 14-3-3-like protein [Gossypium hirsutum]
Length=253

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDELSKICNDIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKAGDDRKEAA  146


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>gb|AEN70731.1| 14-3-3-like protein, partial [Gossypium tomentosum]
 gb|AEN70733.1| 14-3-3-like protein, partial [Gossypium barbadense var. brasiliense]
 gb|AEN70735.1| 14-3-3-like protein, partial [Gossypium barbadense var. peruvianum]
Length=252

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDELSKICNDIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKAGDDRKEAA  146


 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>gb|AEN70728.1| 14-3-3-like protein, partial [Gossypium mustelinum]
 gb|AEN70730.1| 14-3-3-like protein, partial [Gossypium darwinii]
 gb|AEN70732.1| 14-3-3-like protein, partial [Gossypium tomentosum]
 gb|AEN70734.1| 14-3-3-like protein, partial [Gossypium barbadense var. brasiliense]
 gb|AEN70736.1| 14-3-3-like protein, partial [Gossypium barbadense var. peruvianum]
 gb|AEN70738.1| 14-3-3-like protein, partial [Gossypium hirsutum subsp. latifolium]
Length=252

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDELSKICNDIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKAGDDRKEAA  146


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>emb|CDY61631.1| BnaA08g19740D, partial [Brassica napus]
Length=328

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+KDRE  VYLAKLSEQAERYDEMVE MK++AK+D ELTVEERNLLSVGYKNVIGARRAS
Sbjct  5    SDKDRETFVYLAKLSEQAERYDEMVETMKKVAKVDSELTVEERNLLSVGYKNVIGARRAS  64

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  65   WRIMSSIEQKEESKGNESNVKHIKGYRQKVEDELADICKDILTIIDQHLIPHATSGEATV  124

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRG  118
            F+YKMKGDY+RYLAEFK +QE+K  
Sbjct  125  FYYKMKGDYYRYLAEFKTEQERKEA  149


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEA+EQSLKGYEAA  AA+T+LPSTHPIRLGLALNFSVFYY
Sbjct  137  LAEFKTEQERKEASEQSLKGYEAATQAASTDLPSTHPIRLGLALNFSVFYY  187



>gb|KHG17568.1| Uncharacterized protein F383_07573 [Gossypium arboreum]
Length=261

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDELSKICNDIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKAGDDRKEAA  146


 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_006433976.1| hypothetical protein CICLE_v10002186mg [Citrus clementina]
 gb|ESR47216.1| hypothetical protein CICLE_v10002186mg [Citrus clementina]
 gb|KDO80976.1| hypothetical protein CISIN_1g025437mg [Citrus sinensis]
Length=237

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE+HVYLA+L+EQAERYDEMVE MK++AKLDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDEL+KICNDIL +I++HL+PSS SGE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK   ++K   
Sbjct  122  YYKMKGDYYRYLAEFKGADDRKEAA  146


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+ SLK YEAA AAA +ELP THPIRLGLALNFSVFYY
Sbjct  142  RKEAADHSLKAYEAATAAAASELPPTHPIRLGLALNFSVFYY  183



>ref|XP_010551389.1| PREDICTED: 14-3-3-like protein GF14 iota [Tarenaya hassleriana]
Length=265

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+KDRE  VY+AKLSEQAERYDEMVE MK++A+L+ E+TVEERNLLSVGYKNVIGARRAS
Sbjct  4    SDKDRETFVYMAKLSEQAERYDEMVETMKKVARLNSEMTVEERNLLSVGYKNVIGARRAS  63

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK+I+ YRQKVEDELSKIC DIL II++HLVP + SGEATV
Sbjct  64   WRIMSSIEQKEESKGNESNVKIIKGYRQKVEDELSKICQDILGIIDQHLVPHASSGEATV  123

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY RYLAEFK + E+K   
Sbjct  124  FYYKMKGDYCRYLAEFKTEAERKEAA  149


 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  136  LAEFKTEAERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  186



>ref|XP_006415927.1| hypothetical protein EUTSA_v10008445mg [Eutrema salsugineum]
 gb|ESQ34280.1| hypothetical protein EUTSA_v10008445mg [Eutrema salsugineum]
Length=276

 Score =   243 bits (621),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  555  LSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRA  376
            +++K+REN VY+AKLSEQAERYDEMVE MK++A++D ELTVEERNLLSVGYKNVIGARRA
Sbjct  4    VTDKERENFVYMAKLSEQAERYDEMVETMKKVARMDSELTVEERNLLSVGYKNVIGARRA  63

Query  375  SWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEAT  196
            SWRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II +HL+P + SGEAT
Sbjct  64   SWRIMSSIEQKEESKGNESNVKHIKGYRQKVEDELANICQDILTIIVQHLIPHATSGEAT  123

Query  195  VFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            VF+YKMKGDY+RYLAEFK +QE+K   
Sbjct  124  VFYYKMKGDYYRYLAEFKTEQERKEAA  150


 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  137  LAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  187



>gb|AEN70741.1| 14-3-3-like protein, partial [Gossypium davidsonii]
Length=252

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLTEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE N K I+ YRQ+VEDELSKICNDIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNAKRIKDYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKAGDDRKEAA  146


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_001782988.1| predicted protein [Physcomitrella patens]
 gb|EDQ52187.1| predicted protein [Physcomitrella patens]
Length=258

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE++VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESYVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVK I+ YR KVE+ELSKIC DIL II++HL+PSS +GE+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKRIKEYRHKVEEELSKICQDILTIIDEHLIPSSSTGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF++KMKGDY+RYLAEFK   E+K   
Sbjct  121  TVFYFKMKGDYYRYLAEFKTGNERKEAA  148


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK Y+AA   A T+L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNERKEAADQSLKAYQAASNTATTDLAPTHPIRLGLALNFSVFYY  185



>ref|XP_006433977.1| hypothetical protein CICLE_v10002186mg [Citrus clementina]
 ref|XP_006472594.1| PREDICTED: 14-3-3 protein 7-like [Citrus sinensis]
 gb|ESR47217.1| hypothetical protein CICLE_v10002186mg [Citrus clementina]
 gb|KDO80974.1| hypothetical protein CISIN_1g025437mg [Citrus sinensis]
Length=253

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE+HVYLA+L+EQAERYDEMVE MK++AKLDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDEL+KICNDIL +I++HL+PSS SGE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK   ++K   
Sbjct  122  YYKMKGDYYRYLAEFKGADDRKEAA  146


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+ SLK YEAA AAA +ELP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKGADDRKEAADHSLKAYEAATAAAASELPPTHPIRLGLALNFSVFYY  183



>gb|AEN70742.1| 14-3-3-like protein, partial [Gossypium klotzschianum]
Length=252

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE N K I+ YRQ+VEDELSKICNDIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNAKRIKDYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKAGDDRKEAA  146


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>emb|CDX85023.1| BnaC05g20320D [Brassica napus]
Length=270

 Score =   243 bits (620),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            ++K+RE  VYLAKLSEQAERYDEMVE MK++AK+D ELTVEERNLLSVGYKNVIGARRAS
Sbjct  5    TDKEREIFVYLAKLSEQAERYDEMVETMKKVAKVDSELTVEERNLLSVGYKNVIGARRAS  64

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  65   WRIMSSIEQKEESKGNESNVKTIKGYRQKVEDELANICQDILSIIDQHLIPHATSGEATV  124

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +QE+K   
Sbjct  125  FYYKMKGDYYRYLAEFKTEQERKEAS  150


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEA+EQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  137  LAEFKTEQERKEASEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  187



>ref|XP_001764363.1| predicted protein [Physcomitrella patens]
 gb|EDQ70917.1| predicted protein [Physcomitrella patens]
Length=258

 Score =   243 bits (619),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE+ VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSTEKERESQVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVK I+ YR KVE+ELSKIC DIL II++HL+PSS +GE+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKRIKDYRHKVEEELSKICQDILTIIDEHLIPSSSTGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   ++K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGNDRKEAA  148


 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+QSLK Y+AA   A T+L  THPIRLGLALNFSVFYY
Sbjct  144  RKEAADQSLKAYQAASNTATTDLAPTHPIRLGLALNFSVFYY  185



>gb|AEN70739.1| 14-3-3-like protein, partial [Gossypium armourianum]
Length=252

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDELSKIC+DIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICSDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKAGDDRKEAA  146


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>gb|KDO80975.1| hypothetical protein CISIN_1g025437mg [Citrus sinensis]
Length=252

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE+HVYLA+L+EQAERYDEMVE MK++AKLDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDEL+KICNDIL +I++HL+PSS SGE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK   ++K   
Sbjct  122  YYKMKGDYYRYLAEFKGADDRKEAA  146


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+ SLK YEAA AAA +ELP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKGADDRKEAADHSLKAYEAATAAAASELPPTHPIRLGLALNFSVFYY  183



>ref|XP_006303557.1| hypothetical protein CARUB_v10011021mg [Capsella rubella]
 gb|EOA36455.1| hypothetical protein CARUB_v10011021mg [Capsella rubella]
Length=268

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+K+RE  VY+AKLSEQAERYDEMVE MK++A+++ ELTVEERNLLSVGYKNVIGARRAS
Sbjct  6    SDKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRAS  65

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  66   WRIMSSIEQKEESKGNESNVKHIKGYRQKVEDELANICQDILTIIDQHLIPHATSGEATV  125

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDYFRYLAEFK +QE+K   
Sbjct  126  FYYKMKGDYFRYLAEFKTEQERKEAA  151


 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  138  LAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  188



>gb|AEN70726.1| 14-3-3-like protein, partial [Gossypium turneri]
 gb|AEN70740.1| 14-3-3-like protein, partial [Gossypium harknessii]
Length=252

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKSVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDELSKIC+DIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICSDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   ++K   
Sbjct  122  YYKMKGDYFRYLAEFKAADDRKEAA  146


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAADDRKEAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>gb|ABK21097.1| unknown [Picea sitchensis]
Length=259

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RENHVY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MTTEKERENHVYMAKLAEQAERYDEMVDSMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEE+KGNE N K IR YR KVE ELSKIC+DIL II++HL+PSS SGE+
Sbjct  61   ASWRIMSSIEQKEEAKGNEVNAKRIRDYRHKVETELSKICDDILNIIDEHLIPSSSSGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
             VF+YKMKGDY+RYLAEFK   ++K
Sbjct  121  MVFYYKMKGDYYRYLAEFKTGSDRK  145


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KE A+Q+LK Y +A   A T+LP THPIRLGL LNFSVFYY
Sbjct  144  RKETADQALKAYLSASTTATTDLPPTHPIRLGLILNFSVFYY  185



>ref|XP_001776144.1| predicted protein [Physcomitrella patens]
 gb|EDQ59055.1| predicted protein [Physcomitrella patens]
Length=258

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE++VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MSAEKERESYVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKE+SKGN  NVK I+ YR KVE+ELSKICNDIL II+ HL+PSS +GE+
Sbjct  61   ASWRIMSSIEQKEDSKGNYQNVKRIKDYRHKVEEELSKICNDILSIIDGHLIPSSSTGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   E+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGAERKEAA  148


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSLK Y+AA   A T+L  THPIRLGLALNFSVFYY
Sbjct  143  ERKEAADQSLKAYQAASNTAVTDLAPTHPIRLGLALNFSVFYY  185



>ref|XP_010543950.1| PREDICTED: 14-3-3 protein 7 isoform X1 [Tarenaya hassleriana]
Length=257

 Score =   238 bits (608),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+REN VYLA+L+EQAERYDEMVE MK++A+LDVELTVEERNLLSVGYKNVIG+RRASW
Sbjct  2    EKERENQVYLARLAEQAERYDEMVEAMKKVAQLDVELTVEERNLLSVGYKNVIGSRRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE N K I+ YRQ+VEDELSKICNDIL +I+ HL+PS+ SGE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNAKRIKDYRQRVEDELSKICNDILAVIDMHLIPSAASGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            ++KMKGDYFRYLAEFK+  ++K   
Sbjct  122  YHKMKGDYFRYLAEFKSGDDRKEAA  146


 Score = 72.0 bits (175),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+QSLK YEAA   ANT+L  THPIRLGLALNFSVFYY
Sbjct  142  RKEAADQSLKSYEAASTTANTDLSPTHPIRLGLALNFSVFYY  183



>ref|XP_006433978.1| hypothetical protein CICLE_v10002186mg [Citrus clementina]
 gb|ESR47218.1| hypothetical protein CICLE_v10002186mg [Citrus clementina]
Length=264

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE+HVYLA+L+EQAERYDEMVE MK++AKLDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDEL+KICNDIL +I++HL+PSS SGE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK   ++K   
Sbjct  122  YYKMKGDYYRYLAEFKGADDRKEAA  146


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+ SLK YEAA AAA +ELP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKGADDRKEAADHSLKAYEAATAAAASELPPTHPIRLGLALNFSVFYY  183



>ref|XP_002962509.1| hypothetical protein SELMODRAFT_77993 [Selaginella moellendorffii]
 gb|EFJ35972.1| hypothetical protein SELMODRAFT_77993 [Selaginella moellendorffii]
Length=244

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M  EK+RE  VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MGMEKERECFVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE NVK I  Y+QKVEDELS ICNDIL II++HLVP+S +GE+
Sbjct  61   ASWRILSSIEQKEESKGNEQNVKRIGDYQQKVEDELSTICNDILTIIDEHLVPASSTGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDYFRYLAEFK   E+K   
Sbjct  121  TVFYYKMKGDYFRYLAEFKTGNERKEAA  148


 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QS K Y+AA   A+T+LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNERKEAADQSFKAYQAATDTASTDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_002890655.1| hypothetical protein ARALYDRAFT_313341 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66914.1| hypothetical protein ARALYDRAFT_313341 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+K+RE  VY+AKLSEQAERYDEMVE MK++AK++ ELTVEERNLLSVGYKNVIGARRAS
Sbjct  6    SDKERETFVYMAKLSEQAERYDEMVETMKKVAKVNSELTVEERNLLSVGYKNVIGARRAS  65

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  66   WRIMSSIEQKEESKGNESNVKHIKGYRQKVEDELANICQDILSIIDQHLIPHATSGEATV  125

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +QE+K   
Sbjct  126  FYYKMKGDYYRYLAEFKTEQERKEAA  151


 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  138  LAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  188



>gb|KDP41387.1| hypothetical protein JCGZ_15794 [Jatropha curcas]
Length=253

 Score =   239 bits (609),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK++AKLDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDEL+KICNDIL +I++HL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELAKICNDILSVIDEHLLPSSTTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK+  ++K   
Sbjct  122  YYKMKGDYYRYLAEFKSGDDRKEAA  146


 Score = 71.6 bits (174),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+QSLK YEAA + A ++LP THPIRLGLALNFSVFYY
Sbjct  142  RKEAADQSLKAYEAATSTAASDLPPTHPIRLGLALNFSVFYY  183



>ref|NP_564249.1| 14-3-3-like protein GF14 iota [Arabidopsis thaliana]
 sp|Q9C5W6.1|14312_ARATH RecName: Full=14-3-3-like protein GF14 iota; AltName: Full=General 
regulatory factor 12 [Arabidopsis thaliana]
 gb|AAK11271.1|AF335544_1 14-3-3 protein GF14iota [Arabidopsis thaliana]
 dbj|BAC42545.1| putative 14-3-3 protein epsilon [Arabidopsis thaliana]
 gb|AAP12879.1| At1g26480 [Arabidopsis thaliana]
 gb|AEE30696.1| 14-3-3-like protein GF14 iota [Arabidopsis thaliana]
Length=268

