BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20096_g1_i8 len=1487 path=[6822:0-943 7765:944-1035 580:1036-1486]

Length=1487
                                                                      Score     E

ref|XP_009790978.1|  PREDICTED: uncharacterized protein LOC104238346    523   0.0      
ref|XP_009593763.1|  PREDICTED: uncharacterized protein LOC104090392    515   7e-178   
gb|EYU37338.1|  hypothetical protein MIMGU_mgv1a009617mg                508   3e-175   
ref|XP_006348890.1|  PREDICTED: uncharacterized protein LOC102578540    508   6e-175   
ref|XP_004243271.1|  PREDICTED: uncharacterized protein LOC101268200    507   1e-174   
ref|XP_011082983.1|  PREDICTED: uncharacterized protein LOC105165614    506   3e-174   
gb|AFK46755.1|  unknown                                                 486   2e-166   
ref|XP_004303199.1|  PREDICTED: uncharacterized protein LOC101312845    483   2e-165   
ref|XP_002281976.1|  PREDICTED: uncharacterized protein LOC100260760    481   1e-164   Vitis vinifera
ref|XP_010035876.1|  PREDICTED: uncharacterized protein LOC104425012    478   4e-163   
ref|XP_007048743.1|  DNAJ heat shock N-terminal domain-containing...    476   2e-162   
gb|KHN36707.1|  Chaperone protein DnaJ                                  475   4e-162   
gb|KHG26066.1|  Chaperone DnaJ                                          474   8e-162   
ref|XP_003539555.1|  PREDICTED: uncharacterized protein LOC100786494    473   3e-161   
ref|NP_001242058.1|  uncharacterized protein LOC100809007               472   8e-161   
ref|XP_010554518.1|  PREDICTED: uncharacterized protein LOC104824189    471   9e-161   
ref|XP_007048742.1|  DNAJ heat shock N-terminal domain-containing...    471   1e-160   
gb|KHN27954.1|  Chaperone protein DnaJ                                  470   3e-160   
ref|XP_007149726.1|  hypothetical protein PHAVU_005G094000g             470   4e-160   
ref|XP_010246441.1|  PREDICTED: uncharacterized protein LOC104589728    468   2e-159   
emb|CDP15953.1|  unnamed protein product                                468   4e-159   
ref|XP_007132823.1|  hypothetical protein PHAVU_011G127500g             466   2e-158   
gb|EPS63040.1|  hypothetical protein M569_11748                         465   3e-158   
ref|XP_006468985.1|  PREDICTED: uncharacterized protein LOC102624...    464   7e-158   
ref|XP_002880004.1|  DNAJ heat shock N-terminal domain-containing...    462   3e-157   
gb|KDO63412.1|  hypothetical protein CISIN_1g019284mg                   462   4e-157   
ref|XP_006294528.1|  hypothetical protein CARUB_v10023558mg             462   6e-157   
ref|XP_006446824.1|  hypothetical protein CICLE_v10017707mg             461   1e-156   
ref|XP_006468984.1|  PREDICTED: uncharacterized protein LOC102624...    459   7e-156   
ref|NP_565982.1|  DNAJ heat shock N-terminal domain-containing pr...    459   7e-156   Arabidopsis thaliana [mouse-ear cress]
gb|KDO63411.1|  hypothetical protein CISIN_1g019284mg                   458   2e-155   
ref|XP_006411543.1|  hypothetical protein EUTSA_v10016894mg             457   4e-155   
emb|CDY50820.1|  BnaC04g52570D                                          457   5e-155   
ref|XP_003596710.1|  Chaperone protein dnaJ                             457   6e-155   
ref|XP_004150330.1|  PREDICTED: uncharacterized protein LOC101218014    456   8e-155   
ref|XP_010506113.1|  PREDICTED: uncharacterized protein LOC104782...    456   1e-154   
ref|XP_011033756.1|  PREDICTED: uncharacterized protein LOC105132130    456   1e-154   
ref|XP_010508533.1|  PREDICTED: uncharacterized protein LOC104785091    456   2e-154   
ref|XP_010102119.1|  DnaJ homolog subfamily A member 3                  456   2e-154   
ref|XP_008451842.1|  PREDICTED: uncharacterized protein LOC103493004    454   4e-154   
ref|XP_010517816.1|  PREDICTED: uncharacterized protein LOC104793202    455   4e-154   
ref|XP_002320418.2|  hypothetical protein POPTR_0014s14030g             456   6e-154   Populus trichocarpa [western balsam poplar]
gb|KDO63413.1|  hypothetical protein CISIN_1g019284mg                   453   1e-153   
ref|XP_004505462.1|  PREDICTED: chaperone protein DnaJ-like isofo...    451   1e-152   
ref|XP_003540004.1|  PREDICTED: uncharacterized protein LOC100812547    450   2e-152   
ref|XP_002530203.1|  expressed protein, putative                        449   5e-152   Ricinus communis
ref|XP_006375498.1|  hypothetical protein POPTR_0014s14030g             450   2e-151   
ref|XP_010274415.1|  PREDICTED: uncharacterized protein LOC104609738    447   2e-151   
ref|XP_009142878.1|  PREDICTED: uncharacterized protein LOC103866667    446   9e-151   
ref|XP_003527333.1|  PREDICTED: protein CAJ1-like isoform X1            445   2e-150   
gb|KHN33936.1|  Protein CAJ1                                            445   2e-150   
gb|KFK37121.1|  hypothetical protein AALP_AA4G215500                    445   3e-150   
ref|XP_010924729.1|  PREDICTED: uncharacterized protein LOC105047489    439   6e-148   
ref|XP_006830213.1|  hypothetical protein AMTR_s00130p00027180          438   1e-147   
gb|KDP25749.1|  hypothetical protein JCGZ_23709                         437   1e-147   
ref|XP_010689743.1|  PREDICTED: protein CAJ1                            436   1e-146   
ref|XP_008792330.1|  PREDICTED: uncharacterized protein LOC103708976    435   2e-146   
ref|XP_007215649.1|  hypothetical protein PRUPE_ppa008260mg             435   2e-146   
ref|XP_006294527.1|  hypothetical protein CARUB_v10023558mg             432   1e-145   
ref|XP_004505463.1|  PREDICTED: chaperone protein DnaJ-like isofo...    431   3e-145   
ref|XP_003607622.1|  Chaperone protein dnaJ                             431   6e-145   
ref|XP_010506112.1|  PREDICTED: uncharacterized protein LOC104782...    432   7e-145   
ref|XP_008343086.1|  PREDICTED: uncharacterized protein LOC103405851    423   1e-141   
ref|XP_009416422.1|  PREDICTED: uncharacterized protein LOC103997025    421   5e-141   
ref|XP_009378942.1|  PREDICTED: zuotin-like                             418   1e-139   
ref|XP_006582275.1|  PREDICTED: protein CAJ1-like isoform X2            406   1e-135   
gb|KDO63414.1|  hypothetical protein CISIN_1g019284mg                   403   5e-135   
ref|XP_002441427.1|  hypothetical protein SORBIDRAFT_09g026410          405   1e-134   Sorghum bicolor [broomcorn]
ref|NP_001131992.1|  uncharacterized protein LOC100193395               404   3e-134   Zea mays [maize]
ref|NP_001044143.1|  Os01g0730500                                       403   6e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004961418.1|  PREDICTED: uncharacterized protein LOC101786...    402   1e-133   
ref|XP_007048744.1|  DNAJ heat shock N-terminal domain-containing...    399   3e-133   
ref|XP_004961417.1|  PREDICTED: uncharacterized protein LOC101786...    401   5e-133   
ref|XP_002456291.1|  hypothetical protein SORBIDRAFT_03g033600          400   1e-132   Sorghum bicolor [broomcorn]
gb|ACF83085.1|  unknown                                                 397   3e-131   Zea mays [maize]
ref|XP_003569728.1|  PREDICTED: uncharacterized protein LOC100837569    395   5e-131   
ref|XP_008647783.1|  PREDICTED: LOC100280972 isoform X1                 395   7e-131   
gb|EEC79572.1|  hypothetical protein OsI_20727                          395   1e-130   Oryza sativa Indica Group [Indian rice]
ref|XP_009406776.1|  PREDICTED: uncharacterized protein LOC103989609    395   1e-130   
ref|NP_001056124.1|  Os05g0529700                                       395   1e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006375497.1|  hypothetical protein POPTR_0014s14030g             395   1e-130   
dbj|BAJ99619.1|  predicted protein                                      394   2e-130   
emb|CDM84083.1|  unnamed protein product                                393   5e-130   
gb|KEH38856.1|  DnaJ heat shock amino-terminal domain protein           389   3e-129   
ref|XP_004969835.1|  PREDICTED: uncharacterized protein LOC101760028    391   4e-129   
ref|NP_001147364.1|  LOC100280972                                       390   5e-129   Zea mays [maize]
ref|XP_008228978.1|  PREDICTED: dnaJ homolog subfamily C member 4       387   7e-128   
ref|XP_006644659.1|  PREDICTED: zuotin-like                             387   1e-127   
ref|XP_006654690.1|  PREDICTED: uncharacterized protein LOC102717898    387   2e-127   
ref|XP_003568045.1|  PREDICTED: uncharacterized protein LOC100841326    385   9e-127   
ref|XP_004487580.1|  PREDICTED: protein CAJ1-like                       380   3e-125   
gb|AFK44747.1|  unknown                                                 377   3e-125   
ref|XP_006375496.1|  hypothetical protein POPTR_0014s14030g             373   3e-122   
gb|ABK23437.1|  unknown                                                 362   2e-117   Picea sitchensis
gb|EMT05309.1|  Chaperone protein dnaJ                                  360   1e-116   
dbj|BAJ95859.1|  predicted protein                                      357   5e-116   
gb|EMS48052.1|  Chaperone protein DnaJ                                  341   1e-110   
emb|CDX79847.1|  BnaA05g03090D                                          329   2e-106   
ref|XP_001755559.1|  predicted protein                                  327   2e-105   
gb|AAS72346.1|  unknown protein                                         328   4e-105   Oryza sativa Japonica Group [Japonica rice]
gb|ABK21719.1|  unknown                                                 328   1e-104   Picea sitchensis
tpg|DAA57778.1|  TPA: hypothetical protein ZEAMMB73_852744              317   1e-101   
gb|EMT21641.1|  Chaperone protein dnaJ 10                               309   6e-98    
ref|XP_001760033.1|  predicted protein                                  296   4e-94    
ref|XP_006375495.1|  hypothetical protein POPTR_0014s14030g             282   4e-88    
gb|EMS60360.1|  Protein tumorous imaginal discs, mitochondrial          279   4e-86    
ref|XP_002993146.1|  hypothetical protein SELMODRAFT_136585             275   5e-86    
ref|XP_002994240.1|  hypothetical protein SELMODRAFT_138386             274   7e-86    
gb|ADK60794.1|  unknown                                                 226   6e-68    
ref|XP_005650033.1|  DnaJ-domain-containing protein                     230   7e-68    
ref|XP_008653859.1|  PREDICTED: protein tumorous imaginal discs, ...    223   6e-66    
gb|ACV53168.1|  chloroplast DnaJ-like protein 3                         229   7e-66    Chlamydomonas reinhardtii
ref|XP_008381239.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    233   1e-64    
ref|XP_001700257.1|  chloroplast DnaJ-like protein                      218   1e-62    Chlamydomonas reinhardtii
gb|AFK34524.1|  unknown                                                 206   4e-60    
ref|XP_005847377.1|  hypothetical protein CHLNCDRAFT_134196             210   1e-59    
ref|XP_003599734.1|  Chaperone protein dnaJ                             201   3e-58    
gb|ACV53169.1|  chloroplast DnaJ-like protein 4                         183   6e-49    Chlamydomonas reinhardtii
ref|XP_002958604.1|  molecular chaperone                                181   3e-47    
emb|CEF96548.1|  3Fe-4S ferredoxin                                      161   5e-41    
ref|XP_001699768.1|  chloroplast DnaJ-like protein                      152   7e-38    Chlamydomonas reinhardtii
ref|XP_002951411.1|  molecular chaperone                                150   5e-37    
gb|KFM23764.1|  Chaperone protein DnaJ                                  139   2e-35    
ref|XP_001700843.1|  chloroplast DnaJ-like protein                      142   5e-34    Chlamydomonas reinhardtii
gb|KFM23765.1|  Putative tartrate transporter                           143   3e-33    
ref|XP_007510483.1|  predicted protein                                  134   5e-31    
gb|ABR17365.1|  unknown                                                 128   5e-30    Picea sitchensis
gb|ABK24669.1|  unknown                                                 130   2e-29    Picea sitchensis
ref|XP_005648299.1|  hypothetical protein COCSUDRAFT_41909              127   3e-29    
ref|XP_002506005.1|  predicted protein                                  124   1e-27    Micromonas commoda
ref|XP_010067007.1|  PREDICTED: uncharacterized protein LOC104454...    124   2e-27    
ref|XP_010067006.1|  PREDICTED: uncharacterized protein LOC104454...    124   2e-27    
gb|KDP42595.1|  hypothetical protein JCGZ_24369                         123   3e-27    
ref|XP_004297730.1|  PREDICTED: uncharacterized protein LOC101312533    123   5e-27    
gb|ABD93569.1|  chloroplast heat shock protein-binding protein          112   7e-27    Coffea canephora [robusta coffee]
ref|XP_003074178.1|  DNAJ heat shock N-terminal domain-containing...    122   8e-27    
ref|XP_006847860.1|  hypothetical protein AMTR_s00029p00078660          122   9e-27    
gb|EYU45092.1|  hypothetical protein MIMGU_mgv1a005727mg                121   1e-26    
gb|ABD93570.1|  chloroplast heat shock protein-binding protein          112   1e-26    Lactuca sativa [cultivated lettuce]
ref|XP_010250129.1|  PREDICTED: uncharacterized protein LOC104592448    121   1e-26    
ref|XP_008445880.1|  PREDICTED: uncharacterized protein LOC103488766    120   2e-26    
ref|XP_010546245.1|  PREDICTED: uncharacterized protein LOC104818375    120   2e-26    
ref|XP_002972990.1|  hypothetical protein SELMODRAFT_413357             120   2e-26    
ref|XP_004143617.1|  PREDICTED: uncharacterized protein LOC101205271    120   2e-26    
ref|XP_004165266.1|  PREDICTED: uncharacterized protein LOC101229316    120   2e-26    
gb|KGN50447.1|  hypothetical protein Csa_5G175710                       120   3e-26    
gb|ABD93564.1|  chloroplast heat shock protein-binding protein          110   6e-26    Solanum tuberosum [potatoes]
emb|CAN73797.1|  hypothetical protein VITISV_018825                     119   6e-26    Vitis vinifera
ref|XP_002984459.1|  hypothetical protein SELMODRAFT_423510             120   8e-26    
ref|NP_197715.1|  DNAJ heat shock N-terminal domain-containing pr...    119   9e-26    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002272283.1|  PREDICTED: uncharacterized protein LOC100247733    119   1e-25    Vitis vinifera
ref|XP_010421122.1|  PREDICTED: uncharacterized protein LOC104706624    118   1e-25    
ref|XP_006286752.1|  hypothetical protein CARUB_v10003126mg             118   1e-25    
emb|CBI29047.3|  unnamed protein product                                119   1e-25    
ref|XP_008811242.1|  PREDICTED: uncharacterized protein LOC103722452    118   2e-25    
ref|XP_007043272.1|  DNAJ heat shock N-terminal domain-containing...    118   2e-25    
gb|ABD93568.1|  chloroplast heat shock protein-binding protein          108   2e-25    Capsicum annuum
ref|XP_008221070.1|  PREDICTED: uncharacterized protein LOC103321089    118   3e-25    
ref|XP_002310648.2|  hypothetical protein POPTR_0007s07670g             117   4e-25    Populus trichocarpa [western balsam poplar]
ref|XP_008366971.1|  PREDICTED: uncharacterized protein LOC103430601    117   4e-25    
ref|XP_008350811.1|  PREDICTED: uncharacterized protein LOC103414182    117   4e-25    
emb|CAJ86103.1|  H0103C06.7                                             117   5e-25    Oryza sativa [red rice]
ref|XP_011002243.1|  PREDICTED: uncharacterized protein LOC105109291    116   6e-25    
ref|XP_009602427.1|  PREDICTED: uncharacterized protein LOC104097550    116   6e-25    
ref|XP_010493438.1|  PREDICTED: uncharacterized protein LOC104770...    116   7e-25    
ref|XP_007222154.1|  hypothetical protein PRUPE_ppa005756mg             115   8e-25    
ref|XP_006484525.1|  PREDICTED: uncharacterized protein LOC102629406    115   8e-25    
ref|XP_010493439.1|  PREDICTED: uncharacterized protein LOC104770...    116   8e-25    
emb|CDY02215.1|  BnaA03g39520D                                          116   8e-25    
ref|XP_010454604.1|  PREDICTED: uncharacterized protein LOC104736336    115   1e-24    
ref|XP_006437599.1|  hypothetical protein CICLE_v10031498mg             115   1e-24    
ref|XP_010940344.1|  PREDICTED: uncharacterized protein LOC105058955    115   1e-24    
ref|NP_001054247.1|  Os04g0675400                                       115   1e-24    Oryza sativa Japonica Group [Japonica rice]
gb|KFK27645.1|  hypothetical protein AALP_AA8G410200                    115   2e-24    
ref|XP_006394593.1|  hypothetical protein EUTSA_v10005272mg             115   2e-24    
ref|XP_003556599.2|  PREDICTED: uncharacterized protein LOC100785995    115   3e-24    
gb|KHN07249.1|  Chaperone protein dnaJ 20, chloroplastic                115   3e-24    
ref|XP_010688676.1|  PREDICTED: uncharacterized protein LOC104902564    114   3e-24    
gb|KHM99065.1|  Chaperone protein dnaJ 20, chloroplastic                114   3e-24    
ref|XP_009779297.1|  PREDICTED: uncharacterized protein LOC104228512    114   4e-24    
emb|CDY61909.1|  BnaC07g49690D                                          114   4e-24    
gb|EYU44777.1|  hypothetical protein MIMGU_mgv1a011175mg                111   5e-24    
ref|XP_009136377.1|  PREDICTED: uncharacterized protein LOC103860517    114   5e-24    
ref|XP_003589717.1|  Chaperone protein dnaJ                             114   5e-24    
ref|XP_004498122.1|  PREDICTED: uncharacterized protein LOC101499169    114   5e-24    
ref|XP_003528458.2|  PREDICTED: uncharacterized protein LOC100812414    114   6e-24    
ref|XP_002874118.1|  DNAJ heat shock N-terminal domain-containing...    113   7e-24    
ref|XP_011083757.1|  PREDICTED: uncharacterized protein LOC105166195    113   9e-24    
ref|XP_002961980.1|  hypothetical protein SELMODRAFT_403442             112   1e-23    
ref|XP_001781183.1|  predicted protein                                  113   1e-23    
ref|XP_002971106.1|  hypothetical protein SELMODRAFT_147630             112   1e-23    
ref|XP_009385991.1|  PREDICTED: uncharacterized protein LOC103973215    112   2e-23    
emb|CDP14399.1|  unnamed protein product                                112   2e-23    
dbj|BAJ89861.1|  predicted protein                                      112   3e-23    
ref|XP_002456296.1|  hypothetical protein SORBIDRAFT_03g033630          103   5e-23    Sorghum bicolor [broomcorn]
ref|XP_007153072.1|  hypothetical protein PHAVU_003G004300g             111   7e-23    
ref|XP_004231500.1|  PREDICTED: uncharacterized protein LOC101265380    110   1e-22    
gb|KHN29584.1|  Chaperone protein dnaJ 20, chloroplastic                110   1e-22    
gb|EPS72837.1|  hypothetical protein M569_01924                         109   1e-22    
ref|XP_001762380.1|  predicted protein                                  109   1e-22    
emb|CBG76273.1|  OO_Ba0005L10-OO_Ba0081K17.24                           112   1e-22    Oryza officinalis
ref|XP_003534680.2|  PREDICTED: uncharacterized protein LOC100783616    110   1e-22    
gb|AFW78770.1|  hypothetical protein ZEAMMB73_356788                    103   2e-22    
ref|XP_006350359.1|  PREDICTED: uncharacterized protein LOC102586830    108   3e-22    
ref|XP_004960085.1|  PREDICTED: uncharacterized protein LOC101773612    108   3e-22    
ref|XP_009393615.1|  PREDICTED: uncharacterized protein LOC103979262    106   5e-22    
ref|XP_011098439.1|  PREDICTED: uncharacterized protein LOC105177106    105   8e-22    
dbj|BAJ88021.1|  predicted protein                                      104   1e-21    
gb|ACR35926.1|  unknown                                                 106   2e-21    Zea mays [maize]
ref|NP_001148244.1|  dnaJ domain containing protein                     106   2e-21    Zea mays [maize]
ref|XP_002447316.1|  hypothetical protein SORBIDRAFT_06g032790          106   3e-21    Sorghum bicolor [broomcorn]
ref|XP_004306359.1|  PREDICTED: uncharacterized protein LOC101298739    102   6e-21    
ref|NP_001150750.1|  3Fe-4S ferredoxin                                  102   6e-21    Zea mays [maize]
ref|XP_005643297.1|  Six-hairpin glycosidase                            106   7e-21    
gb|ABR17679.1|  unknown                                                 104   8e-21    Picea sitchensis
ref|XP_007031547.1|  DNAJ heat shock N-terminal domain-containing...    102   1e-20    
gb|ABD93567.1|  chloroplast heat shock protein-binding protein        95.5    2e-20    Helianthus annuus
ref|XP_010240605.1|  PREDICTED: uncharacterized protein LOC100821370    104   2e-20    
ref|XP_001415419.1|  predicted protein                                98.2    3e-20    Ostreococcus lucimarinus CCE9901
ref|XP_009802151.1|  PREDICTED: uncharacterized protein LOC104247753    100   3e-20    
ref|XP_010251143.1|  PREDICTED: uncharacterized protein LOC104593132    100   4e-20    
ref|XP_003634709.1|  PREDICTED: uncharacterized protein LOC100854700    100   4e-20    
ref|XP_004965401.1|  PREDICTED: uncharacterized protein LOC101776...    100   5e-20    
ref|XP_004965402.1|  PREDICTED: uncharacterized protein LOC101776...    100   5e-20    
ref|XP_010112538.1|  Chaperone protein DnaJ                             102   9e-20    
ref|XP_008341430.1|  PREDICTED: uncharacterized protein LOC103404...  99.4    1e-19    
ref|XP_008230562.1|  PREDICTED: uncharacterized protein LOC103329820  99.4    1e-19    
ref|XP_002298530.2|  hypothetical protein POPTR_0001s35100g           99.0    1e-19    Populus trichocarpa [western balsam poplar]
ref|XP_008341428.1|  PREDICTED: uncharacterized protein LOC103404...  98.6    2e-19    
ref|XP_006656965.1|  PREDICTED: uncharacterized protein LOC102699516  97.8    3e-19    
ref|XP_004142792.1|  PREDICTED: uncharacterized protein LOC101222804  97.8    3e-19    
gb|AFK44586.1|  unknown                                               97.4    5e-19    
gb|KHG00215.1|  Chaperone DnaJ                                        97.1    5e-19    
ref|XP_011047334.1|  PREDICTED: uncharacterized protein LOC105141...  97.1    6e-19    
ref|XP_011047333.1|  PREDICTED: uncharacterized protein LOC105141...  97.1    6e-19    
ref|XP_008368418.1|  PREDICTED: uncharacterized protein LOC103432...  97.1    6e-19    
ref|XP_010033304.1|  PREDICTED: uncharacterized protein LOC104422...  97.1    7e-19    
ref|XP_010033306.1|  PREDICTED: uncharacterized protein LOC104422...  97.1    7e-19    
ref|XP_009377190.1|  PREDICTED: uncharacterized protein LOC103965...  96.7    8e-19    
ref|XP_009377189.1|  PREDICTED: uncharacterized protein LOC103965...  96.7    8e-19    
ref|WP_007306952.1|  ferredoxin                                       93.2    9e-19    
gb|KDP45321.1|  hypothetical protein JCGZ_09570                       96.3    9e-19    
ref|XP_008368417.1|  PREDICTED: uncharacterized protein LOC103432...  96.7    9e-19    
ref|WP_017300659.1|  hypothetical protein                             93.6    1e-18    
gb|EEC80606.1|  hypothetical protein OsI_22964                        96.7    2e-18    Oryza sativa Indica Group [Indian rice]
emb|CDP02083.1|  unnamed protein product                              95.1    2e-18    
ref|XP_008666436.1|  PREDICTED: uncharacterized protein LOC103645090  93.6    2e-18    
ref|WP_015223402.1|  ferredoxin                                       92.0    2e-18    
ref|WP_017288848.1|  hypothetical protein                             92.8    2e-18    
ref|WP_010873983.1|  ferredoxin                                       92.0    2e-18    
ref|WP_012595207.1|  ferredoxin                                       92.0    2e-18    
ref|XP_002524662.1|  heat shock protein binding protein, putative     95.1    3e-18    Ricinus communis
ref|XP_003553824.2|  PREDICTED: uncharacterized protein LOC100776887  95.1    3e-18    
ref|XP_008458791.1|  PREDICTED: uncharacterized protein LOC103498...  95.5    3e-18    
ref|WP_009545187.1|  MULTISPECIES: ferredoxin                         91.7    3e-18    
gb|EMT08869.1|  Alpha-glucan water dikinase, chloroplastic            98.6    3e-18    
ref|XP_006446559.1|  hypothetical protein CICLE_v10016190mg           94.4    4e-18    
ref|WP_015164053.1|  ferredoxin-like protein                          91.7    4e-18    
ref|WP_015180920.1|  ferredoxin                                       91.7    4e-18    
gb|EKQ67631.1|  ferredoxin                                            91.7    5e-18    
ref|XP_002438418.1|  hypothetical protein SORBIDRAFT_10g017810        94.4    6e-18    Sorghum bicolor [broomcorn]
ref|WP_015186840.1|  ferredoxin                                       91.3    6e-18    
ref|WP_011244652.1|  ferredoxin                                       90.5    6e-18    
ref|WP_008275393.1|  ferredoxin                                       90.9    6e-18    
ref|XP_006470274.1|  PREDICTED: uncharacterized protein LOC102626758  94.0    6e-18    
gb|KDO55193.1|  hypothetical protein CISIN_1g022195mg                 94.0    6e-18    
ref|WP_015221117.1|  ferredoxin                                       90.9    7e-18    
ref|XP_002964161.1|  hypothetical protein SELMODRAFT_29878            88.2    7e-18    
gb|KDO55192.1|  hypothetical protein CISIN_1g022195mg                 93.6    7e-18    
gb|AIE72867.1|  Ferredoxin                                            90.5    7e-18    
ref|XP_008458792.1|  PREDICTED: uncharacterized protein LOC103498...  94.4    9e-18    
ref|WP_015144699.1|  ferredoxin                                       90.5    9e-18    
ref|WP_035986009.1|  ferredoxin                                       90.5    1e-17    
ref|XP_008458794.1|  PREDICTED: uncharacterized J domain-containi...  92.4    1e-17    
ref|WP_015783886.1|  ferredoxin                                       89.7    1e-17    
ref|WP_036617387.1|  ferredoxin                                       90.1    2e-17    
gb|KDO52726.1|  hypothetical protein CISIN_1g012925mg                 94.7    2e-17    
ref|WP_038084516.1|  ferredoxin                                       89.7    2e-17    
ref|WP_012598242.1|  ferredoxin                                       89.7    2e-17    
ref|WP_035154069.1|  ferredoxin                                       89.4    3e-17    
ref|WP_013325053.1|  ferredoxin                                       89.4    3e-17    
ref|WP_036001568.1|  ferredoxin                                       89.4    3e-17    
ref|WP_015147072.1|  ferredoxin                                       89.0    4e-17    
ref|WP_027400745.1|  ferredoxin                                       89.0    4e-17    
ref|WP_015192929.1|  ferredoxin                                       88.6    4e-17    
ref|WP_017294437.1|  hypothetical protein                             88.6    4e-17    
ref|WP_007356518.1|  MULTISPECIES: ferredoxin                         89.0    5e-17    
ref|WP_017742961.1|  ferredoxin                                       88.6    5e-17    
ref|WP_011612138.1|  ferredoxin                                       88.6    6e-17    
ref|WP_015111139.1|  ferredoxin                                       88.6    6e-17    
ref|WP_006197893.1|  ferredoxin                                       88.6    6e-17    
ref|WP_012162276.1|  ferredoxin                                       89.0    6e-17    
ref|WP_010477857.1|  ferredoxin                                       88.6    6e-17    
ref|WP_015154471.1|  ferredoxin                                       88.2    6e-17    
ref|XP_003058569.1|  hypothetical protein MICPUCDRAFT_70264           93.6    6e-17    
ref|WP_039716583.1|  ferredoxin                                       88.2    6e-17    
ref|WP_015170464.1|  hypothetical protein                             88.2    7e-17    
ref|WP_017305157.1|  hypothetical protein                             87.8    8e-17    
ref|WP_015124555.1|  ferredoxin                                       86.7    1e-16    
ref|XP_002955370.1|  hypothetical protein VOLCADRAFT_37192            85.1    1e-16    
ref|WP_017718566.1|  ferredoxin                                       87.4    1e-16    
ref|XP_003057141.1|  predicted protein                                85.5    1e-16    
ref|WP_009149209.1|  ferredoxin                                       87.4    1e-16    
ref|WP_013189776.1|  ferredoxin                                       87.4    1e-16    
ref|WP_019494390.1|  ferredoxin                                       87.4    2e-16    
ref|WP_015080212.1|  ferredoxin                                       87.0    2e-16    
ref|WP_011057974.1|  ferredoxin                                       86.7    2e-16    
ref|WP_012406941.1|  ferredoxin                                       87.0    2e-16    
ref|WP_015211058.1|  ferredoxin                                       87.0    2e-16    
ref|WP_015136505.1|  ferredoxin                                       86.7    2e-16    
ref|WP_016859567.1|  ferredoxin                                       86.7    3e-16    
ref|WP_024125152.1|  4Fe-4S type iron-sulfur protein                  85.9    3e-16    
ref|WP_006617670.1|  ferredoxin                                       86.3    3e-16    
ref|WP_015217508.1|  ferredoxin                                       86.3    3e-16    
ref|WP_006624397.1|  MULTISPECIES: ferredoxin                         85.9    4e-16    
ref|WP_010994222.1|  ferredoxin                                       85.9    4e-16    
ref|WP_015116309.1|  ferredoxin                                       85.9    4e-16    
ref|WP_028085002.1|  ferredoxin                                       85.9    5e-16    
ref|WP_026722309.1|  ferredoxin                                       85.9    5e-16    
ref|WP_017321987.1|  ferredoxin                                       85.9    5e-16    
ref|WP_039743211.1|  ferredoxin                                       85.5    5e-16    
ref|WP_017312988.1|  ferredoxin                                       85.5    6e-16    
ref|WP_012306431.1|  ferredoxin                                       85.1    6e-16    
ref|WP_006277833.1|  ferredoxin                                       85.5    6e-16    
gb|EDX84563.1|  hypothetical protein S7335_2260                       85.5    7e-16    
ref|WP_009633374.1|  ferredoxin                                       85.1    7e-16    
ref|WP_017654536.1|  ferredoxin                                       85.5    7e-16    
ref|WP_009783896.1|  ferredoxin                                       85.1    7e-16    
ref|WP_030007600.1|  ferredoxin                                       85.1    7e-16    
ref|WP_026734303.1|  ferredoxin                                       85.1    8e-16    
ref|WP_006634894.1|  ferredoxin                                       85.1    9e-16    
ref|WP_006509566.1|  ferredoxin                                       84.7    9e-16    
ref|WP_008229924.1|  Ferredoxin                                       84.3    9e-16    
ref|WP_011319405.1|  ferredoxin                                       85.1    9e-16    
gb|ABD93565.1|  chloroplast heat shock protein-binding protein        82.4    9e-16    
ref|WP_009456776.1|  MULTISPECIES: ferredoxin                         85.1    1e-15    
ref|XP_007515005.1|  predicted protein                                89.0    1e-15    
ref|WP_028088920.1|  ferredoxin                                       84.7    1e-15    
ref|WP_039725519.1|  ferredoxin                                       85.1    1e-15    
ref|WP_015176942.1|  ferredoxin                                       84.7    1e-15    
ref|WP_022608204.1|  ferredoxin                                       85.1    1e-15    
ref|WP_015205002.1|  ferredoxin                                       84.7    1e-15    
ref|WP_008313807.1|  ferredoxin                                       84.7    1e-15    
ref|WP_027254509.1|  ferredoxin                                       84.7    1e-15    
ref|WP_023068690.1|  4Fe-4S single cluster domain protein             84.3    1e-15    
ref|WP_027845213.1|  ferredoxin                                       84.3    1e-15    
ref|WP_019504771.1|  hypothetical protein                             84.0    2e-15    
ref|WP_011142874.1|  ferredoxin                                       84.0    2e-15    
ref|WP_006102958.1|  ferredoxin                                       84.0    2e-15    
ref|WP_026794852.1|  MULTISPECIES: ferredoxin                         84.0    2e-15    
emb|CDN15365.1|  Ferredoxin                                           83.6    2e-15    
ref|WP_015197182.1|  ferredoxin                                       83.6    3e-15    
ref|WP_038018668.1|  ferredoxin                                       83.6    3e-15    
ref|WP_012630415.1|  ferredoxin                                       84.0    3e-15    
ref|WP_016949365.1|  ferredoxin                                       83.6    3e-15    
ref|WP_015230996.1|  ferredoxin                                       83.6    3e-15    
ref|WP_037222882.1|  ferredoxin                                       83.6    3e-15    
ref|WP_008235246.1|  Ferredoxin                                       82.8    3e-15    
ref|WP_024544612.1|  ferredoxin                                       83.2    3e-15    
ref|WP_015132160.1|  ferredoxin                                       83.6    3e-15    
ref|WP_023075978.1|  ferredoxin                                       83.6    3e-15    
ref|WP_017315745.1|  ferredoxin                                       83.2    4e-15    
ref|WP_010315260.1|  ferredoxin                                       82.4    5e-15    
ref|WP_016865107.1|  ferredoxin                                       82.8    5e-15    
ref|WP_029634495.1|  ferredoxin [                                     82.4    7e-15    
ref|WP_006529461.1|  ferredoxin                                       81.6    7e-15    
gb|AAD26588.1|AF136577_4  unknown                                     82.4    7e-15    
ref|WP_036482376.1|  ferredoxin                                       82.4    7e-15    
ref|WP_026788596.1|  ferredoxin                                       82.4    7e-15    
ref|XP_003626291.1|  Chaperone protein dnaJ                           84.0    8e-15    
ref|WP_006514057.1|  ferredoxin                                       82.0    9e-15    
ref|WP_016923432.1|  hypothetical protein                             82.0    1e-14    
ref|WP_016874211.1|  ferredoxin                                       82.0    1e-14    
ref|WP_018399858.1|  ferredoxin                                       81.3    2e-14    
ref|WP_015110557.1|  ferredoxin                                       80.9    2e-14    
ref|WP_019500424.1|  hypothetical protein                             81.3    2e-14    
ref|WP_010311015.1|  ferredoxin                                       80.5    2e-14    
ref|WP_015225188.1|  ferredoxin                                       80.9    2e-14    
ref|WP_009629353.1|  hypothetical protein                             80.1    3e-14    
ref|WP_023171310.1|  ferredoxin                                       80.5    4e-14    
ref|XP_002287534.1|  predicted protein                                78.6    4e-14    
ref|WP_002747586.1|  ferredoxin                                       79.7    4e-14    
ref|WP_011620256.1|  ferredoxin                                       79.3    6e-14    
ref|XP_009037557.1|  hypothetical protein AURANDRAFT_16950            77.8    7e-14    
ref|WP_015166981.1|  ferredoxin                                       78.6    8e-14    
ref|WP_036899569.1|  hypothetical protein                             79.7    8e-14    
ref|WP_019480297.1|  hypothetical protein                             79.3    9e-14    
gb|EJK59672.1|  hypothetical protein THAOC_20067                      82.0    1e-13    
ref|WP_036928119.1|  ferredoxin                                       77.0    1e-13    
ref|WP_011133105.1|  ferredoxin                                       78.2    1e-13    
ref|WP_006043266.1|  ferredoxin                                       78.6    1e-13    
ref|YP_002048844.1|  3Fe-4S ferredoxin                                78.2    2e-13    
ref|WP_002784283.1|  MULTISPECIES: ferredoxin                         78.2    2e-13    
ref|WP_035829364.1|  ferredoxin                                       78.2    2e-13    
ref|WP_011933944.1|  ferredoxin                                       78.2    2e-13    
gb|AII45908.1|  hypothetical protein KR49_05485                       77.0    2e-13    
ref|WP_006854355.1|  ferredoxin                                       78.2    2e-13    
dbj|BAC42598.1|  unknown protein                                      82.0    2e-13    
dbj|GAL91265.1|  ferredoxin                                           77.8    2e-13    
ref|WP_019475378.1|  hypothetical protein                             78.2    2e-13    
ref|WP_024969125.1|  ferredoxin                                       77.8    2e-13    
ref|WP_002734255.1|  ferredoxin                                       77.8    3e-13    
ref|XP_002179425.1|  predicted protein                                76.3    3e-13    
ref|WP_002762643.1|  ferredoxin                                       77.0    4e-13    
ref|WP_032520124.1|  ferredoxin                                       76.6    4e-13    
ref|XP_005778385.1|  hypothetical protein EMIHUDRAFT_48003            75.9    4e-13    
gb|KDO56319.1|  hypothetical protein CISIN_1g024836mg                 78.2    5e-13    
ref|WP_025923546.1|  ferredoxin                                       76.3    6e-13    
ref|WP_038027224.1|  ferredoxin                                       76.3    6e-13    
ref|XP_005756812.1|  hypothetical protein EMIHUDRAFT_59988            74.7    6e-13    
ref|WP_011936363.1|  ferredoxin                                       75.9    6e-13    
ref|WP_011820958.1|  ferredoxin                                       75.9    8e-13    
ref|WP_038001101.1|  ferredoxin                                       76.3    8e-13    
ref|WP_025937599.1|  ferredoxin                                       75.5    1e-12    
ref|WP_038546166.1|  ferredoxin                                       75.5    1e-12    
ref|WP_025928844.1|  ferredoxin                                       75.1    1e-12    
ref|WP_006909784.1|  ferredoxin                                       75.9    1e-12    
ref|WP_006172009.1|  ferredoxin                                       75.5    1e-12    
ref|WP_025942023.1|  MULTISPECIES: ferredoxin                         75.1    2e-12    
ref|WP_012196149.1|  ferredoxin                                       75.1    2e-12    
ref|WP_025965940.1|  ferredoxin                                       75.1    2e-12    
ref|WP_011359428.1|  ferredoxin                                       74.3    2e-12    
gb|KDO56318.1|  hypothetical protein CISIN_1g024836mg                 77.0    2e-12    
gb|EAU72324.1|  possible 3Fe-4S ferredoxin                            74.3    2e-12    
ref|WP_011863587.1|  ferredoxin                                       74.7    2e-12    
gb|AIQ95826.1|  Ferredoxin                                            74.7    2e-12    
ref|WP_032522056.1|  ferredoxin                                       74.7    2e-12    
ref|WP_025956160.1|  MULTISPECIES: ferredoxin                         74.7    2e-12    
ref|WP_025889359.1|  MULTISPECIES: ferredoxin                         74.7    2e-12    
ref|XP_006433325.1|  hypothetical protein CICLE_v10002196mg           77.0    2e-12    
ref|WP_037989026.1|  ferredoxin                                       73.9    2e-12    
ref|WP_025933986.1|  ferredoxin                                       74.7    2e-12    
ref|WP_025946411.1|  MULTISPECIES: ferredoxin                         74.7    2e-12    
ref|WP_025895000.1|  MULTISPECIES: ferredoxin                         74.7    2e-12    
ref|WP_025882374.1|  MULTISPECIES: ferredoxin                         74.3    2e-12    
ref|WP_019475676.1|  hypothetical protein                             75.5    2e-12    
ref|WP_019478617.1|  hypothetical protein                             75.5    3e-12    
ref|WP_011819090.1|  ferredoxin                                       74.3    3e-12    
ref|WP_025952083.1|  ferredoxin                                       74.3    3e-12    
ref|WP_036923058.1|  hypothetical protein                             75.1    3e-12    
ref|WP_025893556.1|  MULTISPECIES: ferredoxin                         73.9    3e-12    
ref|WP_011365006.1|  ferredoxin                                       73.2    3e-12    
ref|WP_025927013.1|  MULTISPECIES: ferredoxin                         73.9    3e-12    
emb|CBJ27569.1|  ferredoxin (cyanobacterial type ferredoxin family)   78.6    3e-12    
ref|NP_001149610.1|  dnaJ domain containing protein                   76.3    3e-12    
ref|XP_009417928.1|  PREDICTED: uncharacterized protein LOC103998234  76.6    3e-12    
ref|WP_032527401.1|  ferredoxin                                       73.9    4e-12    
ref|WP_025924884.1|  MULTISPECIES: ferredoxin                         73.9    4e-12    
ref|WP_032516251.1|  ferredoxin                                       73.6    4e-12    
gb|ACG36066.1|  dnaJ domain containing protein                        75.9    4e-12    
gb|ABE11083.1|  conserved hypothetical protein                        73.6    4e-12    
ref|WP_002807208.1|  ferredoxin                                       73.6    5e-12    
ref|WP_025915090.1|  ferredoxin                                       73.6    5e-12    
ref|WP_032518108.1|  ferredoxin                                       73.6    5e-12    
ref|WP_012008377.1|  ferredoxin                                       73.6    5e-12    
ref|XP_004494618.1|  PREDICTED: chaperone protein dnaJ 8, chlorop...  75.1    5e-12    
gb|AHF64481.1|  putative 3Fe-4S ferredoxin                            72.4    6e-12    
ref|XP_010108806.1|  Chaperone protein DnaJ                           78.2    6e-12    
ref|WP_025974758.1|  ferredoxin                                       72.8    6e-12    
ref|WP_038553523.1|  ferredoxin                                       72.4    6e-12    
ref|WP_025930874.1|  ferredoxin                                       73.2    7e-12    
ref|XP_001419625.1|  predicted protein                                72.0    7e-12    
gb|EEE65716.1|  hypothetical protein OsJ_21353                        78.2    8e-12    
ref|WP_032525012.1|  ferredoxin                                       72.8    9e-12    
gb|AII44220.1|  hypothetical protein KR100_12750                      72.4    9e-12    
ref|WP_011377112.1|  ferredoxin                                       72.8    1e-11    
ref|WP_019476859.1|  hypothetical protein                             73.6    1e-11    
ref|WP_028952645.1|  ferredoxin                                       72.8    1e-11    
ref|XP_010938602.1|  PREDICTED: uncharacterized protein LOC105057...  74.7    1e-11    
ref|WP_011824413.1|  ferredoxin                                       72.8    1e-11    
ref|WP_015159780.1|  ferredoxin                                       73.2    1e-11    
ref|WP_038654143.1|  ferredoxin                                       72.8    1e-11    
ref|WP_011295352.1|  ferredoxin                                       72.8    1e-11    
ref|WP_032513263.1|  ferredoxin                                       72.0    2e-11    
ref|WP_007098879.1|  ferredoxin                                       72.4    2e-11    
ref|WP_011127491.1|  ferredoxin                                       72.0    2e-11    
ref|WP_025980014.1|  ferredoxin                                       72.0    2e-11    
ref|XP_005773670.1|  hypothetical protein EMIHUDRAFT_50449            70.5    2e-11    
ref|XP_004494617.1|  PREDICTED: chaperone protein dnaJ 8, chlorop...  73.9    2e-11    
ref|XP_002439759.1|  hypothetical protein SORBIDRAFT_09g019580        73.9    2e-11    
ref|XP_006472016.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    2e-11    
ref|XP_004962163.1|  PREDICTED: uncharacterized protein LOC101774289  73.6    3e-11    
ref|WP_011825124.1|  ferredoxin                                       71.2    3e-11    
ref|XP_003566268.1|  PREDICTED: uncharacterized protein LOC100824...  73.2    3e-11    
gb|KHG07973.1|  Electron transport complex rnfB                       74.3    4e-11    
ref|WP_011130866.1|  MULTISPECIES: ferredoxin                         71.2    4e-11    
gb|EJK65860.1|  hypothetical protein THAOC_13242                      73.9    6e-11    
gb|AII48684.1|  ferredoxin                                            69.3    6e-11    
ref|XP_005773795.1|  hypothetical protein EMIHUDRAFT_47823            69.3    7e-11    
ref|WP_011125781.1|  MULTISPECIES: ferredoxin                         70.1    7e-11    
ref|WP_036900564.1|  ferredoxin                                       70.5    7e-11    
gb|KGN60912.1|  hypothetical protein Csa_2G022810                     72.0    9e-11    
ref|XP_011087400.1|  PREDICTED: uncharacterized protein LOC105168902  72.0    9e-11    
ref|XP_005856128.1|  ferredoxin                                       72.0    1e-10    
gb|EWM25866.1|  ferredoxin                                            72.0    1e-10    
gb|AFW76716.1|  hypothetical protein ZEAMMB73_534756                  70.9    1e-10    
emb|CDP15515.1|  unnamed protein product                              72.0    1e-10    
ref|XP_005837535.1|  hypothetical protein GUITHDRAFT_67022            68.9    1e-10    
gb|AFW77911.1|  hypothetical protein ZEAMMB73_222711                  70.5    2e-10    
ref|WP_025946995.1|  ferredoxin                                       68.2    2e-10    