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+K+RE  VY+AKLSEQAERYDEMVE MK++A+++ ELTVEERNLLSVGYKNVIGARRAS
Sbjct  6    SDKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRAS  65

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  66   WRIMSSIEQKEESKGNESNVKQIKGYRQKVEDELANICQDILTIIDQHLIPHATSGEATV  125

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +QE+K   
Sbjct  126  FYYKMKGDYYRYLAEFKTEQERKEAA  151


 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  138  LAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  188



>ref|XP_002962780.1| hypothetical protein SELMODRAFT_230088 [Selaginella moellendorffii]
 gb|EFJ36243.1| hypothetical protein SELMODRAFT_230088 [Selaginella moellendorffii]
Length=242

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    EKERECFVYMAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK I  Y+QKVEDELS ICNDIL II++HLVP+S +GE+TVF
Sbjct  62   RILSSIEQKEESKGNEQNVKRIGDYQQKVEDELSTICNDILTIIDEHLVPASSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK   E+K   
Sbjct  122  YYKMKGDYFRYLAEFKTGNERKEAA  146


 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QS K Y+AA   A+T+LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKTGNERKEAADQSFKAYQAATDTASTDLPPTHPIRLGLALNFSVFYY  183



>gb|KFK44572.1| hypothetical protein AALP_AA1G275000 [Arabis alpina]
Length=267

 Score =   241 bits (615),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+K+RE  VY+AKLSEQAERYDEMVE MK++A+++ ELTVEERNLLSVGYKNVIGARRAS
Sbjct  5    SDKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRAS  64

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  65   WRIMSSIEQKEESKGNESNVKHIKGYRQKVEDELANICQDILSIIDQHLIPHATSGEATV  124

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +QE+K   
Sbjct  125  FYYKMKGDYYRYLAEFKTEQERKEAA  150


 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  137  LAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  187



>ref|XP_010538942.1| PREDICTED: 14-3-3 protein 7 [Tarenaya hassleriana]
Length=253

 Score =   238 bits (607),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+R+N VYLA+L+EQAERYDEMVE MK++A+LDVELT+EERNLLSVGYKNVIGARRASW
Sbjct  2    EKERDNQVYLARLAEQAERYDEMVEAMKKVAQLDVELTIEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKE++KGNE NVK I  YRQ+VE ELSKICNDIL +I+KHL+PS+ SGE+TVF
Sbjct  62   RILSSIEQKEDAKGNEQNVKRISDYRQRVEHELSKICNDILAVIDKHLIPSATSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK+  ++K   
Sbjct  122  YYKMKGDYFRYLAEFKSGDDRKEAA  146


 Score = 70.9 bits (172),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+QSLK YEAA   AN++L  THPIRLGLALNFSVFYY
Sbjct  142  RKEAADQSLKAYEAASTTANSDLAPTHPIRLGLALNFSVFYY  183



>ref|XP_010499034.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X1 [Camelina 
sativa]
 ref|XP_010499036.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X2 [Camelina 
sativa]
Length=268

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+K+RE  VY+AKLSEQAERYDEMVE MK++A+++ ELTVEERNLLSVGYKNVIGARRAS
Sbjct  6    SDKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRAS  65

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  66   WRIMSSIEQKEESKGNESNVKHIKGYRQKVEDELANICQDILNIIDQHLIPHATSGEATV  125

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +QE+K   
Sbjct  126  FYYKMKGDYYRYLAEFKTEQERKEAA  151


 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  138  LAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  188



>ref|XP_010477849.1| PREDICTED: 14-3-3-like protein GF14 iota [Camelina sativa]
Length=268

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+K+RE  VY+AKLSEQAERYDEMVE MK++A+++ ELTVEERNLLSVGYKNVIGARRAS
Sbjct  6    SDKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRAS  65

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  66   WRIMSSIEQKEESKGNESNVKHIKGYRQKVEDELANICQDILNIIDQHLIPHATSGEATV  125

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +QE+K   
Sbjct  126  FYYKMKGDYYRYLAEFKTEQERKEAA  151


 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  138  LAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  188



>gb|ABK24180.1| unknown [Picea sitchensis]
Length=259

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +E++RE+HV++AKL+EQAERYDEMV+ MK +AKLD+EL+VEERNLLSVGYKNVIG+RR
Sbjct  1    MSTERERESHVFMAKLAEQAERYDEMVQSMKNVAKLDLELSVEERNLLSVGYKNVIGSRR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEE+KGNE NVK IR YRQKVEDEL +ICNDIL II+ HL+PSS SGE+
Sbjct  61   ASWRIMSSIEQKEEAKGNEQNVKRIRDYRQKVEDELYRICNDILSIIDDHLLPSSTSGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK+  E+K
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNERK  145


 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KE A+QSLK YEAA   A T+L  THPIRLGLALNFSVFYY
Sbjct  144  RKEIADQSLKAYEAASNTAATDLAPTHPIRLGLALNFSVFYY  185



>gb|ACU22928.1| unknown [Glycine max]
Length=259

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M  EK+RE  VYLAKL+EQAERY+EMVE MK++AKLD++LTVEERNLLSVGYKNVIGARR
Sbjct  1    MSVEKERETQVYLAKLAEQAERYEEMVECMKKVAKLDLDLTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE+NVKLI++Y QKVE+ELSKIC D L II++HL+PS  S EA
Sbjct  61   ASWRIMSSIEQKEESKGNEHNVKLIKSYCQKVEEELSKICGDTLTIIDQHLIPSPGSAEA  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDYFRYLAEFK DQE+K   
Sbjct  121  SVFYYKMKGDYFRYLAEFKTDQERKEAA  148


 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA A ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  135  LAEFKTDQERKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYY  185



>ref|XP_010460303.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X1 [Camelina 
sativa]
 ref|XP_010460304.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X2 [Camelina 
sativa]
Length=268

 Score =   241 bits (614),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+K+RE  VY+AKLSEQAERYDEMVE MK++A+++ ELTVEERNLLSVGYKNVIGARRAS
Sbjct  6    SDKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRAS  65

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  66   WRIMSSIEQKEESKGNESNVKHIKGYRQKVEDELANICQDILNIIDQHLIPHATSGEATV  125

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +QE+K   
Sbjct  126  FYYKMKGDYYRYLAEFKTEQERKEAA  151


 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  138  LAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  188



>gb|AAF98570.1|AC013427_13 Strong similarity to GF14 mu from Arabidopsis thaliana gb|AB011545 
and is a member of the 14-3-3 protein PF|00244 family 
[Arabidopsis thaliana]
Length=286

 Score =   241 bits (615),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+K+RE  VY+AKLSEQAERYDEMVE MK++A+++ ELTVEERNLLSVGYKNVIGARRAS
Sbjct  6    SDKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRAS  65

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATV
Sbjct  66   WRIMSSIEQKEESKGNESNVKQIKGYRQKVEDELANICQDILTIIDQHLIPHATSGEATV  125

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY+RYLAEFK +QE+K   
Sbjct  126  FYYKMKGDYYRYLAEFKTEQERKEAA  151


 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  138  LAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  188



>ref|XP_010924614.1| PREDICTED: 14-3-3-like protein D [Elaeis guineensis]
Length=261

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+++REN VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQRERENFVYIAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNEN+VK I+ YRQKVE ELS ICNDI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNENHVKKIKEYRQKVELELSNICNDIMAVIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK+  E+K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKSGDERKEAA  148


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAEQS K Y+ A   A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGDERKEAAEQSHKAYQMATTTAEADLSPTHPIRLGLALNFSVFYY  185



>gb|ABY65000.1| 14-3-3a protein [Gossypium hirsutum]
 gb|KHG10184.1| Uncharacterized protein F383_13179 [Gossypium arboreum]
Length=251

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  543  DRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASWRI  364
            +RE  VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARRASWRI
Sbjct  2    EREQQVYLARLAEQAERYDEMVEAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRI  61

Query  363  MSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVFFY  184
            +SSIEQKEE+KGNE NVK I+ YRQ+VEDEL+KIC+DIL +I+KHL+PSS +GE+TVF+Y
Sbjct  62   LSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICDDILSVIDKHLIPSSSTGESTVFYY  121

Query  183  KMKGDYFRYLAEFKNDQEKKRGC  115
            KMKGDYFRYLAEFK  +++K   
Sbjct  122  KMKGDYFRYLAEFKAGEDRKEAA  144


 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLK YEAA   AN++LP THPIRLGLALNFSVFYY
Sbjct  131  LAEFKAGEDRKEAADQSLKAYEAATTTANSDLPPTHPIRLGLALNFSVFYY  181



>ref|XP_010925645.1| PREDICTED: 14-3-3 protein 9 isoform X1 [Elaeis guineensis]
Length=260

 Score =   239 bits (609),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+K+REN++Y+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQKERENYIYVAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+ SIEQKEE++GNE +VK IR YRQKVE ELS ICNDI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILCSIEQKEEARGNEQHVKRIREYRQKVESELSNICNDIMTVIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK+  E+K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKSGSERKEAA  148


 Score = 68.2 bits (165),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAAEQSLK Y+AA + A  +L  THPIRLGLALNFSVFYY
Sbjct  143  ERKEAAEQSLKAYQAATSTAEADLSPTHPIRLGLALNFSVFYY  185



>ref|XP_010925646.1| PREDICTED: 14-3-3-like protein D isoform X2 [Elaeis guineensis]
Length=259

 Score =   239 bits (609),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+K+REN++Y+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQKERENYIYVAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+ SIEQKEE++GNE +VK IR YRQKVE ELS ICNDI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILCSIEQKEEARGNEQHVKRIREYRQKVESELSNICNDIMTVIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK+  E+K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKSGSERKEAA  148


 Score = 68.2 bits (165),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAAEQSLK Y+AA + A  +L  THPIRLGLALNFSVFYY
Sbjct  143  ERKEAAEQSLKAYQAATSTAEADLSPTHPIRLGLALNFSVFYY  185



>ref|XP_007018760.1| General regulatory factor 11, OMICRON,RHS5 [Theobroma cacao]
 gb|EOY15985.1| General regulatory factor 11, OMICRON,RHS5 [Theobroma cacao]
Length=274

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK++A LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREQQVYLARLAEQAERYDEMVEAMKRVAMLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDELSKICNDIL +I+KHL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELSKICNDILSVIDKHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKK  124
            +YKMKGDYFRYLAEFK   ++K
Sbjct  122  YYKMKGDYFRYLAEFKATDDRK  143


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   + T  +K+AA+QSLK YEAA + A+++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKATDDRKDAADQSLKAYEAATSTASSDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_010919994.1| PREDICTED: 14-3-3-like protein D isoform X1 [Elaeis guineensis]
Length=261

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+++REN VY+AKL+EQAERYDEMVE M ++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQRERENFVYIAKLAEQAERYDEMVETMNKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNEN+VK I+ YRQKVE ELSKICND++ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNENHVKGIKEYRQKVESELSKICNDVMALIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   ++K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKTGNDRKEAA  148


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAE+SLK Y+ A + A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNDRKEAAEESLKAYQMASSTAEADLSPTHPIRLGLALNFSVFYY  185



>emb|CBI27277.3| unnamed protein product [Vitis vinifera]
Length=253

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -1

Query  522  LAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASWRIMSSIEQK  343
            +AKL+EQAERY+EMVE MK +AKLD+ELTVEERNLLSVGYKNVIGARRASWRIMSSIEQK
Sbjct  1    MAKLAEQAERYEEMVECMKTVAKLDLELTVEERNLLSVGYKNVIGARRASWRIMSSIEQK  60

Query  342  EESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVFFYKMKGDYF  163
            EESKGNE NVKLI+ YRQKVE+ELSKIC DIL II+KHL+PSS SGEATVF+YKMKGDY+
Sbjct  61   EESKGNEQNVKLIKGYRQKVEEELSKICGDILTIIDKHLIPSSGSGEATVFYYKMKGDYY  120

Query  162  RYLAEFKNDQEKKRG  118
            RYLAEFK DQE+K  
Sbjct  121  RYLAEFKTDQERKEA  135


 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 43/56 (77%), Gaps = 5/56 (9%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEA-----AFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEA+EQSLKGYEA     A + ANT+LPSTHPIRLGLALNFSVFYY
Sbjct  123  LAEFKTDQERKEASEQSLKGYEACSLLAASSTANTDLPSTHPIRLGLALNFSVFYY  178



>ref|XP_009408618.1| PREDICTED: 14-3-3-like protein GF14 iota [Musa acuminata subsp. 
malaccensis]
Length=266

 Score =   230 bits (587),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK RE+HVY+AKL+EQAERY+EM E MK++AKLDVELT EERNLLSVGYKNVIGARR
Sbjct  1    MSTEKVRESHVYMAKLAEQAERYEEMAESMKKVAKLDVELTAEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEESKGNE NVKLI+ YRQK+E+EL+++C+DIL II++HL+P S S E+
Sbjct  61   ASWRIMSSIEQKEESKGNEQNVKLIKDYRQKIEEELTQMCDDILAIIDQHLIPFSSSVES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
             VF+ KMKGDY+RY+AEFK ++E+K   
Sbjct  121  KVFYAKMKGDYYRYIAEFKTEEERKEAA  148


 Score = 76.6 bits (187),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  134  KRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            + +KEAA+QSLKGY+ A   ANTELP THPIRLGLALNFSVFYY
Sbjct  142  EERKEAADQSLKGYQDASEKANTELPPTHPIRLGLALNFSVFYY  185



>ref|XP_010920003.1| PREDICTED: 14-3-3-like protein D isoform X2 [Elaeis guineensis]
Length=260

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+++REN VY+AKL+EQAERYDEMVE M ++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQRERENFVYIAKLAEQAERYDEMVETMNKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNEN+VK I+ YRQKVE ELSKICND++ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNENHVKGIKEYRQKVESELSKICNDVMALIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   ++K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKTGNDRKEAA  148


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAE+SLK Y+ A + A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNDRKEAAEESLKAYQMASSTAEADLSPTHPIRLGLALNFSVFYY  185



>ref|XP_006446784.1| hypothetical protein CICLE_v10016299mg [Citrus clementina]
 gb|ESR60024.1| hypothetical protein CICLE_v10016299mg [Citrus clementina]
 gb|KDO63354.1| hypothetical protein CISIN_1g024539mg [Citrus sinensis]
Length=202

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMV+ MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICNDI+ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVFFYKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFFYKMKGDYYRYLAEFKFGDEKKEAA  148


 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA  S+K YE A  AA  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYY  185



>ref|XP_006446785.1| hypothetical protein CICLE_v10016299mg [Citrus clementina]
 gb|ESR60025.1| hypothetical protein CICLE_v10016299mg [Citrus clementina]
Length=243

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMV+ MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICNDI+ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVFFYKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFFYKMKGDYYRYLAEFKFGDEKKEAA  148


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA  S+K YE A  AA  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYY  185



>gb|KDO63353.1| hypothetical protein CISIN_1g024539mg [Citrus sinensis]
Length=247

 Score =   237 bits (605),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMV+ MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICNDI+ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVFFYKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFFYKMKGDYYRYLAEFKFGDEKKEAA  148


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA  S+K YE A  AA  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYY  185



>ref|XP_006446782.1| hypothetical protein CICLE_v10016299mg [Citrus clementina]
 ref|XP_006469022.1| PREDICTED: 14-3-3-like protein D-like isoform X3 [Citrus sinensis]
 ref|XP_006469023.1| PREDICTED: 14-3-3-like protein D-like isoform X4 [Citrus sinensis]
 gb|ESR60022.1| hypothetical protein CICLE_v10016299mg [Citrus clementina]
 gb|KDO63350.1| hypothetical protein CISIN_1g024539mg [Citrus sinensis]
Length=261

 Score =   238 bits (606),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMV+ MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICNDI+ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVFFYKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFFYKMKGDYYRYLAEFKFGDEKKEAA  148


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA  S+K YE A  AA  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYY  185



>ref|XP_006446783.1| hypothetical protein CICLE_v10016299mg [Citrus clementina]
 ref|XP_006469024.1| PREDICTED: 14-3-3-like protein D-like isoform X5 [Citrus sinensis]
 gb|ESR60023.1| hypothetical protein CICLE_v10016299mg [Citrus clementina]
 gb|KDO63349.1| hypothetical protein CISIN_1g024539mg [Citrus sinensis]
Length=260

 Score =   238 bits (606),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMV+ MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICNDI+ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVFFYKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFFYKMKGDYYRYLAEFKFGDEKKEAA  148


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA  S+K YE A  AA  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYY  185



>ref|XP_006469020.1| PREDICTED: 14-3-3-like protein D-like isoform X1 [Citrus sinensis]
 ref|XP_006469021.1| PREDICTED: 14-3-3-like protein D-like isoform X2 [Citrus sinensis]
 gb|KDO63352.1| hypothetical protein CISIN_1g024539mg [Citrus sinensis]
Length=266

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMV+ MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICNDI+ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVFFYKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFFYKMKGDYYRYLAEFKFGDEKKEAA  148


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA  S+K YE A  AA  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYY  185



>ref|XP_010277038.1| PREDICTED: 14-3-3-like protein D [Nelumbo nucifera]
Length=261

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+R+++VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKERDSYVYIAKLAEQAERYDEMVDSMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE EL+ ICNDI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEQNAKRIKEYRQKVESELTSICNDIMTVIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRG  118
            TVF+YKMKGDY+RYLAEFK   E+K  
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGNERKEA  147


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEA++QSLK Y+ A + A ++L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNERKEASDQSLKAYQTASSTAESDLSPTHPIRLGLALNFSVFYY  185



>ref|XP_011004796.1| PREDICTED: 14-3-3 protein 7-like [Populus euphratica]
Length=253

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E++RE  VYLA+L+EQAERYDEMVE MK++AKLDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EREREQQVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ Y Q VEDEL+KICNDIL +I++HL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKEYMQSVEDELAKICNDILSVIDQHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK   E+K   
Sbjct  122  YYKMKGDYYRYLAEFKGADERKEAA  146


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A ++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKGADERKEAADQSLKAYEAATSTAISDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_002306573.1| 14-3-3-like protein GF14 omicron [Populus trichocarpa]
 gb|ABK93679.1| unknown [Populus trichocarpa]
 gb|ABK94348.1| unknown [Populus trichocarpa]
 gb|EEE93569.1| 14-3-3-like protein GF14 omicron [Populus trichocarpa]
Length=253

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E++RE  VYLA+L+EQAERYDEMVE MK++AKLDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EREREQQVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ Y Q VEDEL+KICNDIL +I++HL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKEYMQSVEDELAKICNDILSVIDQHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK   E+K   
Sbjct  122  YYKMKGDYYRYLAEFKGADERKEAA  146


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A ++L  THPIRLGLALNFSVFYY
Sbjct  133  LAEFKGADERKEAADQSLKAYEAATSTAISDLLPTHPIRLGLALNFSVFYY  183



>ref|NP_001234637.1| 14-3-3 protein 7 [Solanum lycopersicum]
 ref|XP_006364862.1| PREDICTED: 14-3-3 protein 7-like [Solanum tuberosum]
 sp|P93212.2|14337_SOLLC RecName: Full=14-3-3 protein 7 [Solanum lycopersicum]
 gb|AAL04425.1| 14-3-3 family protein [Solanum lycopersicum]
Length=252

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK IAK+DVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREKQVYLARLAEQAERYDEMVEAMKAIAKMDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKG+E NVK I+ YRQ+VEDEL+KIC+DIL +I++HLVPSS +GE+TVF
Sbjct  62   RILSSIEQKEESKGHEQNVKRIKTYRQRVEDELTKICSDILSVIDEHLVPSSTTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKK  124
            +YKMKGDY+RYLAEFK   ++K
Sbjct  122  YYKMKGDYYRYLAEFKAGDDRK  143


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEA+EQSLK YEAA A A+++L  THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEASEQSLKAYEAATATASSDLAPTHPIRLGLALNFSVFYY  183



>ref|XP_006370164.1| hypothetical protein POPTR_0001s40270g [Populus trichocarpa]
 gb|ERP66733.1| hypothetical protein POPTR_0001s40270g [Populus trichocarpa]
Length=276

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDREN VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MDSSKDRENFVYVAKLAEQAERYDEMVDAMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE NVK I+ YRQKVE EL+ IC+DI+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEESKGNETNVKRIKEYRQKVEAELTGICHDIMTVIDEHLIPSCTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK+  E+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNERKEAA  148


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 35/59 (59%), Gaps = 16/59 (27%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAA-------------FAA---ANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSLK YE               F A   A ++L  THPIRLGLALNFSVFYY
Sbjct  143  ERKEAADQSLKAYELVLRRRKVLELAFLKFTATTTAASDLSPTHPIRLGLALNFSVFYY  201



>ref|XP_002513928.1| 14-3-3 protein, putative [Ricinus communis]
 gb|EEF48511.1| 14-3-3 protein, putative [Ricinus communis]
Length=253

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VY A+L+EQAERYDEMVE MK++AKLDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREQQVYTARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDEL+KICNDIL +I++HL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLLPSSMTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK   ++K   
Sbjct  122  YYKMKGDYYRYLAEFKTTDDRKEAA  146


 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   + T  +KEAA+QSLK YEAA + A T+LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKTTDDRKEAADQSLKAYEAATSTAATDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_006383497.1| hypothetical protein POPTR_0005s17120g [Populus trichocarpa]
 gb|ERP61294.1| hypothetical protein POPTR_0005s17120g [Populus trichocarpa]
Length=253

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E++RE  VYLA+L+EQAERYDEMVE MK++AKLDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EREREQQVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ Y Q VEDEL+KICNDIL +I++HL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKEYMQSVEDELAKICNDILSVIDQHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK   E+K   
Sbjct  122  YYKMKGDYYRYLAEFKGADERKEAA  146


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A ++L  THPIRLGLALNFSVFYY
Sbjct  133  LAEFKGADERKEAADQSLKAYEAATSTAISDLLPTHPIRLGLALNFSVFYY  183



>ref|XP_006370162.1| hypothetical protein POPTR_0001s40270g [Populus trichocarpa]
 ref|XP_011006524.1| PREDICTED: 14-3-3-like protein D isoform X2 [Populus euphratica]
 gb|ERP66731.1| hypothetical protein POPTR_0001s40270g [Populus trichocarpa]
Length=259

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDREN VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MDSSKDRENFVYVAKLAEQAERYDEMVDAMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE NVK I+ YRQKVE EL+ IC+DI+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEESKGNETNVKRIKEYRQKVEAELTGICHDIMTVIDEHLIPSCTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK+  E+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNERKEAA  148


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSLK YE A   A ++L  THPIRLGLALNFSVFYY
Sbjct  143  ERKEAADQSLKAYETATTTAASDLSPTHPIRLGLALNFSVFYY  185



>emb|CDY69181.1| BnaAnng29600D [Brassica napus]
Length=253

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE HVYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ETEREKHVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK I+ YR+KVEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRIQNYRKKVEDELAKVCNDILSVIDKHLIPSSTAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKEAA  146


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_002893851.1| hypothetical protein ARALYDRAFT_473646 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70110.1| hypothetical protein ARALYDRAFT_473646 [Arabidopsis lyrata subsp. 
lyrata]
Length=249

 Score =   233 bits (595),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+REN VYLAKL+EQAERYDEMVE MK++A LDVELT+EERNLLSVGYKNVIGARRASW
Sbjct  2    EKERENQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKE S+GNE N K I+ YR KVE+ELSKIC DIL +I+KHLVPS+ SGE+TVF
Sbjct  62   RILSSIEQKEVSRGNEQNAKRIKDYRTKVEEELSKICYDILAVIDKHLVPSATSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK+  +++   
Sbjct  122  YYKMKGDYFRYLAEFKSGADREEAA  146


 Score = 70.5 bits (171),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            ++EAA+QSLK YEAA  +A++EL +THPIRLGLALNFSVFYY
Sbjct  142  REEAADQSLKAYEAATTSASSELSTTHPIRLGLALNFSVFYY  183



>ref|XP_006370161.1| 14-3-3 brain family protein [Populus trichocarpa]
 ref|XP_011006523.1| PREDICTED: 14-3-3-like protein D isoform X1 [Populus euphratica]
 gb|AAF76227.1|AF272573_1 14-3-3 protein [Populus tremula x Populus alba]
 gb|ERP66730.1| 14-3-3 brain family protein [Populus trichocarpa]
Length=260

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDREN VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MDSSKDRENFVYVAKLAEQAERYDEMVDAMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE NVK I+ YRQKVE EL+ IC+DI+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEESKGNETNVKRIKEYRQKVEAELTGICHDIMTVIDEHLIPSCTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK+  E+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNERKEAA  148


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSLK YE A   A ++L  THPIRLGLALNFSVFYY
Sbjct  143  ERKEAADQSLKAYETATTTAASDLSPTHPIRLGLALNFSVFYY  185



>ref|XP_009145353.1| PREDICTED: 14-3-3-like protein GF14 epsilon [Brassica rapa]
Length=253

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE HVYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ETEREKHVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK I+ YR+KVEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRIQNYRKKVEDELAKVCNDILSVIDKHLIPSSTAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKEAA  146


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_008777420.1| PREDICTED: 14-3-3-like protein D [Phoenix dactylifera]
Length=261

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+++REN+VY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQRERENYVYVAKLAEQAERYDEMVESMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE++GNE +VK IR YRQKVE ELS IC+DI+ ++++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEETRGNEQHVKRIREYRQKVESELSNICSDIMTVMDEHLIPSSTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   E++   
Sbjct  121  SVFYYKMKGDYYRYLAEFKTGSERREAA  148


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            ++EAAEQSLK Y+ A + A  +L  THPIRLGLALNFSVFYY
Sbjct  144  RREAAEQSLKAYQTATSTAEADLSPTHPIRLGLALNFSVFYY  185



>ref|XP_009785724.1| PREDICTED: 14-3-3 protein 7 [Nicotiana sylvestris]
 dbj|BAD10938.1| 14-3-3 protein [Nicotiana tabacum]
Length=252

 Score =   233 bits (593),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK +AK+DVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREKQVYLARLAEQAERYDEMVEAMKTVAKMDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKG++ NVK I+ Y+Q+VEDEL+KIC DIL +I++HLVPSS +GE+TVF
Sbjct  62   RILSSIEQKEESKGHDQNVKRIKTYQQRVEDELTKICIDILSVIDEHLVPSSTTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK+  ++K   
Sbjct  122  YYKMKGDYYRYLAEFKSGDDRKEAA  146


 Score = 70.5 bits (171),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+QSLK YEAA A A+ +L  THPIRLGLALNFSVFYY
Sbjct  142  RKEAADQSLKAYEAATATASADLAPTHPIRLGLALNFSVFYY  183



>ref|XP_006370163.1| hypothetical protein POPTR_0001s40270g [Populus trichocarpa]
 gb|ERP66732.1| hypothetical protein POPTR_0001s40270g [Populus trichocarpa]
Length=275

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDREN VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MDSSKDRENFVYVAKLAEQAERYDEMVDAMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE NVK I+ YRQKVE EL+ IC+DI+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEESKGNETNVKRIKEYRQKVEAELTGICHDIMTVIDEHLIPSCTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK+  E+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNERKEAA  148


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YE A   A ++L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNERKEAADQSLKAYETATTTAASDLSPTHPIRLGLALNFSVFYY  185



>ref|XP_010459979.1| PREDICTED: 14-3-3-like protein GF14 epsilon isoform X2 [Camelina 
sativa]
Length=254

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +REN VYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ENERENQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK ++ YR++VEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRLKTYRKRVEDELAKVCNDILSVIDKHLIPSSTAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K+  
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKQAA  146


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +K+AA+QSL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKQAADQSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_004136830.1| PREDICTED: 14-3-3-like protein D-like [Cucumis sativus]
 ref|XP_004155472.1| PREDICTED: 14-3-3-like protein D-like [Cucumis sativus]
 gb|KGN43625.1| hypothetical protein Csa_7G048090 [Cucumis sativus]
Length=261

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+R+N VY+AKL+EQAERYDEMV+ MK +AKLDVELTVEERNLLSVGYKNV+GARR
Sbjct  1    MASTKERDNFVYIAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVVGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICNDI+ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNETNAKRIKEYRQKVESELSGICNDIMMVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK+  EKK
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNEKK  145


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KK+AA+QS+K YEAA ++A +ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNEKKDAADQSMKAYEAATSSAESELPPTHPIRLGLALNFSVFYY  185



>ref|XP_008455307.1| PREDICTED: 14-3-3-like protein D [Cucumis melo]
Length=261

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+R+N VY+AKL+EQAERYDEMV+ MK +AKLDVELTVEERNLLSVGYKNV+GARR
Sbjct  1    MASTKERDNFVYIAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVVGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICNDI+ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEANAKRIKEYRQKVESELSGICNDIMMVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK+  EKK
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNEKK  145


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KK+AA+QS+K YEAA ++A +ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNEKKDAADQSMKAYEAATSSAESELPPTHPIRLGLALNFSVFYY  185



>ref|XP_010459978.1| PREDICTED: 14-3-3-like protein GF14 epsilon isoform X1 [Camelina 
sativa]
Length=254

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +REN VYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ENERENQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK ++ YR++VEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRLKTYRKRVEDELAKVCNDILSVIDKHLIPSSTAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K+  
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKQAA  146


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +K+AA+QSL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKQAADQSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>emb|CDY38227.1| BnaC05g17440D [Brassica napus]
Length=253

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE HVYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ETEREKHVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK I+ YR++VEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRIQNYRKRVEDELAKVCNDILSVIDKHLIPSSTAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKEAA  146


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_002523376.1| 14-3-3 protein, putative [Ricinus communis]
 gb|EEF38955.1| 14-3-3 protein, putative [Ricinus communis]
Length=260

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDRE  VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNV+G+RR
Sbjct  1    MDSSKDRETFVYVAKLAEQAERYDEMVESMKKVAKLDVELTVEERNLLSVGYKNVVGSRR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE NVK I+ YRQKVE ELS IC+DI+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEESKGNEANVKRIKEYRQKVESELSTICSDIMTVIDEHLIPSCTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   +KK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGNDKKEAA  148


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QSLK YE A   A +ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNDKKEAADQSLKAYETASTTAESELPPTHPIRLGLALNFSVFYY  185



>ref|XP_011016523.1| PREDICTED: 14-3-3 protein 7 [Populus euphratica]
Length=253

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VY A+L+EQAERYDEMVE M ++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREQQVYSARLAEQAERYDEMVEAMNKVARLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDEL+KICNDIL +I++HL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKQYRQRVEDELAKICNDILSVIDQHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEF++  E+K   
Sbjct  122  YYKMKGDYYRYLAEFRSADERKEAA  146


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   R    +KEAA+QSLK YEAA + A ++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFRSADERKEAADQSLKAYEAATSTAISDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_008813767.1| PREDICTED: 14-3-3-like protein D isoform X1 [Phoenix dactylifera]
Length=260