>ref|XP_009790978.1| PREDICTED: uncharacterized protein LOC104238346 [Nicotiana sylvestris]
Length=338

 Score =   523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/338 (79%), Positives = 291/338 (86%), Gaps = 2/338 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSV--SSHGGSGRRKGFGRIRVAYQ  428
             MAQLLSPVCTD LK QNPV     R + PIL  N N+   SS+G SG+++G GRI+VAYQ
Sbjct  1     MAQLLSPVCTDSLKLQNPVQCFSSRSKWPILANNFNNPNWSSNGHSGKKRGLGRIKVAYQ  60

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             +SAASEE+ADDYYAVLGLLPDA+P QIKKAYYNCMKACHPDLSGDD ETTNFCMFINE+Y
Sbjct  61    DSAASEEIADDYYAVLGLLPDATPSQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVY  120

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
             EILSDPVQR VYDEIHGY ATAINPF  DSSPKDHVFVDEFSCIGCKNCANVCPKVF IE
Sbjct  121   EILSDPVQRRVYDEIHGYTATAINPFLSDSSPKDHVFVDEFSCIGCKNCANVCPKVFGIE  180

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             ED+GRARVY QSG+ +LIQQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVA MLSGM
Sbjct  181   EDYGRARVYDQSGNTDLIQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVAFMLSGM  240

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G  S+DVFRMAS RWEKRQ+KVL QAK+RM K+K S+K +SYWD LW   +DY  TEEE 
Sbjct  241   GGGSVDVFRMASIRWEKRQSKVLEQAKIRMMKKKDSEKPESYWDNLWGNAKDYANTEEEV  300

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAASKDN  1262
             +ER  RAAAAARRWREYSR+G DK PTFKLPEA S DN
Sbjct  301   EERTKRAAAAARRWREYSRRGADKPPTFKLPEAISNDN  338



>ref|XP_009593763.1| PREDICTED: uncharacterized protein LOC104090392 [Nicotiana tomentosiformis]
Length=338

 Score =   515 bits (1326),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 262/338 (78%), Positives = 288/338 (85%), Gaps = 2/338 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSV--SSHGGSGRRKGFGRIRVAYQ  428
             MAQLLSPVCTD LK QNP+     R + PIL  N N++  SS G SG+++  GRI+VAYQ
Sbjct  1     MAQLLSPVCTDSLKLQNPLQLFSSRSKWPILANNFNNLNWSSVGHSGKKRRLGRIKVAYQ  60

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             +SAASEE+ADDYY VLGLLPDA+P QIKKAYYNCMKACHPDLSGDD ETTNFCMFINE+Y
Sbjct  61    DSAASEEIADDYYGVLGLLPDATPTQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVY  120

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
             EILSDPVQR VYDEIHGY ATAINPF  DSS KDHVFVDEFSCIGCKNCANVCPKVF IE
Sbjct  121   EILSDPVQRRVYDEIHGYTATAINPFLSDSSTKDHVFVDEFSCIGCKNCANVCPKVFGIE  180

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             ED+GRARVY QSG+ +LIQQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVA MLSGM
Sbjct  181   EDYGRARVYDQSGNTDLIQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVAFMLSGM  240

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G  S+DVFRMAS RWEKRQ+KVL QAK+RM K+K S+K +SYWD LW   +DY  T+EE 
Sbjct  241   GGGSVDVFRMASIRWEKRQSKVLEQAKIRMMKKKDSEKPESYWDNLWGNAKDYANTDEEV  300

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAASKDN  1262
             +ER  RAAAAARRWREYSR+G DK PTFKLPEA S DN
Sbjct  301   EERTKRAAAAARRWREYSRRGADKPPTFKLPEAISNDN  338



>gb|EYU37338.1| hypothetical protein MIMGU_mgv1a009617mg [Erythranthe guttata]
Length=336

 Score =   508 bits (1309),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 263/335 (79%), Positives = 290/335 (87%), Gaps = 4/335 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLF-PRKRSPILGTNCNSVSSHGGSGRRKGF-GRIRVAYQ  428
             MAQLLSPVCTD LKFQNPV NL  PR R  +LG    + SSHGG  RRK   GRIRVA Q
Sbjct  1     MAQLLSPVCTDTLKFQNPVQNLLCPRSRFSMLGRTSVNWSSHGG--RRKALIGRIRVASQ  58

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             ++A+ ++VADDYYAVLGLLPDA+PEQIKKAYY+CMKACHPDLSGDD ETTNFCMFINEIY
Sbjct  59    DTASYDDVADDYYAVLGLLPDATPEQIKKAYYSCMKACHPDLSGDDPETTNFCMFINEIY  118

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
             E+LSDPVQR+VYDEIHGYA TAINPFFDDSSPKDHVFVDEFSCIGCKNCANVC KVFDIE
Sbjct  119   EVLSDPVQRMVYDEIHGYALTAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCSKVFDIE  178

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             EDFGRAR YSQ G  + +QQA+ESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM
Sbjct  179   EDFGRARAYSQPGIIDSVQQAVESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  238

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G+  +DVFRMAS RW++RQ+KVL QA++RM KQK SDK+ + W  LW   +DY  TEE+ 
Sbjct  239   GSGGVDVFRMASIRWQRRQSKVLEQARMRMAKQKDSDKTPASWSNLWGNEKDYANTEEQV  298

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             KERA +AAAAARRWREYSR+GVDKRPTFKLPEA S
Sbjct  299   KERAAKAAAAARRWREYSRRGVDKRPTFKLPEAIS  333



>ref|XP_006348890.1| PREDICTED: uncharacterized protein LOC102578540 [Solanum tuberosum]
Length=335

 Score =   508 bits (1307),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 263/338 (78%), Positives = 291/338 (86%), Gaps = 5/338 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKG-FGRIRVAYQE  431
             MAQLLSPVCTD LK  NPV   + R + PI    CN+ SS G SGR++G  GRI+VAYQ+
Sbjct  1     MAQLLSPVCTDSLKLHNPVQCFYSRSKVPIF---CNNFSSLGYSGRKRGGLGRIKVAYQD  57

Query  432   SAA-SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             SAA SEE+ADD+YAVLGLLPDA+P QIKKAYY+CMKACHPDLSGDD ETTNFCMFINE+Y
Sbjct  58    SAAASEEIADDFYAVLGLLPDATPAQIKKAYYSCMKACHPDLSGDDPETTNFCMFINEVY  117

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
             EILSDPVQR VYDEIHGY ATAINPF  DSSPKDHVFVDEFSCIGCKNCANVC KVF IE
Sbjct  118   EILSDPVQRRVYDEIHGYTATAINPFLSDSSPKDHVFVDEFSCIGCKNCANVCSKVFGIE  177

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             EDFGRARVY Q G  +LIQQAI+SCPVDCIHWTSAAQLSLLEDEMRR+ERVNVALMLSGM
Sbjct  178   EDFGRARVYDQCGHPDLIQQAIDSCPVDCIHWTSAAQLSLLEDEMRRIERVNVALMLSGM  237

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G+ ++DVFRMASTRWEKRQ+KVL QAKVRM K+K S+K++SYWD LW   +DY  TEEE 
Sbjct  238   GSGAMDVFRMASTRWEKRQSKVLEQAKVRMMKKKDSEKTESYWDNLWGDRKDYTKTEEEV  297

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAASKDN  1262
             ++R+ RAAAAARRWREYSR+G DK PTFKLPEA S DN
Sbjct  298   EDRSKRAAAAARRWREYSRRGADKPPTFKLPEAISNDN  335



>ref|XP_004243271.1| PREDICTED: uncharacterized protein LOC101268200 [Solanum lycopersicum]
Length=335

 Score =   507 bits (1305),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 260/337 (77%), Positives = 289/337 (86%), Gaps = 3/337 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSPVCTD LK QN V   + R + PILG N +S+   G   +R G GRI+VAYQ+S
Sbjct  1     MAQLLSPVCTDSLKLQNTVQCFYTRSKVPILGNNFSSMGVFGK--KRGGLGRIKVAYQDS  58

Query  435   AA-SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
             AA SEE+ADD+YAVLGLLPDA+P QIKKAYY+CMKACHPDLSGDD ETTNFCMFINE+YE
Sbjct  59    AAASEEIADDFYAVLGLLPDATPAQIKKAYYSCMKACHPDLSGDDPETTNFCMFINEVYE  118

Query  612   ILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEE  791
             ILSDPVQR VYDEIHGY ATAINPF  DSSPKDHVFVDEFSCIGCKNCANVC KVF IEE
Sbjct  119   ILSDPVQRRVYDEIHGYTATAINPFLSDSSPKDHVFVDEFSCIGCKNCANVCSKVFGIEE  178

Query  792   DFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             DFGRARVY Q G  +LIQQAI+SCPVDCIHWTSAAQLSLLEDEMRR+ERVNVALMLSGMG
Sbjct  179   DFGRARVYDQCGHPDLIQQAIDSCPVDCIHWTSAAQLSLLEDEMRRIERVNVALMLSGMG  238

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeak  1151
             + ++DVFRMASTRWEKRQ+KVL QAKVRM K+K S+K++SYWD LW   +DY  TEEE +
Sbjct  239   SGAMDVFRMASTRWEKRQSKVLEQAKVRMMKKKNSEKTESYWDNLWGDRKDYTKTEEEVE  298

Query  1152  eragraaaaarrwreYSRKGVDKRPTFKLPEAASKDN  1262
             +R+ RAAAAAR+WREYSR+G DK PTFKLPEA S DN
Sbjct  299   DRSKRAAAAARKWREYSRRGADKPPTFKLPEAISNDN  335



>ref|XP_011082983.1| PREDICTED: uncharacterized protein LOC105165614 [Sesamum indicum]
Length=334

 Score =   506 bits (1302),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 255/333 (77%), Positives = 286/333 (86%), Gaps = 2/333 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSPVCTD LKFQNP+ +  PR R PI G N  S S+HGG  +RK  GR+RVA Q+S
Sbjct  1     MAQLLSPVCTDALKFQNPLQSFCPRNRCPIAGKNSVSWSNHGG--KRKSLGRMRVASQDS  58

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
              + E++ADDYYAVLGLLPDA+PEQIKKAYY+CMKACHPDLSGDD ETTNFCMFINE+Y++
Sbjct  59    VSYEDIADDYYAVLGLLPDATPEQIKKAYYSCMKACHPDLSGDDPETTNFCMFINEVYDV  118

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGYA TA NPF DDS PKDH+FVDEFSCIGCKNCANVCP VF IEED
Sbjct  119   LSDPVQRMVYDEIHGYALTATNPFLDDSCPKDHIFVDEFSCIGCKNCANVCPDVFAIEED  178

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRAR YSQSG  + +QQA+ESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG+
Sbjct  179   FGRARAYSQSGQPDSVQQAVESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGS  238

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
             AS+DVFRMA+ RWEKRQAKVL +A++RM KQK S K+ +YW  LW   +DY+  EE+ KE
Sbjct  239   ASVDVFRMATVRWEKRQAKVLEKARMRMVKQKDSSKTQNYWSNLWGDAKDYENAEEKVKE  298

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             RA RAAAAARRWREYSR+G DK PTFKLPEA S
Sbjct  299   RAARAAAAARRWREYSRRGADKPPTFKLPEAVS  331



>gb|AFK46755.1| unknown [Lotus japonicus]
Length=335

 Score =   486 bits (1251),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 257/334 (77%), Positives = 284/334 (85%), Gaps = 4/334 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSPV T++ K  NP  NL+ R    +L     + ++H  SG+RKGFGR+RVA +ES
Sbjct  1     MAQLLSPVYTEVPKIHNPSLNLYSRSMWRMLPQTSTTFAAH--SGKRKGFGRVRVATEES  58

Query  435   AAS-EEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
              +     ADDYYAVLGLLPDA+P QIKKAYYNCMKACHPDLSGDD ETTNFC FINE+Y 
Sbjct  59    FSPINAAADDYYAVLGLLPDATPAQIKKAYYNCMKACHPDLSGDDPETTNFCTFINEVYA  118

Query  612   ILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEE  791
             +LSDPVQR+VYDEIHGY+ T+INPF DDS PKDHVFVDEFSCIGCKNCANV   VF IEE
Sbjct  119   VLSDPVQRMVYDEIHGYSLTSINPFLDDS-PKDHVFVDEFSCIGCKNCANVACDVFAIEE  177

Query  792   DFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             DFGRARV +Q G+ ELIQQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG
Sbjct  178   DFGRARVQNQCGNPELIQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  237

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeak  1151
             +AS DVFRMAS+RWEKRQAKVL QA+ RM KQKGSD++DSYWD LW KPRDYQ +E+E K
Sbjct  238   SASSDVFRMASSRWEKRQAKVLDQARQRMMKQKGSDETDSYWDNLWGKPRDYQRSEDEVK  297

Query  1152  eragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             ERA RAAAAARRWREYSRKGVDK PTFKLPEAAS
Sbjct  298   ERAKRAAAAARRWREYSRKGVDKPPTFKLPEAAS  331



>ref|XP_004303199.1| PREDICTED: uncharacterized protein LOC101312845 [Fragaria vesca 
subsp. vesca]
Length=336

 Score =   483 bits (1243),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/337 (74%), Positives = 287/337 (85%), Gaps = 5/337 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILG--TNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MAQLLSPV T+ LKFQNP   L P     +L   ++ NS+S  G +G+R+  GR+RVA +
Sbjct  1     MAQLLSPVFTEALKFQNP---LLPPSTWRVLARTSSINSLSLMGHAGKRRACGRVRVATE  57

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
              S +   +ADDYY+VLGLLPDA+P QIKKAYYNCMKACHPDLSG+D ETTNFCMFINE+Y
Sbjct  58    GSTSVGALADDYYSVLGLLPDATPAQIKKAYYNCMKACHPDLSGEDPETTNFCMFINEVY  117

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
             E+LSDPVQR+VYDEIHGYA TAINPF D+++PKDH FVDEFSCIGCKNCANV P VF IE
Sbjct  118   EVLSDPVQRMVYDEIHGYALTAINPFVDNTAPKDHTFVDEFSCIGCKNCANVAPDVFAIE  177

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             EDFGRARVYSQ G+ +L+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML+GM
Sbjct  178   EDFGRARVYSQCGNQDLVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLAGM  237

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G+A+ DVFR AS+RW+KRQAKVL QAKVRMTKQK S+K++SYWD +W K +DYQT+EEE 
Sbjct  238   GSAAADVFRTASSRWQKRQAKVLEQAKVRMTKQKDSEKTESYWDNVWGKAKDYQTSEEET  297

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAASKD  1259
             KERA RAAAAARRWREYSRKG DK P +KLPEA S +
Sbjct  298   KERAKRAAAAARRWREYSRKGADKPPRYKLPEAISNN  334



>ref|XP_002281976.1| PREDICTED: uncharacterized protein LOC100260760 [Vitis vinifera]
 emb|CBI22017.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   481 bits (1238),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 251/333 (75%), Positives = 275/333 (83%), Gaps = 7/333 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSPVCTD LKFQNP+HN   R   P       +++    S RR    R RVA    
Sbjct  1     MAQLLSPVCTDSLKFQNPLHNFSSRSPYPKPTRGWTNLAH---SSRR----RFRVAAAGQ  53

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A+SE VA+DYY VLGLLPDA+P QIKKAYYNCMKACHPDLSGDD E TNFCMFINE+Y +
Sbjct  54    ASSEAVAEDYYTVLGLLPDATPAQIKKAYYNCMKACHPDLSGDDPENTNFCMFINEVYAV  113

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQRLVYDEIHG+A TAINPFFDDSSP+DH FVDEFSCIGCKNCANV P VF IEED
Sbjct  114   LSDPVQRLVYDEIHGHALTAINPFFDDSSPRDHAFVDEFSCIGCKNCANVAPDVFGIEED  173

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARVYSQ G  EL+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVE++NVALMLSGMG+
Sbjct  174   FGRARVYSQCGKPELVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVEKINVALMLSGMGS  233

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
              ++DVFRMASTRWEKRQ+K L QAK+RM K+KGSDK++SYW  LW  P+D Q  EEE KE
Sbjct  234   GAVDVFRMASTRWEKRQSKALEQAKIRMMKKKGSDKTESYWSNLWGSPKDIQNKEEEVKE  293

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             RA RAAAAARRWREYSRKG DK PTFKLPEA S
Sbjct  294   RAKRAAAAARRWREYSRKGADKPPTFKLPEAIS  326



>ref|XP_010035876.1| PREDICTED: uncharacterized protein LOC104425012 [Eucalyptus grandis]
 gb|KCW47361.1| hypothetical protein EUGRSUZ_K01146 [Eucalyptus grandis]
Length=338

 Score =   478 bits (1229),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 247/335 (74%), Positives = 282/335 (84%), Gaps = 5/335 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRK--RSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MAQL+S VCTD LKFQNPV +L  R   R P      N +   G   RR+  GR++VA  
Sbjct  1     MAQLMSSVCTDALKFQNPVLSLCSRSPCRVPAKPGGWNPL---GCGARRRACGRVKVATD  57

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             +SA+ + VADDYYAVLGLLPDA+P QIKKAYYNCMK CHPDLSG+D ET NFCMFINE+Y
Sbjct  58    DSASLDSVADDYYAVLGLLPDATPAQIKKAYYNCMKECHPDLSGNDPETNNFCMFINEVY  117

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
              +LSDPVQR+VYDEIHGYA TA+NPF DDS PKDH FVDEFSCIGCKNCANV P VF IE
Sbjct  118   AVLSDPVQRMVYDEIHGYALTALNPFLDDSCPKDHAFVDEFSCIGCKNCANVAPDVFAIE  177

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             ED+GRARVYSQ G+ EL+QQAI+SCPVDCIHWTSAAQ+SLLEDEMRRVERVNVA+MLSGM
Sbjct  178   EDYGRARVYSQCGNPELVQQAIDSCPVDCIHWTSAAQMSLLEDEMRRVERVNVAMMLSGM  237

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G+ S+DVFR+AS+RWEKRQAKVL +AK+RM +QK S KS+SYWD LWAKP++Y+ +EEE 
Sbjct  238   GSGSVDVFRVASSRWEKRQAKVLEKAKIRMMQQKDSGKSNSYWDDLWAKPKEYRDSEEEI  297

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
              +RA RAAAAARRWREYSR+GVDK PTFKLPEAAS
Sbjct  298   NKRARRAAAAARRWREYSRRGVDKPPTFKLPEAAS  332



>ref|XP_007048743.1| DNAJ heat shock N-terminal domain-containing protein isoform 
2 [Theobroma cacao]
 gb|EOX92900.1| DNAJ heat shock N-terminal domain-containing protein isoform 
2 [Theobroma cacao]
Length=337

 Score =   476 bits (1225),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 248/333 (74%), Positives = 277/333 (83%), Gaps = 0/333 (0%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSPVCTD LK  NP  N+  R     +     S S  G  G+R+G GR++VA   S
Sbjct  1     MAQLLSPVCTDALKLHNPYLNMCKRGSWKAMAKRGASWSVMGHGGKRRGCGRVKVATGNS  60

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A ++ +ADDYY VLGLLPDA PE+IKKAYYNCMKACHPDLSG+D ETTNFCMFINE+Y +
Sbjct  61    AYTDSLADDYYTVLGLLPDARPEEIKKAYYNCMKACHPDLSGNDPETTNFCMFINEVYGV  120

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGYA TAINPF DDS+PKDHVFVDEFSCIGCKNCANV   VF IEED
Sbjct  121   LSDPVQRMVYDEIHGYALTAINPFMDDSAPKDHVFVDEFSCIGCKNCANVTSDVFRIEED  180

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARV+SQ G+ ELI+QAIESCPVDCIH TSAAQLSLLEDEMRRVERVNVALMLSGMG+
Sbjct  181   FGRARVHSQCGNPELIEQAIESCPVDCIHRTSAAQLSLLEDEMRRVERVNVALMLSGMGS  240

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
             AS+DVFRMA +RWEKRQAKVL QAK++MT QK S K+DSYW  LW KP++Y+ +EEE KE
Sbjct  241   ASMDVFRMACSRWEKRQAKVLEQAKIKMTWQKDSGKTDSYWSNLWGKPQEYKKSEEEVKE  300

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             RA  AAAAARRWREYSR+GVDK PT KLPEA S
Sbjct  301   RARTAAAAARRWREYSRRGVDKPPTSKLPEAVS  333



>gb|KHN36707.1| Chaperone protein DnaJ [Glycine soja]
Length=339

 Score =   475 bits (1222),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 241/335 (72%), Positives = 283/335 (84%), Gaps = 4/335 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRK--RSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MAQLLSPVC + LK  NP  NL  R   R  + G +  +  +H GS RR GFG++RV  +
Sbjct  1     MAQLLSPVCMEALKIHNPSLNLCSRSSWRMLVKGASPCTFLTHSGSKRR-GFGKVRVTAE  59

Query  429   ESAA-SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
             +S + SE +ADDYY VLGLLPDA+PEQIKKAYYNCMK+CHPDLSG+D ETTNFCMFINE+
Sbjct  60    DSVSPSETIADDYYEVLGLLPDATPEQIKKAYYNCMKSCHPDLSGNDPETTNFCMFINEV  119

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             Y +LSDPVQR++YDEIHGY+ T+INPF DDSSP+DH FVDEFSCIGCKNCANV P VF I
Sbjct  120   YTVLSDPVQRMIYDEIHGYSLTSINPFLDDSSPRDHAFVDEFSCIGCKNCANVAPGVFAI  179

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EEDFGRAR Y+Q G  EL+QQAI+SCPV CIHWTS+AQLSLLEDEMRRVERVNVALM+SG
Sbjct  180   EEDFGRARAYNQCGDPELVQQAIDSCPVSCIHWTSSAQLSLLEDEMRRVERVNVALMVSG  239

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MG ASIDVFRMAS+RWEKRQ+KVL +AK+RM +++GSDK +SYWD LW K +DYQ+++EE
Sbjct  240   MGTASIDVFRMASSRWEKRQSKVLAKAKLRMMREEGSDKKNSYWDNLWGKQKDYQSSDEE  299

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEAA  1250
              +ERA RAA+AARRWREYS +GVDK PTFKLPEA+
Sbjct  300   VEERAKRAASAARRWREYSSRGVDKPPTFKLPEAS  334



>gb|KHG26066.1| Chaperone DnaJ [Gossypium arboreum]
Length=339

 Score =   474 bits (1220),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 245/333 (74%), Positives = 279/333 (84%), Gaps = 0/333 (0%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSPV TD LK  NP  N+  R           S S  G  G+R+G GR+++A   S
Sbjct  1     MAQLLSPVYTDTLKIHNPSLNMSRRSSWKAYAKTGASWSLMGHGGQRRGCGRVKLASGNS  60

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A+++ +ADDYYAVLGLLPDA+PE+IKKAYYNCMKACHPDLSG+D ETTNFCMFINE+Y +
Sbjct  61    ASTDSLADDYYAVLGLLPDATPEEIKKAYYNCMKACHPDLSGNDPETTNFCMFINEVYGV  120

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGYA TA+NPF DDS+P+DHVFVDEFSCIGCKNCANV   VF IEED
Sbjct  121   LSDPVQRMVYDEIHGYALTAMNPFMDDSAPRDHVFVDEFSCIGCKNCANVACDVFRIEED  180

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARV+SQ G+ EL+Q+AI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG+
Sbjct  181   FGRARVHSQFGNPELVQEAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGS  240

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
             AS DVFRMAS+RWEKRQAKVL QAKVRM +QK +DK+DSYW  LW KP+ Y+ +EEE KE
Sbjct  241   ASTDVFRMASSRWEKRQAKVLEQAKVRMMQQKDADKTDSYWTNLWGKPKQYKKSEEEVKE  300

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             RA RAAAAARRWREYSR+GVDK PT KLP+  S
Sbjct  301   RAKRAAAAARRWREYSRRGVDKAPTVKLPDPLS  333



>ref|XP_003539555.1| PREDICTED: uncharacterized protein LOC100786494 [Glycine max]
Length=339

 Score =   473 bits (1217),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 241/335 (72%), Positives = 284/335 (85%), Gaps = 4/335 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRK--RSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MAQLLSPVC + LK  NP  NL  R   R  + G +  +  +H G  +R+G GR+RV  +
Sbjct  1     MAQLLSPVCMEALKIHNPSLNLCSRSSWRMLVKGASPCTFVTHSG-WKRRGCGRVRVTAE  59

Query  429   ESAA-SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
             +S + SE +ADDYY VLGLLPDA+PEQIKKAYYNCMK+CHPDLSG+D ETTNFC+FINE+
Sbjct  60    DSVSPSETIADDYYEVLGLLPDATPEQIKKAYYNCMKSCHPDLSGNDPETTNFCIFINEV  119

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             Y +LSDPVQR +YDEIHGY+ T+INPF DDSSP+DH FVDEFSCIGCKNCANV P VF I
Sbjct  120   YTVLSDPVQRRIYDEIHGYSLTSINPFLDDSSPRDHAFVDEFSCIGCKNCANVAPGVFAI  179

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EEDFGRAR Y+QSG+ EL+QQAI+SCPV CIHWTSAAQLSLLEDEMRRVERVNVALMLSG
Sbjct  180   EEDFGRARAYNQSGNPELVQQAIDSCPVSCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  239

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MG ASIDVFRMAS+RWEKRQ+KVL +AK+RM +++G+DK +SYWD LW K +DYQ+++EE
Sbjct  240   MGTASIDVFRMASSRWEKRQSKVLAKAKLRMMREEGADKKNSYWDNLWGKQKDYQSSDEE  299

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEAA  1250
              +ERA RAA+AARRWREYSR+GVDK PTFKLPEA+
Sbjct  300   VEERAKRAASAARRWREYSRRGVDKPPTFKLPEAS  334



>ref|NP_001242058.1| uncharacterized protein LOC100809007 [Glycine max]
 gb|ACU18106.1| unknown [Glycine max]
Length=339

 Score =   472 bits (1214),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 242/340 (71%), Positives = 283/340 (83%), Gaps = 5/340 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRK--RSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MAQLLSPVC + LK  NP  NL  R   R  + G +  +  +H GS RR GFG++RV  +
Sbjct  1     MAQLLSPVCMEALKIHNPSLNLCSRSSWRMLVKGASPCTFLTHSGSKRR-GFGKVRVTAE  59

Query  429   ESAA-SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
             +S + SE +ADDYY V GLLPDA+PEQIKKAYYNCMK+CHPDLSG+D ETTNFCMFINE+
Sbjct  60    DSVSPSETIADDYYEVFGLLPDATPEQIKKAYYNCMKSCHPDLSGNDPETTNFCMFINEV  119

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             Y +LSDPVQR++YDEIHGY+ T+INPF DDSSP+DH FVDEFSCIGCKNCANV P VF I
Sbjct  120   YTVLSDPVQRMIYDEIHGYSLTSINPFLDDSSPRDHAFVDEFSCIGCKNCANVAPGVFAI  179

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EEDFGRAR Y+Q G  EL+QQAI+SCPV CIHWTS AQLSLLEDEMRRVERVNVALM+SG
Sbjct  180   EEDFGRARAYNQCGDPELVQQAIDSCPVSCIHWTSPAQLSLLEDEMRRVERVNVALMVSG  239

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MG ASIDVFRM S+RWEKRQ+KVL +AK+RM +++GSDK +SYWD LW K +DYQ+++EE
Sbjct  240   MGTASIDVFRMTSSRWEKRQSKVLAKAKLRMMREEGSDKKNSYWDNLWGKQKDYQSSDEE  299

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEAA-SKDN  1262
              +ERA RAA+AARRWREYS +GVDK PTFKLPEA+  KDN
Sbjct  300   VEERAKRAASAARRWREYSSRGVDKPPTFKLPEASLGKDN  339



>ref|XP_010554518.1| PREDICTED: uncharacterized protein LOC104824189 [Tarenaya hassleriana]
Length=340

 Score =   471 bits (1213),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 245/344 (71%), Positives = 287/344 (83%), Gaps = 17/344 (5%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGS--------GRRKGFGR  410
             MAQLLSPVCTD+LK QNPV      + SP          +HGGS        GRR+   R
Sbjct  1     MAQLLSPVCTDLLKLQNPV---LSSRSSPWRF----PAKTHGGSSWCFSSFPGRRRSGIR  53

Query  411   IRVAYQESAA--SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNF  584
             +RVA ++ A+  +++VADDYYAVLGLLPDA+ E+IKKAYYNCMKACHPDLSGD+ ETTNF
Sbjct  54    LRVATEDPASLFTDDVADDYYAVLGLLPDATQEEIKKAYYNCMKACHPDLSGDNPETTNF  113

Query  585   CMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANV  764
             CMFINE+Y +LSDPVQR+VYDEIHGYAATA NPF DDS  +D +FVDEF+CIGCKNCANV
Sbjct  114   CMFINEVYAVLSDPVQRMVYDEIHGYAATATNPFLDDSGERDQIFVDEFACIGCKNCANV  173

Query  765   CPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVN  944
              P +F IEEDFGRAR YSQ G+ +L QQA+E+CPVDCIHWTSAAQLSLLEDEMRRVERVN
Sbjct  174   APDIFQIEEDFGRARAYSQCGNRDLAQQAVETCPVDCIHWTSAAQLSLLEDEMRRVERVN  233

Query  945   VALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRD  1124
             VALMLSGMG+ ++DVFRMAS+RWEKRQAKVLGQA+ RMTK+KG++++ SYWD LW KP+D
Sbjct  234   VALMLSGMGSGAVDVFRMASSRWEKRQAKVLGQARSRMTKRKGTEETPSYWDNLWGKPKD  293

Query  1125  YQTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
             Y+ +EEE +ERA RAAAAARRWREYSR+GVDK PTFKLPEA+S+
Sbjct  294   YKKSEEEVQERAKRAAAAARRWREYSRRGVDKPPTFKLPEASSE  337



>ref|XP_007048742.1| DNAJ heat shock N-terminal domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOX92899.1| DNAJ heat shock N-terminal domain-containing protein isoform 
1 [Theobroma cacao]
Length=337

 Score =   471 bits (1213),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 246/333 (74%), Positives = 276/333 (83%), Gaps = 0/333 (0%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSPVCTD LK  NP  N+  R     +     S S  G  G+R+G GR++VA   S
Sbjct  1     MAQLLSPVCTDALKLHNPYLNMCKRGSWKAMAKRGASWSVMGHGGKRRGCGRVKVATGNS  60

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A ++ +ADDYY VLGLLPDA PE+IKKAYYNCMKACHPDLSG+D ETTNFCMFINE+Y +
Sbjct  61    AYTDSLADDYYTVLGLLPDARPEEIKKAYYNCMKACHPDLSGNDPETTNFCMFINEVYGV  120

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGYA TAINPF DDS+PKDHVFVDEFS +GCKNCANV   VF IEED
Sbjct  121   LSDPVQRMVYDEIHGYALTAINPFMDDSAPKDHVFVDEFSSLGCKNCANVTSDVFRIEED  180

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARV+SQ G+ ELI+QAIESCPVDCIH TSAAQLSLLEDEMRRVERVNVALMLSGMG+
Sbjct  181   FGRARVHSQCGNPELIEQAIESCPVDCIHRTSAAQLSLLEDEMRRVERVNVALMLSGMGS  240

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
             AS+DVFRMA +RWEKRQAKVL QAK++MT QK S K+DSYW  LW KP++Y+ +EEE KE
Sbjct  241   ASMDVFRMACSRWEKRQAKVLEQAKIKMTWQKDSGKTDSYWSNLWGKPQEYKKSEEEVKE  300

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             RA  AAAAARRWREYSR+GVDK PT KLPEA S
Sbjct  301   RARTAAAAARRWREYSRRGVDKPPTSKLPEAVS  333



>gb|KHN27954.1| Chaperone protein DnaJ [Glycine soja]
Length=339

 Score =   470 bits (1210),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 239/335 (71%), Positives = 284/335 (85%), Gaps = 4/335 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRK--RSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MAQLLSPVC + LK  NP  NL  R   R  + G +  +  +H G  +R+G GR+RV  +
Sbjct  1     MAQLLSPVCMEALKIHNPSLNLCSRSSWRMLVKGASPCTFVTHSG-WKRRGCGRVRVTAE  59

Query  429   ESAA-SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
             +S + SE +ADDYY VLGLLPDA+PEQIKKAYYNCMK+CHPDLSG+D ETTNFC+FINE+
Sbjct  60    DSVSPSETIADDYYEVLGLLPDATPEQIKKAYYNCMKSCHPDLSGNDPETTNFCIFINEV  119

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             Y +LSDPVQR +YDEIHGY+ T+INPF DDSSP+DH FVDEFSCIGCKNCANV P VF I
Sbjct  120   YTVLSDPVQRRIYDEIHGYSLTSINPFLDDSSPRDHAFVDEFSCIGCKNCANVAPGVFAI  179

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EEDFGRAR Y+QSG+ EL+QQAI+SCPV CIHWTS+AQLSLL+DEMRRVERVNVALMLSG
Sbjct  180   EEDFGRARAYNQSGNPELVQQAIDSCPVSCIHWTSSAQLSLLDDEMRRVERVNVALMLSG  239

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MG ASIDVFRMAS+RWEKRQ+KVL +AK+RM +++G+DK +SYWD LW K +DYQ+++EE
Sbjct  240   MGTASIDVFRMASSRWEKRQSKVLAKAKLRMMREEGADKKNSYWDNLWGKQKDYQSSDEE  299

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEAA  1250
              +ERA RAA+AARRWREYSR+GVDK PTFKLPEA+
Sbjct  300   VEERAKRAASAARRWREYSRRGVDKPPTFKLPEAS  334



>ref|XP_007149726.1| hypothetical protein PHAVU_005G094000g [Phaseolus vulgaris]
 gb|ESW21720.1| hypothetical protein PHAVU_005G094000g [Phaseolus vulgaris]
Length=338

 Score =   470 bits (1209),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 239/332 (72%), Positives = 277/332 (83%), Gaps = 1/332 (0%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSPVC + LK  NP  NL       +L    +  +S   SG+R+G GR++V  ++S
Sbjct  1     MAQLLSPVCMEALKIHNPSLNLCSTGSWRMLVKTPSHCTSVTRSGKRRGCGRVKVTAEDS  60

Query  435   AA-SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
              + ++ +ADDYY VLGLLPDASPEQIKKAYYNCMK+CHPDLSG+D ETTNFCMFINEIY 
Sbjct  61    VSPTDTIADDYYEVLGLLPDASPEQIKKAYYNCMKSCHPDLSGNDPETTNFCMFINEIYT  120

Query  612   ILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEE  791
             +LSDP+QR +YDEIHGY+ T+INPF DDSSP+DH FVDEFSCIGCKNCANV P VF IEE
Sbjct  121   VLSDPIQRRIYDEIHGYSLTSINPFLDDSSPRDHAFVDEFSCIGCKNCANVAPDVFAIEE  180

Query  792   DFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             DFGRAR ++Q G+ EL+QQAI+SCPV CIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG
Sbjct  181   DFGRARAFNQCGNPELVQQAIDSCPVSCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  240

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeak  1151
              ASIDVFRMA +RWEKRQ+KVL +AKVRM KQ+GSDK +SYWD LW K +DYQ+++E  +
Sbjct  241   TASIDVFRMARSRWEKRQSKVLEKAKVRMMKQEGSDKKNSYWDNLWGKQKDYQSSDEVVE  300

Query  1152  eragraaaaarrwreYSRKGVDKRPTFKLPEA  1247
             ERA RAA+AARRWREYSRKGVD  PTFKLPEA
Sbjct  301   ERARRAASAARRWREYSRKGVDNPPTFKLPEA  332



>ref|XP_010246441.1| PREDICTED: uncharacterized protein LOC104589728 [Nelumbo nucifera]
Length=334

 Score =   468 bits (1204),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 247/333 (74%), Positives = 272/333 (82%), Gaps = 3/333 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLS VCTD LKFQNP    +   R   L     S  S   +GRR  +        + 
Sbjct  1     MAQLLSSVCTDALKFQNPSKFSYSGNRGRSLAKK--SSPSTAVAGRRPCYKIKATVNNDF  58

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
              + EEVADDYYAVLGLLPDA P QIKKAYYNCMKACHPDLSG+D ETTNFCMFINE+Y +
Sbjct  59    TSQEEVADDYYAVLGLLPDAKPAQIKKAYYNCMKACHPDLSGNDPETTNFCMFINEVYAV  118

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGYA TAINPF DDS+PKDH FVDEF CIGCKNCAN+ P VF+IEED
Sbjct  119   LSDPVQRMVYDEIHGYALTAINPFMDDSNPKDHAFVDEFCCIGCKNCANIAPDVFEIEED  178

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARV SQSG+ EL+Q+AI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA
Sbjct  179   FGRARVCSQSGNPELVQEAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  238

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
             +S+DVFRMASTRWEKRQ+KVL +AK+RM KQK SDK  SYW+ LW KP+DYQ T +E KE
Sbjct  239   SSVDVFRMASTRWEKRQSKVLERAKLRMMKQKDSDKPRSYWNDLWGKPKDYQNT-DEVKE  297

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             RA RAAAAARRWREYSRKG D+ PTFKLPEA S
Sbjct  298   RAKRAAAAARRWREYSRKGADRPPTFKLPEAIS  330



>emb|CDP15953.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   468 bits (1203),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 243/341 (71%), Positives = 277/341 (81%), Gaps = 8/341 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNS--------VSSHGGSGRRKGFGR  410
             MAQLLSPVCTD LKFQN   +   RK+  ILG    S        +S    + RRKG GR
Sbjct  1     MAQLLSPVCTDALKFQNLSPSFSSRKQWSILGKKYMSNLPKIEYYMSWTPAARRRKGVGR  60

Query  411   IRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCM  590
             +RVA  + + SE+ ADDYYAVLGLLPDA+P+QIKKAYYNCMKACHPDLSGD  ETTNFCM
Sbjct  61    LRVATADPSLSEDFADDYYAVLGLLPDATPDQIKKAYYNCMKACHPDLSGDAPETTNFCM  120

Query  591   FINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCP  770
             FINE+Y +LSDP+QR++YDEIHGYA TAINPF DDS+PKDHVFVDEFSCIGCKNC NVC 
Sbjct  121   FINEVYSVLSDPLQRMIYDEIHGYALTAINPFLDDSAPKDHVFVDEFSCIGCKNCTNVCK  180

Query  771   KVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVA  950
              VF IEEDFGRAR Y+QSG+ +LIQQAI+SCPVDCIHWTSA QLSLLEDEMRRV+RVNVA
Sbjct  181   AVFTIEEDFGRARAYTQSGNPDLIQQAIDSCPVDCIHWTSAQQLSLLEDEMRRVDRVNVA  240

Query  951   LMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQ  1130
              MLSGMG+A +DVFRMAS+ WEKRQ K+L + K RM KQK SDK +++W+ LW KP+ Y+
Sbjct  241   FMLSGMGSAGVDVFRMASSTWEKRQTKILEEVKRRMMKQKESDKYEAFWNNLWGKPKGYR  300

Query  1131  TTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
              +EEE KERA RAAAAARRWREYSR+GVDK PT KLPE  S
Sbjct  301   NSEEEVKERASRAAAAARRWREYSRRGVDKPPTIKLPETIS  341



>ref|XP_007132823.1| hypothetical protein PHAVU_011G127500g [Phaseolus vulgaris]
 gb|ESW04817.1| hypothetical protein PHAVU_011G127500g [Phaseolus vulgaris]
Length=337

 Score =   466 bits (1198),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 243/335 (73%), Positives = 280/335 (84%), Gaps = 3/335 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MA+LLSPV T+ LK  NP+ N   R    +L      ++    +G+R+G GR+RVA  E 
Sbjct  1     MAKLLSPVYTEPLKLHNPLLNFCSRSSWRMLPKTATPMNFVTNNGKRRGCGRVRVAAGEK  60

Query  435   A--ASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             +   SE VADDYYAVLGLLPDA+P QIKKAYYNCMKACHPDLSG+D ETTNFC FINE+Y
Sbjct  61    SFSTSEAVADDYYAVLGLLPDATPAQIKKAYYNCMKACHPDLSGNDPETTNFCTFINEVY  120

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
              +LSDP+QR++YDEIHGY+ T+INPF D+SSPKDHVFVDEFSCIGCKNCANV   VF IE
Sbjct  121   GVLSDPIQRMIYDEIHGYSLTSINPFLDESSPKDHVFVDEFSCIGCKNCANVACDVFGIE  180

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             E+FGRAR YSQ G  +L+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM
Sbjct  181   EEFGRARAYSQCGKSDLVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  240

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G+AS DVFRMAS+RWEKRQAKVL QA++RM K+KGSDK+D +W+ LW KP+D  ++EEE 
Sbjct  241   GSASTDVFRMASSRWEKRQAKVLEQARLRMMKEKGSDKADMFWNNLWGKPKDL-SSEEEM  299

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             KERA RAAAAARRWREYSR+GVDK PTFKLPEAAS
Sbjct  300   KERAKRAAAAARRWREYSRRGVDKPPTFKLPEAAS  334



>gb|EPS63040.1| hypothetical protein M569_11748, partial [Genlisea aurea]
Length=330

 Score =   465 bits (1196),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 239/333 (72%), Positives = 274/333 (82%), Gaps = 6/333 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSPVC D LKFQN V +  PR R PI+G    S      SG+R+   R+R A+QES
Sbjct  1     MAQLLSPVCADSLKFQNLVPSFCPRNRWPIIGKTVCS------SGKRRNLVRVRAAFQES  54

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A  +E+ADDYYAVLGLLPDA+PEQIKKAYYNCMKACHPDL GDD++TTNFC+FIN++YE+
Sbjct  55    APYDEIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLCGDDQDTTNFCVFINDVYEV  114

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGY  TAINPF DDSSP+DHVFVDEF+CIGCKNCANVC  VF IEED
Sbjct  115   LSDPVQRMVYDEIHGYTPTAINPFLDDSSPRDHVFVDEFACIGCKNCANVCSSVFAIEED  174

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRAR Y+QSG+ + +QQA++SCPV+CI+WTSAAQLSLLEDEMRRVERVNVALMLSGMG+
Sbjct  175   FGRARAYNQSGNTDSVQQAVDSCPVNCIYWTSAAQLSLLEDEMRRVERVNVALMLSGMGS  234

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
             AS+DVFR AS+RWEKRQAKVL QAK+RM   K S+K+ S W  LW K ++Y    EE KE
Sbjct  235   ASVDVFRTASSRWEKRQAKVLAQAKMRMMNGKDSEKTPSSWSNLWGKAKEYGDGSEEGKE  294

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             RA RAAAAARRWREYSR+  DK P FKL E  S
Sbjct  295   RAKRAAAAARRWREYSRRAADKPPGFKLSEGIS  327



>ref|XP_006468985.1| PREDICTED: uncharacterized protein LOC102624088 isoform X2 [Citrus 
sinensis]
Length=340

 Score =   464 bits (1195),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 241/334 (72%), Positives = 279/334 (84%), Gaps = 2/334 (1%)
 Frame = +3

Query  258   AQLLSPVCTDILKFQNPVHNLFPRKRS-PILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             AQLL+PVC D+LK QNP  N F  + S  +L  N +S+S  G S +R+  GR RV  ++S
Sbjct  3     AQLLTPVCIDVLKLQNPSLNSFSSRSSWRLLDNNSSSLSLMGHSSKRRSCGRARVTAEDS  62

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A+++ +ADDYYAVLGLLPDA+PEQIKKAYYNCMKACHPDLSGDD ETTNFCMFINE+Y +
Sbjct  63    ASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAV  122

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGY+  A NPF DDS PKDHVFVDEFSCIGCKNC NV P+VF IEED
Sbjct  123   LSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEED  182

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARVY+Q G  E +QQAIESCPVDCIH TSA QLSLLEDEMRRVERVNVA+MLSGMG+
Sbjct  183   FGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGMGS  242

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVR-MTKQKGSDKSDSYWDYLWAKPRDYQTTeeeak  1151
              S DVFRMAS+RWE+RQAKVL QAK+R M ++K SDK+ SYW  +W KP+DY+ +EEE K
Sbjct  243   GSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKDYRNSEEEVK  302

Query  1152  eragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             ER+ RAAAAARRWREYSR+G D+ PTFKLPEA +
Sbjct  303   ERSKRAAAAARRWREYSRRGADQPPTFKLPEATT  336



>ref|XP_002880004.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56263.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=344

 Score =   462 bits (1190),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 242/343 (71%), Positives = 284/343 (83%), Gaps = 11/343 (3%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRK-RSPILGTNCNSVSSHGG----SGRRKG--FGRI  413
             MAQ+LSPVCTD+LKFQN +  L  R   SP         SS  G    +GRR+    GR+
Sbjct  1     MAQILSPVCTDLLKFQNSI--LSSRSGTSPRFSAKTTGASSSWGLPRYAGRRRSGSIGRL  58

Query  414   RVAYQE--SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFC  587
             RVA ++  S ++ +VADDYYAVLGLLPDA+ E+IKKAYYNCMK+CHPDLSG+D ETTNFC
Sbjct  59    RVATEDASSLSTGDVADDYYAVLGLLPDATQEEIKKAYYNCMKSCHPDLSGNDPETTNFC  118

Query  588   MFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVC  767
             MFIN+IYEILSDPVQR+VYDEIHGY  TAINPF DDS+P+DHVFVDEF+CIGCKNCANV 
Sbjct  119   MFINDIYEILSDPVQRMVYDEIHGYTVTAINPFLDDSTPRDHVFVDEFACIGCKNCANVA  178

Query  768   PKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV  947
             P +F IEEDFGRAR  +Q G+ +L+QQA+E+CPVDCIH TSAAQLSLLEDEMRRVERVNV
Sbjct  179   PDIFKIEEDFGRARACNQRGNPDLVQQAVETCPVDCIHQTSAAQLSLLEDEMRRVERVNV  238

Query  948   ALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDY  1127
             ALMLSGMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K +D++ SYWD LW K  DY
Sbjct  239   ALMLSGMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKNTDETPSYWDNLWGKQNDY  298

Query  1128  QTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
             Q +EEE +ERA RAAAAARRWREYSR+GVDKRPTFKLP++AS+
Sbjct  299   QKSEEEVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSASR  341



>gb|KDO63412.1| hypothetical protein CISIN_1g019284mg [Citrus sinensis]
Length=340

 Score =   462 bits (1190),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 241/334 (72%), Positives = 278/334 (83%), Gaps = 2/334 (1%)
 Frame = +3

Query  258   AQLLSPVCTDILKFQNPVHNLFPRKRSPIL-GTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             AQLL+PVC D+LK QNP  N F  + S  L   N +S+S  G S +R+  GR RV  ++S
Sbjct  3     AQLLTPVCIDVLKLQNPSLNSFSSRSSSRLLANNSSSLSLMGHSSKRRSCGRARVTAEDS  62

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A+++ +ADDYYAVLGLLPDA+PEQIKKAYYNCMKACHPDLSGDD ETTNFCMFINE+Y +
Sbjct  63    ASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAV  122

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGY+  A NPF DDS PKDHVFVDEFSCIGCKNC NV P+VF IEED
Sbjct  123   LSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEED  182

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARVY+Q G  E +QQAIESCPVDCIH TSA QLSLLEDEMRRVERVNVA+MLSGMG+
Sbjct  183   FGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGMGS  242

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVR-MTKQKGSDKSDSYWDYLWAKPRDYQTTeeeak  1151
              S DVFRMAS+RWE+RQAKVL QAK+R M ++K SDK+ SYW  +W KP+DY+ +EEE K
Sbjct  243   GSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKDYRNSEEEVK  302

Query  1152  eragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             ER+ RAAAAARRWREYSR+G D+ PTFKLPEA +
Sbjct  303   ERSKRAAAAARRWREYSRRGADQPPTFKLPEATT  336



>ref|XP_006294528.1| hypothetical protein CARUB_v10023558mg [Capsella rubella]
 gb|EOA27426.1| hypothetical protein CARUB_v10023558mg [Capsella rubella]
Length=343

 Score =   462 bits (1189),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 241/342 (70%), Positives = 284/342 (83%), Gaps = 10/342 (3%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGG----SGRRKG--FGRIR  416
             MAQ+LSPVCTD+LKFQN V +   R  +          SS  G    +G+R+    GR+R
Sbjct  1     MAQILSPVCTDLLKFQNSVRS--SRSGASRFSPKTTGASSSWGLPRFAGKRRSGSIGRLR  58

Query  417   VAYQE--SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCM  590
             VA ++  S ++ +VADDYYAVLGLLPDA+PE+IKKAYYNCMK+CHPDLSG+D ETTNFCM
Sbjct  59    VATEDASSLSTGDVADDYYAVLGLLPDATPEEIKKAYYNCMKSCHPDLSGNDPETTNFCM  118

Query  591   FINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCP  770
             FIN+IYEILSDPVQR+VYDEIHGYA TA NPF DDS+P+DHVFVDEF+CIGCKNCANV P
Sbjct  119   FINDIYEILSDPVQRMVYDEIHGYAVTATNPFLDDSTPRDHVFVDEFACIGCKNCANVAP  178

Query  771   KVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVA  950
              +F+IEEDFGRAR  +Q G+ +LIQQA+E+CPVDCIH TSAAQLSLLEDEMRRVERVNVA
Sbjct  179   DIFEIEEDFGRARACNQRGNPDLIQQAVETCPVDCIHQTSAAQLSLLEDEMRRVERVNVA  238

Query  951   LMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQ  1130
             LMLSGMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K  D++ SYWD LW K  +YQ
Sbjct  239   LMLSGMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKNIDETPSYWDNLWGKENNYQ  298

Query  1131  TTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
              +EEE +ERA RAAAAARRWREYSR+GVDKRPTFKLP++ASK
Sbjct  299   KSEEEVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSASK  340



>ref|XP_006446824.1| hypothetical protein CICLE_v10017707mg [Citrus clementina]
 gb|ESR60064.1| hypothetical protein CICLE_v10017707mg [Citrus clementina]
Length=340

 Score =   461 bits (1186),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 239/334 (72%), Positives = 277/334 (83%), Gaps = 2/334 (1%)
 Frame = +3

Query  258   AQLLSPVCTDILKFQNPVHNLFPRKRSPIL-GTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             AQLL+PVC D+LK QNP  N F  + S  L   N +S+S  G S +R+  GR RV  ++S
Sbjct  3     AQLLTPVCIDVLKLQNPSLNSFSSRSSSRLLANNSSSLSLMGHSSKRRSCGRARVTAEDS  62

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A+++ +ADDYYAVLGLLPDA+PEQIKKAYYNCMKACHPDLSGDD ETTNFCMFINE+Y +
Sbjct  63    ASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAV  122

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGY+  A NPF DDS PKDHVFVDEFSCIGCKNC NV P+VF IEED
Sbjct  123   LSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEED  182

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARVY+Q G  E +QQAIESCPVDCIH TSA QLSLLEDEMRRVERVNVA+MLSGMG+
Sbjct  183   FGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGMGS  242

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVR-MTKQKGSDKSDSYWDYLWAKPRDYQTTeeeak  1151
              S DVFRMAS+RWE+RQAKVL QAK+R M ++K SDK+ SYW  +W KP++Y+ +EEE K
Sbjct  243   GSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKEYRNSEEEVK  302

Query  1152  eragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             ER+ RAAAAAR WREYSR+G D+ PTFKLPEA +
Sbjct  303   ERSKRAAAAARTWREYSRRGADQPPTFKLPEATT  336



>ref|XP_006468984.1| PREDICTED: uncharacterized protein LOC102624088 isoform X1 [Citrus 
sinensis]
Length=343

 Score =   459 bits (1182),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 236/337 (70%), Positives = 274/337 (81%), Gaps = 5/337 (1%)
 Frame = +3

Query  258   AQLLSPVCTDILKFQNPVHNLFPRKRS-PILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             AQLL+PVC D+LK QNP  N F  + S  +L  N +S+S  G S +R+  GR RV  ++S
Sbjct  3     AQLLTPVCIDVLKLQNPSLNSFSSRSSWRLLDNNSSSLSLMGHSSKRRSCGRARVTAEDS  62

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A+++ +ADDYYAVLGLLPDA+PEQIKKAYYNCMKACHPDLSGDD ETTNFCMFINE+Y +
Sbjct  63    ASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAV  122

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGY+  A NPF DDS PKDHVFVDEFSCIGCKNC NV P+VF IEED
Sbjct  123   LSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEED  182

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARVY+Q G  E +QQAIESCPVDCIH TSA QLSLLEDEMRRVERVNVA+MLSGMG+
Sbjct  183   FGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGMGS  242

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVR-MTKQKGSDKSDSYWDYLWAKPRDYQTTeeeak  1151
              S DVFRMAS+RWE+RQAKVL QAK+R M ++K SDK+ SYW  +W KP+DY+ +    +
Sbjct  243   GSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKDYRNSVVAEE  302

Query  1152  erag---raaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             E      RAAAAARRWREYSR+G D+ PTFKLPEA +
Sbjct  303   EVKERSKRAAAAARRWREYSRRGADQPPTFKLPEATT  339



>ref|NP_565982.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
 gb|AAL47445.1| At2g42750/F7D19.25 [Arabidopsis thaliana]
 gb|AAD21732.2| expressed protein [Arabidopsis thaliana]
 gb|AAM19907.1| At2g42750/F7D19.25 [Arabidopsis thaliana]
 gb|AAM62780.1| unknown [Arabidopsis thaliana]
 gb|AEC10164.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
Length=344

 Score =   459 bits (1182),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 236/341 (69%), Positives = 281/341 (82%), Gaps = 7/341 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPV----HNLFPRKRSPILGTNCN-SVSSHGGSGRRKGFGRIRV  419
             MAQ+LSPVCTD+LKFQN          PR  +   G + +  +  + G  R    GR+RV
Sbjct  1     MAQILSPVCTDLLKFQNSALSSRSGASPRFSAKTTGASSSWYLPRYAGKRRTDSIGRLRV  60

Query  420   AYQE--SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMF  593
             A ++  S ++ +VADDYYAVLGLLPDA+ E+IKKAYYNCMK+CHPDLSG+D ETTNFCMF
Sbjct  61    ATEDASSLSTGDVADDYYAVLGLLPDATQEEIKKAYYNCMKSCHPDLSGNDPETTNFCMF  120

Query  594   INEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPK  773
             IN+IYEILSDPVQR+VYDEIHGY  TAINPF DDS+P+DHVFVDEF+CIGCKNCANV P 
Sbjct  121   INDIYEILSDPVQRMVYDEIHGYTVTAINPFLDDSTPRDHVFVDEFACIGCKNCANVAPD  180

Query  774   VFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVAL  953
             +F IEEDFGRAR  +Q G+ +L+QQA+E+CPVDCIH TSAAQLSLLEDEMRRVERVNVAL
Sbjct  181   IFQIEEDFGRARACNQRGNPDLVQQAVETCPVDCIHQTSAAQLSLLEDEMRRVERVNVAL  240

Query  954   MLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQT  1133
             MLSGMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K +D++ SYWD LW K  +YQ 
Sbjct  241   MLSGMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKNTDETPSYWDNLWGKQNEYQK  300

Query  1134  TeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
             +EEE +ERA RAAAAARRWREYSR+GVDKRPTFKLP++AS+
Sbjct  301   SEEEVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSASR  341



>gb|KDO63411.1| hypothetical protein CISIN_1g019284mg [Citrus sinensis]
Length=343

 Score =   458 bits (1178),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 236/337 (70%), Positives = 273/337 (81%), Gaps = 5/337 (1%)
 Frame = +3