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+++REN VY+AKL+EQAERY+E+VE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQRERENFVYIAKLAEQAERYEELVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNEN+VK I+ YRQKVE ELS ICND++ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNENHVKGIKEYRQKVESELSNICNDVMALIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   ++K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKTGNDRKEAA  148


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAEQSLK Y+ A + A  +L  THPIRLGLALN+SVFYY
Sbjct  135  LAEFKTGNDRKEAAEQSLKAYQMASSTAEADLSPTHPIRLGLALNYSVFYY  185



>ref|XP_002302299.1| 14-3-3-like protein GF14 omicron [Populus trichocarpa]
 gb|EEE81572.1| 14-3-3-like protein GF14 omicron [Populus trichocarpa]
Length=253

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VY A+L+EQAERYDEMVE M ++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREQQVYSARLAEQAERYDEMVEAMNKVARLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE+KGNE NVK I+ YRQ+VEDEL+KICNDIL +I++HL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEAKGNEQNVKRIKQYRQRVEDELAKICNDILSVIDQHLIPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEF++  E+K   
Sbjct  122  YYKMKGDYYRYLAEFRSADERKEAA  146


 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   R    +KEAA+QSLK YEAA + A ++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFRSADERKEAADQSLKSYEAATSTAISDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_008813768.1| PREDICTED: 14-3-3-like protein D isoform X2 [Phoenix dactylifera]
Length=259

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+++REN VY+AKL+EQAERY+E+VE MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQRERENFVYIAKLAEQAERYEELVESMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNEN+VK I+ YRQKVE ELS ICND++ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNENHVKGIKEYRQKVESELSNICNDVMALIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   ++K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKTGNDRKEAA  148


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAEQSLK Y+ A + A  +L  THPIRLGLALN+SVFYY
Sbjct  135  LAEFKTGNDRKEAAEQSLKAYQMASSTAEADLSPTHPIRLGLALNYSVFYY  185



>ref|XP_009588303.1| PREDICTED: 14-3-3 protein 7 [Nicotiana tomentosiformis]
Length=252

 Score =   231 bits (590),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            +K+RE  VYLA+L+EQAERYDEMVE MK +AK+DVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    DKEREKQVYLARLAEQAERYDEMVEAMKTVAKMDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKG++ NVK I+ Y+Q+VEDEL+KIC DIL +I++HLVPSS +GE+TVF
Sbjct  62   RILSSIEQKEESKGHDQNVKRIKTYQQRVEDELTKICIDILSVIDEHLVPSSTTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK+  ++K   
Sbjct  122  YYKMKGDYYRYLAEFKSGDDRKEAA  146


 Score = 70.5 bits (171),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+QSLK YEAA A A+ +L  THPIRLGLALNFSVFYY
Sbjct  142  RKEAADQSLKAYEAATATASADLAPTHPIRLGLALNFSVFYY  183



>ref|XP_010532565.1| PREDICTED: 14-3-3-like protein GF14 iota [Tarenaya hassleriana]
Length=266

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  552  SEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRAS  373
            S+K+RE  VYLAKLSEQAERYDEMVE MK++A+L+ E++VEERNLLSVGYKNVIGARRAS
Sbjct  6    SDKERETFVYLAKLSEQAERYDEMVETMKKVARLNSEMSVEERNLLSVGYKNVIGARRAS  65

Query  372  WRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATV  193
            WRIMSSIEQKEESKGNE+NVK+I+ YRQKVE+ELSKIC DIL II+++LVP + SGEATV
Sbjct  66   WRIMSSIEQKEESKGNESNVKIIKGYRQKVEEELSKICEDILGIIDQNLVPHASSGEATV  125

Query  192  FFYKMKGDYFRYLAEFKNDQEKKRGC  115
            F+YKMKGDY RYLAEFK + E+K   
Sbjct  126  FYYKMKGDYCRYLAEFKTEAERKEAA  151


 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  138  LAEFKTEAERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  188



>emb|CAA65150.1| 14-3-3 protein [Solanum lycopersicum]
Length=252

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK IAK+DVELTVEERNL+SVGYK VIGARRASW
Sbjct  2    EKEREKQVYLARLAEQAERYDEMVEAMKAIAKMDVELTVEERNLVSVGYKXVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKG+E NVK I+ YRQ+VEDEL+KIC+DIL +I++HLVPSS +GE+TVF
Sbjct  62   RILSSIEQKEESKGHEQNVKRIKTYRQRVEDELTKICSDILSVIDEHLVPSSTTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKK  124
            +YKMKGDY+RYLAEFK   ++K
Sbjct  122  YYKMKGDYYRYLAEFKAGDDRK  143


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEA+EQSLK YEAA A A+++L  THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEASEQSLKLYEAATATASSDLAPTHPIRLGLALNFSVFYY  183



>ref|XP_002285787.1| PREDICTED: 14-3-3 protein 7 [Vitis vinifera]
 emb|CBI19165.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  546  KDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASWR  367
            ++RE  VYLA+L+EQAERYDEMVE MK++AKLDVELTVEERNL+SVGYKNVIGARRASWR
Sbjct  2    EEREQQVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWR  61

Query  366  IMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVFF  187
            I+SSIEQKEE++GNE N K I+ YRQ+VEDELSKICNDIL +I+ HL+PSS +GE+TVF+
Sbjct  62   ILSSIEQKEETRGNEQNAKRIKDYRQRVEDELSKICNDILSVIDNHLIPSSSTGESTVFY  121

Query  186  YKMKGDYFRYLAEFKNDQEKKRGC  115
            YKMKGDY+RYLAEFK   ++K   
Sbjct  122  YKMKGDYYRYLAEFKAGNDRKEAA  145


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A ++LP THPIRLGLALNFSVFYY
Sbjct  132  LAEFKAGNDRKEAADQSLKAYEAATSTAASDLPPTHPIRLGLALNFSVFYY  182



>ref|XP_006416211.1| hypothetical protein EUTSA_v10008554mg [Eutrema salsugineum]
 gb|ESQ34564.1| hypothetical protein EUTSA_v10008554mg [Eutrema salsugineum]
Length=253

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ESEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK +++YR++VEDEL+K+CNDIL +I+KHL+PSSK+ E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRLKSYRKRVEDELAKVCNDILSVIDKHLIPSSKAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGTERKEAA  146


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+ SL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADHSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>gb|AAD27824.2| 14-3-3 protein [Populus tremula x Populus alba]
Length=260

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDREN VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MDSSKDRENFVYVAKLAEQAERYDEMVDAMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE NVK I+ YR+KVE EL+ +CNDI+ +I++HL+PSS  GE+
Sbjct  61   ASWRILSSIEQKEESKGNETNVKRIKEYRKKVEAELTGVCNDIMTVIDEHLIPSSIPGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
             VF+YKMKGDY+RYLAEFK+  E+K   
Sbjct  121  AVFYYKMKGDYYRYLAEFKSGNERKEAA  148


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YE A + A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNERKEAADQSLKAYETATSTAARDLSPTHPIRLGLALNFSVFYY  185



>gb|ADO95305.1| 14-3-3-like protein GF14 Epsilon [Eutrema salsugineum]
Length=253

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ESEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK +++YR++VEDEL+K+CNDIL +I+KHL+PSSK+ E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRLKSYRKRVEDELAKVCNDILSVIDKHLIPSSKAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGTERKEAA  146


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+ SL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADHSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_006397422.1| hypothetical protein EUTSA_v10001836mg [Eutrema salsugineum]
 dbj|BAJ34123.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38875.1| hypothetical protein EUTSA_v10001836mg [Eutrema salsugineum]
Length=252

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLAKL+EQAERYDEMVE MK++A LDVELT+EERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREKQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEES+GNE N K I+ YR KVEDELSKIC DIL +I+KHLVPS+ SGE+TVF
Sbjct  62   RILSSIEQKEESRGNEQNAKRIKDYRTKVEDELSKICYDILAVIDKHLVPSATSGESTVF  121

Query  189  FYKMKGDYFRYLAEFK  142
            +YKMKGDYFRYLAEFK
Sbjct  122  YYKMKGDYFRYLAEFK  137


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            + EAA QSLK YEAA + A++EL  THPIRLGLALNFSVFYY
Sbjct  142  RDEAANQSLKAYEAATSTASSELGPTHPIRLGLALNFSVFYY  183



>gb|ADO95307.1| 14-3-3-like protein GF14 Omicron [Eutrema salsugineum]
Length=252

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLAKL+EQAERYDEMVE MK++A LDVELT+EERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREKQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEES+GNE N K I+ YR KVEDELSKIC DIL +I+KHLVPS+ SGE+TVF
Sbjct  62   RILSSIEQKEESRGNEQNAKRIKDYRTKVEDELSKICYDILAVIDKHLVPSATSGESTVF  121

Query  189  FYKMKGDYFRYLAEFK  142
            +YKMKGDYFRYLAEFK
Sbjct  122  YYKMKGDYFRYLAEFK  137


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            + EAA QSLK YEAA + A++EL  THPIRLGLALNFSVFYY
Sbjct  142  RDEAANQSLKAYEAATSTASSELGPTHPIRLGLALNFSVFYY  183



>ref|XP_010060009.1| PREDICTED: 14-3-3 protein 7 [Eucalyptus grandis]
 gb|KCW66531.1| hypothetical protein EUGRSUZ_F00330 [Eucalyptus grandis]
 gb|KCW66532.1| hypothetical protein EUGRSUZ_F00330 [Eucalyptus grandis]
Length=253

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E++RE  VY A+L+EQAERYDEMVE MKQ+AKLDVELTVEERN+LSVGYKNVIGARRASW
Sbjct  2    EREREQQVYQARLAEQAERYDEMVESMKQVAKLDVELTVEERNVLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKE +KGNE NVK I+ YRQ+VEDEL+KIC+DIL +I+KHL+PSS SGE+TVF
Sbjct  62   RILSSIEQKEGTKGNEQNVKRIKDYRQRVEDELAKICSDILSVIDKHLIPSSSSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY RYLAEFK   ++K   
Sbjct  122  YYKMKGDYCRYLAEFKAGDDRKEAA  146


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+T+L  THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAASSTASTDLAPTHPIRLGLALNFSVFYY  183



>ref|XP_006304125.1| hypothetical protein CARUB_v10010075mg [Capsella rubella]
 gb|EOA37023.1| hypothetical protein CARUB_v10010075mg [Capsella rubella]
Length=254

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ENEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK ++ YR++VEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRLKTYRKRVEDELAKVCNDILSVIDKHLIPSSTAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDYFRYLAEF +  E+K   
Sbjct  122  FYKMKGDYFRYLAEFSSGAERKEAA  146


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA+T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAADTGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_006593482.1| PREDICTED: SGF14D isoform X1 [Glycine max]
Length=260

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M + KDREN VY+AKL+EQAERY+EMVE MK +A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MTASKDRENFVYIAKLAEQAERYEEMVESMKNVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMRVIDEHLIPSAAAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK+  EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNEKKEAA  148


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QS+K YE+A AAA  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNEKKEAADQSMKAYESATAAAEADLPPTHPIRLGLALNFSVFYY  185



>ref|XP_010279115.1| PREDICTED: 14-3-3-like protein D isoform X1 [Nelumbo nucifera]
Length=262

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+RE+ VY+AKL+EQAERY+EMV+ MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASPKERESFVYIAKLAEQAERYEEMVDSMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICNDI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEQNAKRIKEYRQKVESELSNICNDIMTVIDEHLIPSSTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   E+K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKTGNERKEAA  148


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK Y+AA +AA + L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNERKEAADQSLKAYQAASSAAESGLSPTHPIRLGLALNFSVFYY  185



>ref|XP_011029567.1| PREDICTED: 14-3-3-like protein D isoform X2 [Populus euphratica]
Length=259

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDREN VY+AKL+EQAERYDEMV+ MK++A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MDSSKDRENFVYVAKLAEQAERYDEMVDAMKKVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE NVK I+ YR+KVE EL+ +CNDI+ +I++HL+PSS  GE+
Sbjct  61   ASWRILSSIEQKEESKGNETNVKRIKEYRKKVEAELTGVCNDIMTVIDEHLIPSSVPGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK+  E+K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKSGNERKEAA  148


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YE A + A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNERKEAADQSLKAYETATSTAARDLSPTHPIRLGLALNFSVFYY  185



>ref|NP_001237065.1| 14-3-3-like protein D [Glycine max]
 sp|Q96453.1|1433D_SOYBN RecName: Full=14-3-3-like protein D; AltName: Full=SGF14D [Glycine 
max]
 gb|AAB09583.1| SGF14D [Glycine max]
 gb|KHN36695.1| 14-3-3-like protein D [Glycine soja]
Length=261

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M + KDREN VY+AKL+EQAERY+EMVE MK +A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MTASKDRENFVYIAKLAEQAERYEEMVESMKNVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMRVIDEHLIPSAAAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK+  EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNEKKEAA  148


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QS+K YE+A AAA  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNEKKEAADQSMKAYESATAAAEADLPPTHPIRLGLALNFSVFYY  185



>ref|XP_010279116.1| PREDICTED: 14-3-3-like protein D isoform X2 [Nelumbo nucifera]
Length=261

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+RE+ VY+AKL+EQAERY+EMV+ MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASPKERESFVYIAKLAEQAERYEEMVDSMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICNDI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEQNAKRIKEYRQKVESELSNICNDIMTVIDEHLIPSSTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   E+K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKTGNERKEAA  148


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK Y+AA +AA + L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNERKEAADQSLKAYQAASSAAESGLSPTHPIRLGLALNFSVFYY  185



>ref|XP_011029566.1| PREDICTED: 14-3-3-like protein D isoform X1 [Populus euphratica]
Length=260

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDREN VY+AKL+EQAERYDEMV+ MK++A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MDSSKDRENFVYVAKLAEQAERYDEMVDAMKKVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE NVK I+ YR+KVE EL+ +CNDI+ +I++HL+PSS  GE+
Sbjct  61   ASWRILSSIEQKEESKGNETNVKRIKEYRKKVEAELTGVCNDIMTVIDEHLIPSSVPGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK+  E+K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKSGNERKEAA  148


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YE A + A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNERKEAADQSLKAYETATSTAARDLSPTHPIRLGLALNFSVFYY  185



>gb|KCW66530.1| hypothetical protein EUGRSUZ_F00330 [Eucalyptus grandis]
Length=260

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E++RE  VY A+L+EQAERYDEMVE MKQ+AKLDVELTVEERN+LSVGYKNVIGARRASW
Sbjct  2    EREREQQVYQARLAEQAERYDEMVESMKQVAKLDVELTVEERNVLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKE +KGNE NVK I+ YRQ+VEDEL+KIC+DIL +I+KHL+PSS SGE+TVF
Sbjct  62   RILSSIEQKEGTKGNEQNVKRIKDYRQRVEDELAKICSDILSVIDKHLIPSSSSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY RYLAEFK   ++K   
Sbjct  122  YYKMKGDYCRYLAEFKAGDDRKEAA  146


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YEAA + A+T+L  THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGDDRKEAADQSLKAYEAASSTASTDLAPTHPIRLGLALNFSVFYY  183



>ref|XP_007048686.1| General regulatory factor 9, MU isoform 3 [Theobroma cacao]
 gb|EOX92843.1| General regulatory factor 9, MU isoform 3 [Theobroma cacao]
Length=275

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKERENFVYVAKLAEQAERYDEMVEAMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKE++KGNE N K I+ YR KVE ELS ICNDI+ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEDAKGNEVNAKRIKEYRHKVESELSSICNDIMTVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVFFYKMK DY+RYLAEFK   EKK   
Sbjct  121  TVFFYKMKADYYRYLAEFKAGNEKKEAA  148