Query  258   AQLLSPVCTDILKFQNPVHNLFPRKRSPIL-GTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             AQLL+PVC D+LK QNP  N F  + S  L   N +S+S  G S +R+  GR RV  ++S
Sbjct  3     AQLLTPVCIDVLKLQNPSLNSFSSRSSSRLLANNSSSLSLMGHSSKRRSCGRARVTAEDS  62

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A+++ +ADDYYAVLGLLPDA+PEQIKKAYYNCMKACHPDLSGDD ETTNFCMFINE+Y +
Sbjct  63    ASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAV  122

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGY+  A NPF DDS PKDHVFVDEFSCIGCKNC NV P+VF IEED
Sbjct  123   LSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEED  182

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARVY+Q G  E +QQAIESCPVDCIH TSA QLSLLEDEMRRVERVNVA+MLSGMG+
Sbjct  183   FGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGMGS  242

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVR-MTKQKGSDKSDSYWDYLWAKPRDYQTTeeeak  1151
              S DVFRMAS+RWE+RQAKVL QAK+R M ++K SDK+ SYW  +W KP+DY+ +    +
Sbjct  243   GSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKDYRNSVVAEE  302

Query  1152  erag---raaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             E      RAAAAARRWREYSR+G D+ PTFKLPEA +
Sbjct  303   EVKERSKRAAAAARRWREYSRRGADQPPTFKLPEATT  339



>ref|XP_006411543.1| hypothetical protein EUTSA_v10016894mg [Eutrema salsugineum]
 gb|ESQ52996.1| hypothetical protein EUTSA_v10016894mg [Eutrema salsugineum]
Length=338

 Score =   457 bits (1176),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 238/337 (71%), Positives = 280/337 (83%), Gaps = 5/337 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCN-SVSSHGGSGRRKGFGRIRVAYQE  431
             MAQLLSPVCTD+LKFQN V  L  R  +          + S+ G GR    GR+RVA ++
Sbjct  1     MAQLLSPVCTDLLKFQNSV--LSSRSCASRFSAKTGVCLPSYAGKGRSGAVGRLRVATED  58

Query  432   --SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
               S ++ +V DDYYAVLGLLPDA+ E+IKKAYYNCMK+CHPDLSG+D ETTNFCMFIN+I
Sbjct  59    ASSLSTGDVDDDYYAVLGLLPDATQEEIKKAYYNCMKSCHPDLSGNDPETTNFCMFINDI  118

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             YEILSDPVQR+VYDEIHGYA TAINPF D+SSPKDHVFVDEF+CIGCKNCANV P VF I
Sbjct  119   YEILSDPVQRMVYDEIHGYAVTAINPFLDESSPKDHVFVDEFACIGCKNCANVAPDVFKI  178

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EEDFGRAR  +Q G+ +L+QQA+E+CPVDCI+ TSAAQLSLLEDEMRRVERVNVALMLSG
Sbjct  179   EEDFGRARACNQRGNPDLVQQAVETCPVDCIYQTSAAQLSLLEDEMRRVERVNVALMLSG  238

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K ++++ +YWD LW K   YQ +EEE
Sbjct  239   MGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKSTEETPTYWDNLWGKQNQYQKSEEE  298

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
              +ERA RAAAAARRWREYSR+GVDKRPTFKLP++AS+
Sbjct  299   VQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSASR  335



>emb|CDY50820.1| BnaC04g52570D [Brassica napus]
Length=340

 Score =   457 bits (1176),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 240/337 (71%), Positives = 280/337 (83%), Gaps = 6/337 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKG--FGRIRVAYQ  428
             MAQLLSPVCTD+LKFQ+ V  L  R R     T+  + SS     RR     GR+RVA +
Sbjct  1     MAQLLSPVCTDLLKFQSSV--LSSRSRHLSAKTSGAAASSWCLRKRRSSGSIGRLRVATE  58

Query  429   E--SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINE  602
             +  S ++ +VADDYYAVLGLLPDA+PE+IKKAYYNCMK+CHPDLSG+D ETTNFCMFIN+
Sbjct  59    DASSLSTGDVADDYYAVLGLLPDATPEEIKKAYYNCMKSCHPDLSGNDPETTNFCMFIND  118

Query  603   IYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFD  782
             +YEILSDPVQR+VYDEIHGYA TA NPF DDSSPKDHVFVDEF+CIGCKNCANV P +F 
Sbjct  119   VYEILSDPVQRMVYDEIHGYAVTATNPFLDDSSPKDHVFVDEFACIGCKNCANVAPDIFK  178

Query  783   IEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLS  962
             IEEDFGRAR  +Q G+ +L+QQA+E+CPVDCI+ TSAAQLSLLEDEMRRVERVNVALMLS
Sbjct  179   IEEDFGRARACNQRGNPDLLQQAVETCPVDCIYQTSAAQLSLLEDEMRRVERVNVALMLS  238

Query  963   GMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTee  1142
             GMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K +D+  SYWD LW K   YQ +EE
Sbjct  239   GMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKSTDEEPSYWDNLWGKDNQYQKSEE  298

Query  1143  eakeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             E +ERA RAAAAARRWREYSR+GVDKRPTFKLP+++S
Sbjct  299   EVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSSS  335



>ref|XP_003596710.1| Chaperone protein dnaJ [Medicago truncatula]
 gb|ACJ84986.1| unknown [Medicago truncatula]
 gb|AES66961.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=338

 Score =   457 bits (1175),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 240/337 (71%), Positives = 276/337 (82%), Gaps = 2/337 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSP  T+ LK  NP  NL  +     L  + +  S    S +R+  GR+RV  ++S
Sbjct  1     MAQLLSPFYTEALKINNPSLNLCSKTSWRKLTKHASPCSLAMESDKRRKCGRLRVEAEDS  60

Query  435   A-ASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
                 +  ADDYYAVLGL PDA+PEQIKKAYY+CMKACHPDLSG++ ETTNFCMFINE+Y 
Sbjct  61    VYPVDTTADDYYAVLGLFPDATPEQIKKAYYDCMKACHPDLSGNNPETTNFCMFINEVYA  120

Query  612   ILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEE  791
             +LSDP+QR VYDEIHGY+ T+ NPFFDDS PKDHVFVDEFSCIGCKNCANV P VF +EE
Sbjct  121   VLSDPIQRNVYDEIHGYSLTSTNPFFDDSCPKDHVFVDEFSCIGCKNCANVAPDVFAMEE  180

Query  792   DFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             DFGRARV+SQ G+ EL+QQAI+SCPVDCIHWTSAAQLSLLEDEMRR+ERVNVALMLSGMG
Sbjct  181   DFGRARVFSQRGNPELVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRIERVNVALMLSGMG  240

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeak  1151
             +AS DVFRMA +RWEKRQ+KVL QAK+RM +Q+ S K+DSYWD LW +P+DYQ +E+E K
Sbjct  241   SASFDVFRMARSRWEKRQSKVLEQAKMRMMRQESSGKTDSYWDNLWGQPKDYQNSEDETK  300

Query  1152  eragraaaaarrwreYSRKGVDKRPTFKLPEA-ASKD  1259
             ERA RAAAAARRWREYSRKGVDK P FKLPEA  SKD
Sbjct  301   ERAERAAAAARRWREYSRKGVDKPPKFKLPEAEPSKD  337



>ref|XP_004150330.1| PREDICTED: uncharacterized protein LOC101218014 [Cucumis sativus]
 ref|XP_004165728.1| PREDICTED: uncharacterized protein LOC101224265 [Cucumis sativus]
 gb|KGN61129.1| hypothetical protein Csa_2G058620 [Cucumis sativus]
Length=333

 Score =   456 bits (1173),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 243/336 (72%), Positives = 277/336 (82%), Gaps = 10/336 (3%)
 Frame = +3

Query  255   MAQLLSPVCTD--ILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MA LLSPVCTD  IL+ Q P+  L P +  P          S G +  R+  G ++VA +
Sbjct  1     MAHLLSPVCTDTIILQSQPPIL-LTPWRSLP------KPTPSFGRAPGRRNCGSLKVASR  53

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             +SA++E VADDYYAVLGLLPDASPEQIKKAYYNCMK CHPDL+GDD++TTNFCMFINE+Y
Sbjct  54    DSASTESVADDYYAVLGLLPDASPEQIKKAYYNCMKECHPDLTGDDQDTTNFCMFINEVY  113

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
             E+LSDPVQRLVYDEIHGYA TAINPF DDSS KD  FVDEFSCIGCKNCANV P VF IE
Sbjct  114   EVLSDPVQRLVYDEIHGYALTAINPFIDDSSTKDLAFVDEFSCIGCKNCANVAPDVFGIE  173

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             EDFGRARVYSQ G+ + +Q+AI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVA MLSGM
Sbjct  174   EDFGRARVYSQCGNQQRVQEAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVAFMLSGM  233

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMT-KQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             G++++DVFR+AS+RWEKRQAKVL +AKVRMT K+K SD  DSYW  LW  P+D + +EEE
Sbjct  234   GSSAVDVFRLASSRWEKRQAKVLEKAKVRMTKKKKNSDTDDSYWSNLWGTPKDQRNSEEE  293

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
               ERA RAAAAARRWREYSR+GVDK PTFKLPE+ S
Sbjct  294   TNERAKRAAAAARRWREYSRRGVDKPPTFKLPESIS  329



>ref|XP_010506113.1| PREDICTED: uncharacterized protein LOC104782785 isoform X2 [Camelina 
sativa]
Length=345

 Score =   456 bits (1174),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 237/342 (69%), Positives = 278/342 (81%), Gaps = 8/342 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSS------HGGSGRRKGFGRIR  416
             MAQ+LSPVCTD+LKFQN V +      S          SS      + G  R    GR+R
Sbjct  1     MAQILSPVCTDLLKFQNSVVSSRSGASSRFSAKTTAGASSSWGLPRYAGKKRSGSIGRLR  60

Query  417   VAYQE--SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCM  590
             VA ++  S ++ +VADDYYAVLGLLPDA+P +IKKAYYNCMK+CHPDLSG+D ETTNFC+
Sbjct  61    VATEDASSLSTGDVADDYYAVLGLLPDATPAEIKKAYYNCMKSCHPDLSGNDPETTNFCI  120

Query  591   FINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCP  770
             FIN+IYEILSDPVQR+VYDEIHGYA TA NPF DDSSP+DHVFVDEF+CIGCKNCANV P
Sbjct  121   FINDIYEILSDPVQRMVYDEIHGYAVTATNPFLDDSSPRDHVFVDEFACIGCKNCANVAP  180

Query  771   KVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVA  950
              +F+IEEDFGRAR  +Q G+ +LIQ A+E+CPVDCIH TSAAQLSLLEDEMRRVERVNVA
Sbjct  181   DIFEIEEDFGRARACNQRGNPDLIQLAVETCPVDCIHQTSAAQLSLLEDEMRRVERVNVA  240

Query  951   LMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQ  1130
             LMLSGMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K +D++ SYWD LW +  DYQ
Sbjct  241   LMLSGMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKNTDETPSYWDNLWGQQNDYQ  300

Query  1131  TTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
              +EEE +ERA RAAAAARRWREYSR+GVDKRPTFKLP++A K
Sbjct  301   KSEEEVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSACK  342



>ref|XP_011033756.1| PREDICTED: uncharacterized protein LOC105132130 [Populus euphratica]
Length=336

 Score =   456 bits (1173),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 245/338 (72%), Positives = 284/338 (84%), Gaps = 5/338 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNP--VHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MAQL+SPVCTD LK + P  V ++  R ++ +     NS S    + +R+ FGR+RVA  
Sbjct  1     MAQLMSPVCTDALKIKKPSNVFHISSRGKTTLYH---NSNSGSVLNSKRRDFGRVRVAAN  57

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
              SA+++ VADDYYAVLGLLPDA+PEQIKKAYY+CMKACHPDLSG+D +TTNFCMFINE+Y
Sbjct  58    SSASADAVADDYYAVLGLLPDATPEQIKKAYYSCMKACHPDLSGNDPDTTNFCMFINEVY  117

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
              +LSDP+QR++YDEIHG+A TA+NPFFDDSSPKDH FVDEFSCIGCKNCANV P VF IE
Sbjct  118   AVLSDPLQRMIYDEIHGFALTAMNPFFDDSSPKDHAFVDEFSCIGCKNCANVAPDVFGIE  177

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             EDFGRARVY+Q G+ EL+QQAIESCPVDCIHWTSAAQLSLLEDEMRRVER+NVALMLSGM
Sbjct  178   EDFGRARVYNQCGNLELVQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERINVALMLSGM  237

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G+A  DVFRMA +RWEKRQAK+L QAK+RM KQK  DK  SYW  LW  P++ Q++EEE 
Sbjct  238   GSAGADVFRMACSRWEKRQAKILEQAKIRMMKQKDVDKKGSYWSDLWGNPKENQSSEEET  297

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAASKDN  1262
             KERA RAAAAARRWREYSRKGVDK PTFKLPEA S ++
Sbjct  298   KERARRAAAAARRWREYSRKGVDKPPTFKLPEAISNND  335



>ref|XP_010508533.1| PREDICTED: uncharacterized protein LOC104785091 [Camelina sativa]
Length=348

 Score =   456 bits (1172),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 242/345 (70%), Positives = 281/345 (81%), Gaps = 11/345 (3%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPV---HNLFPRKRSPILGTNCNSVSSHGGSGRRKG------FG  407
             MAQ+LSPVCTD+LKFQN V    +     R     T   S SS GG  R  G       G
Sbjct  1     MAQILSPVCTDLLKFQNSVLSSRSGASSSRFSAKTTTGASSSSWGGLPRYAGKKRSGSIG  60

Query  408   RIRVAYQE--SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTN  581
             R+RVA ++  S ++ +VADDYYAVLGLLPDA+P +IKKAYYNCMK+CHPDLSG+D ETTN
Sbjct  61    RLRVATEDASSLSTGDVADDYYAVLGLLPDATPAEIKKAYYNCMKSCHPDLSGNDPETTN  120

Query  582   FCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCAN  761
             FC+FIN+IYEILSDPVQR+VYDEIHGYA TA NPF DDSSP+DHVFVDEF+CIGCKNCAN
Sbjct  121   FCIFINDIYEILSDPVQRMVYDEIHGYAVTATNPFLDDSSPRDHVFVDEFACIGCKNCAN  180

Query  762   VCPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERV  941
             V P +F+IEEDFGRAR  +Q G+ +LIQ A+E+CPVDCIH TSAAQLSLLEDEMRRVERV
Sbjct  181   VAPDIFEIEEDFGRARACNQRGNPDLIQLAVETCPVDCIHQTSAAQLSLLEDEMRRVERV  240

Query  942   NVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPR  1121
             NVALMLSGMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K +D++ SYWD LW +  
Sbjct  241   NVALMLSGMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKNTDEAPSYWDNLWGQQN  300

Query  1122  DYQTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
             DYQ +EEE +ERA RAAAAARRWREYSR+GVDKRPTFKLP+ ASK
Sbjct  301   DYQKSEEEVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDTASK  345



>ref|XP_010102119.1| DnaJ homolog subfamily A member 3 [Morus notabilis]
 gb|EXB92369.1| DnaJ homolog subfamily A member 3 [Morus notabilis]
Length=350

 Score =   456 bits (1172),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 245/346 (71%), Positives = 282/346 (82%), Gaps = 11/346 (3%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPI---LGTNCNSVSSHGGSGRRKG-FGRIRVA  422
             MAQLLSP+C + L FQNP+ +    +       + +   +++ HGG G+R+G  GR+RVA
Sbjct  1     MAQLLSPLCAEALNFQNPLLSSSCSRSLCRVFAMTSGGLTLTGHGGIGKRRGCVGRVRVA  60

Query  423   YQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINE  602
              ++SA+ + VADDYY VLGLLPDA+P QIKK YYNCMKACHPDLSG+D ET NFCMFINE
Sbjct  61    AKDSASMDAVADDYYEVLGLLPDATPAQIKKGYYNCMKACHPDLSGNDPETNNFCMFINE  120

Query  603   IY-------EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCAN  761
             +Y       ++LSDPVQR++YDEIHGYA TAINPF DD S KDH FVDEFSCIGCKNCAN
Sbjct  121   VYAKLTIAVQVLSDPVQRMIYDEIHGYALTAINPFVDDLSSKDHAFVDEFSCIGCKNCAN  180

Query  762   VCPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERV  941
             V P VF IEEDFGRARVY+Q G+ EL+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERV
Sbjct  181   VAPDVFGIEEDFGRARVYNQCGNPELVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERV  240

Query  942   NVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPR  1121
             NVALMLSGMG +SIDVFRMAS+RWEKRQAKVL QAKVRMTKQK  DK++SYW  LW KP+
Sbjct  241   NVALMLSGMGLSSIDVFRMASSRWEKRQAKVLRQAKVRMTKQKDGDKTNSYWSNLWGKPK  300

Query  1122  DYQTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASKD  1259
             +Y  +EEE KERA RAAAAARRWREYSR+G DK PTFKLPE  S +
Sbjct  301   EYVNSEEEVKERAKRAAAAARRWREYSRRGADKPPTFKLPEEISDN  346



>ref|XP_008451842.1| PREDICTED: uncharacterized protein LOC103493004 [Cucumis melo]
Length=333

 Score =   454 bits (1169),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 240/341 (70%), Positives = 279/341 (82%), Gaps = 14/341 (4%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSV----SSHGGSGRRKGFGRIRVA  422
             MA LLSPVCT+ +K Q+         + PIL T   S+    ++ G    R+    ++VA
Sbjct  1     MAHLLSPVCTETIKLQS---------QPPILLTPWRSLPKPSAAIGRGPARRNCSSLKVA  51

Query  423   YQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINE  602
              ++SA++E VADDYYAVLGLLPDASPEQIKKAYYNCMK CHPDLSGDD++TTNFCMFINE
Sbjct  52    ARDSASTESVADDYYAVLGLLPDASPEQIKKAYYNCMKECHPDLSGDDQDTTNFCMFINE  111

Query  603   IYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFD  782
             +YE+LSDPVQRLVYDEIHGYA TAINPF DDSS KD  FVDEFSCIGCKNCANV P VF 
Sbjct  112   VYEVLSDPVQRLVYDEIHGYALTAINPFIDDSSTKDLAFVDEFSCIGCKNCANVAPDVFG  171

Query  783   IEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLS  962
             IEEDFGRARVYSQ G+ + +Q+AI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVA MLS
Sbjct  172   IEEDFGRARVYSQCGNQQRVQEAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVAFMLS  231

Query  963   GMGAASIDVFRMASTRWEKRQAKVLGQAKVRMT-KQKGSDKSDSYWDYLWAKPRDYQTTe  1139
             GMG++++DVFR+AS+RWEKRQAKVL +AKVRM  K+K SD  DSYW  LW +P+D + +E
Sbjct  232   GMGSSAVDVFRLASSRWEKRQAKVLEKAKVRMMKKKKNSDTDDSYWSNLWGRPKDQRNSE  291

Query  1140  eeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASKDN  1262
             EE  ERA RAAAAARRWREYSR+GVDK PTFKLPE+ S ++
Sbjct  292   EETNERAKRAAAAARRWREYSRRGVDKPPTFKLPESISSND  332



>ref|XP_010517816.1| PREDICTED: uncharacterized protein LOC104793202 [Camelina sativa]
Length=345

 Score =   455 bits (1170),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 238/342 (70%), Positives = 280/342 (82%), Gaps = 8/342 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGG----SGRRKG--FGRIR  416
             MAQ+LSPVCTD+LKFQN V +      S          SS  G    +G+R+    GR+R
Sbjct  1     MAQILSPVCTDLLKFQNSVLSSRSGASSRFSAKTTAGASSSWGLPRYAGKRRSGSIGRLR  60

Query  417   VAYQE--SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCM  590
             VA ++  S ++ +VADDYYAVLGLLPDA+P +IKKAYYNCMK+CHPDLSG+D ETTNFC+
Sbjct  61    VATEDASSLSTGDVADDYYAVLGLLPDATPAEIKKAYYNCMKSCHPDLSGNDPETTNFCI  120

Query  591   FINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCP  770
             FIN+IYEILSDPVQR+VYDEIHGYA TA NPF DDSSP+DHVFVDEF+CIGCKNCANV P
Sbjct  121   FINDIYEILSDPVQRMVYDEIHGYAVTATNPFLDDSSPRDHVFVDEFACIGCKNCANVAP  180

Query  771   KVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVA  950
              +F+IEEDFGRAR  +Q G+ +LIQ A+E+CPVDCIH TSAAQLSLLEDEMRRVERVNVA
Sbjct  181   DIFEIEEDFGRARACNQRGNPDLIQLAVETCPVDCIHQTSAAQLSLLEDEMRRVERVNVA  240

Query  951   LMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQ  1130
             LMLSGMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K +D+  SYWD LW +   YQ
Sbjct  241   LMLSGMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKNTDEEPSYWDNLWGQQNGYQ  300

Query  1131  TTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
              +EEE +ERA RAAAAARRWREYSR+GVDKRPTFKLP++ASK
Sbjct  301   KSEEEVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSASK  342



>ref|XP_002320418.2| hypothetical protein POPTR_0014s14030g [Populus trichocarpa]
 gb|EEE98733.2| hypothetical protein POPTR_0014s14030g [Populus trichocarpa]
Length=392

 Score =   456 bits (1173),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 244/337 (72%), Positives = 283/337 (84%), Gaps = 6/337 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNP--VHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MAQL+SPVCTD LK + P  V ++  R ++ +   N  SV +     +R+ FGRIRVA  
Sbjct  58    MAQLISPVCTDALKIKKPSNVFHISSRGKTALYHNNSRSVLN----SKRRDFGRIRVAAN  113

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
              SA+++ VADDYYAVLGLLPDA+PEQIKKAYY+CMKACHPDLSG+D +TTNFCMFINE+Y
Sbjct  114   SSASADAVADDYYAVLGLLPDATPEQIKKAYYSCMKACHPDLSGNDTDTTNFCMFINEVY  173

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
              +LSDP+QR++YDEIHG+A TA+NPFFDDSSPKDH FVDEFSCIGCKNCANV P+VF IE
Sbjct  174   AVLSDPLQRMIYDEIHGFALTAMNPFFDDSSPKDHAFVDEFSCIGCKNCANVAPEVFGIE  233

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             EDFGRARVYSQ G+ +L+QQAIESCPVDCIHWTSAAQLSLLEDEMRRVER+NVALMLSGM
Sbjct  234   EDFGRARVYSQCGNLQLVQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERINVALMLSGM  293

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G+A  DVFRMA +RWEKRQAK+L QAK+RM KQK  DK  SYW  LW  P++ Q++EEE 
Sbjct  294   GSAGADVFRMACSRWEKRQAKILDQAKIRMMKQKDVDKKGSYWSDLWGNPKENQSSEEET  353

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAASKD  1259
             KERA RAAAAARRWREYSRKGVDK P +KLPEA S +
Sbjct  354   KERARRAAAAARRWREYSRKGVDKPPAYKLPEAISNN  390



>gb|KDO63413.1| hypothetical protein CISIN_1g019284mg [Citrus sinensis]
Length=338

 Score =   453 bits (1166),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 239/334 (72%), Positives = 276/334 (83%), Gaps = 4/334 (1%)
 Frame = +3

Query  258   AQLLSPVCTDILKFQNPVHNLFPRKRSPIL-GTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             AQLL+PVC D+LK QNP  N F  + S  L   N +S+S  G S +R+  GR RV  ++S
Sbjct  3     AQLLTPVCIDVLKLQNPSLNSFSSRSSSRLLANNSSSLSLMGHSSKRRSCGRARVTAEDS  62

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A+++ +ADDYYAVLGLLPDA+PEQIKKAYYNCMKACHPDLSGDD ETTNFCMFINE+Y +
Sbjct  63    ASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAV  122

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGY+  A NPF DDS PKDHVFVDEFSCIGCKNC NV P+VF IEED
Sbjct  123   LSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEED  182

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARVY+Q G  E +QQAIESCPVDCIH TSA QLSLLEDEMRRVER  VA+MLSGMG+
Sbjct  183   FGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVER--VAMMLSGMGS  240

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVR-MTKQKGSDKSDSYWDYLWAKPRDYQTTeeeak  1151
              S DVFRMAS+RWE+RQAKVL QAK+R M ++K SDK+ SYW  +W KP+DY+ +EEE K
Sbjct  241   GSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKDYRNSEEEVK  300

Query  1152  eragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             ER+ RAAAAARRWREYSR+G D+ PTFKLPEA +
Sbjct  301   ERSKRAAAAARRWREYSRRGADQPPTFKLPEATT  334



>ref|XP_004505462.1| PREDICTED: chaperone protein DnaJ-like isoform X1 [Cicer arietinum]
Length=342

 Score =   451 bits (1160),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 243/342 (71%), Positives = 279/342 (82%), Gaps = 6/342 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAY-QE  431
             MAQLLSPV ++  K  NP  NL PR    +L     + +    + +R+  GR+RVA  Q+
Sbjct  1     MAQLLSPVYSEAFKIHNPSLNLCPRTSWQMLQKTSTTWNFVTNTYKRRRCGRLRVAADQD  60

Query  432   SAASEE--VADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
             S A+ +   A+DYYAVLGLLPDA+PEQIKKAYYNCMK CHPDLSG+D E TNFC+FINE+
Sbjct  61    SFATTDSAAAEDYYAVLGLLPDATPEQIKKAYYNCMKTCHPDLSGNDPEVTNFCIFINEV  120

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             YE+LSDP+QR++YDEIHGY+ T+INPF DDSSPKDHVFVDEFSCIGCKNCANV   VF I
Sbjct  121   YEVLSDPLQRMIYDEIHGYSLTSINPFLDDSSPKDHVFVDEFSCIGCKNCANVACDVFGI  180

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EEDFGRARVYSQ G+ E IQQAI+SCPVDCIHWTSAAQLSLLEDEMRR+ERVNVALMLSG
Sbjct  181   EEDFGRARVYSQCGNPESIQQAIDSCPVDCIHWTSAAQLSLLEDEMRRIERVNVALMLSG  240

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MG+AS DVFRMA++RWEKRQ K L QA++RM KQKG +K+DSYWD L  KPRDY  +EEE
Sbjct  241   MGSASSDVFRMANSRWEKRQLKFLEQARLRMMKQKGYNKTDSYWDNLRGKPRDYDRSEEE  300

Query  1146  akeragraaaaarrwreYSRKGVDKRPTF--KLPEAAS-KDN  1262
              KERA RAAAAAR+WREYSRKG DK+P    KLPEAAS KDN
Sbjct  301   VKERAKRAAAAARKWREYSRKGADKKPQTYNKLPEAASTKDN  342



>ref|XP_003540004.1| PREDICTED: uncharacterized protein LOC100812547 [Glycine max]
 gb|KHN34249.1| Protein CAJ1 [Glycine soja]
Length=332

 Score =   450 bits (1157),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 241/335 (72%), Positives = 279/335 (83%), Gaps = 8/335 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSPV T+ LK  + + ++   +  P   T  N V+ +G   +R+G GR+RVA +E 
Sbjct  1     MAQLLSPVYTEPLK--SNLSSISSWRILPKTATLSNFVTHNG---KRRGCGRVRVAAEEK  55

Query  435   A--ASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             +   S+ VADDYYAVLGLLPDA+P QIKKAYYNCMKACHPDLS +D E TNFC FINE+Y
Sbjct  56    SFSTSDTVADDYYAVLGLLPDATPAQIKKAYYNCMKACHPDLSDNDPEATNFCTFINEVY  115

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
              +LSDP+QR++YD+IHGY+ T+INPF DDSSPKDHVFVDEFSCIGCKNCANV   VF IE
Sbjct  116   GVLSDPIQRMIYDDIHGYSLTSINPFLDDSSPKDHVFVDEFSCIGCKNCANVACDVFGIE  175

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             E+FGRARVYSQ G  EL+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM
Sbjct  176   EEFGRARVYSQCGKPELVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  235

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G+A  DVFRMAS+RWEKRQAKVL QAK+RM K+KGSDK+D +W+ LW KP+D  ++EEE 
Sbjct  236   GSAGTDVFRMASSRWEKRQAKVLEQAKLRMMKEKGSDKTDMFWNNLWGKPKDL-SSEEEI  294

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             KERA RAAAAARRWREYSR+GVDK PTFKLPE AS
Sbjct  295   KERAKRAAAAARRWREYSRRGVDKPPTFKLPETAS  329



>ref|XP_002530203.1| expressed protein, putative [Ricinus communis]
 gb|EEF32177.1| expressed protein, putative [Ricinus communis]
Length=334

 Score =   449 bits (1155),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 241/333 (72%), Positives = 273/333 (82%), Gaps = 7/333 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSV-SSHGGSGRRKGFGRIRVAYQE  431
             M Q +SPVCTD LK QN    L     S ++ +  NS  S+ G S    GF RI+VA  +
Sbjct  1     MTQSMSPVCTDGLKIQN--QWLILGSNSRLIPSKTNSPWSNKGRSPLSSGFRRIKVATSD  58

Query  432   SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
             S++   VADDYYAVLGLLPDA+ EQIKKAYYNCMK CHPDLSG+D +TTNFCMFINE+Y 
Sbjct  59    SSS---VADDYYAVLGLLPDATQEQIKKAYYNCMKECHPDLSGNDPDTTNFCMFINEVYA  115

Query  612   ILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEE  791
             +LSDPVQR+VYDEIHGYA TA+NPF DDS P+DHVFVDEFSCIGCKNC NV   VF IEE
Sbjct  116   VLSDPVQRMVYDEIHGYALTAVNPFLDDSIPRDHVFVDEFSCIGCKNCVNVACDVFKIEE  175

Query  792   DFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             DFGRARV+ Q G+ EL+QQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG
Sbjct  176   DFGRARVHGQCGNSELVQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  235

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKS-DSYWDYLWAKPRDYQTTeeea  1148
             + ++DVFRMAS+RWEKRQ+KVL QAK+RM  QK S+K+  SYW  LW KP+DY+ ++EE 
Sbjct  236   SGAVDVFRMASSRWEKRQSKVLEQAKIRMMNQKDSNKTGSSYWSDLWGKPKDYKRSDEEV  295

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEA  1247
             KERA RAAAAARRWREYSRKGVDK PTFKLPEA
Sbjct  296   KERANRAAAAARRWREYSRKGVDKPPTFKLPEA  328



>ref|XP_006375498.1| hypothetical protein POPTR_0014s14030g [Populus trichocarpa]
 gb|ERP53295.1| hypothetical protein POPTR_0014s14030g [Populus trichocarpa]
Length=390

 Score =   450 bits (1157),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 243/337 (72%), Positives = 282/337 (84%), Gaps = 8/337 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNP--VHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MAQL+SPVCTD LK + P  V ++  R ++ +   N  SV +     +R+ FGRIRVA  
Sbjct  58    MAQLISPVCTDALKIKKPSNVFHISSRGKTALYHNNSRSVLN----SKRRDFGRIRVAAN  113

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
              SA+++ VADDYYAVLGLLPDA+PEQIKKAYY+CMKACHPDLSG+D +TTNFCMFINE+Y
Sbjct  114   SSASADAVADDYYAVLGLLPDATPEQIKKAYYSCMKACHPDLSGNDTDTTNFCMFINEVY  173

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
              +LSDP+QR++YDEIHG+A TA+NPFFDDSSPKDH FVDEFSCIGCKNCANV P+VF IE
Sbjct  174   AVLSDPLQRMIYDEIHGFALTAMNPFFDDSSPKDHAFVDEFSCIGCKNCANVAPEVFGIE  233

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             EDFGRARVYSQ G+ +L+QQAIESCPVDCIHWTSAAQLSLLEDEMRRVER+NVALMLSGM
Sbjct  234   EDFGRARVYSQCGNLQLVQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERINVALMLSGM  293

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G+A  DVFRMA +RWEKRQAK+L  AK+RM KQK  DK  SYW  LW  P++ Q++EEE 
Sbjct  294   GSAGADVFRMACSRWEKRQAKIL--AKIRMMKQKDVDKKGSYWSDLWGNPKENQSSEEET  351

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAASKD  1259
             KERA RAAAAARRWREYSRKGVDK P +KLPEA S +
Sbjct  352   KERARRAAAAARRWREYSRKGVDKPPAYKLPEAISNN  388



>ref|XP_010274415.1| PREDICTED: uncharacterized protein LOC104609738 [Nelumbo nucifera]
Length=334

 Score =   447 bits (1151),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 239/333 (72%), Positives = 265/333 (80%), Gaps = 3/333 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MA+LLS VCTD L FQNP      R R   L  N +   S GG  RR+          + 
Sbjct  1     MAKLLSTVCTDALAFQNPSQFSCSRSRWRALARNNSPWMSVGG--RRRCCKIKATINSDF  58

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
                EE ADDYY VLGLLPDA+PEQIKKAYY+CMKACHPDLSG+D ETTNFC+FINE+Y +
Sbjct  59    TLQEEFADDYYTVLGLLPDATPEQIKKAYYDCMKACHPDLSGNDPETTNFCIFINEVYAV  118

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGYA  AINPF DDSSPKDH FVDEFSCIGCKNCANV P VF IEE+
Sbjct  119   LSDPVQRMVYDEIHGYALMAINPFVDDSSPKDHAFVDEFSCIGCKNCANVAPDVFKIEEE  178

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             +GRARV SQSG+ EL+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG 
Sbjct  179   YGRARVCSQSGNLELVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGT  238

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
             +S DVFRMAS RWEKRQ+KVL +AK+RM KQK SDK+ SYW  LW  P+DYQ T E+ +E
Sbjct  239   SSADVFRMASIRWEKRQSKVLEKAKLRMMKQKDSDKTGSYWSDLWGNPKDYQNT-EDLEE  297

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             RA RAAAA+RRWREYSRKG D+ P FKLPEA S
Sbjct  298   RAKRAAAASRRWREYSRKGADRPPRFKLPEAIS  330