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+ S+K YE A A A  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNEKKEAADHSMKAYETATATAEAELPPTHPIRLGLALNFSVFYY  185



>ref|XP_007048685.1| General regulatory factor 9, MU isoform 2 [Theobroma cacao]
 gb|EOX92842.1| General regulatory factor 9, MU isoform 2 [Theobroma cacao]
Length=260

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKERENFVYVAKLAEQAERYDEMVEAMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKE++KGNE N K I+ YR KVE ELS ICNDI+ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEDAKGNEVNAKRIKEYRHKVESELSSICNDIMTVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVFFYKMK DY+RYLAEFK   EKK   
Sbjct  121  TVFFYKMKADYYRYLAEFKAGNEKKEAA  148


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+ S+K YE A A A  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNEKKEAADHSMKAYETATATAEAELPPTHPIRLGLALNFSVFYY  185



>ref|XP_006853182.1| hypothetical protein AMTR_s00038p00201030 [Amborella trichopoda]
 gb|ERN14649.1| hypothetical protein AMTR_s00038p00201030 [Amborella trichopoda]
Length=257

 Score =   228 bits (581),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M +EK+RE +VY AKL+EQAERY+EMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MTTEKEREVYVYQAKLAEQAERYEEMVEAMKGVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRIMSSIEQKEE+KGN+ NVK IR YR KVE+ELS IC+DIL +I++HLVPSS S E+
Sbjct  61   ASWRIMSSIEQKEEAKGNDQNVKRIRDYRHKVEEELSNICSDILTVIDEHLVPSSNSAES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
             VF+YKMKGDY+RYLAEFK+   +K   
Sbjct  121  MVFYYKMKGDYYRYLAEFKSLSGRKEAA  148


 Score = 71.6 bits (174),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+QSLK Y+AA   A+T+LP THPIRLGLALNFSVFYY
Sbjct  144  RKEAADQSLKAYQAATNTASTDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_006591886.1| PREDICTED: uncharacterized protein LOC100801348 isoform X1 [Glycine 
max]
Length=260

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M + KDREN VY+AKL+EQAERY+EMVE MK +A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MAASKDRENFVYIAKLAEQAERYEEMVESMKNVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMTVIDEHLIPSAAAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKAGNEKKEAA  148


 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QS+K YE+A  AA  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNEKKEAADQSMKAYESATTAAEADLPPTHPIRLGLALNFSVFYY  185



>ref|XP_010915526.1| PREDICTED: 14-3-3-like protein D isoform X1 [Elaeis guineensis]
Length=260

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+++REN+VY+AKL+EQAERYDEMVE MK++AKLDV++TVEERNLLSVGYKNVIGARR
Sbjct  1    MASQRERENYVYVAKLAEQAERYDEMVESMKKVAKLDVDMTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE +VK IR YR+KVE ELS IC D++ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEQHVKRIREYREKVESELSSICMDVMTVIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   EK+   
Sbjct  121  SVFYYKMKGDYYRYLAEFKAGNEKREAA  148


 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    K+EAAEQS K YE A   A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNEKREAAEQSHKAYETATRTAEVDLSPTHPIRLGLALNFSVFYY  185



>ref|XP_010915527.1| PREDICTED: 14-3-3-like protein D isoform X2 [Elaeis guineensis]
Length=259

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+++REN+VY+AKL+EQAERYDEMVE MK++AKLDV++TVEERNLLSVGYKNVIGARR
Sbjct  1    MASQRERENYVYVAKLAEQAERYDEMVESMKKVAKLDVDMTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE +VK IR YR+KVE ELS IC D++ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEQHVKRIREYREKVESELSSICMDVMTVIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   EK+   
Sbjct  121  SVFYYKMKGDYYRYLAEFKAGNEKREAA  148


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    K+EAAEQS K YE A   A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNEKREAAEQSHKAYETATRTAEVDLSPTHPIRLGLALNFSVFYY  185



>ref|XP_010267591.1| PREDICTED: 14-3-3 protein 7-like isoform X4 [Nelumbo nucifera]
Length=254

 Score =   228 bits (581),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E++RE HVY+A+L+EQAERYDEMVE MKQ+A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ERERERHVYMARLAEQAERYDEMVESMKQVARLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEES+GNE NVK IR YR KVEDELS+I NDIL II+ HL+ SS +GE+ VF
Sbjct  62   RILSSIEQKEESRGNEQNVKRIRDYRHKVEDELSRISNDILTIIDDHLLRSSSAGESIVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            ++KMKGDY+RYLAEFK   ++K   
Sbjct  122  YHKMKGDYYRYLAEFKTGVDRKEAA  146


 Score = 71.2 bits (173),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+QSLK Y+AA   A T+LP THPIRLGLALNFSVFYY
Sbjct  142  RKEAADQSLKAYQAATNIAATDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_002316863.1| 14-3-3 brain family protein [Populus trichocarpa]
 gb|EEE97475.1| 14-3-3 brain family protein [Populus trichocarpa]
Length=260

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDREN VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MDSSKDRENFVYVAKLAEQAERYDEMVDAMKKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE NVK I+ YR+KVE EL+ +CNDI+ +I++HL+PSS  GE+
Sbjct  61   ASWRILSSIEQKEESKGNETNVKRIKEYRKKVEAELTGVCNDIMTVIDEHLIPSSIPGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF++KMKGDY+RYLAEFK+  E+K   
Sbjct  121  SVFYHKMKGDYYRYLAEFKSGNERKEAA  148


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK YE A + A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNERKEAADQSLKAYETATSTAARDLSPTHPIRLGLALNFSVFYY  185



>ref|XP_008793009.1| PREDICTED: 14-3-3-like protein D isoform X1 [Phoenix dactylifera]
Length=261

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+++REN VY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQRERENFVYIAKLAEQAERYDEMVESMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNEN+VK I+ YR+KVE ELS IC DI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNENHVKRIKEYRRKVELELSNICLDIMAVIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   E+K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKAGNERKEAA  148


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAE SLK Y+ A   A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNERKEAAELSLKAYQMATTTAEADLSPTHPIRLGLALNFSVFYY  185



>ref|XP_010267573.1| PREDICTED: 14-3-3 protein 7-like isoform X1 [Nelumbo nucifera]
Length=286

 Score =   228 bits (581),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E++RE HVY+A+L+EQAERYDEMVE MKQ+A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ERERERHVYMARLAEQAERYDEMVESMKQVARLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEES+GNE NVK IR YR KVEDELS+I NDIL II+ HL+ SS +GE+ VF
Sbjct  62   RILSSIEQKEESRGNEQNVKRIRDYRHKVEDELSRISNDILTIIDDHLLRSSSAGESIVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            ++KMKGDY+RYLAEFK   ++K   
Sbjct  122  YHKMKGDYYRYLAEFKTGVDRKEAA  146


 Score = 70.9 bits (172),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+QSLK Y+AA   A T+LP THPIRLGLALNFSVFYY
Sbjct  142  RKEAADQSLKAYQAATNIAATDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_009795721.1| PREDICTED: 14-3-3 protein 9 [Nicotiana sylvestris]
Length=261

 Score =   229 bits (585),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMV+ MK +A +DVELTVEERNLLSVGYKNV+G+RR
Sbjct  1    MASSKERENFVYVAKLAEQAERYDEMVDAMKSVANMDVELTVEERNLLSVGYKNVVGSRR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEES+GNE NVK I+ YRQKVE EL+ ICNDI+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEESRGNEQNVKRIKEYRQKVETELTSICNDIMVVIDQHLIPSCTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF++KMKGDY+RYLAEFK+  +KK
Sbjct  121  TVFYHKMKGDYYRYLAEFKSGNDKK  145


 Score = 69.3 bits (168),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            KKE AE SLK Y++A  AA  ELP THPIRLGLALNFSVFYY
Sbjct  144  KKEVAELSLKAYQSATTAAEAELPPTHPIRLGLALNFSVFYY  185



>ref|XP_009409399.1| PREDICTED: 14-3-3-like protein D [Musa acuminata subsp. malaccensis]
Length=255

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S++DRENHVY+AKL+EQAERYDEMV+ MK++A LDVELTVEERNLLSVGYKNVIGA R
Sbjct  1    MASQRDRENHVYVAKLAEQAERYDEMVDAMKKVANLDVELTVEERNLLSVGYKNVIGAGR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE +VK I+ Y+QK E ELS IC+DI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEQHVKKIKEYKQKAEAELSGICSDIMTLIDEHLIPSSVAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   EKK   
Sbjct  121  SVFYYKMKGDYYRYLAEFKTGNEKKEAA  148


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+ SLK YEAA + A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNEKKEAADYSLKAYEAATSTAEADLSPTHPIRLGLALNFSVFYY  185



>ref|XP_008793010.1| PREDICTED: 14-3-3-like protein D isoform X2 [Phoenix dactylifera]
Length=260

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+++REN VY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASQRERENFVYIAKLAEQAERYDEMVESMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNEN+VK I+ YR+KVE ELS IC DI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNENHVKRIKEYRRKVELELSNICLDIMAVIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VF+YKMKGDY+RYLAEFK   E+K   
Sbjct  121  SVFYYKMKGDYYRYLAEFKAGNERKEAA  148


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAE SLK Y+ A   A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNERKEAAELSLKAYQMATTTAEADLSPTHPIRLGLALNFSVFYY  185



>ref|XP_010267584.1| PREDICTED: 14-3-3 protein 7-like isoform X3 [Nelumbo nucifera]
Length=261

 Score =   228 bits (580),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E++RE HVY+A+L+EQAERYDEMVE MKQ+A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ERERERHVYMARLAEQAERYDEMVESMKQVARLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEES+GNE NVK IR YR KVEDELS+I NDIL II+ HL+ SS +GE+ VF
Sbjct  62   RILSSIEQKEESRGNEQNVKRIRDYRHKVEDELSRISNDILTIIDDHLLRSSSAGESIVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            ++KMKGDY+RYLAEFK   ++K   
Sbjct  122  YHKMKGDYYRYLAEFKTGVDRKEAA  146


 Score = 70.9 bits (172),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+QSLK Y+AA   A T+LP THPIRLGLALNFSVFYY
Sbjct  142  RKEAADQSLKAYQAATNIAATDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_010498698.1| PREDICTED: 14-3-3-like protein GF14 epsilon isoform X1 [Camelina 
sativa]
 ref|XP_010498699.1| PREDICTED: 14-3-3-like protein GF14 epsilon isoform X2 [Camelina 
sativa]
 ref|XP_010498700.1| PREDICTED: 14-3-3-like protein GF14 epsilon isoform X3 [Camelina 
sativa]
 ref|XP_010477491.1| PREDICTED: 14-3-3-like protein GF14 epsilon [Camelina sativa]
Length=254

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ENEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK ++ YR++VEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRLKTYRKRVEDELAKVCNDILSVIDKHLIPSSTAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKEAA  146


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_002893217.1| hypothetical protein ARALYDRAFT_313117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69476.1| hypothetical protein ARALYDRAFT_313117 [Arabidopsis lyrata subsp. 
lyrata]
Length=254

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ENEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK ++ YR++VEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRLKTYRKRVEDELAKVCNDILSVIDKHLIPSSNAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGTERKEAA  146


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_010655514.1| PREDICTED: 14-3-3-like protein D isoform X1 [Vitis vinifera]
Length=262

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDR+  VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVG+KNVIGARR
Sbjct  1    MASSKDRDTFVYVAKLAEQAERYDEMVDSMKKVAKLDVELTVEERNLLSVGFKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGN+ N K I+ YRQKVE ELS IC++I+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNDQNAKRIKEYRQKVESELSGICSEIMTVIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK+  EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNEKKEAA  148


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QSLK Y+ A   A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNEKKEAADQSLKAYQTASTTAEADLSPTHPIRLGLALNFSVFYY  185



>ref|XP_002273375.2| PREDICTED: 14-3-3-like protein D isoform X2 [Vitis vinifera]
Length=261

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDR+  VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVG+KNVIGARR
Sbjct  1    MASSKDRDTFVYVAKLAEQAERYDEMVDSMKKVAKLDVELTVEERNLLSVGFKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGN+ N K I+ YRQKVE ELS IC++I+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNDQNAKRIKEYRQKVESELSGICSEIMTVIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK+  EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNEKKEAA  148


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QSLK Y+ A   A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNEKKEAADQSLKAYQTASTTAEADLSPTHPIRLGLALNFSVFYY  185



>ref|XP_010057095.1| PREDICTED: 14-3-3-like protein D [Eucalyptus grandis]
Length=262

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+R+ +VY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASTKERDGYVYVAKLAEQAERYDEMVEAMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKE+SKGNE+NVK I+ YRQKVE EL+ IC D++++I++HL+PS   GE+
Sbjct  61   ASWRILSSIEQKEDSKGNEHNVKKIKEYRQKVEAELANICGDVMKVIDEHLIPSCAGGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVFFYKMKGDY+RYLAEFK   ++K   
Sbjct  121  TVFFYKMKGDYYRYLAEFKAGDDRKEAA  148


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAEQS+K YE A   A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGDDRKEAAEQSMKAYELASTTAEADLSPTHPIRLGLALNFSVFYY  185



>emb|CDP01064.1| unnamed protein product [Coffea canephora]
Length=253

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK++AKLDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREKQVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE KG++ NVK I+ YRQ VEDEL KICNDIL +I++HL+PSS +GE+TVF
Sbjct  62   RILSSIEQKEEGKGHDQNVKRIKGYRQGVEDELMKICNDILAVIDEHLLPSSSTGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY+RYLAEFK  + +K   
Sbjct  122  YYKMKGDYYRYLAEFKAGENRKEAA  146


 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAA+QSLK YEAA A+AN++LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKAGENRKEAADQSLKAYEAATASANSDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_010689898.1| PREDICTED: 14-3-3-like protein D [Beta vulgaris subsp. vulgaris]
Length=260

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMVE MK++AKLDVELTVEERNLLSVGYKNV+G+RR
Sbjct  1    MASTKERENFVYIAKLAEQAERYDEMVEAMKKLAKLDVELTVEERNLLSVGYKNVVGSRR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE KGNE NVK IR YRQKVE EL+ IC+DI+ +I +HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEEGKGNEQNVKRIREYRQKVELELTNICSDIMTVINEHLIPSATAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   E+K   
Sbjct  121  TVFYYKMKGDYYRYLAEFKFANERKEAA  148


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QS+K YE+A   A  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKFANERKEAADQSMKAYESATTTAEAELPPTHPIRLGLALNFSVFYY  185



>ref|XP_004487160.1| PREDICTED: 14-3-3-like protein B-like isoform X1 [Cicer arietinum]
 gb|ACQ45020.1| 14-3-3 [Cicer arietinum]
Length=261

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDREN VY+AKL+EQAERY+EMV+ MK +A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKDRENFVYIAKLAEQAERYEEMVDSMKSVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGN+ N K I+ YR KVE ELS ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEETKGNDVNAKRIKEYRHKVESELSNICNDVMRVIDEHLIPSAAAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGNEKKEAA  148


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QS+K YE+A  AA  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNEKKEAADQSMKAYESATTAAEAELPPTHPIRLGLALNFSVFYY  185



>gb|KCW74108.1| hypothetical protein EUGRSUZ_E02747 [Eucalyptus grandis]
Length=277

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+R+ +VY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASTKERDGYVYVAKLAEQAERYDEMVEAMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKE+SKGNE+NVK I+ YRQKVE EL+ IC D++++I++HL+PS   GE+
Sbjct  61   ASWRILSSIEQKEDSKGNEHNVKKIKEYRQKVEAELANICGDVMKVIDEHLIPSCAGGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVFFYKMKGDY+RYLAEFK   ++K
Sbjct  121  TVFFYKMKGDYYRYLAEFKAGDDRK  145