>ref|XP_009142878.1| PREDICTED: uncharacterized protein LOC103866667 [Brassica rapa]
Length=342

 Score =   446 bits (1148),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 235/337 (70%), Positives = 277/337 (82%), Gaps = 5/337 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKG--FGRIRVAYQ  428
             MAQLLSPVCTD+LKFQ+ V +           T+  + SS     RR     GR+RVA +
Sbjct  1     MAQLLSPVCTDLLKFQSSVLSSRSSTSRFSAKTS-GAASSWCLRKRRSSSTIGRLRVATE  59

Query  429   E--SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINE  602
             +  S ++ +VADDYYAVLGLLPDA+PE+IKKAYYNCMK+CHPDL+G+D ETTNFCMFIN+
Sbjct  60    DASSLSTGDVADDYYAVLGLLPDATPEEIKKAYYNCMKSCHPDLNGNDPETTNFCMFIND  119

Query  603   IYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFD  782
             +YEILSDPVQR+VYDEIHGYA TA NPF DDSSPKDHVFVDEF+CIGCKNCANV P +F 
Sbjct  120   VYEILSDPVQRMVYDEIHGYAVTATNPFLDDSSPKDHVFVDEFACIGCKNCANVAPDIFQ  179

Query  783   IEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLS  962
             IEEDFGRAR  +Q G+ +L+QQA+E+CPVDCI+ TSA QLSLLEDEMRRVERVNVALMLS
Sbjct  180   IEEDFGRARACNQRGNPDLLQQAVETCPVDCIYQTSAGQLSLLEDEMRRVERVNVALMLS  239

Query  963   GMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTee  1142
             GMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K +D+  SYWD LW K   YQ +EE
Sbjct  240   GMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKSTDEEPSYWDNLWGKDNQYQKSEE  299

Query  1143  eakeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             E +ERA RAAAAARRWREYSR+GVDKRPTFKLP+++S
Sbjct  300   EVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSSS  336



>ref|XP_003527333.1| PREDICTED: protein CAJ1-like isoform X1 [Glycine max]
Length=332

 Score =   445 bits (1145),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 241/336 (72%), Positives = 278/336 (83%), Gaps = 10/336 (3%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQE-  431
             MAQLLSPV T+ LK  + + ++   +  P   T  N V+ +G   +R+G GR+RVA +E 
Sbjct  1     MAQLLSPVYTEPLK--SNLSSISSWRMLPKTATPSNFVTHNG---KRRGCGRVRVASEEK  55

Query  432   --SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
               S +   V DDYYAVLGLLPDA+P QIKKAYYNCMKACHPDLS +D E TNFC FINE+
Sbjct  56    SFSTSGTAVVDDYYAVLGLLPDATPGQIKKAYYNCMKACHPDLSDNDPEATNFCTFINEV  115

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             Y +LSDP+QR++YDEIHGY+ T+INPF DDSSPKDHVFVDEFSCIGCKNCANV   VF I
Sbjct  116   YGVLSDPIQRMIYDEIHGYSLTSINPFLDDSSPKDHVFVDEFSCIGCKNCANVACDVFGI  175

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EE+FGRARVYSQ G  EL+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG
Sbjct  176   EEEFGRARVYSQCGKPELVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  235

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MG+AS DVFRMAS+RWEKRQAKVL QA++RM K+KGSDK+D +W+ LW KP+D  ++EEE
Sbjct  236   MGSAS-DVFRMASSRWEKRQAKVLEQARLRMMKEKGSDKTDMFWNNLWGKPKDL-SSEEE  293

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
              KERA RAAAAARRWREYSR+GVDK PTFKLPE AS
Sbjct  294   IKERAKRAAAAARRWREYSRRGVDKPPTFKLPETAS  329



>gb|KHN33936.1| Protein CAJ1 [Glycine soja]
Length=332

 Score =   445 bits (1144),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 241/336 (72%), Positives = 278/336 (83%), Gaps = 10/336 (3%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQE-  431
             MAQLLSPV T+ LK  + + ++   +  P   T  N V+ +G   +R+G GR+RVA +E 
Sbjct  1     MAQLLSPVYTEPLK--SNLSSISSWRMLPKTATPSNFVTHNG---KRRGCGRVRVASEEK  55

Query  432   --SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
               S +   V DDYYAVLGLLPDA+P QIKKAYYNCMKACHPDLS +D E TNFC FINE+
Sbjct  56    SFSTSDTAVVDDYYAVLGLLPDATPGQIKKAYYNCMKACHPDLSDNDPEATNFCTFINEV  115

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             Y +LSDP+QR++YDEIHGY+ T+INPF DDSSPKDHVFVDEFSCIGCKNCANV   VF I
Sbjct  116   YGVLSDPIQRMIYDEIHGYSLTSINPFLDDSSPKDHVFVDEFSCIGCKNCANVACDVFGI  175

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EE+FGRARVYSQ G  EL+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG
Sbjct  176   EEEFGRARVYSQCGKPELVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  235

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MG+AS DVFRMAS+RWEKRQAKVL QA++RM K+KGSDK+D +W+ LW KP+D  ++EEE
Sbjct  236   MGSAS-DVFRMASSRWEKRQAKVLEQARLRMMKEKGSDKTDMFWNNLWGKPKDL-SSEEE  293

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
              KERA RAAAAARRWREYSR+GVDK PTFKLPE AS
Sbjct  294   IKERAKRAAAAARRWREYSRRGVDKPPTFKLPETAS  329



>gb|KFK37121.1| hypothetical protein AALP_AA4G215500 [Arabis alpina]
Length=342

 Score =   445 bits (1144),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 229/339 (68%), Positives = 278/339 (82%), Gaps = 5/339 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNS---VSSHGGSGRRKGFGRIRVAY  425
             MAQLLSPVCTD+LKFQN + +           ++  S   +  + G  R    GR+RVA 
Sbjct  1     MAQLLSPVCTDLLKFQNSILSSRSSASRFSAKSSGGSSWCLPGYTGKRRSGSIGRLRVAT  60

Query  426   QESAA--SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFIN  599
             +++A+  + ++ADDYY+VLGLLPDA+ E+IKKAYYNCMK+CHPDLSG+D ETTNFCMFIN
Sbjct  61    EDTASLSTGDIADDYYSVLGLLPDATQEEIKKAYYNCMKSCHPDLSGNDPETTNFCMFIN  120

Query  600   EIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVF  779
             +IY ILSDPVQR+VYDEIHGY  TAINPF DDSSPKD+VFVDEF+CIGCKNCANV P +F
Sbjct  121   DIYSILSDPVQRMVYDEIHGYTVTAINPFLDDSSPKDNVFVDEFACIGCKNCANVAPDIF  180

Query  780   DIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML  959
              IEEDFGRAR  +Q G+ +L+QQA+E+CPVDCI+  SAAQLSLLEDEMRRVERVNVALML
Sbjct  181   KIEEDFGRARACNQRGNPDLLQQAVETCPVDCIYKISAAQLSLLEDEMRRVERVNVALML  240

Query  960   SGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTe  1139
             SGMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K +D++ SYWD LW +  DY+ +E
Sbjct  241   SGMGSGAMDVFRMARSRWEKRQAKVLNQARTRMMKRKSTDETPSYWDNLWNQQNDYKKSE  300

Query  1140  eeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
             EE +ERA RAAAAARRWREYSR+GVDKRPTFKLP++ S+
Sbjct  301   EEVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSTSR  339



>ref|XP_010924729.1| PREDICTED: uncharacterized protein LOC105047489 [Elaeis guineensis]
Length=337

 Score =   439 bits (1128),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 236/337 (70%), Positives = 269/337 (80%), Gaps = 7/337 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDIL-KFQNPVHNLF---PRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVA  422
             MAQLLSP+C D+L KFQ+P  +      R+RS  L    +         R +   RI   
Sbjct  1     MAQLLSPLCADLLVKFQSPSPSFLCSGNRRRS--LAQTAHHHRRRRCFRRWRRDVRINAV  58

Query  423   YQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINE  602
               +S + +++ADDYYAVLGLLPDA+P+QIKKAYYNCMKACHPDLSG+D + TNFCMFINE
Sbjct  59    AGDSFSQDDIADDYYAVLGLLPDATPQQIKKAYYNCMKACHPDLSGNDSDITNFCMFINE  118

Query  603   IYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFD  782
             +Y +LSDPVQR+VYDEIHGYA TAINPF DD++PKDH FVDEFSCIGCKNCANV P VF 
Sbjct  119   VYAVLSDPVQRMVYDEIHGYALTAINPFLDDTTPKDHAFVDEFSCIGCKNCANVAPDVFR  178

Query  783   IEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLS  962
             IEEDFGRARV SQSG  EL+QQAI+SCPVDCIHWTSA Q+SLLEDEMRR+ERVNV LMLS
Sbjct  179   IEEDFGRARVCSQSGDPELVQQAIDSCPVDCIHWTSAGQVSLLEDEMRRMERVNVGLMLS  238

Query  963   GMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTee  1142
             GMG +SIDVFRMAS+RWEKRQ K+L +AK+RM KQK SDKS   W  LW KP+ YQ TEE
Sbjct  239   GMGGSSIDVFRMASSRWEKRQTKILEKAKLRMMKQKDSDKSGP-WSDLWGKPKSYQNTEE  297

Query  1143  eakeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             EAKERA  AAAAARRWREYSR+G D+ PTFKLPEA S
Sbjct  298   EAKERAKTAAAAARRWREYSRRGADRPPTFKLPEAIS  334



>ref|XP_006830213.1| hypothetical protein AMTR_s00130p00027180 [Amborella trichopoda]
 gb|ERM97629.1| hypothetical protein AMTR_s00130p00027180 [Amborella trichopoda]
Length=330

 Score =   438 bits (1126),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 239/336 (71%), Positives = 270/336 (80%), Gaps = 12/336 (4%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPV--HNLFPRKRSPILGTNCNSVSSHGGSGR-RKGFGRIRVAY  425
             MA LL PVCT+ L F NP   H+     RSP   TN + +  HG   R RK  G+   A 
Sbjct  1     MALLLLPVCTETLIFHNPFPSHSKNHCFRSP---TNLSWI--HGNRHRDRKVTGK---AA  52

Query  426   QESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
               S++   VADDYY+VLGLLPDA+P+QIKKAYYNCMKACHPDLSG++ +TTNFC+FINE+
Sbjct  53    DSSSSQGTVADDYYSVLGLLPDATPDQIKKAYYNCMKACHPDLSGNEPQTTNFCIFINEV  112

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             YE+LSDPVQR+VYDEIHGYA  AINPF DD+ PKDH FVDEFSCIGCKNCANV P VF I
Sbjct  113   YEVLSDPVQRMVYDEIHGYALIAINPFLDDTKPKDHAFVDEFSCIGCKNCANVAPNVFRI  172

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EEDFGRARVY QS + +L+QQAI++CPVDCIHWTSAAQLSLLEDEMRRVERVNV LMLSG
Sbjct  173   EEDFGRARVYCQSRNPDLVQQAIDTCPVDCIHWTSAAQLSLLEDEMRRVERVNVGLMLSG  232

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MGA + DVF+MASTRWEKRQAKVL +AK+RM KQK SDKS SYW  LW KPR YQ+TEEE
Sbjct  233   MGAMASDVFQMASTRWEKRQAKVLEKAKIRMMKQKESDKSGSYWSDLWGKPRSYQSTEEE  292

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
              +ERA + AAAARRWREYSR GVD+  TFKLPE  S
Sbjct  293   VQERAKKVAAAARRWREYSR-GVDRPSTFKLPEEIS  327



>gb|KDP25749.1| hypothetical protein JCGZ_23709 [Jatropha curcas]
Length=328

 Score =   437 bits (1125),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 238/335 (71%), Positives = 265/335 (79%), Gaps = 13/335 (4%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRR--KGFGRIRVAYQ  428
             MAQL S VCTD LK  +P   +          T   SV+S     R     F R+RVA  
Sbjct  1     MAQLRSTVCTDGLKIWSPWLRVGG-------STQPKSVTSWCWKRRSPSHAFRRLRVATD  53

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             +S     VADDYYAVLGLLPDA+PEQIKKAYYNCMK CHPDLSG+D +T NFCMFINE+Y
Sbjct  54    DSP----VADDYYAVLGLLPDATPEQIKKAYYNCMKECHPDLSGNDPQTNNFCMFINEVY  109

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
              +LSDPVQR+VYDEIHGYA TAINPF DDS+P+D  FVDEFSCIGCKNC NV P VF +E
Sbjct  110   AVLSDPVQRMVYDEIHGYALTAINPFLDDSAPRDLAFVDEFSCIGCKNCCNVAPDVFGLE  169

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             EDFGRARVYSQ G+ EL+QQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM
Sbjct  170   EDFGRARVYSQCGNTELVQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  229

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeea  1148
             G+ S+DVFRMAS+RWEKRQAKVL +AK+RM KQK SD++ SYW   W KP++Y  ++EE 
Sbjct  230   GSRSVDVFRMASSRWEKRQAKVLEKAKIRMMKQKDSDENGSYWSNTWDKPKEYTNSDEEV  289

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             KERA RAAAAARRWREYSRKGVDK PT KLPE  S
Sbjct  290   KERAKRAAAAARRWREYSRKGVDKPPTLKLPETIS  324



>ref|XP_010689743.1| PREDICTED: protein CAJ1 [Beta vulgaris subsp. vulgaris]
Length=339

 Score =   436 bits (1120),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 229/334 (69%), Positives = 264/334 (79%), Gaps = 4/334 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNL---FPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAY  425
             MAQLLSPVC D  K QNPVH       R R  +  T        G S RR       VA 
Sbjct  1     MAQLLSPVCADPFKLQNPVHKFNAHSSRSRWSVQSTRRYKWRVLGQSRRRSSTRVQAVAD  60

Query  426   QESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
                   +E+ADDYYAVLGL PDA+P+QIKKAY+NCMKACHPDL+GDD ET NFC FINE+
Sbjct  61    DSMEMVDELADDYYAVLGLTPDATPQQIKKAYHNCMKACHPDLTGDDPETMNFCKFINEV  120

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             Y +LSDPVQR+VYDEI GY+ TAINPF DDS+P+DHVFVDEFSCIGCKNCANV P VF+I
Sbjct  121   YGVLSDPVQRMVYDEIQGYSLTAINPFMDDSAPRDHVFVDEFSCIGCKNCANVAPDVFEI  180

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EEDFGRAR Y Q G  +L QQAIESCPVDCIHWT+AAQL+LLEDEMRRVERVNVALML+G
Sbjct  181   EEDFGRARAYRQCGMCDLAQQAIESCPVDCIHWTTAAQLTLLEDEMRRVERVNVALMLAG  240

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MGA+S DVFRMA++RWEKRQ+K+L +A++RM K+ G+  +D+YW  LW K ++YQ+TEEE
Sbjct  241   MGASS-DVFRMANSRWEKRQSKILEKARLRMMKENGAAAADAYWSNLWGKQKEYQSTEEE  299

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEA  1247
              KERA RAAAAARRWREYSR+G DK PT+KLPEA
Sbjct  300   VKERARRAAAAARRWREYSRRGADKPPTYKLPEA  333



>ref|XP_008792330.1| PREDICTED: uncharacterized protein LOC103708976 [Phoenix dactylifera]
Length=337

 Score =   435 bits (1119),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 233/337 (69%), Positives = 270/337 (80%), Gaps = 7/337 (2%)
 Frame = +3

Query  255   MAQLLSPVCTD-ILKFQNPVHNLF---PRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVA  422
             MAQLLSP+C D ++KFQ+P  +      R+RS  L    +         RR+   RI   
Sbjct  1     MAQLLSPLCADSLVKFQSPSPSFLCFGNRRRS--LAQTAHHRRRRRCFRRRRRDVRITAV  58

Query  423   YQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINE  602
               +S + +++ADDYYAVLGLLPDA+P+QIKKAYYNCMKACHPDLSG+D E TNFCMFINE
Sbjct  59    AGDSFSEDDIADDYYAVLGLLPDATPQQIKKAYYNCMKACHPDLSGNDSEITNFCMFINE  118

Query  603   IYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFD  782
             +Y +LSDPVQR+VYDEIHGYA TAINPF DD++PKDH FVDEFSCIGCKNCANV P  F 
Sbjct  119   VYTVLSDPVQRMVYDEIHGYALTAINPFLDDTAPKDHAFVDEFSCIGCKNCANVAPDTFW  178

Query  783   IEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLS  962
             IEEDFGRARV SQSG  EL+QQAI+SCPVDCIHWTSAAQ+SLLEDEMRR+ERVNV LML+
Sbjct  179   IEEDFGRARVCSQSGDPELVQQAIDSCPVDCIHWTSAAQISLLEDEMRRMERVNVGLMLA  238

Query  963   GMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTee  1142
             GMG +SIDVFRMAS+RW+KRQ K+L +AK+RM KQK SDKS + W  LW KP+ YQ  EE
Sbjct  239   GMGGSSIDVFRMASSRWQKRQTKILEKAKLRMMKQKDSDKSGA-WSDLWGKPKSYQNREE  297

Query  1143  eakeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             EAKERA  AAAA+RRWREYSR+G D+ PTFKLPEA S
Sbjct  298   EAKERAKTAAAASRRWREYSRRGADRPPTFKLPEAIS  334



>ref|XP_007215649.1| hypothetical protein PRUPE_ppa008260mg [Prunus persica]
 gb|EMJ16848.1| hypothetical protein PRUPE_ppa008260mg [Prunus persica]
Length=339

 Score =   435 bits (1118),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 239/334 (72%), Positives = 278/334 (83%), Gaps = 6/334 (2%)
 Frame = +3

Query  261   QLLSPVCTDILKFQNPVHNLFPRKRSP---ILGTNCNSVSSHGGSGRRKGFGRIRVAYQE  431
             QLLSP  ++ LKFQNP+ N     RSP   ++ T+ +      G  RR+GFGR+RVA   
Sbjct  5     QLLSPGFSEALKFQNPLPNGC--SRSPWRMLVKTSSSQSLMGHGGRRRRGFGRVRVATGG  62

Query  432   SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
             S +++ VADDYY+VLGLLPDA+P QIKKAYYNCMKACHPDLSGDD ETTNFCMFINE+YE
Sbjct  63    SPSTDAVADDYYSVLGLLPDATPAQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYE  122

Query  612   ILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEE  791
             +L+DPVQR+VYDEIHGYA TA+NPF DDS  +DH FVDEFSCIGCKNCANV P VF IEE
Sbjct  123   VLTDPVQRMVYDEIHGYALTAVNPFLDDSITRDHAFVDEFSCIGCKNCANVAPDVFGIEE  182

Query  792   DFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             DFGRARVYSQ G+ +L+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML+GMG
Sbjct  183   DFGRARVYSQCGNPDLVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLAGMG  242

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeak  1151
              +S DVFRMAS RW+KRQ+KVL QAK+RM  QK SDK++SYWD +W+  +DY+ +EEE K
Sbjct  243   -SSADVFRMASARWQKRQSKVLEQAKMRMMNQKDSDKTESYWDNIWSNTKDYRNSEEEVK  301

Query  1152  eragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             ERA R AAAARRWREYSR+G DK P++KLPEA S
Sbjct  302   ERAKRTAAAARRWREYSRRGADKPPSYKLPEAIS  335



>ref|XP_006294527.1| hypothetical protein CARUB_v10023558mg [Capsella rubella]
 gb|EOA27425.1| hypothetical protein CARUB_v10023558mg [Capsella rubella]
Length=326

 Score =   432 bits (1112),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 207/302 (69%), Positives = 246/302 (81%), Gaps = 10/302 (3%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGG----SGRRKG--FGRIR  416
             MAQ+LSPVCTD+LKFQN V +   R  +          SS  G    +G+R+    GR+R
Sbjct  1     MAQILSPVCTDLLKFQNSVRS--SRSGASRFSPKTTGASSSWGLPRFAGKRRSGSIGRLR  58

Query  417   VAYQE--SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCM  590
             VA ++  S ++ +VADDYYAVLGLLPDA+PE+IKKAYYNCMK+CHPDLSG+D ETTNFCM
Sbjct  59    VATEDASSLSTGDVADDYYAVLGLLPDATPEEIKKAYYNCMKSCHPDLSGNDPETTNFCM  118

Query  591   FINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCP  770
             FIN+IYEILSDPVQR+VYDEIHGYA TA NPF DDS+P+DHVFVDEF+CIGCKNCANV P
Sbjct  119   FINDIYEILSDPVQRMVYDEIHGYAVTATNPFLDDSTPRDHVFVDEFACIGCKNCANVAP  178

Query  771   KVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVA  950
              +F+IEEDFGRAR  +Q G+ +LIQQA+E+CPVDCIH TSAAQLSLLEDEMRRVERVNVA
Sbjct  179   DIFEIEEDFGRARACNQRGNPDLIQQAVETCPVDCIHQTSAAQLSLLEDEMRRVERVNVA  238

Query  951   LMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQ  1130
             LMLSGMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K  D++ SYWD LW K  +YQ
Sbjct  239   LMLSGMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKNIDETPSYWDNLWGKENNYQ  298

Query  1131  TT  1136
              +
Sbjct  299   KS  300



>ref|XP_004505463.1| PREDICTED: chaperone protein DnaJ-like isoform X2 [Cicer arietinum]
Length=313

 Score =   431 bits (1108),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 208/294 (71%), Positives = 241/294 (82%), Gaps = 3/294 (1%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAY-QE  431
             MAQLLSPV ++  K  NP  NL PR    +L     + +    + +R+  GR+RVA  Q+
Sbjct  1     MAQLLSPVYSEAFKIHNPSLNLCPRTSWQMLQKTSTTWNFVTNTYKRRRCGRLRVAADQD  60

Query  432   SAASEE--VADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
             S A+ +   A+DYYAVLGLLPDA+PEQIKKAYYNCMK CHPDLSG+D E TNFC+FINE+
Sbjct  61    SFATTDSAAAEDYYAVLGLLPDATPEQIKKAYYNCMKTCHPDLSGNDPEVTNFCIFINEV  120

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             YE+LSDP+QR++YDEIHGY+ T+INPF DDSSPKDHVFVDEFSCIGCKNCANV   VF I
Sbjct  121   YEVLSDPLQRMIYDEIHGYSLTSINPFLDDSSPKDHVFVDEFSCIGCKNCANVACDVFGI  180

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EEDFGRARVYSQ G+ E IQQAI+SCPVDCIHWTSAAQLSLLEDEMRR+ERVNVALMLSG
Sbjct  181   EEDFGRARVYSQCGNPESIQQAIDSCPVDCIHWTSAAQLSLLEDEMRRIERVNVALMLSG  240

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDY  1127
             MG+AS DVFRMA++RWEKRQ K L QA++RM KQKG +K+DSYWD L  KPRDY
Sbjct  241   MGSASSDVFRMANSRWEKRQLKFLEQARLRMMKQKGYNKTDSYWDNLRGKPRDY  294



>ref|XP_003607622.1| Chaperone protein dnaJ [Medicago truncatula]
 gb|AES89819.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=341

 Score =   431 bits (1109),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 240/339 (71%), Positives = 272/339 (80%), Gaps = 8/339 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPIL--GTNCNSVSSHGGSGRRKGFGRIRVAY-  425
             MAQLL+P+  + LK  N   +L  R    +L   T  +       S +R+GFGR+RVA  
Sbjct  1     MAQLLTPLYPEALKIHN--SSLCTRSSWQMLQQKTAVSPWRFATPSCKRRGFGRVRVATE  58

Query  426   QESAASEEV--ADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFIN  599
             QES ++ +   A+DYYAVLGLLPDA+PEQIKKAYYNCMK CHPDLSG+D ETTNFC FIN
Sbjct  59    QESFSTSDSVGAEDYYAVLGLLPDATPEQIKKAYYNCMKTCHPDLSGNDPETTNFCTFIN  118

Query  600   EIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVF  779
             E+YE+LSDPVQR VYD+IHGY+ T+INPF DDSSPKDHVFVDEFSCIGCKNCANV   VF
Sbjct  119   EVYEVLSDPVQRRVYDDIHGYSLTSINPFMDDSSPKDHVFVDEFSCIGCKNCANVACDVF  178

Query  780   DIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML  959
              IEEDFGRARVY+Q G+ ELIQ AIESCPVDCIHWTSAAQLSLLEDEMRR+ERVNVALML
Sbjct  179   GIEEDFGRARVYNQFGNPELIQTAIESCPVDCIHWTSAAQLSLLEDEMRRIERVNVALML  238

Query  960   SGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTe  1139
             SGMG+A  DVFRMA+TRWEKRQ K L QA+ RM KQKG DK++SYWD L  KPRDY+ +E
Sbjct  239   SGMGSALGDVFRMANTRWEKRQLKFLEQARSRMMKQKGYDKTNSYWDNLRGKPRDYENSE  298

Query  1140  eeakeragraaaaarrwreYSRKGVDKRP-TFKLPEAAS  1253
             EE KERA RAAAAAR+WREYSRKG   +P T KLPEA S
Sbjct  299   EEVKERAKRAAAAARKWREYSRKGGAVKPSTVKLPEATS  337



>ref|XP_010506112.1| PREDICTED: uncharacterized protein LOC104782785 isoform X1 [Camelina 
sativa]
Length=360

 Score =   432 bits (1110),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 233/357 (65%), Positives = 275/357 (77%), Gaps = 23/357 (6%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSS------HGGSGRRKGFGRIR  416
             MAQ+LSPVCTD+LKFQN V +      S          SS      + G  R    GR+R
Sbjct  1     MAQILSPVCTDLLKFQNSVVSSRSGASSRFSAKTTAGASSSWGLPRYAGKKRSGSIGRLR  60

Query  417   VAYQE--SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCM  590
             VA ++  S ++ +VADDYYAVLGLLPDA+P +IKKAYYNCMK+CHPDLSG+D ETTNFC+
Sbjct  61    VATEDASSLSTGDVADDYYAVLGLLPDATPAEIKKAYYNCMKSCHPDLSGNDPETTNFCI  120

Query  591   FINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCP  770
             FIN+IYEILSDPVQR+VYDEIHGYA TA NPF DDSSP+DHVFVDEF+CIGCKNCANV P
Sbjct  121   FINDIYEILSDPVQRMVYDEIHGYAVTATNPFLDDSSPRDHVFVDEFACIGCKNCANVAP  180

Query  771   KVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRR-------  929
              +F+IEEDFGRAR  +Q G+ +LIQ A+E+CPVDCIH TSAAQLSLLEDEMRR       
Sbjct  181   DIFEIEEDFGRARACNQRGNPDLIQLAVETCPVDCIHQTSAAQLSLLEDEMRRVERVNVR  240

Query  930   --------VERVNVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKS  1085
                     V+   VALMLSGMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K +D++
Sbjct  241   RAFLLLVIVKNHKVALMLSGMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKNTDET  300

Query  1086  DSYWDYLWAKPRDYQTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
              SYWD LW +  DYQ +EEE +ERA RAAAAARRWREYSR+GVDKRPTFKLP++A K
Sbjct  301   PSYWDNLWGQQNDYQKSEEEVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSACK  357



>ref|XP_008343086.1| PREDICTED: uncharacterized protein LOC103405851 [Malus domestica]
Length=343

 Score =   423 bits (1087),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 238/342 (70%), Positives = 282/342 (82%), Gaps = 8/342 (2%)
 Frame = +3

Query  255   MAQLL--SPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVS----SHGGSGRRKGFGRIR  416
             MAQLL  SPV T+ LKFQNP+ N   R     L    +S++      GG  RR+G  R+R
Sbjct  1     MAQLLTPSPVFTEXLKFQNPLRNGCSRSPWRXLAKPGSSLTLMGGHGGGRRRRRGXSRLR  60

Query  417   VAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFI  596
             VA  +S ++  VADDYY+VLGLLPDA+P QIKKAYYNCMKACHPDLSGD+ +T NFCMFI
Sbjct  61    VATDDSPSTNAVADDYYSVLGLLPDATPAQIKKAYYNCMKACHPDLSGDNPDTNNFCMFI  120

Query  597   NEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
             NE+YE+LSDPVQR+VYDEIHGYA TAINPF ++S+PKDH FVDEFSCIGCKNCA+V P V
Sbjct  121   NEVYEVLSDPVQRMVYDEIHGYALTAINPFLNESAPKDHAFVDEFSCIGCKNCASVAPDV  180

Query  777   FDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  956
             F IEED GRARVYSQ GS +L+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM
Sbjct  181   FGIEEDXGRARVYSQCGSVDLVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  240

Query  957   LSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRM-TKQKGSDKSDSYWDYLWAKPRDYQT  1133
             L+GMG +S+DVFRMAS+RW+KRQ++VL QA++RM  K+K SDK++SYWD +W   ++YQ 
Sbjct  241   LAGMG-SSVDVFRMASSRWQKRQSQVLEQAQIRMKKKKKDSDKTESYWDNIWGNTKEYQN  299

Query  1134  TeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASKD  1259
             +EEE KER+ RAAAAARRWREYSR+G DK P++KLPEA S D
Sbjct  300   SEEEVKERSRRAAAAARRWREYSRRGADKPPSYKLPEAVSND  341



>ref|XP_009416422.1| PREDICTED: uncharacterized protein LOC103997025 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416423.1| PREDICTED: uncharacterized protein LOC103997025 [Musa acuminata 
subsp. malaccensis]
Length=337

 Score =   421 bits (1083),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 227/337 (67%), Positives = 272/337 (81%), Gaps = 8/337 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDIL----KFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVA  422
             MAQ+L+PV T +L    K  +  H +   +R  +   + +S   +   GRR       VA
Sbjct  1     MAQVLAPVRTGLLFEFPKMSSTAHGI---RRQGVAAADRSSTDRYRRRGRRNFRIAAAVA  57

Query  423   YQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINE  602
              +  ++ ++VA+D+YAVLGLLPDA+P+QIKKAYYNCMKACHPDLSG+D +  NFCMFINE
Sbjct  58    EKGFSSQDDVAEDFYAVLGLLPDATPQQIKKAYYNCMKACHPDLSGNDPDINNFCMFINE  117

Query  603   IYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFD  782
             +Y +LSDP+QR++YDEIHGYAATAINPFFDDS+ KDH FVDEFSCIGCKNCANV P VF 
Sbjct  118   VYAVLSDPIQRMIYDEIHGYAATAINPFFDDSASKDHAFVDEFSCIGCKNCANVAPDVFR  177

Query  783   IEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLS  962
             IEE++GRARV+SQSG+ +L+QQAIESCPVDCIH TSAAQLSLLEDEMRRVERVNV LMLS
Sbjct  178   IEEEYGRARVFSQSGNPDLVQQAIESCPVDCIHRTSAAQLSLLEDEMRRVERVNVGLMLS  237

Query  963   GMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTee  1142
             GMG++S+DVFRMA +RWEKRQAKVL +AK+RM KQK SDKS S W  +W  P++Y+TTEE
Sbjct  238   GMGSSSLDVFRMACSRWEKRQAKVLERAKIRMMKQKDSDKSGS-WSNIWGAPKNYETTEE  296

Query  1143  eakeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             E KERA RAAAAARRWREYSR+G D+ PT KLPEA S
Sbjct  297   EVKERAKRAAAAARRWREYSRRGADRPPTNKLPEAIS  333



>ref|XP_009378942.1| PREDICTED: zuotin-like [Pyrus x bretschneideri]
Length=343

 Score =   418 bits (1074),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 239/342 (70%), Positives = 283/342 (83%), Gaps = 8/342 (2%)
 Frame = +3

Query  255   MAQLL--SPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVS----SHGGSGRRKGFGRIR  416
             MAQLL  SPV T+ LKFQNP+ N   R    +L    +S++      GG   R+GF R+R
Sbjct  1     MAQLLTPSPVFTESLKFQNPLPNGCSRSPWRMLAKPGSSLTLTGGHGGGRRSRRGFSRLR  60

Query  417   VAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFI  596
             VA  +S ++  VADDYY+VLGLLPDA+P QIKKAYYNCMKACHPDLSGD+ +T NFCMFI
Sbjct  61    VATDDSPSTNAVADDYYSVLGLLPDATPAQIKKAYYNCMKACHPDLSGDNPDTNNFCMFI  120

Query  597   NEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
             NE+YE+LSDPVQR+VYDEIHGYA TAINPF ++S+PKDH FVDEFSCIGCKNCA+V P V
Sbjct  121   NEVYEVLSDPVQRMVYDEIHGYALTAINPFLNESAPKDHAFVDEFSCIGCKNCASVAPDV  180

Query  777   FDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  956
             F IEEDFGRARVYSQ GS +L+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM
Sbjct  181   FGIEEDFGRARVYSQCGSVDLVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  240

Query  957   LSGMGAASIDVFRMASTRWEKRQAKVLGQAKVR-MTKQKGSDKSDSYWDYLWAKPRDYQT  1133
             L+GMG +S+DVFRMAS+RW+KRQ++VL Q K+R M K+K SDK++SYWD +W   ++YQ 
Sbjct  241   LAGMG-SSVDVFRMASSRWQKRQSQVLEQTKIRMMKKKKDSDKTESYWDNIWGNTKNYQN  299

Query  1134  TeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASKD  1259
             +EEE KERA RAAAAARRWREYSR+G DK P++KLPEA + D
Sbjct  300   SEEEVKERAKRAAAAARRWREYSRRGADKPPSYKLPEAINND  341



>ref|XP_006582275.1| PREDICTED: protein CAJ1-like isoform X2 [Glycine max]
Length=305

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 226/333 (68%), Positives = 260/333 (78%), Gaps = 31/333 (9%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSPV T+ LK  + + ++   +  P   T  N V+ +G   +R+G GR        
Sbjct  1     MAQLLSPVYTEPLK--SNLSSISSWRMLPKTATPSNFVTHNG---KRRGCGR--------  47

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
                             LPDA+P QIKKAYYNCMKACHPDLS +D E TNFC FINE+Y +
Sbjct  48    ----------------LPDATPGQIKKAYYNCMKACHPDLSDNDPEATNFCTFINEVYGV  91