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAAEQS+K YE A   A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGDDRKEAAEQSMKAYELASTTAEADLSPTHPIRLGLALNFSVFYY  185



>ref|XP_009613251.1| PREDICTED: 14-3-3 protein 9 [Nicotiana tomentosiformis]
 dbj|BAB68527.1| 14-3-3 protein [Nicotiana tabacum]
Length=261

 Score =   228 bits (581),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMV+ MK +A +DVEL+VEERNLLSVGYKNV+G+RR
Sbjct  1    MASSKERENFVYVAKLAEQAERYDEMVDAMKSVANMDVELSVEERNLLSVGYKNVVGSRR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEES+GNE NVK I+ YRQKVE EL+ ICNDI+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEESRGNEQNVKRIKEYRQKVETELTSICNDIMVVIDQHLIPSCTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF++KMKGDY+RYLAEFK+  +KK
Sbjct  121  TVFYHKMKGDYYRYLAEFKSGNDKK  145


 Score = 69.3 bits (168),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            KKE AE SLK Y++A  AA  ELP THPIRLGLALNFSVFYY
Sbjct  144  KKEVAELSLKAYQSATTAAEAELPPTHPIRLGLALNFSVFYY  185



>ref|NP_001242151.1| uncharacterized protein LOC100801348 [Glycine max]
 gb|ACU24005.1| unknown [Glycine max]
Length=261

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M + KDREN VY+AKL+EQAER++EMVE MK +A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MAASKDRENFVYIAKLAEQAERFEEMVESMKNVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMTVIDEHLIPSAAAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKAGNEKKEAA  148


 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QS+K YE+A  AA  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNEKKEAADQSMKAYESATTAAEADLPPTHPIRLGLALNFSVFYY  185



>ref|XP_009389896.1| PREDICTED: 14-3-3-like protein D [Musa acuminata subsp. malaccensis]
Length=255

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S++DREN+VY+AKL+EQAERYDEMV+ MK++A LDV+LTVEERNLLSVGYKNV+GARR
Sbjct  1    MASQRDRENYVYIAKLAEQAERYDEMVDAMKKVASLDVDLTVEERNLLSVGYKNVVGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKE+++GNE++VK I+ YRQK E ELS IC+DI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEKARGNEHHVKQIKEYRQKAESELSGICSDIMTLIDEHLIPSSTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            ++FFYKMKGDY+RYLAEFK   E+K   
Sbjct  121  SIFFYKMKGDYYRYLAEFKTGNERKEAT  148


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEA ++SL+ Y+AA + A  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNERKEATDKSLEAYQAATSTAEADLPPTHPIRLGLALNFSVFYY  185



>gb|AAD46005.1|AC007894_3 Similar to gb|X95905 14-3-3 protein (TFT7) from Lycopersicon 
esculentum [Arabidopsis thaliana]
 gb|AAG47840.1| 14-3-3 protein GF14omicron [Arabidopsis thaliana]
Length=241

 Score =   228 bits (582),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +R   VYLAKL+EQAERYDEMVE MK++A LDVELT+EERNLLSVGYKNVIGARRASW
Sbjct  2    ENERAKQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE N K I+ YR KVE+ELSKIC DIL +I+KHLVP + SGE+TVF
Sbjct  62   RILSSIEQKEESKGNEQNAKRIKDYRTKVEEELSKICYDILAVIDKHLVPFATSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK+  +++   
Sbjct  122  YYKMKGDYFRYLAEFKSGADREEAA  146


 Score = 68.6 bits (166),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            ++EAA+ SLK YEAA ++A+TEL +THPIRLGLALNFSVFYY
Sbjct  142  REEAADLSLKAYEAATSSASTELSTTHPIRLGLALNFSVFYY  183



>gb|KHN27939.1| 14-3-3-like protein D [Glycine soja]
Length=291

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M + KDREN VY+AKL+EQAERY+EMVE MK +A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MAASKDRENFVYIAKLAEQAERYEEMVESMKNVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMTVIDEHLIPSAAAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKAGNEKKEAA  148


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QS+K YE+A  AA  +LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNEKKEAADQSMKAYESATTAAEADLPPTHPIRLGLALNFSVFYY  185



>gb|KFK44327.1| hypothetical protein AALP_AA1G243900 [Arabis alpina]
Length=253

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ENEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK ++ YR++VEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRLKNYRKRVEDELAKVCNDILSVIDKHLIPSSNAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKEAA  146


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>ref|NP_564451.2| 14-3-3-like protein GF14 omicron [Arabidopsis thaliana]
 gb|ABK59686.1| At1g34760 [Arabidopsis thaliana]
 gb|AEE31735.1| general regulatory factor 11 [Arabidopsis thaliana]
Length=255

 Score =   228 bits (580),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +R   VYLAKL+EQAERYDEMVE MK++A LDVELT+EERNLLSVGYKNVIGARRASW
Sbjct  2    ENERAKQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE N K I+ YR KVE+ELSKIC DIL +I+KHLVP + SGE+TVF
Sbjct  62   RILSSIEQKEESKGNEQNAKRIKDYRTKVEEELSKICYDILAVIDKHLVPFATSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK+  +++   
Sbjct  122  YYKMKGDYFRYLAEFKSGADREEAA  146


 Score = 68.9 bits (167),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            ++EAA+ SLK YEAA ++A+TEL +THPIRLGLALNFSVFYY
Sbjct  142  REEAADLSLKAYEAATSSASTELSTTHPIRLGLALNFSVFYY  183



>ref|XP_011100204.1| PREDICTED: 14-3-3 protein 9 [Sesamum indicum]
Length=259

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S  DRE  VYLAKL+EQAERYDEMVE MK++AK+DVELTVEERNLLSVGYKNVIG+RR
Sbjct  1    MASSADRETAVYLAKLAEQAERYDEMVESMKKVAKMDVELTVEERNLLSVGYKNVIGSRR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEES+GNE N K I+ YRQKVE EL+ IC+DI+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEESRGNEQNAKRIKEYRQKVEAELTNICSDIMTVIDEHLIPSCTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK   ++K
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGNDRK  145


 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KE A+QSLK YE A  +A  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNDRKEVADQSLKAYETATTSAEAELPPTHPIRLGLALNFSVFYY  185



>ref|NP_001077649.1| 14-3-3-like protein GF14 omicron [Arabidopsis thaliana]
 sp|Q9S9Z8.2|14311_ARATH RecName: Full=14-3-3-like protein GF14 omicron; AltName: Full=General 
regulatory factor 11 [Arabidopsis thaliana]
 gb|AEE31736.1| general regulatory factor 11 [Arabidopsis thaliana]
Length=252

 Score =   228 bits (580),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +R   VYLAKL+EQAERYDEMVE MK++A LDVELT+EERNLLSVGYKNVIGARRASW
Sbjct  2    ENERAKQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE N K I+ YR KVE+ELSKIC DIL +I+KHLVP + SGE+TVF
Sbjct  62   RILSSIEQKEESKGNEQNAKRIKDYRTKVEEELSKICYDILAVIDKHLVPFATSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDYFRYLAEFK+  +++   
Sbjct  122  YYKMKGDYFRYLAEFKSGADREEAA  146


 Score = 68.6 bits (166),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            ++EAA+ SLK YEAA ++A+TEL +THPIRLGLALNFSVFYY
Sbjct  142  REEAADLSLKAYEAATSSASTELSTTHPIRLGLALNFSVFYY  183



>emb|CBI30682.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDR+  VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVG+KNVIGARR
Sbjct  1    MASSKDRDTFVYVAKLAEQAERYDEMVDSMKKVAKLDVELTVEERNLLSVGFKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGN+ N K I+ YRQKVE ELS IC++I+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNDQNAKRIKEYRQKVESELSGICSEIMTVIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK+  EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNEKKEAA  148


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QSLK Y+ A   A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNEKKEAADQSLKAYQTASTTAEADLSPTHPIRLGLALNFSVFYY  185



>ref|XP_007149742.1| hypothetical protein PHAVU_005G095500g [Phaseolus vulgaris]
 gb|ESW21736.1| hypothetical protein PHAVU_005G095500g [Phaseolus vulgaris]
Length=261

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDR+N VY+AKL+EQAERY+EMV+ MK++A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKDRDNFVYIAKLAEQAERYEEMVDSMKKVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMRVIDEHLIPSAAAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKIGNEKKEAA  148


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   ++   KKEAA+QS+K YE+A  AA ++LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKIGNEKKEAADQSMKAYESATTAAESDLPPTHPIRLGLALNFSVFYY  185



>gb|AGV54290.1| 14-3-3 protein-like protein [Phaseolus vulgaris]
Length=261

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDR+N VY+AKL+EQAERY+EMV+ MK++A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKDRDNFVYIAKLAEQAERYEEMVDSMKKVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE ELS ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMRVIDEHLIPSAAAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKIGNEKKEAA  148


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   ++   KKEAA+QS+K YE+A  AA ++LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKIGNEKKEAADQSMKAYESASTAAESDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_006449497.1| hypothetical protein CICLE_v10016334mg [Citrus clementina]
 gb|ESR62737.1| hypothetical protein CICLE_v10016334mg [Citrus clementina]
Length=201

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            +KDREN VY+AKL+EQAERYDEMV+ MK++A LDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    DKDRENFVYIAKLAEQAERYDEMVDAMKKVANLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE++GNE NVK I+ YRQKVE ELSKI  DI+++I++HL+PS   GE+TVF
Sbjct  62   RILSSIEQKEEARGNELNVKRIKEYRQKVEAELSKISTDIMQVIDEHLIPSCTGGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKK  124
            +YKMKGDY+RYLAEFK   E+K
Sbjct  122  YYKMKGDYYRYLAEFKTGDERK  143


 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +K+ A+ S+K Y+AA   A  EL  THPIRLGLALNFSVFYY
Sbjct  133  LAEFKTGDERKDVADLSMKAYQAASTTAEAELSPTHPIRLGLALNFSVFYY  183



>gb|KEH39277.1| general regulatory factor 2 [Medicago truncatula]
Length=261

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDREN VY+AKL+EQAERY+EMV+ MK +A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKDRENFVYIAKLAEQAERYEEMVDSMKNVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGN+ N K I+ YR KVE EL+ ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEETKGNDVNAKRIKEYRNKVETELTNICNDVMRVIDEHLIPSATAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK   EKK
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGNEKK  145


 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEA +QS+K YE+A  AA  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNEKKEAGDQSMKAYESATTAAEAELPPTHPIRLGLALNFSVFYY  185



>ref|XP_010103033.1| 14-3-3-like protein B [Morus notabilis]
 gb|EXB94631.1| 14-3-3-like protein B [Morus notabilis]
Length=380

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  579  RISKNAKMLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYK  400
            R  K + M S K+REN VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYK
Sbjct  35   RKKKRSAMASTKERENFVYVAKLAEQAERYDEMVDAMKKVAKLDVELTVEERNLLSVGYK  94

Query  399  NVIGARRASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVP  220
            NVIGARRASWRI+SSIEQKEE+KGN+ NVK I+ YR KVE ELSKIC+DI+ +I++HL+P
Sbjct  95   NVIGARRASWRILSSIEQKEEAKGNDQNVKRIKEYRNKVESELSKICSDIMSVIDEHLIP  154

Query  219  SSKSGEATVFFYKMKGDYFRYLAEFKNDQEKK  124
            S  +GE+TVFF+KMKGDY+RYLAEFK    KK
Sbjct  155  SCTAGESTVFFHKMKGDYYRYLAEFKAGHGKK  186


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QS+K YE A   A  ELP THPIRLGLALNFSVFYY
Sbjct  176  LAEFKAGHGKKEAADQSMKAYETASTTAEAELPPTHPIRLGLALNFSVFYY  226



>ref|XP_011074187.1| PREDICTED: 14-3-3 protein 7 isoform X1 [Sesamum indicum]
Length=253

 Score =   230 bits (586),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMV+ MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREQLVYLARLAEQAERYDEMVDAMKKVARLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKG+E NVK I+ YRQ+VEDEL+KIC DIL +I++HL+PSS +GE++VF
Sbjct  62   RILSSIEQKEESKGHEQNVKRIKNYRQRVEDELTKICMDILAVIDEHLLPSSSTGESSVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKK  124
            +YKMKGDY+RYLAEFK   E+K
Sbjct  122  YYKMKGDYYRYLAEFKTGDERK  143


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +K+ A+QSLK YEAA +AA+T+LP THPIRLGLALNFSVFYY
Sbjct  133  LAEFKTGDERKDVADQSLKAYEAATSAASTDLPPTHPIRLGLALNFSVFYY  183



>ref|NP_849698.1| 14-3-3-like protein GF14 epsilon [Arabidopsis thaliana]
 gb|AAF87261.1|AC068562_8 Identical to 14-3-3 protein GF14 epsilon (GRF10) from Arabidopsis 
thaliana gb|AF145302 and contains a 14-3-3 protein PF|00244 
domain. ESTs gb|H37302, gb|T43075, gb|T88323, gb|T41936, 
gb|R87021, gb|N37965, gb|AI994245, gb|Z46557, gb|T20402, gb|T44175, 
gb|T88028 come from this gene [Arabidopsis thaliana]
 gb|AAG50088.1|AF334382_1 putative 14-3-3 protein GF14epsilon [Arabidopsis thaliana]
 dbj|BAH19578.1| AT1G22300 [Arabidopsis thaliana]
 gb|AEE30226.1| 14-3-3-like protein GF14 epsilon [Arabidopsis thaliana]
Length=254

 Score =   230 bits (586),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ENEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGN+ NVK ++ YR++VEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNDENVKRLKNYRKRVEDELAKVCNDILSVIDKHLIPSSNAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKEAA  146


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA   L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAENGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_007048684.1| General regulatory factor 9, MU isoform 1 [Theobroma cacao]
 gb|EOX92841.1| General regulatory factor 9, MU isoform 1 [Theobroma cacao]
Length=339

 Score =   233 bits (593),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERYDEMVE MK +AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKERENFVYVAKLAEQAERYDEMVEAMKNVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKE++KGNE N K I+ YR KVE ELS ICNDI+ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEDAKGNEVNAKRIKEYRHKVESELSSICNDIMTVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVFFYKMK DY+RYLAEFK   EKK   
Sbjct  121  TVFFYKMKADYYRYLAEFKAGNEKKEAA  148


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+ S+K YE A A A  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNEKKEAADHSMKAYETATATAEAELPPTHPIRLGLALNFSVFYY  185



>ref|NP_564167.1| 14-3-3-like protein GF14 epsilon [Arabidopsis thaliana]
 sp|P48347.1|14310_ARATH RecName: Full=14-3-3-like protein GF14 epsilon; AltName: Full=General 
regulatory factor 10 [Arabidopsis thaliana]
 gb|AAD51785.1|AF145302_1 14-3-3 protein GF14 epsilon [Arabidopsis thaliana]
 gb|AAA79699.1| GF14 epsilon isoform [Arabidopsis thaliana]
 gb|AAK96696.1| 14-3-3 protein GF14 epsilon (GRF10) [Arabidopsis thaliana]
 gb|AAL24222.1| At1g22300/T16E15_11 [Arabidopsis thaliana]
 gb|AAL32916.1| Identical to 14-3-3 protein GF14 epsilon (GRF10) [Arabidopsis 
thaliana]
 gb|AAM10236.1| 14-3-3 protein GF14 epsilon [Arabidopsis thaliana]
 gb|AAM65122.1| 14-3-3 protein GF14epsilon (grf10) [Arabidopsis thaliana]
 gb|AEE30225.1| 14-3-3-like protein GF14 epsilon [Arabidopsis thaliana]
Length=254