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDP+QR++YDEIHGY+ T+INPF DDSSPKDHVFVDEFSCIGCKNCANV   VF IEE+
Sbjct  92    LSDPIQRMIYDEIHGYSLTSINPFLDDSSPKDHVFVDEFSCIGCKNCANVACDVFGIEEE  151

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARVYSQ G  EL+QQAI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG+
Sbjct  152   FGRARVYSQCGKPELVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGS  211

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
             AS DVFRMAS+RWEKRQAKVL QA++RM K+KGSDK+D +W+ LW KP+D  ++EEE KE
Sbjct  212   AS-DVFRMASSRWEKRQAKVLEQARLRMMKEKGSDKTDMFWNNLWGKPKDL-SSEEEIKE  269

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             RA RAAAAARRWREYSR+GVDK PTFKLPE AS
Sbjct  270   RAKRAAAAARRWREYSRRGVDKPPTFKLPETAS  302



>gb|KDO63414.1| hypothetical protein CISIN_1g019284mg [Citrus sinensis]
 gb|KDO63415.1| hypothetical protein CISIN_1g019284mg [Citrus sinensis]
Length=272

 Score =   403 bits (1036),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 219/261 (84%), Gaps = 1/261 (0%)
 Frame = +3

Query  258   AQLLSPVCTDILKFQNPVHNLFPRKRSPIL-GTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             AQLL+PVC D+LK QNP  N F  + S  L   N +S+S  G S +R+  GR RV  ++S
Sbjct  3     AQLLTPVCIDVLKLQNPSLNSFSSRSSSRLLANNSSSLSLMGHSSKRRSCGRARVTAEDS  62

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             A+++ +ADDYYAVLGLLPDA+PEQIKKAYYNCMKACHPDLSGDD ETTNFCMFINE+Y +
Sbjct  63    ASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAV  122

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR+VYDEIHGY+  A NPF DDS PKDHVFVDEFSCIGCKNC NV P+VF IEED
Sbjct  123   LSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEED  182

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             FGRARVY+Q G  E +QQAIESCPVDCIH TSA QLSLLEDEMRRVERVNVA+MLSGMG+
Sbjct  183   FGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGMGS  242

Query  975   ASIDVFRMASTRWEKRQAKVL  1037
              S DVFRMAS+RWE+RQAKVL
Sbjct  243   GSADVFRMASSRWERRQAKVL  263



>ref|XP_002441427.1| hypothetical protein SORBIDRAFT_09g026410 [Sorghum bicolor]
 gb|EES19857.1| hypothetical protein SORBIDRAFT_09g026410 [Sorghum bicolor]
Length=340

 Score =   405 bits (1041),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 223/339 (66%), Positives = 256/339 (76%), Gaps = 11/339 (3%)
 Frame = +3

Query  264   LLSPVCTDILKFQNPVHNL---FPRKRSPILG--TNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             L  PV  D L    P  +     P +R P +G      S      S RR+       A +
Sbjct  6     LSPPVLADALA--TPPRSFPCSLPTRRLPTVGFAGAVRSDLQQSWSARRRDLRVCATATE  63

Query  429   ESAASEE-VADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
                  EE VADDYY+VLG++PDA+PE+IKKAYY CMK CHPDLSG+D + TNFCMFINE+
Sbjct  64    ADHEREEDVADDYYSVLGVMPDATPEEIKKAYYGCMKECHPDLSGNDPDVTNFCMFINEV  123

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             Y +LSDP QR VYDEIHGY ATAINPFFDDS+PKDHVFVDEF+CIGCKNCAN+CP VF+I
Sbjct  124   YSVLSDPAQRAVYDEIHGYTATAINPFFDDSAPKDHVFVDEFTCIGCKNCANICPGVFEI  183

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EEDFGR+RVYSQSGS ELIQ AI+SCPVDCIHWTSAAQLSLLE+EMRRVERVNV LML+G
Sbjct  184   EEDFGRSRVYSQSGSTELIQDAIDSCPVDCIHWTSAAQLSLLENEMRRVERVNVGLMLAG  243

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MG AS+DVFRMAS RWEKRQAKVLG+ + RM KQ+ SD + S W  +W  P   Q+ EEE
Sbjct  244   MG-ASVDVFRMASARWEKRQAKVLGKVRTRMVKQENSD-TRSSWSDIWGSPPQDQSNEEE  301

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEA-ASKD  1259
               ERA RAAAAARRWRE+SR+G D+ PT KLPE+  SKD
Sbjct  302   VSERAKRAAAAARRWREFSRRGADRPPTHKLPESVGSKD  340



>ref|NP_001131992.1| uncharacterized protein LOC100193395 [Zea mays]
 gb|ACF80650.1| unknown [Zea mays]
Length=341

 Score =   404 bits (1038),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 228/341 (67%), Positives = 261/341 (77%), Gaps = 15/341 (4%)
 Frame = +3

Query  255   MAQLLSP--VCTDILKFQ---NPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGR---  410
             MA LLSP  +   + KF     PV      +R  I G        H    RR+ +GR   
Sbjct  1     MAPLLSPPLLADSVTKFHAASTPVSCSGSPQRYVITGLAGAGRGEH--DWRRRTWGRTNL  58

Query  411   -IRVAYQESAASEE-VADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNF  584
              ++    ES +SE  +A+DYYAVLG++PDA+P+QIKKAYYNCMK+CHPDLSG+D + TNF
Sbjct  59    RVKAVAAESRSSEGGIAEDYYAVLGVMPDATPKQIKKAYYNCMKSCHPDLSGNDPDVTNF  118

Query  585   CMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANV  764
             CMFINE+Y +L+DP+QR VYDEIHGYAATA NPF D S+P+DHVFVDEFSCIGCKNCANV
Sbjct  119   CMFINEVYTVLTDPIQRAVYDEIHGYAATATNPFLDGSAPRDHVFVDEFSCIGCKNCANV  178

Query  765   CPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVN  944
             C KVF+IEEDFGRARVY QSGS ELIQ+AI+SCPVDCIHWTSAAQLSLLEDEMRRVERVN
Sbjct  179   CSKVFEIEEDFGRARVYDQSGSTELIQEAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVN  238

Query  945   VALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRD  1124
             V LML+GMG  SIDVFRMAS+RWEKRQAKVL + + RM+ Q  S K  S W  +W  P  
Sbjct  239   VGLMLAGMG-GSIDVFRMASSRWEKRQAKVLEKVRRRMS-QDDSRKGGS-WSDIWGAPTR  295

Query  1125  YQTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEA  1247
             Y+  EEE KERA RAAAAARRWREYSRKG DK PTFKLPEA
Sbjct  296   YEKNEEEVKERAKRAAAAARRWREYSRKGADKPPTFKLPEA  336



>ref|NP_001044143.1| Os01g0730500 [Oryza sativa Japonica Group]
 dbj|BAD87004.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06057.1| Os01g0730500 [Oryza sativa Japonica Group]
 dbj|BAG94424.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71426.1| hypothetical protein OsI_03618 [Oryza sativa Indica Group]
 gb|EEE55336.1| hypothetical protein OsJ_03346 [Oryza sativa Japonica Group]
Length=342

 Score =   403 bits (1036),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 209/279 (75%), Positives = 243/279 (87%), Gaps = 3/279 (1%)
 Frame = +3

Query  417   VAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFI  596
             VA +  ++   VA+DYYAVLG++PDA+P+QIKKAYYNCMKACHPDLSG+D + TNFCMFI
Sbjct  64    VAAESPSSGGGVAEDYYAVLGVMPDATPQQIKKAYYNCMKACHPDLSGNDPDVTNFCMFI  123

Query  597   NEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
             NE+Y +L+DP+QR VYDEIHGYAATA NPFFDDS+P+DHVFVDEFSCIGCKNCANVC KV
Sbjct  124   NEVYTVLTDPIQRAVYDEIHGYAATATNPFFDDSAPRDHVFVDEFSCIGCKNCANVCSKV  183

Query  777   FDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  956
             F+IEEDFGRARVY+QSG+ ELIQ+AI++CPVDCIHWTSAAQLSLLEDEMRRVERVNV LM
Sbjct  184   FEIEEDFGRARVYNQSGNAELIQEAIDTCPVDCIHWTSAAQLSLLEDEMRRVERVNVGLM  243

Query  957   LSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTT  1136
             L+GMG +S+DVFRMASTRWEKRQAKVL + + R++ Q+ S K  S W  +W  P  Y+  
Sbjct  244   LAGMG-SSVDVFRMASTRWEKRQAKVLEKVRRRVS-QEDSGKGSS-WSDVWGAPTRYRKN  300

Query  1137  eeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             E+EA+ERA RAAAAARRWREYSRKG DK PTFKLPEA S
Sbjct  301   EDEARERAKRAAAAARRWREYSRKGADKPPTFKLPEAVS  339



>ref|XP_004961418.1| PREDICTED: uncharacterized protein LOC101786293 isoform X2 [Setaria 
italica]
Length=343

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 231/268 (86%), Gaps = 1/268 (0%)
 Frame = +3

Query  444   EEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSD  623
             E+VADDYY+VLG++PDA+PE+IKKAYY+CMKACHPDLSGDD + TNFCMFINE+Y +LSD
Sbjct  72    EDVADDYYSVLGVMPDATPEEIKKAYYSCMKACHPDLSGDDPDVTNFCMFINEVYSVLSD  131

Query  624   PVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGR  803
             P QR VYDEIHGY ATAINPFFDDS+PKDHVFVDEF+CIGCKNCAN+CP VF IEEDFGR
Sbjct  132   PAQRAVYDEIHGYTATAINPFFDDSAPKDHVFVDEFTCIGCKNCANICPNVFQIEEDFGR  191

Query  804   ARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASI  983
             +RVYSQSGS ELIQ AI+SCPVDCIHWTSAAQLSLLE+EMRRVERVNV LMLSGMG AS+
Sbjct  192   SRVYSQSGSTELIQDAIDSCPVDCIHWTSAAQLSLLENEMRRVERVNVGLMLSGMG-ASV  250

Query  984   DVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeakerag  1163
             DVFRMAS RWEKRQAK+L + + RM  Q+ SD   S+ D     PRD     EEA ERA 
Sbjct  251   DVFRMASVRWEKRQAKILEKVRTRMVNQENSDTGRSWSDIWGPPPRDENNGNEEASERAK  310

Query  1164  raaaaarrwreYSRKGVDKRPTFKLPEA  1247
             RAAAAARRWRE+SR+G D+ PT+KLPEA
Sbjct  311   RAAAAARRWREFSRRGADRPPTYKLPEA  338



>ref|XP_007048744.1| DNAJ heat shock N-terminal domain-containing protein isoform 
3 [Theobroma cacao]
 gb|EOX92901.1| DNAJ heat shock N-terminal domain-containing protein isoform 
3 [Theobroma cacao]
Length=266

 Score =   399 bits (1024),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 207/261 (79%), Positives = 230/261 (88%), Gaps = 0/261 (0%)
 Frame = +3

Query  471   VLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYDE  650
             +   + +A PE+IKKAYYNCMKACHPDLSG+D ETTNFCMFINE+Y +LSDPVQR+VYDE
Sbjct  2     LFQFIFNARPEEIKKAYYNCMKACHPDLSGNDPETTNFCMFINEVYGVLSDPVQRMVYDE  61

Query  651   IHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGS  830
             IHGYA TAINPF DDS+PKDHVFVDEFSCIGCKNCANV   VF IEEDFGRARV+SQ G+
Sbjct  62    IHGYALTAINPFMDDSAPKDHVFVDEFSCIGCKNCANVTSDVFRIEEDFGRARVHSQCGN  121

Query  831   GELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASIDVFRMASTR  1010
              ELI+QAIESCPVDCIH TSAAQLSLLEDEMRRVERVNVALMLSGMG+AS+DVFRMA +R
Sbjct  122   PELIEQAIESCPVDCIHRTSAAQLSLLEDEMRRVERVNVALMLSGMGSASMDVFRMACSR  181

Query  1011  WEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeakeragraaaaarrw  1190
             WEKRQAKVL QAK++MT QK S K+DSYW  LW KP++Y+ +EEE KERA  AAAAARRW
Sbjct  182   WEKRQAKVLEQAKIKMTWQKDSGKTDSYWSNLWGKPQEYKKSEEEVKERARTAAAAARRW  241

Query  1191  reYSRKGVDKRPTFKLPEAAS  1253
             REYSR+GVDK PT KLPEA S
Sbjct  242   REYSRRGVDKPPTSKLPEAVS  262



>ref|XP_004961417.1| PREDICTED: uncharacterized protein LOC101786293 isoform X1 [Setaria 
italica]
Length=342

 Score =   401 bits (1030),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 232/268 (87%), Gaps = 2/268 (1%)
 Frame = +3

Query  444   EEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSD  623
             E+VADDYY+VLG++PDA+PE+IKKAYY+CMKACHPDLSGDD + TNFCMFINE+Y +LSD
Sbjct  72    EDVADDYYSVLGVMPDATPEEIKKAYYSCMKACHPDLSGDDPDVTNFCMFINEVYSVLSD  131

Query  624   PVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGR  803
             P QR VYDEIHGY ATAINPFFDDS+PKDHVFVDEF+CIGCKNCAN+CP VF IEEDFGR
Sbjct  132   PAQRAVYDEIHGYTATAINPFFDDSAPKDHVFVDEFTCIGCKNCANICPNVFQIEEDFGR  191

Query  804   ARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASI  983
             +RVYSQSGS ELIQ AI+SCPVDCIHWTSAAQLSLLE+EMRRVERVNV LMLSGMG AS+
Sbjct  192   SRVYSQSGSTELIQDAIDSCPVDCIHWTSAAQLSLLENEMRRVERVNVGLMLSGMG-ASV  250

Query  984   DVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeakerag  1163
             DVFRMAS RWEKRQAK+L + + RM  Q+ SD   S W  +W  P   +  EEEA ERA 
Sbjct  251   DVFRMASVRWEKRQAKILEKVRTRMVNQENSDTGRS-WSDIWGPPPRDENNEEEASERAK  309

Query  1164  raaaaarrwreYSRKGVDKRPTFKLPEA  1247
             RAAAAARRWRE+SR+G D+ PT+KLPEA
Sbjct  310   RAAAAARRWREFSRRGADRPPTYKLPEA  337



>ref|XP_002456291.1| hypothetical protein SORBIDRAFT_03g033600 [Sorghum bicolor]
 gb|EES01411.1| hypothetical protein SORBIDRAFT_03g033600 [Sorghum bicolor]
Length=341

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 212/281 (75%), Positives = 240/281 (85%), Gaps = 4/281 (1%)
 Frame = +3

Query  408   RIRVAYQESAASEE-VADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNF  584
             R++    ES +SE  +A+DYYAVLG++PDA+P+QIKKAYYNCMK+CHPDLSG+D + TNF
Sbjct  59    RVKAVAAESRSSEGGIAEDYYAVLGVMPDATPKQIKKAYYNCMKSCHPDLSGNDPDMTNF  118

Query  585   CMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANV  764
             CMFINE+Y +L+DP+QR VYDEIHGYAATA NPF DDS+P+DHVFVDEFSCIGCKNCANV
Sbjct  119   CMFINEVYTVLTDPIQRAVYDEIHGYAATATNPFLDDSAPRDHVFVDEFSCIGCKNCANV  178

Query  765   CPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVN  944
             C KVF IEEDFGRARVY QSGS ELIQ+AI+SCPVDCIHWTSAAQLSLLEDEMRRVERVN
Sbjct  179   CSKVFQIEEDFGRARVYDQSGSTELIQEAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVN  238

Query  945   VALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRD  1124
             V LML+GMG  S+DVFRMAS+RWEKRQAKVL + + RM+ Q  S K  S W  +W  P  
Sbjct  239   VGLMLAGMG-GSVDVFRMASSRWEKRQAKVLEKVRRRMS-QDDSSKGGS-WSDIWGAPTR  295

Query  1125  YQTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEA  1247
             Y+  EEEAKERA RAAAAARRWREYSRKG DK PTFKLPEA
Sbjct  296   YEKNEEEAKERAKRAAAAARRWREYSRKGADKPPTFKLPEA  336



>gb|ACF83085.1| unknown [Zea mays]
 gb|AFW78768.1| electron transporter/ heat shock protein binding protein [Zea 
mays]
Length=343

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 207/273 (76%), Positives = 236/273 (86%), Gaps = 5/273 (2%)
 Frame = +3

Query  438   ASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEIL  617
             + E+VADDYY+VLG++PDA+PE+IKKAYY+CMK CHPDLSGD  + TNFCMFINE+Y +L
Sbjct  68    SEEDVADDYYSVLGVMPDATPEEIKKAYYSCMKECHPDLSGDHPDVTNFCMFINEVYSVL  127

Query  618   SDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDF  797
             SDP QR VYDEIHGY ATAINPFFDDS+PKDHVFVDEF+CIGCKNCAN+CP VF IEEDF
Sbjct  128   SDPAQRAVYDEIHGYTATAINPFFDDSAPKDHVFVDEFTCIGCKNCANICPGVFQIEEDF  187

Query  798   GRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAA  977
             GR+RVYSQSGS ELIQ AI+SCPVDCIHWTSAAQLSLLE+EMRRVERVNV LML+GMG A
Sbjct  188   GRSRVYSQSGSTELIQDAIDSCPVDCIHWTSAAQLSLLENEMRRVERVNVGLMLAGMG-A  246

Query  978   SIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAK--PRDYQTT-eeea  1148
             SI+VFRMAS RWEKRQAKVL +A+ RM KQ+ SD + S W  +WA   PRD Q+  + EA
Sbjct  247   SINVFRMASARWEKRQAKVLEKARTRMVKQETSD-TRSSWSEVWASSPPRDDQSNGDGEA  305

Query  1149  keragraaaaarrwreYSRKGVDKRPTFKLPEA  1247
              ERA RAAAAARRWRE+SR+G D+ PT KLPEA
Sbjct  306   SERAKRAAAAARRWREFSRRGADRPPTHKLPEA  338



>ref|XP_003569728.1| PREDICTED: uncharacterized protein LOC100837569 [Brachypodium 
distachyon]
Length=340

 Score =   395 bits (1016),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 205/287 (71%), Positives = 238/287 (83%), Gaps = 4/287 (1%)
 Frame = +3

Query  393   RKGFGRIRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEE  572
             ++G   + VA +  +     A+DYY+VLG++PDA+P+QIKKAYYNCMKACHPDLSG+D +
Sbjct  55    KRGLRVLAVATESRSPDGGAAEDYYSVLGVMPDATPQQIKKAYYNCMKACHPDLSGNDPD  114

Query  573   TTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKN  752
              TNFCMFINE+Y +L+DP+QR VYDEIHGY ATA NPF DD+ P+DHVFVDEFSCIGCKN
Sbjct  115   VTNFCMFINEVYTVLTDPIQRAVYDEIHGYTATATNPFLDDA-PRDHVFVDEFSCIGCKN  173

Query  753   CANVCPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRV  932
             CANVC  VF+IEEDFGRARVY+QSG+ ELIQ AI+SCPVDCIHWTSAAQLSLLEDEMRRV
Sbjct  174   CANVCSNVFEIEEDFGRARVYNQSGNQELIQDAIDSCPVDCIHWTSAAQLSLLEDEMRRV  233

Query  933   ERVNVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWA  1112
             ERVNVALML+GMG +S DVFRMAS RWEKRQAKVL + ++RM+ Q  S+K  S W  +W 
Sbjct  234   ERVNVALMLAGMG-SSADVFRMASRRWEKRQAKVLDKVRMRMS-QDDSNKGSS-WSDIWG  290

Query  1113  KPRDYQTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
              P  YQ  EE+  ER  RAAAAARRWREYSRKG D+ PTFKLPEAAS
Sbjct  291   SPTRYQKNEEDTNERVKRAAAAARRWREYSRKGTDRPPTFKLPEAAS  337



>ref|XP_008647783.1| PREDICTED: LOC100280972 isoform X1 [Zea mays]
 gb|AFW78769.1| hypothetical protein ZEAMMB73_356788 [Zea mays]
Length=345

 Score =   395 bits (1016),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 207/275 (75%), Positives = 236/275 (86%), Gaps = 7/275 (3%)
 Frame = +3

Query  438   ASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEIL  617
             + E+VADDYY+VLG++PDA+PE+IKKAYY+CMK CHPDLSGD  + TNFCMFINE+Y +L
Sbjct  68    SEEDVADDYYSVLGVMPDATPEEIKKAYYSCMKECHPDLSGDHPDVTNFCMFINEVYSVL  127

Query  618   SDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDF  797
             SDP QR VYDEIHGY ATAINPFFDDS+PKDHVFVDEF+CIGCKNCAN+CP VF IEEDF
Sbjct  128   SDPAQRAVYDEIHGYTATAINPFFDDSAPKDHVFVDEFTCIGCKNCANICPGVFQIEEDF  187

Query  798   GRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAA  977
             GR+RVYSQSGS ELIQ AI+SCPVDCIHWTSAAQLSLLE+EMRRVERVNV LML+GMG A
Sbjct  188   GRSRVYSQSGSTELIQDAIDSCPVDCIHWTSAAQLSLLENEMRRVERVNVGLMLAGMG-A  246

Query  978   SIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAK--PRDYQT---Tee  1142
             SI+VFRMAS RWEKRQAKVL +A+ RM KQ+ SD + S W  +WA   PRD Q+    + 
Sbjct  247   SINVFRMASARWEKRQAKVLEKARTRMVKQETSD-TRSSWSEVWASSPPRDDQSNGGNDG  305

Query  1143  eakeragraaaaarrwreYSRKGVDKRPTFKLPEA  1247
             EA ERA RAAAAARRWRE+SR+G D+ PT KLPEA
Sbjct  306   EASERAKRAAAAARRWREFSRRGADRPPTHKLPEA  340



>gb|EEC79572.1| hypothetical protein OsI_20727 [Oryza sativa Indica Group]
Length=344

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 202/272 (74%), Positives = 233/272 (86%), Gaps = 2/272 (1%)
 Frame = +3

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             +A +EVADD+Y+VLG++PDA+PE+IKKAYY+CMKACHPDLSGD+ E TNFCMFINE+Y +
Sbjct  71    SAEDEVADDFYSVLGVMPDATPEEIKKAYYSCMKACHPDLSGDNPEVTNFCMFINEVYTV  130

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR VYDEIHGY ATA NPFFDDS+PKD VFVDEF+CIGCK CANVCP VF IEED
Sbjct  131   LSDPVQRAVYDEIHGYTATATNPFFDDSAPKDQVFVDEFTCIGCKYCANVCPNVFRIEED  190

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             +GR+RVYSQSGS ELIQ+AI+SCPV+CIHWTSAAQLSLLE+EMRR+ERVNV LM +GMG 
Sbjct  191   YGRSRVYSQSGSTELIQEAIDSCPVNCIHWTSAAQLSLLENEMRRIERVNVGLMSAGMG-  249

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
              S+DVFR+AS RWEKRQ+KVL + + RMT +K SD S S W  +W  P  YQ  EEE  E
Sbjct  250   VSVDVFRLASVRWEKRQSKVLEKIRTRMTNKKYSDISSS-WTDIWGSPTRYQGNEEEGTE  308

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEAA  1250
             RA RAAAAARRWREYSRKG D+ P +KLPEAA
Sbjct  309   RAKRAAAAARRWREYSRKGADRPPEYKLPEAA  340



>ref|XP_009406776.1| PREDICTED: uncharacterized protein LOC103989609 [Musa acuminata 
subsp. malaccensis]
Length=340

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/274 (72%), Positives = 236/274 (86%), Gaps = 2/274 (1%)
 Frame = +3

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             ++ ++VADDYYAVLGLLPDA+P QIKKAYYNCMK+CHPDLSG+  +  NFCMF+NE+Y +
Sbjct  64    SSRDDVADDYYAVLGLLPDATPRQIKKAYYNCMKSCHPDLSGNAPDVNNFCMFVNEVYAV  123

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             L DPVQR+VYDEIHGY  TA+NPF DDS+PKDH FVDEFSCIGCKNCANV P VF IEE+
Sbjct  124   LGDPVQRMVYDEIHGYTTTAVNPFLDDSAPKDHAFVDEFSCIGCKNCANVAPDVFQIEEE  183

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             +GRARV  QSG+ +L+Q+AI++CPVDCIHWTSAAQLSLLEDEMRRVERVNV LML+GMG+
Sbjct  184   YGRARVCCQSGNPDLVQEAIDTCPVDCIHWTSAAQLSLLEDEMRRVERVNVGLMLAGMGS  243

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
             +S DVFRMASTRW+KRQAKVL +AK+R+TKQ+ +DKS S W  +W  P++Y +TEE A +
Sbjct  244   SSTDVFRMASTRWDKRQAKVLEKAKIRVTKQRENDKSGS-WSNIWGVPKNYPSTEEAAVK  302

Query  1155  r-agraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
               A RAAAAARRWREYSR+G D+ PT+KLPE  S
Sbjct  303   ERAKRAAAAARRWREYSRRGADRPPTYKLPETIS  336



>ref|NP_001056124.1| Os05g0529700 [Oryza sativa Japonica Group]
 gb|AAU43972.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18038.1| Os05g0529700 [Oryza sativa Japonica Group]
 dbj|BAG98501.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64451.1| hypothetical protein OsJ_19300 [Oryza sativa Japonica Group]
Length=344

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 202/272 (74%), Positives = 233/272 (86%), Gaps = 2/272 (1%)
 Frame = +3

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             +A +EVADD+Y+VLG++PDA+PE+IKKAYY+CMKACHPDLSGD+ E TNFCMFINE+Y +
Sbjct  71    SAEDEVADDFYSVLGVMPDATPEEIKKAYYSCMKACHPDLSGDNPEVTNFCMFINEVYTV  130

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR VYDEIHGY ATA NPFFDDS+PKD VFVDEF+CIGCK CANVCP VF IEED
Sbjct  131   LSDPVQRAVYDEIHGYTATATNPFFDDSAPKDQVFVDEFTCIGCKYCANVCPNVFRIEED  190

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             +GR+RVYSQSGS ELIQ+AI+SCPV+CIHWTSAAQLSLLE+EMRR+ERVNV LM +GMG 
Sbjct  191   YGRSRVYSQSGSTELIQEAIDSCPVNCIHWTSAAQLSLLENEMRRIERVNVGLMSAGMG-  249

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeake  1154
              S+DVFR+AS RWEKRQ+KVL + + RMT +K SD S S W  +W  P  YQ  EEE  E
Sbjct  250   VSVDVFRLASVRWEKRQSKVLEKIRTRMTNKKYSDISSS-WTDIWGSPTRYQGNEEEGTE  308

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEAA  1250
             RA RAAAAARRWREYSRKG D+ P +KLPEAA
Sbjct  309   RAKRAAAAARRWREYSRKGADRPPEYKLPEAA  340



>ref|XP_006375497.1| hypothetical protein POPTR_0014s14030g [Populus trichocarpa]
 gb|ERP53294.1| hypothetical protein POPTR_0014s14030g [Populus trichocarpa]
Length=343

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 194/263 (74%), Positives = 226/263 (86%), Gaps = 6/263 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNP--VHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MAQL+SPVCTD LK + P  V ++  R ++ +   N  SV +     +R+ FGRIRVA  
Sbjct  58    MAQLISPVCTDALKIKKPSNVFHISSRGKTALYHNNSRSVLN----SKRRDFGRIRVAAN  113

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
              SA+++ VADDYYAVLGLLPDA+PEQIKKAYY+CMKACHPDLSG+D +TTNFCMFINE+Y
Sbjct  114   SSASADAVADDYYAVLGLLPDATPEQIKKAYYSCMKACHPDLSGNDTDTTNFCMFINEVY  173

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
              +LSDP+QR++YDEIHG+A TA+NPFFDDSSPKDH FVDEFSCIGCKNCANV P+VF IE
Sbjct  174   AVLSDPLQRMIYDEIHGFALTAMNPFFDDSSPKDHAFVDEFSCIGCKNCANVAPEVFGIE  233

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             EDFGRARVYSQ G+ +L+QQAIESCPVDCIHWTSAAQLSLLEDEMRRVER+NVALMLSGM
Sbjct  234   EDFGRARVYSQCGNLQLVQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERINVALMLSGM  293

Query  969   GAASIDVFRMASTRWEKRQAKVL  1037
             G+A  DVFRMA +RWEKRQAK+L
Sbjct  294   GSAGADVFRMACSRWEKRQAKIL  316



>dbj|BAJ99619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=340

 Score =   394 bits (1012),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 204/280 (73%), Positives = 238/280 (85%), Gaps = 4/280 (1%)
 Frame = +3

Query  417   VAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFI  596
             VA +  +     A+DYYAVLG++PDA+P+QIKKAYYNCMKACHPDLSG+D + TNFCMFI
Sbjct  63    VATEPRSPEGGAAEDYYAVLGVMPDATPQQIKKAYYNCMKACHPDLSGNDPDVTNFCMFI  122

Query  597   NEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
             NE+Y +L+DP+QR VYDEI+GY ATA NPF DD+ P+DHVFVDEFSCIGCKNCANVC KV
Sbjct  123   NEVYTVLTDPIQRAVYDEINGYTATATNPFLDDA-PRDHVFVDEFSCIGCKNCANVCSKV  181

Query  777   FDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  956
             F+IEED+GRARVY+QSG+ ELIQ+AI+SCPVDCIHWTSAAQ++LLEDEMRRVERVNVALM
Sbjct  182   FEIEEDYGRARVYNQSGNEELIQEAIDSCPVDCIHWTSAAQVTLLEDEMRRVERVNVALM  241

Query  957   LSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTT  1136
             LSGMG +S DVFRMASTRWEKRQAKVL + ++RM+ Q  S+K  S W  +W  P  YQ  
Sbjct  242   LSGMG-SSFDVFRMASTRWEKRQAKVLNKVRMRMS-QDDSNKGSS-WSDIWGSPTRYQKN  298

Query  1137  eeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
             +E+ KER  RAAAAARRWREYSRKG D+ PTFKLPEAAS 
Sbjct  299   DEDTKERVKRAAAAARRWREYSRKGADRPPTFKLPEAASN  338



>emb|CDM84083.1| unnamed protein product [Triticum aestivum]
Length=340

 Score =   393 bits (1010),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 204/280 (73%), Positives = 237/280 (85%), Gaps = 4/280 (1%)
 Frame = +3

Query  417   VAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFI  596
             VA +  +     A+DYYAVLG++PDA+P+QIKKAYYNCMKACHPDLSG+D + TNFCMFI
Sbjct  63    VATEPRSPEGSAAEDYYAVLGVMPDATPQQIKKAYYNCMKACHPDLSGNDPDVTNFCMFI  122

Query  597   NEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
             NE+Y +L+DP+QR VYDEI+G+ ATA NPF DD+ P+DHVFVDEFSCIGCKNCANVC KV
Sbjct  123   NEVYTVLTDPIQRAVYDEINGFTATATNPFLDDA-PRDHVFVDEFSCIGCKNCANVCSKV  181

Query  777   FDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  956
             F+IEED+GRARVY+QSG+ ELIQ+AI+SCPVDCIHWTSAAQ++LLEDEMRRVERVNVALM
Sbjct  182   FEIEEDYGRARVYNQSGNEELIQEAIDSCPVDCIHWTSAAQVTLLEDEMRRVERVNVALM  241

Query  957   LSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTT  1136
             LSGMG +S DVFRMASTRWEKRQAKVL + ++RM+ Q  S+K  S W  +W  P  YQ  
Sbjct  242   LSGMG-SSFDVFRMASTRWEKRQAKVLNKVRMRMS-QDDSNKGSS-WSDIWGSPTRYQKN  298

Query  1137  eeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
             EE+ KER  RAAAAARRWREYSRKG DK PTFKLPE AS 
Sbjct  299   EEDTKERMKRAAAAARRWREYSRKGADKPPTFKLPEVASN  338



>gb|KEH38856.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=276

 Score =   389 bits (999),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/267 (70%), Positives = 216/267 (81%), Gaps = 1/267 (0%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
             MAQLLSP  T+ LK  NP  NL  +     L  + +  S    S +R+  GR+RV  ++S
Sbjct  1     MAQLLSPFYTEALKINNPSLNLCSKTSWRKLTKHASPCSLAMESDKRRKCGRLRVEAEDS  60

Query  435   A-ASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
                 +  ADDYYAVLGL PDA+PEQIKKAYY+CMKACHPDLSG++ ETTNFCMFINE+Y 
Sbjct  61    VYPVDTTADDYYAVLGLFPDATPEQIKKAYYDCMKACHPDLSGNNPETTNFCMFINEVYA  120

Query  612   ILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEE  791
             +LSDP+QR VYDEIHGY+ T+ NPFFDDS PKDHVFVDEFSCIGCKNCANV P VF +EE
Sbjct  121   VLSDPIQRNVYDEIHGYSLTSTNPFFDDSCPKDHVFVDEFSCIGCKNCANVAPDVFAMEE  180

Query  792   DFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             DFGRARV+SQ G+ EL+QQAI+SCPVDCIHWTSAAQLSLLEDEMRR+ERVNVALMLSGMG
Sbjct  181   DFGRARVFSQRGNPELVQQAIDSCPVDCIHWTSAAQLSLLEDEMRRIERVNVALMLSGMG  240

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKV  1052
             +AS DVFRMA +RWEKRQ+KVL +  +
Sbjct  241   SASFDVFRMARSRWEKRQSKVLVRTLI  267



>ref|XP_004969835.1| PREDICTED: uncharacterized protein LOC101760028 [Setaria italica]
Length=341

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 207/277 (75%), Positives = 236/277 (85%), Gaps = 3/277 (1%)
 Frame = +3