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ENEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGN+ NVK ++ YR++VEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNDENVKRLKNYRKRVEDELAKVCNDILSVIDKHLIPSSNAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKEAA  146


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA   L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAENGLAPTHPVRLGLALNFSVFYY  183



>gb|KDP32536.1| hypothetical protein JCGZ_14739 [Jatropha curcas]
Length=260

 Score =   223 bits (569),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDR N VY+AKL+EQAERYDEMVE MK++A+LDVELTVEERNLLSVGYKNV+GARR
Sbjct  1    MDSSKDRGNFVYVAKLAEQAERYDEMVESMKKVAELDVELTVEERNLLSVGYKNVVGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE++V+ I+ YR++VE EL+ IC+DI+ I+++HL+PSS   E+
Sbjct  61   ASWRILSSIEQKEESKGNESHVRRIKEYRKRVEAELTNICSDIMRILDEHLIPSSGDVES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
             VF+YKMKGDYFRYLAEF  D EKK   
Sbjct  121  NVFYYKMKGDYFRYLAEFYADTEKKEAA  148


 Score = 71.6 bits (174),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             KKEAA+QSLK Y+ A  AA ++LP THPIRLGLALNFSVFYY
Sbjct  143  EKKEAADQSLKAYQIASTAAESDLPPTHPIRLGLALNFSVFYY  185



>emb|CDP15929.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   230 bits (587),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M + K+REN VY+AKL+EQAERYDEMV+ MK++AK+DVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MAAAKERENFVYVAKLAEQAERYDEMVDAMKKVAKMDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEES+GNE NVK I+ YRQKVE+EL+ IC+DI+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEESRGNEQNVKRIKEYRQKVENELTNICSDIMAVIDEHLIPSCAAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            +VF+YKMKGDY+RYLAEFK   ++K
Sbjct  121  SVFYYKMKGDYYRYLAEFKTGNDRK  145


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KE A+ SLK YEAA +AA + LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNDRKEVADLSLKAYEAATSAAESGLPPTHPIRLGLALNFSVFYY  185



>dbj|BAD12555.1| T(S)14-3-3 protein [Nicotiana tabacum]
Length=238

 Score =   224 bits (572),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  528  VYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASWRIMSSIE  349
            VYLA+L+EQAERYDEMVE MK +AK+DVELTVEERNL+SVGYKNVIGARRASWRI+SSIE
Sbjct  1    VYLARLAEQAERYDEMVEAMKTVAKMDVELTVEERNLVSVGYKNVIGARRASWRILSSIE  60

Query  348  QKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVFFYKMKGD  169
            QKEESKG++ NVK I+ Y+Q+VEDEL+KIC DIL +I++H+VPSS +GE+TVF+YKMKGD
Sbjct  61   QKEESKGHDQNVKRIKTYQQRVEDELTKICIDILSVIDEHVVPSSTTGESTVFYYKMKGD  120

Query  168  YFRYLAEFKNDQEKKRGC  115
            Y+RYLAEFK+  ++K   
Sbjct  121  YYRYLAEFKSGDDRKEAA  138


 Score = 70.5 bits (171),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            +KEAA+QSLK YEAA A A+ +L  THPIRLGLALNFSVFYY
Sbjct  134  RKEAADQSLKAYEAATATASADLAPTHPIRLGLALNFSVFYY  175



>gb|AAM62569.1| 14-3-3-like protein GF14 iota (General regulatory factor 12) 
[Arabidopsis thaliana]
Length=253

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  522  LAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASWRIMSSIEQK  343
            +AKLSEQAERYDEMVE MK++A+++ ELTVEERNLLSVGYKNVIGARRASWRIMSSIEQK
Sbjct  1    MAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRASWRIMSSIEQK  60

Query  342  EESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVFFYKMKGDYF  163
            EESKGNE+NVK I+ YRQKVEDEL+ IC DIL II++HL+P + SGEATVF+YKMKGDY+
Sbjct  61   EESKGNESNVKQIKGYRQKVEDELANICQDILTIIDQHLIPHATSGEATVFYYKMKGDYY  120

Query  162  RYLAEFKNDQEKKRGC  115
            RYLAEFK +QE+K   
Sbjct  121  RYLAEFKTEQERKEAA  136


 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +  + +KEAAEQSLKGYEAA  AA+TELPSTHPIRLGLALNFSVFYY
Sbjct  123  LAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYY  173



>ref|NP_973884.1| 14-3-3-like protein GF14 epsilon [Arabidopsis thaliana]
 gb|AEE30227.1| 14-3-3-like protein GF14 epsilon [Arabidopsis thaliana]
Length=251

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VYLAKLSEQ ERYDEMVE MK++A+LDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ENEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGN+ NVK ++ YR++VEDEL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNDENVKRLKNYRKRVEDELAKVCNDILSVIDKHLIPSSNAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKEAA  146


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA   L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAENGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_009416511.1| PREDICTED: 14-3-3 protein 9-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=263

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+K+REN VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYKNV+GARR
Sbjct  1    MASQKERENFVYIAKLAEQAERYDEMVDAMKKVAKLDVELTVEERNLLSVGYKNVVGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEES+GNE++VK I+ YRQKVE ELS IC DI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEESRGNEHHVKNIKEYRQKVELELSNICTDIVTLIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            +VF+YKMK DY+RYLAEFK   E+K
Sbjct  121  SVFYYKMKADYYRYLAEFKAGNERK  145


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KE AEQSL  Y+AA + A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNERKEVAEQSLTAYQAATSTAEADLAPTHPIRLGLALNFSVFYY  185



>ref|XP_007211873.1| hypothetical protein PRUPE_ppa010158mg [Prunus persica]
 gb|EMJ13072.1| hypothetical protein PRUPE_ppa010158mg [Prunus persica]
Length=261

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -1

Query  543  DRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASWRI  364
            +REN VYLAKLSEQAERYDEMV+ MK++A LDVELTVEERNLLSVGYKNV+G+RRASWRI
Sbjct  6    ERENFVYLAKLSEQAERYDEMVDAMKKVANLDVELTVEERNLLSVGYKNVVGSRRASWRI  65

Query  363  MSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVFFY  184
            +SSIEQKEE+KGNEN+VK ++ YRQKVE ELS IC DI+ +I++HL+PS+  GE+TVF+Y
Sbjct  66   LSSIEQKEEAKGNENHVKQLKEYRQKVESELSTICGDIMTVIDEHLIPSATVGESTVFYY  125

Query  183  KMKGDYFRYLAEFKNDQEKKRGC  115
            KMKGDY+RYLAEFK+  +KK   
Sbjct  126  KMKGDYYRYLAEFKSGDDKKEAA  148


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAAEQS K YE+A  AA  ELP+THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGDDKKEAAEQSKKAYESATIAAEGELPTTHPIRLGLALNFSVFYY  185



>ref|XP_009416512.1| PREDICTED: 14-3-3 protein 9-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=262

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S+K+REN VY+AKL+EQAERYDEMV+ MK++AKLDVELTVEERNLLSVGYKNV+GARR
Sbjct  1    MASQKERENFVYIAKLAEQAERYDEMVDAMKKVAKLDVELTVEERNLLSVGYKNVVGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEES+GNE++VK I+ YRQKVE ELS IC DI+ +I++HL+PSS +GE+
Sbjct  61   ASWRILSSIEQKEESRGNEHHVKNIKEYRQKVELELSNICTDIVTLIDEHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            +VF+YKMK DY+RYLAEFK   E+K
Sbjct  121  SVFYYKMKADYYRYLAEFKAGNERK  145


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KE AEQSL  Y+AA + A  +L  THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNERKEVAEQSLTAYQAATSTAEADLAPTHPIRLGLALNFSVFYY  185



>ref|XP_008228912.1| PREDICTED: 14-3-3-like protein D [Prunus mume]
Length=261

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -1

Query  543  DRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASWRI  364
            +REN VYLAKLSEQAERYDEMV+ MK++A LDVELTVEERNLLSVGYKNV+G+RRASWRI
Sbjct  6    ERENFVYLAKLSEQAERYDEMVDAMKKVANLDVELTVEERNLLSVGYKNVVGSRRASWRI  65

Query  363  MSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVFFY  184
            +SSIEQKEE+KGNEN+VK ++ YRQKVE ELS IC DI+ +I++HL+PS+  GE+TVF+Y
Sbjct  66   LSSIEQKEEAKGNENHVKQLKEYRQKVESELSTICGDIMTVIDEHLIPSATVGESTVFYY  125

Query  183  KMKGDYFRYLAEFKNDQEKKRGC  115
            KMKGDY+RYLAEFK+  +KK   
Sbjct  126  KMKGDYYRYLAEFKSGDDKKEAA  148


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAAEQS K YE+A  AA  ELP+THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGDDKKEAAEQSKKAYESATIAAEGELPTTHPIRLGLALNFSVFYY  185



>gb|AAF27931.1|AF222805_1 14-3-3-like protein [Euphorbia esula]
Length=259

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDRE  VYLAKL+EQAERYDEMVE MK++A LDVELTVEERNLLSVGYKNV+G+RR
Sbjct  1    MDSSKDRETFVYLAKLAEQAERYDEMVESMKKVANLDVELTVEERNLLSVGYKNVVGSRR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE N K I+ YR KVE ELS IC+DI+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEESKGNEINAKRIKEYRNKVESELSTICSDIMTVIDEHLIPSCNAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK   +KK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKAGNDKKEAA  148


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QSLK Y+ A   A T+LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKAGNDKKEAADQSLKAYQTASTTAETDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_006449498.1| hypothetical protein CICLE_v10016334mg [Citrus clementina]
 ref|XP_006449499.1| hypothetical protein CICLE_v10016334mg [Citrus clementina]
 gb|ESR62738.1| hypothetical protein CICLE_v10016334mg [Citrus clementina]
 gb|ESR62739.1| hypothetical protein CICLE_v10016334mg [Citrus clementina]
 gb|KDO77853.1| hypothetical protein CISIN_1g025044mg [Citrus sinensis]
Length=258

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            +KDREN VY+AKL+EQAERYDEMV+ MK++A LDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    DKDRENFVYIAKLAEQAERYDEMVDAMKKVANLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE++GNE NVK I+ YRQKVE ELSKI  DI+++I++HL+PS   GE+TVF
Sbjct  62   RILSSIEQKEEARGNELNVKRIKEYRQKVEAELSKISTDIMQVIDEHLIPSCTGGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKK  124
            +YKMKGDY+RYLAEFK   E+K
Sbjct  122  YYKMKGDYYRYLAEFKTGDERK  143


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +K+ A+ S+K Y+AA   A  EL  THPIRLGLALNFSVFYY
Sbjct  133  LAEFKTGDERKDVADLSMKAYQAASTTAEAELSPTHPIRLGLALNFSVFYY  183



>ref|XP_006467653.1| PREDICTED: 14-3-3-like protein D-like [Citrus sinensis]
Length=258

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            +KDREN VY+AKL+EQAERYDEMV+ MK++A LDVELTVEERNLLSVGYKNVIGARRASW
Sbjct  2    DKDRENFVYIAKLAEQAERYDEMVDAMKKVANLDVELTVEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE++GNE NVK I+ YRQKVE ELSKI  DI+++I++HL+PS   GE+TVF
Sbjct  62   RILSSIEQKEEARGNELNVKRIKEYRQKVEAELSKISTDIMQVIDEHLIPSCTGGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKK  124
            +YKMKGDY+RYLAEFK   E+K
Sbjct  122  YYKMKGDYYRYLAEFKTGDERK  143


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +K+ A+ S+K Y+AA   A  EL  THPIRLGLALNFSVFYY
Sbjct  133  LAEFKTGDERKDVADLSMKAYQAASTTAEAELSPTHPIRLGLALNFSVFYY  183



>dbj|BAF02188.1| hypothetical protein [Arabidopsis thaliana]
Length=252

 Score =   225 bits (573),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +R   VYLAKL+EQAERYDEMVE MK++A LDVELT+EERNLLSVGYKNVIGARRASW
Sbjct  2    ENERAKQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE N K I+ YR KVE+ELSKIC DIL +I+KHLVP + SGE+TVF
Sbjct  62   RILSSIEQKEESKGNEQNAKRIKDYRTKVEEELSKICYDILAVIDKHLVPFATSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKG YFRYLAEFK+  +++   
Sbjct  122  YYKMKGGYFRYLAEFKSGADREEAA  146


 Score = 68.6 bits (166),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            ++EAA+ SLK YEAA ++A+TEL +THPIRLGLALNFSVFYY
Sbjct  142  REEAADLSLKAYEAATSSASTELSTTHPIRLGLALNFSVFYY  183



>gb|AFK39898.1| unknown [Lotus japonicus]
Length=261

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDR   VY+AKL+EQAERY+EMV+ MK++A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKDRGTFVYVAKLAEQAERYEEMVDSMKKVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGN+ N K I+ YRQKVE EL+ ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEETKGNDVNAKRIKEYRQKVESELADICNDVMRVIDEHLIPSATAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RYLAEFK+  EKK   
Sbjct  121  TVFYYKMKGDYYRYLAEFKSGNEKKEAA  148


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEAA+QS+K YE+A  AA  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGNEKKEAADQSMKAYESATTAAEAELPPTHPIRLGLALNFSVFYY  185



>ref|XP_003531255.1| PREDICTED: 14-3-3-like protein C-like isoform X1 [Glycine max]
 ref|XP_006585166.1| PREDICTED: 14-3-3-like protein C-like isoform X2 [Glycine max]
 ref|XP_006585167.1| PREDICTED: 14-3-3-like protein C-like isoform X3 [Glycine max]
 gb|KHN47990.1| 14-3-3-like protein C [Glycine soja]
Length=259

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY AKL+EQAERY+EMVE MK +AKL+VELTVEERNLLSVGYKNV+GARR
Sbjct  1    MASTKERENFVYTAKLAEQAERYEEMVEAMKNVAKLNVELTVEERNLLSVGYKNVVGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGN+ +VK I+ YRQKVE ELS IC+DI+ +I++HL+PSS +GE 
Sbjct  61   ASWRILSSIEQKEEAKGNDVSVKRIKEYRQKVESELSNICSDIMTVIDEHLIPSSSAGEP  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VFFYKMKGDY+RYLAEFK+  E+K   
Sbjct  121  SVFFYKMKGDYYRYLAEFKSGDERKEAA  148


 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+ S+K Y++A   A  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGDERKEAADHSMKAYQSASTTAEAELPPTHPIRLGLALNFSVFYY  185



>gb|AAC15418.1| 14-3-3 protein homolog [Maackia amurensis]
Length=261

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+RE  VY+AKL+EQAERY+EMV+ MK +A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASSKERETFVYVAKLAEQAERYEEMVDSMKNVATLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGNE N K I+ YRQKVE EL+ ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELTNICNDVMRVIDEHLIPSASAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK   EKK
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGNEKK  145


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEA +QS+K YE+A AAA  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNEKKEAGDQSMKAYESATAAAEAELPPTHPIRLGLALNFSVFYY  185



>ref|XP_009103246.1| PREDICTED: 14-3-3-like protein GF14 epsilon [Brassica rapa]
Length=253

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VY AKLSEQ ERYDEMVE MK++A++DVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ESEREKQVYSAKLSEQTERYDEMVEAMKKVAQMDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK I+ YR++VE+EL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRIQTYRKRVEEELAKVCNDILSVIDKHLIPSSTAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKEAA  146