Query  417   VAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFI  596
             VA +  ++   VA+DYYAVLG++PDA+P+QIKKAYYNCMK+CHPDLSG+D + TNFCMFI
Sbjct  63    VAAESRSSEGGVAEDYYAVLGVMPDATPKQIKKAYYNCMKSCHPDLSGNDPDVTNFCMFI  122

Query  597   NEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
             NE+Y +L+DP+QR VYDEIHGYAATA NPF DD++P+DHVFVDEFSCIGCKNCANVC KV
Sbjct  123   NEVYTVLTDPIQRAVYDEIHGYAATATNPFLDDNAPRDHVFVDEFSCIGCKNCANVCSKV  182

Query  777   FDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  956
             F IEEDFGRARVY QSG  +LI++AIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV LM
Sbjct  183   FQIEEDFGRARVYDQSGDIKLIEEAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVGLM  242

Query  957   LSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTT  1136
             L+GMG  SIDVFRMAS+RWEKRQAKVL + + R++ Q  S K  S W  +W  P  YQ  
Sbjct  243   LAGMG-GSIDVFRMASSRWEKRQAKVLEKVRRRVS-QDDSSKGGS-WSDIWGAPTRYQKN  299

Query  1137  eeeakeragraaaaarrwreYSRKGVDKRPTFKLPEA  1247
             EEEAKERA RAAAAARRWREYSRKG DK PT+KLPEA
Sbjct  300   EEEAKERAKRAAAAARRWREYSRKGADKPPTYKLPEA  336



>ref|NP_001147364.1| LOC100280972 [Zea mays]
 gb|ACG27100.1| electron transporter/ heat shock protein binding protein [Zea 
mays]
Length=343

 Score =   390 bits (1003),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 232/269 (86%), Gaps = 5/269 (2%)
 Frame = +3

Query  450   VADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPV  629
             VADDYY+VLG++PDA+ E+IKKAYY+CMK CHPDLSGD  + TNFCMFINE+Y +LSDP 
Sbjct  72    VADDYYSVLGVMPDATTEEIKKAYYSCMKECHPDLSGDHPDVTNFCMFINEVYSVLSDPA  131

Query  630   QRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRAR  809
             QR VYDEIHGY ATAINPFFDDS+PKDHVFVDEF+CIGCKNCAN+CP VF IEEDFGR+R
Sbjct  132   QRAVYDEIHGYTATAINPFFDDSAPKDHVFVDEFTCIGCKNCANICPGVFQIEEDFGRSR  191

Query  810   VYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASIDV  989
             VYSQSGS ELIQ AI+SCPVDCIHWTSAAQLSLLE+EMRRVERVNV LML+GMG ASI+V
Sbjct  192   VYSQSGSTELIQDAIDSCPVDCIHWTSAAQLSLLENEMRRVERVNVGLMLAGMG-ASINV  250

Query  990   FRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAK--PRDYQTT-eeeakera  1160
             FRMAS RWEKRQAKVL +A+ RM KQ+ SD + S W  +WA   PRD Q+  + EA ERA
Sbjct  251   FRMASVRWEKRQAKVLEKARTRMVKQETSD-TRSSWSEVWASSPPRDDQSNGDGEASERA  309

Query  1161  graaaaarrwreYSRKGVDKRPTFKLPEA  1247
              RAAAAARRWRE+SR+G D+ PT KLPEA
Sbjct  310   KRAAAAARRWREFSRRGADRPPTHKLPEA  338



>ref|XP_008228978.1| PREDICTED: dnaJ homolog subfamily C member 4 [Prunus mume]
Length=317

 Score =   387 bits (993),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 220/332 (66%), Positives = 254/332 (77%), Gaps = 24/332 (7%)
 Frame = +3

Query  261   QLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVS-SHGGSGRRKGFGRIRVAYQESA  437
             QLLSP  ++ LKFQNP+ N   R    +L    +S+S    G  R +GFGR+RVA   S 
Sbjct  5     QLLSPGFSEALKFQNPLPNGCSRSPRRMLVKTSSSLSLMGHGGRRPRGFGRVRVATGGSP  64

Query  438   ASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEIL  617
             +++ VADDYY+VLGLLPDA+P QIKKAYYNCMKACHPDLSGDD ETTNFCMFINE+YE+L
Sbjct  65    STDAVADDYYSVLGLLPDATPAQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYEVL  124

Query  618   SDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDF  797
             SDPVQR+VYDEIHGYA TA+NPF DDS+ +DH FVDEFSCIGCKNCANV P VF      
Sbjct  125   SDPVQRMVYDEIHGYALTAVNPFLDDSTTRDHAFVDEFSCIGCKNCANVAPDVFG-----  179

Query  798   GRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAA  977
                               I+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML+GMG +
Sbjct  180   -----------------TIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLAGMG-S  221

Query  978   SIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeaker  1157
             S DVFRMAS RW+KRQ+KVL QAK+RM  QK SDK++SYWD +W   +D + +EEE KER
Sbjct  222   SADVFRMASARWQKRQSKVLEQAKMRMMNQKDSDKTESYWDNIWGNTKDNRNSEEEVKER  281

Query  1158  agraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             A R AAAARRWREYSR+G DK P++KLPEA S
Sbjct  282   AKRTAAAARRWREYSRRGADKPPSYKLPEAIS  313



>ref|XP_006644659.1| PREDICTED: zuotin-like [Oryza brachyantha]
Length=342

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 210/290 (72%), Positives = 239/290 (82%), Gaps = 4/290 (1%)
 Frame = +3

Query  384   SGRRKGFGRIRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGD  563
             SGRR       VA +  ++   VA+DYYAVLG++PDA+P+QIKKAYYNCMKACHPDLSG+
Sbjct  54    SGRRV-LTVSAVAAESPSSGGGVAEDYYAVLGVMPDATPQQIKKAYYNCMKACHPDLSGN  112

Query  564   DEETTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIG  743
             D + TNFCMFINE+Y +L+DP+QR VYDEIHGYAATA NPF DDS+P+DHVFVDEFSCIG
Sbjct  113   DPDVTNFCMFINEVYTVLTDPIQRAVYDEIHGYAATATNPFLDDSAPRDHVFVDEFSCIG  172

Query  744   CKNCANVCPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEM  923
             CKNCANVC KVF+IEED+GRARVY QSG  +LIQ+AI++CPVDCIHWTSAAQLSLLEDEM
Sbjct  173   CKNCANVCSKVFEIEEDYGRARVYCQSGKVDLIQEAIDTCPVDCIHWTSAAQLSLLEDEM  232

Query  924   RRVERVNVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDY  1103
             RRVERVNV LML+GMG +S+DVFRMASTRWEKRQAKVL   KVR    +      S W  
Sbjct  233   RRVERVNVGLMLAGMG-SSVDVFRMASTRWEKRQAKVL--EKVRRRVSQDDSSKKSSWSD  289

Query  1104  LWAKPRDYQTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             +W  P  Y+  EEEA+ERA RAAAAARRWREYSRKG DK PTFKLPEA S
Sbjct  290   VWGAPTRYRKNEEEARERAKRAAAAARRWREYSRKGADKPPTFKLPEAVS  339



>ref|XP_006654690.1| PREDICTED: uncharacterized protein LOC102717898 [Oryza brachyantha]
Length=346

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/274 (72%), Positives = 230/274 (84%), Gaps = 2/274 (1%)
 Frame = +3

Query  426   QESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
             +  +  +EVADD+Y+VLG++PDA+PE+IKKAYY+CMKACHPDLSGD  E TNFCMFINE+
Sbjct  70    EHGSTEDEVADDFYSVLGVMPDATPEEIKKAYYSCMKACHPDLSGDGPEVTNFCMFINEV  129

Query  606   YEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             Y +LSDP+QR VYDEIHGY+ATAINPFFDDS+PKD VFVDEF+CIGCK CANVCP VF I
Sbjct  130   YTVLSDPIQRAVYDEIHGYSATAINPFFDDSAPKDQVFVDEFTCIGCKYCANVCPNVFRI  189

Query  786   EEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
             EED+GR+RVYSQSG  ELIQ+AI+SCPV+CIHWTSAAQLSLLE+EMRR+ERVNV LM +G
Sbjct  190   EEDYGRSRVYSQSGRTELIQEAIDSCPVNCIHWTSAAQLSLLENEMRRIERVNVGLMSAG  249

Query  966   MGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeee  1145
             MG  S+DVFRMAS RWEKRQ+K+L   + RM  +  SD S + W  +W  P  YQ  EEE
Sbjct  250   MG-VSVDVFRMASVRWEKRQSKILENIRTRMANKNNSDISGT-WSDIWGSPTRYQGNEEE  307

Query  1146  akeragraaaaarrwreYSRKGVDKRPTFKLPEA  1247
             A ERA RAAAAARRWREYSRKG DK P ++LPEA
Sbjct  308   ATERAKRAAAAARRWREYSRKGADKPPGYRLPEA  341



>ref|XP_003568045.1| PREDICTED: uncharacterized protein LOC100841326 [Brachypodium 
distachyon]
Length=342

 Score =   385 bits (989),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 199/281 (71%), Positives = 230/281 (82%), Gaps = 3/281 (1%)
 Frame = +3

Query  408   RIRVAYQESAASEE-VADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNF  584
             R   A  E   SEE VADD+Y+VLG++PDA+ E+IKKAYY+CMKACHPDLSGDD   T+F
Sbjct  59    RASTAEAEYGTSEEDVADDFYSVLGVMPDATTEEIKKAYYSCMKACHPDLSGDDPNVTSF  118

Query  585   CMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANV  764
             CMF+NE+Y +LSDPVQR  YDEIHGY ATA NPFFD ++ KDHVFVDEF+CIGC+NCAN+
Sbjct  119   CMFVNEVYAVLSDPVQRAAYDEIHGYTATATNPFFDSNASKDHVFVDEFTCIGCRNCANI  178

Query  765   CPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVN  944
             CP VF+IEEDFGR+RVYSQSGS +LIQ AI+SCPVDCIHWTSAAQLSLLE+EMR+VERVN
Sbjct  179   CPGVFEIEEDFGRSRVYSQSGSTDLIQDAIDSCPVDCIHWTSAAQLSLLENEMRKVERVN  238

Query  945   VALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRD  1124
             V LM +GMG  S+DVFRMAS RWEKRQ+KVL + + RM  QK SD   S W  +W  P  
Sbjct  239   VGLMSAGMG-VSVDVFRMASARWEKRQSKVLEKIRTRMVNQKNSDMGSS-WSDIWGSPSR  296

Query  1125  YQTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEA  1247
             YQ+ +EEA ERA RAA AARRWREYSRKG D+ P FKLPEA
Sbjct  297   YQSNDEEAAERADRAARAARRWREYSRKGTDRPPKFKLPEA  337



>ref|XP_004487580.1| PREDICTED: protein CAJ1-like [Cicer arietinum]
Length=305

 Score =   380 bits (975),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 186/276 (67%), Positives = 222/276 (80%), Gaps = 10/276 (4%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPR---KRSPILGTNCNSVSSHGGSGRRKGFGRIRVAY  425
             M+QLLSPV T+ LK QN   NL  +   K+   +   C  V     SG+RK   R+RV+ 
Sbjct  1     MSQLLSPVYTEALKIQNTSLNLCSKSSWKKPDKVANPCTLVMQ---SGKRKECRRVRVSA  57

Query  426   QESAAS-EEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINE  602
             ++S +  +  ADDYYAVLGLLPDA+PE+IKKAYY+CMKACHPDLS +D ETTNF MF+NE
Sbjct  58    EDSVSPIDSSADDYYAVLGLLPDATPEEIKKAYYDCMKACHPDLSSNDPETTNFSMFVNE  117

Query  603   IYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFD  782
             +Y +LSDP+QR VYDEIHGY+ ++INPF DDS  KDHVFVDEFSCIGCKNCANV   VF 
Sbjct  118   VYAVLSDPIQRKVYDEIHGYSLSSINPFLDDSISKDHVFVDEFSCIGCKNCANVASDVFA  177

Query  783   IEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLS  962
             IEEDFGRARV+SQ G+ EL+QQAIESCPVDCIHWTSAAQLSLLEDEM R+ERVNVALMLS
Sbjct  178   IEEDFGRARVFSQHGNPELVQQAIESCPVDCIHWTSAAQLSLLEDEMHRIERVNVALMLS  237

Query  963   GMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQK  1070
             GMG+AS DVFRMAS+RWEKRQ+KVL   ++++ K++
Sbjct  238   GMGSASFDVFRMASSRWEKRQSKVL---RMKLKKEQ  270



>gb|AFK44747.1| unknown [Medicago truncatula]
 gb|KEH38855.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=245

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 218/244 (89%), Gaps = 1/244 (0%)
 Frame = +3

Query  531   MKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKD  710
             MKACHPDLSG++ ETTNFCMFINE+Y +LSDP+QR VYDEIHGY+ T+ NPFFDDS PKD
Sbjct  1     MKACHPDLSGNNPETTNFCMFINEVYAVLSDPIQRNVYDEIHGYSLTSTNPFFDDSCPKD  60

Query  711   HVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTS  890
             HVFVDEFSCIGCKNCANV P VF +EEDFGRARV+SQ G+ EL+QQAI+SCPVDCIHWTS
Sbjct  61    HVFVDEFSCIGCKNCANVAPDVFAMEEDFGRARVFSQRGNPELVQQAIDSCPVDCIHWTS  120

Query  891   AAQLSLLEDEMRRVERVNVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQK  1070
             AAQLSLLEDEMRR+ERVNVALMLSGMG+AS DVFRMA +RWEKRQ+KVL QAK+RM +Q+
Sbjct  121   AAQLSLLEDEMRRIERVNVALMLSGMGSASFDVFRMARSRWEKRQSKVLEQAKMRMMRQE  180

Query  1071  GSDKSDSYWDYLWAKPRDYQTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEA-  1247
              S K+DSYWD LW +P+DYQ +E+E KERA RAAAAARRWREYSRKGVDK P FKLPEA 
Sbjct  181   SSGKTDSYWDNLWGQPKDYQNSEDETKERAERAAAAARRWREYSRKGVDKPPKFKLPEAE  240

Query  1248  ASKD  1259
              SKD
Sbjct  241   PSKD  244



>ref|XP_006375496.1| hypothetical protein POPTR_0014s14030g [Populus trichocarpa]
 gb|ERP53293.1| hypothetical protein POPTR_0014s14030g [Populus trichocarpa]
Length=327

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 185/252 (73%), Positives = 215/252 (85%), Gaps = 6/252 (2%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNP--VHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
             MAQL+SPVCTD LK + P  V ++  R ++ +   N  SV +     +R+ FGRIRVA  
Sbjct  58    MAQLISPVCTDALKIKKPSNVFHISSRGKTALYHNNSRSVLN----SKRRDFGRIRVAAN  113

Query  429   ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
              SA+++ VADDYYAVLGLLPDA+PEQIKKAYY+CMKACHPDLSG+D +TTNFCMFINE+Y
Sbjct  114   SSASADAVADDYYAVLGLLPDATPEQIKKAYYSCMKACHPDLSGNDTDTTNFCMFINEVY  173

Query  609   EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
              +LSDP+QR++YDEIHG+A TA+NPFFDDSSPKDH FVDEFSCIGCKNCANV P+VF IE
Sbjct  174   AVLSDPLQRMIYDEIHGFALTAMNPFFDDSSPKDHAFVDEFSCIGCKNCANVAPEVFGIE  233

Query  789   EDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM  968
             EDFGRARVYSQ G+ +L+QQAIESCPVDCIHWTSAAQLSLLEDEMRRVER+NVALMLSGM
Sbjct  234   EDFGRARVYSQCGNLQLVQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERINVALMLSGM  293

Query  969   GAASIDVFRMAS  1004
             G+A  DVFRM S
Sbjct  294   GSAGADVFRMVS  305



>gb|ABK23437.1| unknown [Picea sitchensis]
Length=367

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 205/354 (58%), Positives = 247/354 (70%), Gaps = 27/354 (8%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRS---PILGTNCNSVSSHGGSGRRKGFGRIRVA-  422
             MA     VCT+ LKFQ    N   R R      L T+   +S   GSG+     R+ +  
Sbjct  1     MAVTQPQVCTNSLKFQPRDSNTRFRTRDWKPRSLDTSKRMLSQ--GSGKDLLSERLFMVK  58

Query  423   -----------YQESAASEEV-------ADDYYAVLGLLPDASPEQIKKAYYNCMKACHP  548
                         +  A  EEV       ADDYY+VLG+LPDA+P +IK AYY+CMK+CHP
Sbjct  59    LARRGRVRVVGVKAKARDEEVNLYGDSAADDYYSVLGVLPDATPAEIKHAYYSCMKSCHP  118

Query  549   DLSGDDEETTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDE  728
             DLSG+D + TNFC+F+NE+YE+LSDPVQR+VYDEIHGY+   +NPF DDS P+DHVFVDE
Sbjct  119   DLSGNDADATNFCIFVNEVYEVLSDPVQRMVYDEIHGYSLRTVNPFLDDSRPRDHVFVDE  178

Query  729   FSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSL  908
             FSCIGCKNCANV  ++F IEEDFGRAR   QSG+ +L+QQAI+SCPVDCIHWTSAAQLSL
Sbjct  179   FSCIGCKNCANVASEIFAIEEDFGRARACCQSGNPDLVQQAIDSCPVDCIHWTSAAQLSL  238

Query  909   LEDEMRRVERVNVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSD  1088
             LEDEMRRVERVNV LML+ MG+A  DVF  AS RWEKRQ + L +A +RM KQK   K+ 
Sbjct  239   LEDEMRRVERVNVGLMLANMGSAVPDVFSQASVRWEKRQRRALERAVIRMRKQKKGGKAQ  298

Query  1089  SYWDYLWA---KPRDYQTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLP  1241
             SYW+  W    +  +  +    A+ERA RAAAAAR+WREYSRKGVD+RPT  LP
Sbjct  299   SYWEGAWGVDNRSTNPSSENYSARERASRAAAAARKWREYSRKGVDRRPTCSLP  352



>gb|EMT05309.1| Chaperone protein dnaJ [Aegilops tauschii]
Length=363

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 220/280 (79%), Gaps = 17/280 (6%)
 Frame = +3

Query  417   VAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFI  596
             VA +  +     A+DYYAVLG++PDA+P+QIKKAYYNCMKACHPDLSG+D + TNFCMFI
Sbjct  63    VATEPRSPEGSAAEDYYAVLGVMPDATPQQIKKAYYNCMKACHPDLSGNDPDVTNFCMFI  122

Query  597   NEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
             NE+Y +L+DP+QR VYDEI+G+ ATA NPF DD+ P+DHVFVDEFSCIGCKNCANVC KV
Sbjct  123   NEVYTVLTDPIQRAVYDEINGFTATATNPFLDDA-PRDHVFVDEFSCIGCKNCANVCSKV  181

Query  777   FDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  956
             F+IEED+GRARVY+QSG+ ELIQ+AI+SCPVDCIHWTSAAQ++LLEDEMRRVERVNVALM
Sbjct  182   FEIEEDYGRARVYNQSGNEELIQEAIDSCPVDCIHWTSAAQVTLLEDEMRRVERVNVALM  241

Query  957   LSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTT  1136
             LSGMG +S DVFRM                KVRM   +      S W  +W  P  YQ  
Sbjct  242   LSGMG-SSFDVFRM---------------NKVRMRMSQDDANKGSSWSDIWGSPTRYQKN  285

Query  1137  eeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASK  1256
             EE+ KER  RAAAAARRWREYSRKG D+ PTFKLPEAAS 
Sbjct  286   EEDTKERVKRAAAAARRWREYSRKGADRPPTFKLPEAASN  325



>dbj|BAJ95859.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   357 bits (917),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 188/271 (69%), Positives = 218/271 (80%), Gaps = 3/271 (1%)
 Frame = +3

Query  438   ASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEIL  617
             + E+VADD+Y+VLG++PDA+ E+IKKAYY+CMK CHPDL G   + TNF +FINE+Y +L
Sbjct  74    SEEDVADDFYSVLGVMPDATSEEIKKAYYSCMKTCHPDLGGGHPDVTNFSIFINEVYTVL  133

Query  618   SDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDF  797
             SDPVQR VYDEIHGY ATA NPFFDDS+ KDHVFVDEF+CIGC+ CANVCP VF+IE+DF
Sbjct  134   SDPVQRAVYDEIHGYTATATNPFFDDSAVKDHVFVDEFTCIGCRICANVCPSVFEIEDDF  193

Query  798   GRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAA  977
             GRARV SQ GS ELIQ AI+SCPVDCIHWTSAAQLSLLE E RR+ERVNV LM +GMG  
Sbjct  194   GRARVCSQRGSPELIQDAIDSCPVDCIHWTSAAQLSLLESETRRIERVNVGLMNAGMG-V  252

Query  978   SIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTe-eeake  1154
             S++VFRMAS  WEKRQAKVL + + RM  Q  SD + S W  +W  P  YQ TE  EA E
Sbjct  253   SVNVFRMASASWEKRQAKVLEKIRTRMMNQNNSDTT-SPWSDIWGSPTRYQNTEDVEASE  311

Query  1155  ragraaaaarrwreYSRKGVDKRPTFKLPEA  1247
             RA RA AAARRWREYSRKG D+ P +KLP+A
Sbjct  312   RANRAEAAARRWREYSRKGADRPPRYKLPDA  342



>gb|EMS48052.1| Chaperone protein DnaJ [Triticum urartu]
Length=266

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/258 (70%), Positives = 206/258 (80%), Gaps = 17/258 (7%)
 Frame = +3

Query  483   LPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYDEIHGY  662
             +PDA+P+QIKKAYYNCMKACHPDLSG+D + TNFCMFINE+Y +L+DPVQR VYDEI+G+
Sbjct  24    MPDATPQQIKKAYYNCMKACHPDLSGNDPDVTNFCMFINEVYTVLTDPVQRAVYDEINGF  83

Query  663   AATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGELI  842
              ATA NPF DD+ P+DHVFVDEFSCIGCKNCANVC KVF+IEED+GRARVY+QSG+ ELI
Sbjct  84    TATATNPFLDDA-PRDHVFVDEFSCIGCKNCANVCSKVFEIEEDYGRARVYNQSGNEELI  142

Query  843   QQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASIDVFRMASTRWEKR  1022
             Q+AI+SCPVDCIHWTSAAQ++LLEDEMRRVERVNVALMLSGMG +S DVFRM        
Sbjct  143   QEAIDSCPVDCIHWTSAAQVTLLEDEMRRVERVNVALMLSGMG-SSFDVFRM--------  193

Query  1023  QAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTTeeeakeragraaaaarrwreYS  1202
                     KVRM   +      S W  +W  P  YQ  +E+ KER  RAAAAARRWREYS
Sbjct  194   -------NKVRMRMSQDDANKGSSWSDIWGSPTRYQKNDEDTKERVKRAAAAARRWREYS  246

Query  1203  RKGVDKRPTFKLPEAASK  1256
             RKG D+ PTFKLPEAAS 
Sbjct  247   RKGADRPPTFKLPEAASN  264



>emb|CDX79847.1| BnaA05g03090D [Brassica napus]
Length=228

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 195/222 (88%), Gaps = 0/222 (0%)
 Frame = +3

Query  588   MFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVC  767
             MFIN++YEILSDPVQR+VYDEIHGYA TA NPF DDSSPKDHVFVDEF+CIGCKNCANV 
Sbjct  1     MFINDVYEILSDPVQRMVYDEIHGYAVTATNPFLDDSSPKDHVFVDEFACIGCKNCANVA  60

Query  768   PKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV  947
             P +F IEEDFGRAR  +Q G+ +L+QQA+E+CPVDCI+ TSAAQLSLLEDEMRRVERVNV
Sbjct  61    PDIFQIEEDFGRARACNQRGNPDLLQQAVETCPVDCIYQTSAAQLSLLEDEMRRVERVNV  120

Query  948   ALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDY  1127
             ALMLSGMG+ ++DVFRMA +RWEKRQAKVL QA+ RM K+K +D+  SYWD LW K   Y
Sbjct  121   ALMLSGMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKRKSTDEEPSYWDNLWGKDNQY  180

Query  1128  QTTeeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAAS  1253
             Q +EEE +ERA RAAAAARRWREYSR+GVDKRPTFKLP+++S
Sbjct  181   QKSEEEVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSSS  222



>ref|XP_001755559.1| predicted protein [Physcomitrella patens]
 gb|EDQ79619.1| predicted protein [Physcomitrella patens]
Length=273

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 207/267 (78%), Gaps = 4/267 (1%)
 Frame = +3

Query  450   VADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPV  629
             +A+D+Y+VLGL PDA+ E+IKKAYY+CMKACHPDLSG+  ++T+FCM +NEIYE+LSDP 
Sbjct  1     IAEDFYSVLGLTPDATQEEIKKAYYSCMKACHPDLSGNSPDSTDFCMLVNEIYEVLSDPD  60

Query  630   QRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRAR  809
             QR+VYDEI+GY  T +NPF +    +DH FVDEFSCIGCKNC NV P  F+IEE++GRAR
Sbjct  61    QRMVYDEINGYTLTFVNPFLNPKQERDHTFVDEFSCIGCKNCGNVAPGTFEIEEEYGRAR  120

Query  810   VYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASIDV  989
             V  QSG+  L Q+AIE+CPVDCIHW +AAQL+LLEDEMRR+ERVNV +ML+GMG+ S DV
Sbjct  121   VRCQSGNPRLTQEAIETCPVDCIHWVTAAQLTLLEDEMRRIERVNVGMMLAGMGSQSPDV  180

Query  990   FRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKP---RDYQTTeeeakera  1160
             F  AS RWEKRQAK L +A++RM K+ G D   ++W   W  P    D++  +  A+ERA
Sbjct  181   FAQASWRWEKRQAKALERARIRMMKENGKDAPGAWWQG-WTNPGGDGDFKPDDMGARERA  239

Query  1161  graaaaarrwreYSRKGVDKRPTFKLP  1241
              + AAA+RRWREYSR+   +R  + LP
Sbjct  240   AKTAAASRRWREYSRQNAGRRSVYSLP  266



>gb|AAS72346.1| unknown protein [Oryza sativa Japonica Group]
Length=295

 Score =   328 bits (840),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 181/232 (78%), Gaps = 22/232 (9%)
 Frame = +3

Query  435   AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
             +A +EVADD+Y+VLG++PDA+PE+IKKAYY+CMKACHPDLSGD+ E TNFCMFINE+Y +
Sbjct  71    SAEDEVADDFYSVLGVMPDATPEEIKKAYYSCMKACHPDLSGDNPEVTNFCMFINEVYTV  130

Query  615   LSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             LSDPVQR VYDEIHGY ATA NPFFDDS+PKD VFVDEF+CIGCK CANVCP VF IEED
Sbjct  131   LSDPVQRAVYDEIHGYTATATNPFFDDSAPKDQVFVDEFTCIGCKYCANVCPNVFRIEED  190

Query  795   FGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA  974
             +G                     PV+CIHWTSAAQLSLLE+EMRR+ERVNV LM +GMG 
Sbjct  191   YGS--------------------PVNCIHWTSAAQLSLLENEMRRIERVNVGLMSAGMG-  229

Query  975   ASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQ  1130
              S+DVFR+AS RWEKRQ+KVL + + RMT +K SD S S W  +W  P  YQ
Sbjct  230   VSVDVFRLASVRWEKRQSKVLEKIRTRMTNKKYSDISSS-WTDIWGSPTRYQ  280



>gb|ABK21719.1| unknown [Picea sitchensis]
Length=339

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/304 (57%), Positives = 208/304 (68%), Gaps = 29/304 (10%)
 Frame = +3

Query  255   MAQLLSPVCTDILKFQNPVHNLFPRKRS---PILGTNCNSVSSHGGSGRRKGFGRIRVA-  422
             MA     VCT+ LKFQ    N   R R      L T+   +S   GSG+     R+ +  
Sbjct  1     MAVTQPQVCTNSLKFQPRDSNTRFRTRDWKPRSLDTSKRMLSQ--GSGKDLLSERLFMVK  58

Query  423   -----------YQESAASEEV-------ADDYYAVLGLLPDASPEQIKKAYYNCMKACHP  548
                         +  A  EEV       ADDYY+VLG+LPDA+P +IK AYY+CMK+CHP
Sbjct  59    LARRGRVRVVGVKAKARDEEVNLYGDSAADDYYSVLGVLPDATPAEIKHAYYSCMKSCHP  118

Query  549   DLSGDDEETTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDE  728
             DLSG+D + TNFC+F+NE+YE+LSDPVQR+VYDEIHGY+   +NPF DDS P+DHVFVDE
Sbjct  119   DLSGNDADATNFCIFVNEVYEVLSDPVQRMVYDEIHGYSLRTVNPFLDDSRPRDHVFVDE  178

Query  729   FSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSL  908
             FSCIGCKNCANV  ++F IEEDFGRAR   QSG+ +L+QQAI+SCPVDCIHWTSAAQLSL
Sbjct  179   FSCIGCKNCANVASEIFAIEEDFGRARACCQSGNPDLVQQAIDSCPVDCIHWTSAAQLSL  238

Query  909   LEDEMRRVERVNVALMLSGMGAASIDVFRMASTRWEKRQAKVLG-----QAKVRMTKQKG  1073
             LEDEMRRVERVNV LML+ MG+A  DVF  AS RWEKRQ + L      +  V   +Q+G
Sbjct  239   LEDEMRRVERVNVGLMLANMGSAVPDVFSQASVRWEKRQRRALKTIVPVRGLVEQLQQQG  298

Query  1074  SDKS  1085
             S  S
Sbjct  299   SGGS  302



>tpg|DAA57778.1| TPA: hypothetical protein ZEAMMB73_852744 [Zea mays]
Length=251

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +3

Query  417  VAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFI  596
            VA +  +++  +A+DYYAVLG++PDA+P+QIKK YYNCMK+CHPDLSG+D + TNFCMFI
Sbjct  44   VAAESRSSAGGIAEDYYAVLGVMPDATPKQIKKPYYNCMKSCHPDLSGNDPDVTNFCMFI  103

Query  597  NEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
            NE+Y +L+DP+QR V+DEIHGYAATA NPF DDS+P+DHVFVDEFSCIGCKNCANVC KV
Sbjct  104  NEVYTVLTDPIQRAVHDEIHGYAATATNPFLDDSAPRDHVFVDEFSCIGCKNCANVCSKV  163

Query  777  FDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  956
            F IEEDFGRARVY QSGS ELIQ+AI+SCPVDCIHWT AAQLSLLEDEMRRVERVNV LM
Sbjct  164  FQIEEDFGRARVYDQSGSTELIQEAIDSCPVDCIHWTLAAQLSLLEDEMRRVERVNVGLM  223

Query  957  LSGMGA  974
            L+G  A
Sbjct  224  LAGWEA  229



>gb|EMT21641.1| Chaperone protein dnaJ 10 [Aegilops tauschii]
Length=285

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 171/208 (82%), Gaps = 11/208 (5%)
 Frame = +3

Query  444   EEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY-----  608
             E+VADD+Y+VLG++PDA+ E+IKKAYY+CMK CHPDLSG   + TNF MFINE+Y     
Sbjct  78    EDVADDFYSVLGVMPDATSEEIKKAYYSCMKTCHPDLSGGHPDVTNFSMFINEVYTLTRG  137

Query  609   -----EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPK  773
                  ++LSDPVQR VYDEIHGY ATA NPF DDS+ KD VFVDEF+CIGC+ CANVCP 
Sbjct  138   VGFEEQVLSDPVQRAVYDEIHGYTATATNPFVDDSAVKDQVFVDEFTCIGCRICANVCPS  197

Query  774   VFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVAL  953
             VF+IE++FGRARV SQ G+ EL+Q AI+SCPVDCIHWTSAAQLSLLE E RR+ERVNV L
Sbjct  198   VFEIEDEFGRARVCSQRGNPELVQDAIDSCPVDCIHWTSAAQLSLLESETRRIERVNVGL  257

Query  954   MLSGMGAASIDVFRMASTRWEKRQAKVL  1037
             M +GMG  SI+VFRMAS  WEKRQAKVL
Sbjct  258   MNAGMG-VSINVFRMASASWEKRQAKVL  284



>ref|XP_001760033.1| predicted protein [Physcomitrella patens]
 gb|EDQ75158.1| predicted protein [Physcomitrella patens]
Length=220

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 170/223 (76%), Gaps = 12/223 (5%)
 Frame = +3

Query  450   VADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPV  629
             + +D+Y+VLGL PDA+ E+IKKAYY+CMKACHPDLSG++ ++T+FCMF+NEIYE+LSDP 
Sbjct  3     IGEDFYSVLGLTPDATQEEIKKAYYSCMKACHPDLSGNNSDSTDFCMFVNEIYEVLSDPE  62

Query  630   QRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRAR  809
             QR+VYDEI+GYA T+ NPF      +DH FVDEF+CIGCKNCANV    F+IEE++GRAR
Sbjct  63    QRMVYDEINGYALTSANPFLFPKQERDHAFVDEFTCIGCKNCANVASDTFEIEEEYGRAR  122

Query  810   VYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASIDV  989
                  GS           PVDCIHW +AAQL+LLEDEMRRVERVNV +MLSGMG  S DV
Sbjct  123   NLHDFGS-----------PVDCIHWVTAAQLTLLEDEMRRVERVNVGMMLSGMGYQSPDV  171

Query  990   FRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKP  1118
             F  AS RWEKRQAK + QA++RM K+KG D   ++W   W+ P
Sbjct  172   FAQASWRWEKRQAKAMEQARIRMMKEKGKDAFGAWWQG-WSNP  213



>ref|XP_006375495.1| hypothetical protein POPTR_0014s14030g [Populus trichocarpa]
 gb|ERP53292.1| hypothetical protein POPTR_0014s14030g [Populus trichocarpa]
Length=258

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 170/204 (83%), Gaps = 6/204 (3%)
 Frame = +3