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>emb|CDY46640.1| BnaA07g10560D [Brassica napus]
Length=253

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VY AKLSEQ ERYDEMVE MK++A++DVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ESEREKQVYSAKLSEQTERYDEMVEAMKKVAQMDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK I+ YR++VE+EL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRIQTYRKRVEEELAKVCNDILSVIDKHLIPSSTAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKEAA  146


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_002285427.1| PREDICTED: 14-3-3-like protein D [Vitis vinifera]
Length=254

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  540  RENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASWRIM  361
            REN VY+AKL+EQAERYDEMV+ MK++AKLDV+LTVEERNLLSVGYKNVIGARRASWRI+
Sbjct  3    RENFVYIAKLAEQAERYDEMVDAMKKVAKLDVDLTVEERNLLSVGYKNVIGARRASWRIL  62

Query  360  SSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVFFYK  181
            SSIEQKEE +GNE N K I+ YRQKVE ELS IC+DI+ +I++HL+P+S +GE+TVF+YK
Sbjct  63   SSIEQKEEVRGNEQNAKRIKEYRQKVESELSGICSDIMTVIDEHLIPASTAGESTVFYYK  122

Query  180  MKGDYFRYLAEFKNDQEKKRGC  115
            MKGDY+RYLAEFK   E+K   
Sbjct  123  MKGDYYRYLAEFKTGNERKEAA  144


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK Y+ A   A ++L  THPIRLGLALNFSVFYY
Sbjct  131  LAEFKTGNERKEAADQSLKAYQTASTTAESDLSPTHPIRLGLALNFSVFYY  181



>ref|XP_003629763.1| 14-3-3-like protein gf14-6 [Medicago truncatula]
Length=258

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERY+EMVE MK +AKLDVELTVEERNLLSVGYKNV+GA R
Sbjct  1    MASTKERENFVYIAKLAEQAERYEEMVEAMKNVAKLDVELTVEERNLLSVGYKNVVGAHR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIE KEESKG + NVK I+ YR KVE ELS IC+DI+ II+ HL+PSS +GE+
Sbjct  61   ASWRILSSIEHKEESKGYDVNVKRIKEYRHKVESELSNICSDIMSIIDDHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VFFYKMKGDY+RYLAEFKN  E+K   
Sbjct  121  SVFFYKMKGDYYRYLAEFKNGDERKEAA  148


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+ S++ Y+ A  AA  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKNGDERKEAADHSMEAYQTASTAAEGELPPTHPIRLGLALNFSVFYY  185



>gb|ACU19187.1| unknown [Glycine max]
Length=259

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY AKL+EQAERY+EMVE MK +AKL+VELTVEERNLLSVGYKNV+GARR
Sbjct  1    MASTKERENFVYTAKLAEQAERYEEMVEAMKNVAKLNVELTVEERNLLSVGYKNVVGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGN+ +VK I+ YRQKVE ELS IC+DI+ +I++HL+PSS +GE 
Sbjct  61   ASWRILSSIEQKEEAKGNDVSVKRIKEYRQKVESELSNICSDIMTVIDEHLIPSSSAGEP  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VFFYKMKGDY+RYLAEFK+  E+K   
Sbjct  121  SVFFYKMKGDYYRYLAEFKSGDERKEAA  148


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA++S+K Y++A   A  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKSGDERKEAADRSMKAYQSASTTAEAELPPTHPIRLGLALNFSVFYY  185



>gb|AFK41067.1| unknown [Medicago truncatula]
 gb|AET04239.2| general regulatory factor 2 [Medicago truncatula]
Length=259

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+AKL+EQAERY+EMVE MK +AKLDVELTVEERNLLSVGYKNV+GA R
Sbjct  1    MASTKERENFVYIAKLAEQAERYEEMVEAMKNVAKLDVELTVEERNLLSVGYKNVVGAHR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIE KEESKG + NVK I+ YR KVE ELS IC+DI+ II+ HL+PSS +GE+
Sbjct  61   ASWRILSSIEHKEESKGYDVNVKRIKEYRHKVESELSNICSDIMSIIDDHLIPSSSAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            +VFFYKMKGDY+RYLAEFKN  E+K   
Sbjct  121  SVFFYKMKGDYYRYLAEFKNGDERKEAA  148


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+ S++ Y+ A  AA  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKNGDERKEAADHSMEAYQTASTAAEGELPPTHPIRLGLALNFSVFYY  185



>ref|XP_009349095.1| PREDICTED: 14-3-3-like protein D [Pyrus x bretschneideri]
Length=261

 Score =   228 bits (581),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN+VY AKL+EQAERYDEMVE M ++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASPKERENYVYTAKLAEQAERYDEMVEAMAKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE KGN+ NV  I+ YRQKVE ELS IC+DI+ +I++HL+PS  + E+
Sbjct  61   ASWRILSSIEQKEEGKGNDQNVSRIKEYRQKVESELSSICSDIMRVIDEHLIPSCTAFES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVFFYKMKGDY+RYLAEFK   ++K
Sbjct  121  TVFFYKMKGDYYRYLAEFKTGDDRK  145


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KE A+QS+K Y+AA + A ++LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGDDRKEVADQSMKAYQAASSKAESDLPPTHPIRLGLALNFSVFYY  185



>ref|XP_010686202.1| PREDICTED: 14-3-3-like protein D [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   221 bits (564),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S  DR   VYLAKL+EQAERYDEMV+ MK++A  DV+LTVEERNLLSVGYKNVIGARR
Sbjct  1    MASPNDRYTFVYLAKLAEQAERYDEMVDSMKKLANFDVDLTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGNE NVK IR YR KVE EL+ ICND++++I+ HL+P S S E+
Sbjct  61   ASWRILSSIEQKEESKGNEVNVKRIRDYRHKVESELTDICNDVMKVIDDHLLPFSSSSES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKKRGC  115
            TVF+YKMKGDY+RY+AEFK   E+K   
Sbjct  121  TVFYYKMKGDYYRYIAEFKAGDERKEAA  148


 Score = 71.2 bits (173),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  134  KRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
              +KEAA++SLK YEA  A A  +LPSTH IRLGLALNFSVFYY
Sbjct  142  DERKEAADESLKAYEAGIATAEADLPSTHAIRLGLALNFSVFYY  185



>ref|XP_004162232.1| PREDICTED: 14-3-3 protein 7-like [Cucumis sativus]
 gb|KGN62694.1| hypothetical protein Csa_2G368950 [Cucumis sativus]
Length=250

 Score =   224 bits (570),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE+ VYLA+L+EQAERYDEMVE MK +AKLDVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    EKEREHLVYLARLAEQAERYDEMVEMMKNVAKLDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEE K NE NVK ++ YRQ+VEDEL++IC DIL +++KHL+PSS SGE+ VF
Sbjct  62   RILSSIEQKEEGKKNEVNVKRVKEYRQRVEDELARICRDILTVVDKHLIPSSSSGESNVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            +YKMKGDY RYLAEFK+  E++   
Sbjct  122  YYKMKGDYNRYLAEFKSGPEREEAA  146


 Score = 68.6 bits (166),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            ++EAA+QS+K YE+A + A+++LP THPIRLGLALNFSVFYY
Sbjct  142  REEAADQSMKAYESASSIASSDLPPTHPIRLGLALNFSVFYY  183



>ref|XP_008371470.1| PREDICTED: 14-3-3-like protein D [Malus domestica]
Length=261

 Score =   228 bits (580),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN+VY AKL+EQAERYDEMVE M ++AKLDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASPKERENYVYTAKLAEQAERYDEMVEAMAKVAKLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE KGN+ NV  I+ YRQKVE ELS IC+DI+ +I++HL+PS  + E+
Sbjct  61   ASWRILSSIEQKEEGKGNDQNVSRIKEYRQKVESELSSICSDIMRVIDEHLIPSCTAFES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVFFYKMKGDY+RYLAEFK   ++K
Sbjct  121  TVFFYKMKGDYYRYLAEFKTGDDRK  145


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KE A+QS+K Y+AA + A ++LP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGDDRKEVADQSMKAYQAASSKAESDLPPTHPIRLGLALNFSVFYY  185



>sp|P42654.1|1433B_VICFA RecName: Full=14-3-3-like protein B; AltName: Full=VFA-1433B 
[Vicia faba]
 emb|CAA88416.1| 14-3-3 brain protein homolog [Vicia faba]
Length=261

 Score =   228 bits (580),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDREN VY+AKL+EQAERY+EMV+ MK +A LDVELT+EERNLLSVGYKNVIGARR
Sbjct  1    MASTKDRENFVYIAKLAEQAERYEEMVDSMKNVANLDVELTIEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEESKGN+ N K I+ YR KVE ELS IC D++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEESKGNDVNAKRIKEYRHKVETELSNICIDVMRVIDEHLIPSAAAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK   EKK
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGNEKK  145


 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEA +QS+K YE+A  AA  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNEKKEAGDQSMKAYESATTAAEAELPPTHPIRLGLALNFSVFYY  185



>gb|ACJ85000.1| unknown [Medicago truncatula]
Length=261

 Score =   228 bits (580),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S KDR+N VY+AKL+EQAERY+EMV+ MK +A LDVELTVEERNLLSVGYKNVIGARR
Sbjct  1    MASPKDRKNFVYIAKLAEQAERYEEMVDSMKNVANLDVELTVEERNLLSVGYKNVIGARR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE+KGN+ N K I+ YR KVE EL+ ICND++ +I++HL+PS+ +GE+
Sbjct  61   ASWRILSSIEQKEETKGNDVNAKRIKEYRNKVETELTNICNDVMRVIDEHLIPSATAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK   EKK
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGNEKK  145


 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKEA +QS+K YE+A  AA  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGNEKKEAGDQSMKAYESATTAAEAELPPTHPIRLGLALNFSVFYY  185



>emb|CDY00444.1| BnaC07g13820D [Brassica napus]
Length=253

 Score =   227 bits (578),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            E +RE  VY AKLSEQ ERYDEMVE MK++A++DVELTVEERNL+SVGYKNVIGARRASW
Sbjct  2    ETEREKQVYSAKLSEQTERYDEMVEAMKKVAQMDVELTVEERNLVSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEESKGNE NVK I+ YR++VE+EL+K+CNDIL +I+KHL+PSS + E+TVF
Sbjct  62   RILSSIEQKEESKGNEENVKRIQNYRKRVEEELAKVCNDILSVIDKHLIPSSTAVESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEKKRGC  115
            FYKMKGDY+RYLAEF +  E+K   
Sbjct  122  FYKMKGDYYRYLAEFSSGAERKEAA  146


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  131  RKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
             +KEAA+QSL+ Y+AA AAA T L  THP+RLGLALNFSVFYY
Sbjct  141  ERKEAADQSLEAYKAAVAAAETGLAPTHPVRLGLALNFSVFYY  183



>ref|XP_006350030.1| PREDICTED: 14-3-3 protein 8-like isoform X2 [Solanum tuberosum]
Length=258

 Score =   227 bits (579),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+A+L+EQAERYDEMV+ MK +A LDVELTVEERNLLSVGYKNV+G+RR
Sbjct  1    MASSKERENLVYIARLAEQAERYDEMVDAMKNVANLDVELTVEERNLLSVGYKNVVGSRR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE +GNE NVK I+ YRQKVE EL+ ICN+I+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEEGRGNEQNVKRIQNYRQKVESELTDICNNIMTVIDEHLIPSCTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK   +KK
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGDDKK  145


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKE ++ SLK Y+ A   A  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGDDKKEVSDLSLKAYQTATTTAEAELPITHPIRLGLALNFSVFYY  185



>emb|CBI20197.3| unnamed protein product [Vitis vinifera]
Length=290

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  540  RENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASWRIM  361
            REN VY+AKL+EQAERYDEMV+ MK++AKLDV+LTVEERNLLSVGYKNVIGARRASWRI+
Sbjct  3    RENFVYIAKLAEQAERYDEMVDAMKKVAKLDVDLTVEERNLLSVGYKNVIGARRASWRIL  62

Query  360  SSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVFFYK  181
            SSIEQKEE +GNE N K I+ YRQKVE ELS IC+DI+ +I++HL+P+S +GE+TVF+YK
Sbjct  63   SSIEQKEEVRGNEQNAKRIKEYRQKVESELSGICSDIMTVIDEHLIPASTAGESTVFYYK  122

Query  180  MKGDYFRYLAEFKNDQEKKRGC  115
            MKGDY+RYLAEFK   E+K   
Sbjct  123  MKGDYYRYLAEFKTGNERKEAA  144


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    +KEAA+QSLK Y+ A   A ++L  THPIRLGLALNFSVFYY
Sbjct  131  LAEFKTGNERKEAADQSLKAYQTASTTAESDLSPTHPIRLGLALNFSVFYY  181



>gb|KFK23383.1| hypothetical protein AALP_AAs59400U000500 [Arabis alpina]
Length=252

 Score =   223 bits (569),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  549  EKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARRASW  370
            EK+RE  VYLA+L+EQAERYDEMVE MK++A LDVELT++ERNLLSVGYKNVIGARRASW
Sbjct  2    EKEREKLVYLARLNEQAERYDEMVEAMKKVAALDVELTIDERNLLSVGYKNVIGARRASW  61

Query  369  RIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEATVF  190
            RI+SSIEQKEES+GNE NVK I+ YR KVE ELSKIC DIL +I+K+LVPS+ SGE+TVF
Sbjct  62   RILSSIEQKEESRGNEQNVKRIKDYRTKVEVELSKICYDILAVIDKNLVPSATSGESTVF  121

Query  189  FYKMKGDYFRYLAEFKNDQEK  127
            +YKMKGDY RYLAEFK+  ++
Sbjct  122  YYKMKGDYLRYLAEFKSGADR  142


 Score = 68.2 bits (165),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  128  KKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            + EAA+QSLK Y+AA   A+TEL  THPIRLGLALNFSVFYY
Sbjct  142  RDEAADQSLKAYQAATTTASTELGPTHPIRLGLALNFSVFYY  183



>ref|XP_006350029.1| PREDICTED: 14-3-3 protein 8-like isoform X1 [Solanum tuberosum]
Length=259

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  558  MLSEKDRENHVYLAKLSEQAERYDEMVERMKQIAKLDVELTVEERNLLSVGYKNVIGARR  379
            M S K+REN VY+A+L+EQAERYDEMV+ MK +A LDVELTVEERNLLSVGYKNV+G+RR
Sbjct  1    MASSKERENLVYIARLAEQAERYDEMVDAMKNVANLDVELTVEERNLLSVGYKNVVGSRR  60

Query  378  ASWRIMSSIEQKEESKGNENNVKLIRAYRQKVEDELSKICNDILEIIEKHLVPSSKSGEA  199
            ASWRI+SSIEQKEE +GNE NVK I+ YRQKVE EL+ ICN+I+ +I++HL+PS  +GE+
Sbjct  61   ASWRILSSIEQKEEGRGNEQNVKRIQNYRQKVESELTDICNNIMTVIDEHLIPSCTAGES  120

Query  198  TVFFYKMKGDYFRYLAEFKNDQEKK  124
            TVF+YKMKGDY+RYLAEFK   +KK
Sbjct  121  TVFYYKMKGDYYRYLAEFKTGDDKK  145


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  155  LLSLRMTKRKKEAAEQSLKGYEAAFAAANTELPSTHPIRLGLALNFSVFYY  3
            L   +    KKE ++ SLK Y+ A   A  ELP THPIRLGLALNFSVFYY
Sbjct  135  LAEFKTGDDKKEVSDLSLKAYQTATTTAEAELPITHPIRLGLALNFSVFYY  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401487976976