Query  255  MAQLLSPVCTDILKFQNP--VHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQ  428
            MAQL+SPVCTD LK + P  V ++  R ++ +   N  SV +     +R+ FGRIRVA  
Sbjct  58   MAQLISPVCTDALKIKKPSNVFHISSRGKTALYHNNSRSVLN----SKRRDFGRIRVAAN  113

Query  429  ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             SA+++ VADDYYAVLGLLPDA+PEQIKKAYY+CMKACHPDLSG+D +TTNFCMFINE+Y
Sbjct  114  SSASADAVADDYYAVLGLLPDATPEQIKKAYYSCMKACHPDLSGNDTDTTNFCMFINEVY  173

Query  609  EILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
             +LSDP+QR++YDEIHG+A TA+NPFFDDSSPKDH FVDEFSCIGCKNCANV P+VF IE
Sbjct  174  AVLSDPLQRMIYDEIHGFALTAMNPFFDDSSPKDHAFVDEFSCIGCKNCANVAPEVFGIE  233

Query  789  EDFGRARVYSQSGSGELIQQAIES  860
            EDFGRARVYSQ G+ +L+QQAIES
Sbjct  234  EDFGRARVYSQCGNLQLVQQAIES  257



>gb|EMS60360.1| Protein tumorous imaginal discs, mitochondrial [Triticum urartu]
Length=303

 Score =   279 bits (713),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 168/246 (68%), Gaps = 50/246 (20%)
 Frame = +3

Query  408   RIRVAYQESAA----SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEET  575
             RIR AY   A      E+VADD+Y+VLG++PDA+ E+IKKAYY+CMK CHPDLSG D + 
Sbjct  2     RIR-AYTAEAEHGRWEEDVADDFYSVLGVMPDATSEEIKKAYYSCMKTCHPDLSGGDPDV  60

Query  576   TNFCMFINEIY--------------------------------------------EILSD  623
             TNF MFINE+Y                                            ++LSD
Sbjct  61    TNFSMFINEVYTVGAFSTSFRLLMDANTQLFWKMLDFPLKLSLLTKLTRVVGFEEQVLSD  120

Query  624   PVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGR  803
             PVQR VYDEIHGY ATA NPFFDDS+ KD VFVDEF+CIGC+ CANVCP VF+IE++FGR
Sbjct  121   PVQRAVYDEIHGYTATATNPFFDDSAVKDRVFVDEFTCIGCRICANVCPSVFEIEDEFGR  180

Query  804   ARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASI  983
             ARV SQ G+ ELIQ AI+SCPVDCIHWTSAAQLSLLE E RR+ERVNV LM +GMG  S+
Sbjct  181   ARVCSQRGNPELIQDAIDSCPVDCIHWTSAAQLSLLESETRRIERVNVGLMNAGMG-VSV  239

Query  984   DVFRMA  1001
             +VFRM 
Sbjct  240   NVFRMV  245



>ref|XP_002993146.1| hypothetical protein SELMODRAFT_136585, partial [Selaginella 
moellendorffii]
 gb|EFJ05786.1| hypothetical protein SELMODRAFT_136585, partial [Selaginella 
moellendorffii]
Length=193

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 149/193 (77%), Gaps = 2/193 (1%)
 Frame = +3

Query  489   DASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYDEIHGYAA  668
             DA+ E I+KAYY+CMK CHPDL GDD   TNFCMF+NE+YE+LSDP QR+VYDEI+GYA 
Sbjct  1     DATSEDIRKAYYSCMKECHPDLIGDDSGATNFCMFVNEVYEVLSDPEQRMVYDEINGYAL  60

Query  669   TAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGELIQQ  848
             T+ NPF   +  KD VFVDE SCIGCKNC N  P  F IEE+ GRARV SQSG   L Q 
Sbjct  61    TSKNPFLSVTCTKDRVFVDEVSCIGCKNCVNTAPCTFAIEEEHGRARVVSQSGDASLSQI  120

Query  849   AIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASIDVFRMASTRWEKRQA  1028
             AIESCPVDCIHW SA QL+LLEDEMRRVERV+V +MLSGMG  S DVF  ASTRWEK+QA
Sbjct  121   AIESCPVDCIHWVSAPQLALLEDEMRRVERVSVGVMLSGMGYQSADVFATASTRWEKKQA  180

Query  1029  K--VLGQAKVRMT  1061
             K  VL    V+M+
Sbjct  181   KARVLSLQFVQMS  193



>ref|XP_002994240.1| hypothetical protein SELMODRAFT_138386, partial [Selaginella 
moellendorffii]
 gb|EFJ04707.1| hypothetical protein SELMODRAFT_138386, partial [Selaginella 
moellendorffii]
Length=193

 Score =   274 bits (701),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 149/193 (77%), Gaps = 2/193 (1%)
 Frame = +3

Query  489   DASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYDEIHGYAA  668
             DA+ E I+KAYY+CMK CHPDL GDD   TNFCMF+NE+YE+LSDP QR+VYDEI+GYA 
Sbjct  1     DATSEDIRKAYYSCMKECHPDLIGDDSGATNFCMFVNEVYEVLSDPEQRMVYDEINGYAL  60

Query  669   TAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGELIQQ  848
             T+ NPF   +  KD VFVDE SCIGCKNC N  P  F IEE+ GRARV SQSG   L Q 
Sbjct  61    TSKNPFLSVTCTKDRVFVDEVSCIGCKNCVNTAPCTFAIEEEHGRARVVSQSGDASLSQI  120

Query  849   AIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASIDVFRMASTRWEKRQA  1028
             AIESCPVDCIHW SA QL+LLEDEMRRVERV+V +MLSGMG  S DVF  ASTRWEK+QA
Sbjct  121   AIESCPVDCIHWVSAPQLALLEDEMRRVERVSVGVMLSGMGYQSADVFATASTRWEKKQA  180

Query  1029  K--VLGQAKVRMT  1061
             K  VL    V+M+
Sbjct  181   KARVLSLHFVQMS  193



>gb|ADK60794.1| unknown, partial [Arachis diogoi]
 gb|ADK60852.1| heat shock protein DnaJ N-terminal domain-containing protein, 
partial [Arachis diogoi]
Length=140

 Score =   226 bits (576),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  735   CIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLE  914
             CIGCKNC NV P VF IEEDFGRARVYSQ G+ EL+QQAI+SCPVDCIHWTSAAQLSLLE
Sbjct  1     CIGCKNCTNVAPDVFAIEEDFGRARVYSQCGNPELVQQAIDSCPVDCIHWTSAAQLSLLE  60

Query  915   DEMRRVERVNVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSY  1094
             DEMRR+ERVNVALM SGMG AS DVFRMAS+RWEKRQ+KVL +AK+RM KQ+ SD++DSY
Sbjct  61    DEMRRIERVNVALMHSGMGGASFDVFRMASSRWEKRQSKVLERAKMRMMKQQRSDRTDSY  120

Query  1095  WDYLWAKPRDYQTT  1136
             W+ LW  P+DY+++
Sbjct  121   WENLWGNPKDYESS  134



>ref|XP_005650033.1| DnaJ-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25489.1| DnaJ-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=273

 Score =   230 bits (587),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 154/214 (72%), Gaps = 9/214 (4%)
 Frame = +3

Query  417   VAY--QESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDL---SGDDEETT-  578
             VAY  Q +    + A+D+YA+LG+ PDAS ++IK+AYY  M+ACHPD+    G+D+E++ 
Sbjct  10    VAYEAQTNEGVNDEAEDFYAILGVTPDASEKEIKQAYYRVMRACHPDVVSVEGEDDESSA  69

Query  579   -NFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNC  755
                C+F+N+IYE L D  +R  YD I G++  A+NPF+D S  +  VFV E+ CIGCKNC
Sbjct  70    EEVCVFVNDIYETLMDREKREAYDAIAGFSGNALNPFYDTSYERSQVFVSEYDCIGCKNC  129

Query  756   ANVCPKVFDIEEDFGRARVYSQSGSG-ELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRV  932
              NVCPK F IE+++GRAR   Q GS  EL+Q+AI++CPV+CIHW +A QL+LLE  M ++
Sbjct  130   TNVCPKTFAIEDEYGRARAMQQGGSTDELLQEAIDTCPVNCIHWVTAPQLALLETTMAKM  189

Query  933   ERVNVALMLSGMGAASIDVFRMASTRWEKRQAKV  1034
             ERV+  +++ G G + +DVF  A+T WEKRQA++
Sbjct  190   ERVDAWILMMG-GGSGVDVFMEAATAWEKRQARI  222



>ref|XP_008653859.1| PREDICTED: protein tumorous imaginal discs, mitochondrial-like 
[Zea mays]
Length=194

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 138/207 (67%), Gaps = 19/207 (9%)
 Frame = +3

Query  255  MAQLLSP--VCTDILKFQ---NPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRV  419
            MA LLSP  +   + KF     PV      +R  I G        H    RR+ +GR  +
Sbjct  1    MAPLLSPPLLADSVTKFHAASTPVSCSGSPQRYVITGLAGAGRGEH--DWRRRTWGRTNL  58

Query  420  AYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFIN  599
              +  AA    ++   A            IKKAYYNCMK+CHPDLSG+D + TNFCMFIN
Sbjct  59   RVKAVAAESRSSEGGIA------------IKKAYYNCMKSCHPDLSGNDPDVTNFCMFIN  106

Query  600  EIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVF  779
            E+Y +L+DP+QR VYDEIHGYAATA NPF D S+P+DHVFVDEFSCIGCKNCANVC KVF
Sbjct  107  EVYTVLTDPIQRAVYDEIHGYAATATNPFLDGSAPRDHVFVDEFSCIGCKNCANVCSKVF  166

Query  780  DIEEDFGRARVYSQSGSGELIQQAIES  860
            +IEEDFGRARVY QSGS ELIQ+AI+S
Sbjct  167  EIEEDFGRARVYDQSGSTELIQEAIDS  193



>gb|ACV53168.1| chloroplast DnaJ-like protein 3 [Chlamydomonas reinhardtii]
Length=393

 Score =   229 bits (584),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 140/193 (73%), Gaps = 3/193 (2%)
 Frame = +3

Query  462   YYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLV  641
             +Y++LG+ P A  ++IK AYY  ++ CHPD SGDDE  T+FC  +NE+YE LSDP +R +
Sbjct  59    FYSLLGVSPLADGKEIKAAYYRMVRTCHPDRSGDDE-ATDFCAMLNEVYETLSDPTKRAL  117

Query  642   YDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQ  821
             YDE+ G++A ++NPF DD  P D VFVDEFSCIGC+NC  VCPK F +EED+GRARV  Q
Sbjct  118   YDELAGFSAESVNPFLDDRYPADRVFVDEFSCIGCRNCNAVCPKTFGMEEDYGRARVMLQ  177

Query  822   SGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG-AASIDVFR  995
                 E  +Q+AI++CPV CIHW +A QL+LLE  M R+ER+ V  M+ G G  A+ DVF 
Sbjct  178   DADSEAKLQEAIDTCPVSCIHWVTAPQLNLLEGAMARMERIAVWSMMGGSGMGANKDVFV  237

Query  996   MASTRWEKRQAKV  1034
              AS  W++RQ+++
Sbjct  238   EASYAWQRRQSEI  250



>ref|XP_008381239.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103444103 
[Malus domestica]
Length=702

 Score =   233 bits (594),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 171/341 (50%), Positives = 213/341 (62%), Gaps = 59/341 (17%)
 Frame = +3

Query  258   AQLLSP--VCTDILKFQNPVHNLFPRKRSPILGTNCNSVSS----HGGSGRRKGFGRIRV  419
             AQLLSP  V T+ LKFQNP+ N   R    +L    +S++S     GG  RR+G GR+ V
Sbjct  412   AQLLSPSPVFTEXLKFQNPLPNGCSRTPWRMLAKPSSSLTSIGGHGGGGRRRRGLGRLGV  471

Query  420   AYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFIN  599
             A   S +++ VADDYY+VLGL                   C              C  +N
Sbjct  472   ATDGSPSTDAVADDYYSVLGL-------------------CKI-----------LCFRVN  501

Query  600   EIYEILSDPVQRLV-YDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
                 I+ D  +R+V Y  I    A     F    SP                     P V
Sbjct  502   SSLVIIEDSKKRVVTYRWIFNPTAXGHFTFVVVPSP---------------------PDV  540

Query  777   FDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  956
             F IEEDFGRARV SQ G+ +L+Q+AI+SCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM
Sbjct  541   FGIEEDFGRARVXSQFGNVDLVQRAIDSCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  600

Query  957   LSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKPRDYQTT  1136
             L+GMG  S+DVFRMAS+RW+KRQ++VL QAK+RM K++ +DK+++YWD +WAKP++Y  +
Sbjct  601   LAGMG-XSVDVFRMASSRWQKRQSQVLEQAKIRMMKKRDTDKTEAYWDNIWAKPKEYHNS  659

Query  1137  eeeakeragraaaaarrwreYSRKGVDKRPTFKLPEAASKD  1259
             EEE KERA RAAAAARRWREYSR+G DK P++KLPEA S +
Sbjct  660   EEEVKERARRAAAAARRWREYSRRGADKPPSYKLPEAISNN  700



>ref|XP_001700257.1| chloroplast DnaJ-like protein [Chlamydomonas reinhardtii]
 gb|EDO98224.1| chloroplast DnaJ-like protein [Chlamydomonas reinhardtii]
Length=325

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +3

Query  486   PDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYDEIHGYA  665
             P A  ++IK AYY  ++ CHPD +GDDE  T+FC  +NE+YE LSDP +R +YDE+ G++
Sbjct  38    PLADGKEIKAAYYRMVRTCHPDRTGDDE-ATDFCAMLNEVYETLSDPTKRALYDELAGFS  96

Query  666   ATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGEL-I  842
             A ++NPF DD  P D VFVDEFSCIGC+NC  VCPK F +EED+GRARV  Q    E  +
Sbjct  97    AESVNPFLDDRYPADRVFVDEFSCIGCRNCNAVCPKTFGMEEDYGRARVMLQDADSEAKL  156

Query  843   QQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG-AASIDVFRMASTRWEK  1019
             Q+AI++CPV CIHW +A QL+LLE  M R+ER+ V  M+ G G  A+ DVF  AS  W++
Sbjct  157   QEAIDTCPVSCIHWVTAPQLNLLEGAMARMERIAVWSMMGGSGMGANKDVFVEASYAWQR  216

Query  1020  RQAKV  1034
             RQ+++
Sbjct  217   RQSEI  221



>gb|AFK34524.1| unknown [Medicago truncatula]
Length=169

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 126/166 (76%), Gaps = 7/166 (4%)
 Frame = +3

Query  255  MAQLLSPVCTDILKFQNPVHNLFPRKRSPIL--GTNCNSVSSHGGSGRRKGFGRIRVAY-  425
            MAQLL+P+  + LK  N   +L  R    +L   T  +       S +R+GFGR+RVA  
Sbjct  1    MAQLLTPLYPEALKIHN--SSLCTRSSWQMLQQKTAVSPWRFATPSCKRRGFGRVRVATE  58

Query  426  QESAASEEV--ADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFIN  599
            QES ++ +   A+DYYAVLGLLPDA+PEQIKKAYYNCMK CHPDLSG+D ETTNFC FIN
Sbjct  59   QESFSTSDSVGAEDYYAVLGLLPDATPEQIKKAYYNCMKTCHPDLSGNDPETTNFCTFIN  118

Query  600  EIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSC  737
            E+YE+LSDPVQR VYD+IHGY+ T+INPF DDSSPKDHVFVDEFSC
Sbjct  119  EVYEVLSDPVQRRVYDDIHGYSLTSINPFMDDSSPKDHVFVDEFSC  164



>ref|XP_005847377.1| hypothetical protein CHLNCDRAFT_134196 [Chlorella variabilis]
 gb|EFN55275.1| hypothetical protein CHLNCDRAFT_134196 [Chlorella variabilis]
Length=322

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 165/260 (63%), Gaps = 22/260 (8%)
 Frame = +3

Query  369   SSHGGSGRR----KGFGRIRV-AYQESAASEEVAD---DYYAVLGLLPDASPEQIKKAYY  524
             S+ GGS R+    +G GR+RV A+Q  A +   AD   D+YA+LG+   A  ++IK+AY 
Sbjct  7     SARGGSSRQAAVGRGRGRLRVLAWQPPAPTATEADEATDFYAILGVSYTAGTDEIKRAYR  66

Query  525   NCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSP  704
                K  HPD+S D E +T F +F+N++Y+ LSDP +R  YD I G+    +NPF D S  
Sbjct  67    RLAKEFHPDVSAD-ESSTEFAIFLNDVYDTLSDPDKRAAYDAIVGFQIGGVNPFTDTSYE  125

Query  705   KDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSG-ELIQQAIESCPVDCIH  881
             +D VFVDEF+CIGCKNC  V    F +E+++GRARV  Q   G E +Q+AI++CPV CIH
Sbjct  126   RDSVFVDEFTCIGCKNCNCVASATFMMEDEWGRARVRQQGVDGVEKLQEAIDTCPVSCIH  185

Query  882   WTSAAQLSLLEDEMRRVERVNVALMLSGMG-AASIDVFRMASTRWEKRQAKVLGQAKVRM  1058
             W +A QL+LLE+ M R+ERV   ++++G G  A+++VF  AS  W+KRQA +   AKV  
Sbjct  186   WVTAPQLALLEETMSRMERVAAFVLMTGGGKGANMNVFFEASIAWQKRQAAL--AAKV--  241

Query  1059  TKQKGSDKSDSYWDYLWAKP  1118
                    ++D+ W +  A P
Sbjct  242   -------QADNGWGFFRATP  254



>ref|XP_003599734.1| Chaperone protein dnaJ, partial [Medicago truncatula]
Length=169

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 124/164 (76%), Gaps = 7/164 (4%)
 Frame = +3

Query  255  MAQLLSPVCTDILKFQNPVHNLFPRKRSPIL--GTNCNSVSSHGGSGRRKGFGRIRVAY-  425
            MAQLL+P+  + LK  N   +L  R    +L   T  +       S +R+GFGR+RVA  
Sbjct  1    MAQLLTPLYPEALKIHN--SSLCTRSSWQMLQQKTAVSPWRFATPSCKRRGFGRVRVATE  58

Query  426  QESAASEEV--ADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFIN  599
            QES ++ +   A+DYYAVLGLLPDA+PEQIKKAYYNCMK CHPDLSG+D ETTNFC FIN
Sbjct  59   QESFSTSDSVGAEDYYAVLGLLPDATPEQIKKAYYNCMKTCHPDLSGNDPETTNFCTFIN  118

Query  600  EIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEF  731
            E+YE+LSDPVQR VYD+IHGY+ T+INPF DDSSPKDHVFVDEF
Sbjct  119  EVYEVLSDPVQRRVYDDIHGYSLTSINPFMDDSSPKDHVFVDEF  162



>gb|ACV53169.1| chloroplast DnaJ-like protein 4 [Chlamydomonas reinhardtii]
Length=382

 Score =   183 bits (465),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 126/198 (64%), Gaps = 5/198 (3%)
 Frame = +3

Query  453   ADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLS--GDDEETTNFCMFINEIYEILSDP  626
              +D+Y +LG+ P A P  IK+AY++ M+  HPD +  G  +   + C+ +NEIY  LSD 
Sbjct  89    GEDFYTILGVTPSAEPRDIKRAYHSLMREFHPDRAPEGLRDGMADLCVLLNEIYATLSDE  148

Query  627   VQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED-FGR  803
              +R VYD I G++++AINPF D S  +D VFVDE SCIGC  C   CP  F+IE+  +GR
Sbjct  149   EKRCVYDSIAGFSSSAINPFLDGSFARDQVFVDEISCIGCGKCVRACPMTFEIEDSKYGR  208

Query  804   ARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAAS  980
             ARV SQ S S E +Q AIE CPVDCIH+ +  QLSLLE  +  + R+ V+ M    G + 
Sbjct  209   ARVISQTSDSVEDVQIAIECCPVDCIHYVTLPQLSLLEAALGTMSRIEVSTM-QRFGRSG  267

Query  981   IDVFRMASTRWEKRQAKV  1034
              +VF +A   WE+R A +
Sbjct  268   GNVFEVAYKAWERRMAAI  285



>ref|XP_002958604.1| molecular chaperone [Volvox carteri f. nagariensis]
 gb|EFJ40341.1| molecular chaperone [Volvox carteri f. nagariensis]
Length=492

 Score =   181 bits (460),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 127/194 (65%), Gaps = 5/194 (3%)
 Frame = +3

Query  453   ADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDD--EETTNFCMFINEIYEILSDP  626
              +D+Y +LG+ P+A    IK+AY+  M+  HPD + D+  ++  + C+ +NEIYE LSD 
Sbjct  53    GEDFYTILGVPPNAEFRDIKRAYHGLMRQFHPDRAPDNLRDDMASLCVLLNEIYETLSDE  112

Query  627   VQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE-EDFGR  803
              +R  YD + G+++++INPF D+S  +D VFVDE +CIGC  C   CP+ F+IE   +GR
Sbjct  113   DRRTTYDTLAGFSSSSINPFLDNSFARDQVFVDEITCIGCGKCVRACPRTFEIEASKYGR  172

Query  804   ARVYSQSGSG-ELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAAS  980
             ARV SQ     + +Q AIE CPVDCIHW S  QLSLLE  + R+ R+ V++M    G + 
Sbjct  173   ARVISQDADDVDSVQIAIECCPVDCIHWVSLPQLSLLEAALSRMGRIEVSVMQR-FGRSG  231

Query  981   IDVFRMASTRWEKR  1022
              +VF++A   WE+R
Sbjct  232   GNVFQVAYKAWEQR  245



>emb|CEF96548.1| 3Fe-4S ferredoxin [Ostreococcus tauri]
Length=356

 Score =   161 bits (408),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 122/211 (58%), Gaps = 15/211 (7%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D+Y +LG+  DA    IKKAYY   K CHPD+SGD E+  + C+ +NE YEILSDP  R 
Sbjct  40    DFYDLLGVADDADARTIKKAYYGFAKECHPDVSGD-EDGHDMCVLLNEAYEILSDPASRA  98

Query  639   VYD-EIHGYAATAINPFFDDSSPK-----------DHVFVDEFSCIGCKNCANVCPKVFD  782
             +YD E+      A + F  ++  K             VFVDEF+CIGCK C    P  F 
Sbjct  99    MYDAELEQQRMDAADSFTGNAYSKWTTRRAKPGEDRAVFVDEFTCIGCKQCVWAAPATFR  158

Query  783   IEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML  959
             + ED+GR+RV++Q  + E  IQQAI+SCPVDCIHW     L  LE      E+V+V +M+
Sbjct  159   MNEDYGRSRVFAQWLNNEDDIQQAIDSCPVDCIHWVKRDDLPYLEHVAVNFEKVSVGIMM  218

Query  960   SGMGAASI-DVFRMASTRWEKRQAKVLGQAK  1049
             SG    +I D F  A +  + RQ ++  +A+
Sbjct  219   SGTNKTNIVDPFEAAQSFMKARQRRIEQRAE  249



>ref|XP_001699768.1| chloroplast DnaJ-like protein [Chlamydomonas reinhardtii]
 gb|EDP07464.1| chloroplast DnaJ-like protein [Chlamydomonas reinhardtii]
Length=358

 Score =   152 bits (385),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 115/197 (58%), Gaps = 16/197 (8%)
 Frame = +3

Query  453   ADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLS--GDDEETTNFCMFINEIYEILSDP  626
              +D+Y +LG+ P A P  IK+AY++ M+  HPD +  G  +   + C+ +NEIY  LSD 
Sbjct  78    GEDFYTILGVTPSAEPRDIKRAYHSLMREFHPDRAPEGLRDGMADLCVLLNEIYATLSDE  137

Query  627   VQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED-FGR  803
              +R VYD I G++++AINPF D S  +D VFVDE SCIGC  C   CP  F+IE+  +GR
Sbjct  138   EKRCVYDSIAGFSSSAINPFLDGSFARDQVFVDEISCIGCGKCVRACPMTFEIEDSKYGR  197

Query  804   ARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASI  983
             ARV SQ+        ++E   V      +  QLSLLE  +  + R+ V+ M    G +  
Sbjct  198   ARVISQT------SDSVEDVQV------TLPQLSLLEAALGTMSRIEVSTM-QRFGRSGG  244

Query  984   DVFRMASTRWEKRQAKV  1034
             +VF +A   WE+R A +
Sbjct  245   NVFEVAYKAWERRMAAI  261



>ref|XP_002951411.1| molecular chaperone [Volvox carteri f. nagariensis]
 gb|EFJ47587.1| molecular chaperone [Volvox carteri f. nagariensis]
Length=373

 Score =   150 bits (379),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 112/200 (56%), Gaps = 25/200 (13%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            DYY VLG+  DA  E+IKKAY +  K CHPD  GD     N C+ +NE Y++LSDP QR 
Sbjct  57   DYYEVLGVDDDAPAEEIKKAYRSLAKECHPDYLGD--RGHNICILLNEAYQVLSDPEQRQ  114

Query  639  VY---------DEIHGYAATAINPFF----------DDSSPKDHVFVDEFSCIGCKNCAN  761
             Y         DE   Y   A++ +           +D + +  VFVDEF+CIGCK C  
Sbjct  115  KYNAKLEQALLDEDDKYTGQALSRWMPTVKPAMAKNEDPAERRAVFVDEFTCIGCKQCVW  174

Query  762  VCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEM--RRV  932
              P  F IE++ GR+RV++Q    E  +Q AI+ CPV CIHW   A L  LE  M  R  
Sbjct  175  CAPATFRIEQEHGRSRVFAQWLDTEDNLQAAIDGCPVSCIHWVDRADLPALEFVMQHRMT  234

Query  933  ERVNVALMLSGMGAASIDVF  992
             RVNV +M++G G A +DVF
Sbjct  235  TRVNVGVMMAGQG-AQLDVF  253



>gb|KFM23764.1| Chaperone protein DnaJ [Auxenochlorella protothecoides]
Length=142

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (68%), Gaps = 2/137 (1%)
 Frame = +3

Query  447  EVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDP  626
            E  DDYY+VLG+   AS + IK+A+   +K  HPD+S D EE T+F +F+N++YE L DP
Sbjct  7    ETQDDYYSVLGISSAASVKDIKRAFRVIVKDHHPDISMD-EEATDFQIFLNDVYETLMDP  65

Query  627  VQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRA  806
             +R  YD I G+     NPF D  + +D VFVDEFSCIGC+NC NVCP+ F++E+++GRA
Sbjct  66   EKRAEYDAISGFQLGGTNPFRDVHAERDQVFVDEFSCIGCRNCNNVCPRTFEMEDEYGRA  125

Query  807  RVYSQS-GSGELIQQAI  854
            RV  Q   +GE I   I
Sbjct  126  RVVDQGLDTGEQIALLI  142



>ref|XP_001700843.1| chloroplast DnaJ-like protein [Chlamydomonas reinhardtii]
 gb|EDP07097.1| chloroplast DnaJ-like protein [Chlamydomonas reinhardtii]
Length=383

 Score =   142 bits (357),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 118/220 (54%), Gaps = 25/220 (11%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             DYY VLG+  DA  ++IKKAY    K+CHPD  G  E+    C+ +NE Y+IL D   R 
Sbjct  67    DYYEVLGVDDDAPYDEIKKAYRALAKSCHPDYLG--EKGHEICIMLNEAYQILGDADARA  124

Query  639   VY---------DEIHGYAATAINPFF----------DDSSPKDHVFVDEFSCIGCKNCAN  761
              Y         DE   Y    ++ +           +D + +  VFVDEF+CIGCK C  
Sbjct  125   NYNNKLEQALLDEDDNYTGLPLSKWMPTVKPNMAKNEDPAERRGVFVDEFTCIGCKQCVW  184

Query  762   VCPKVFDIEEDFGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEM--RRV  932
                  F IE + GR+RVY+Q     E IQ AIESCPV CIHW   A L  LE  M  +  
Sbjct  185   CASATFRIEPEHGRSRVYAQWLDDEEKIQTAIESCPVSCIHWVDKADLPALEYVMQCKMT  244

Query  933   ERVNVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKV  1052
             ERVNV +M++G G A +DVF   ++  ++R+ K   +A+ 
Sbjct  245   ERVNVGVMMAGQG-AQMDVFASTASFLKERKRKEEARARA  283



>gb|KFM23765.1| Putative tartrate transporter [Auxenochlorella protothecoides]
Length=691

 Score =   143 bits (360),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 119/203 (59%), Gaps = 3/203 (1%)
 Frame = +3

Query  447   EVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDP  626
             E  DDYY+VLG+   AS + IK+A+   +K  HPD+S  DEE T+F +F+N++YE L DP
Sbjct  7     ETQDDYYSVLGISSAASVKDIKRAFRVIVKDHHPDIS-MDEEATDFQIFLNDVYETLMDP  65

Query  627   VQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRA  806
              +R  YD I G++  A  P                            P+ F++E+++GRA
Sbjct  66    EKRAEYDAISGFSWAAPTPSATCMLSATRCSWMSSRASAAATATTSAPRTFEMEDEYGRA  125

Query  807   RVYSQS-GSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAAS-  980
             RV  Q   +   +Q+AI++CPV CIHW S  QL+LLE  M R+ERV   L+L+G G  + 
Sbjct  126   RVVDQGLDTVPRVQEAIDTCPVSCIHWVSEGQLALLEVTMSRMERVAAWLILTGGGKGTN  185

Query  981   IDVFRMASTRWEKRQAKVLGQAK  1049
             IDVF  AS  WEKRQA++ G A+
Sbjct  186   IDVFNEASGAWEKRQAELRGAAQ  208



>ref|XP_007510483.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18016.1| predicted protein [Bathycoccus prasinos]
Length=448

 Score =   134 bits (337),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 95/281 (34%), Positives = 134/281 (48%), Gaps = 48/281 (17%)
 Frame = +3

Query  405   GRIRVAYQESAASEEVAD----DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEE  572
             G++  A+ E   + EV      D+Y+++ +  DAS  +IKKAY    KACHPD++G  E 
Sbjct  124   GQLLDAFGEEIDTTEVKKAIPGDFYSLIQVPKDASSAEIKKAYRRLQKACHPDIAG--EA  181

Query  573   TTNFCMFINEIYEILSDPVQRLVYD------------------------EIHGYAATAIN  680
              ++ C+ +NE Y+IL D   R  YD                        E  GY    ++
Sbjct  182   GSDVCIILNEAYDILMDDTARAAYDAEMKELERMTQEFMKRGAADEEDDEGGGYTGEPLS  241

Query  681   PFFDDSSPKDH---VFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQ-SGSGELIQQ  848
              F        +   VFV+E  CIGCK C +  PK F +++ FGRARV++Q     E I  
Sbjct  242   EFKGKDPAIGYPRAVFVNECQCIGCKQCCHSAPKTFAMDDQFGRARVFAQWDDEEEDINI  301

Query  849   AIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAAS--IDVFRMASTRWEKR  1022
             AIESCPVDCIH+     L +LE  M + ER +VA M+SG        DV      R E+R
Sbjct  302   AIESCPVDCIHFVKENNLPILEYAMSKCERTSVASMMSGSARVDDPFDVANQMIRRGEER  361

Query  1023  QAK--------VLGQAKVRMTKQKGSDKSDSYWDYLWAKPR  1121
               +        + G++ V   K++  D     W  L  KPR
Sbjct  362   YGRLGLDPNEALKGKSLVGRMKKRIRDA----WLQLGEKPR  398



>gb|ABR17365.1| unknown [Picea sitchensis]
Length=285

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 100/179 (56%), Gaps = 11/179 (6%)
 Frame = +3

Query  444  EEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSD  623
            E +  D Y +LG+   A  +QI++AY    K CHPD++G D    +  + +N  Y +LSD
Sbjct  67   ENLGYDLYDLLGVESKAGQDQIRRAYRWLQKKCHPDIAGPDGH--HMSILLNHAYSVLSD  124

Query  624  PVQRLVYDE-------IHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVF  779
            P  R  YD+       + GY+   + + +F  +S +  +FVDE  C+GC  CA V PK F
Sbjct  125  PNARFAYDQTRVETLDLEGYSGQPLYSKWFGSASEERALFVDEVKCVGCLKCALVAPKTF  184

Query  780  DIEEDFGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVAL  953
             IE  +GRAR   Q + S + ++ AI +CPVDCI W   A+L  LE  M +  RV+V L
Sbjct  185  AIETVYGRARAVGQWADSEDTVEDAIRACPVDCISWVERAKLPALEFLMSKQPRVSVRL  243



>gb|ABK24669.1| unknown [Picea sitchensis]
Length=523

 Score =   130 bits (327),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 100/179 (56%), Gaps = 11/179 (6%)
 Frame = +3

Query  444  EEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSD  623
            E +  D Y +LG+   A  +QI++AY    K CHPD++G D    +  + +N  Y +LSD
Sbjct  67   ENLGYDLYDLLGVESKAGQDQIRRAYRWLQKKCHPDIAGPDGH--HMSILLNHAYSVLSD  124

Query  624  PVQRLVYDE-------IHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVF  779
            P  R  YD+       + GY+   + + +F  +S +  +FVDE  C+GC  CA V PK F
Sbjct  125  PNARFAYDQTRVETLDLEGYSGQPLYSKWFGSASEERALFVDEVKCVGCLKCALVAPKTF  184

Query  780  DIEEDFGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVAL  953
             IE  +GRAR   Q + S + ++ AI +CPVDCI W   A+L  LE  M +  RV+V L
Sbjct  185  AIETVYGRARAVGQWADSEDTVEDAIRACPVDCISWVERAKLPALEFLMSKQPRVSVRL  243



>ref|XP_005648299.1| hypothetical protein COCSUDRAFT_41909 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23755.1| hypothetical protein COCSUDRAFT_41909 [Coccomyxa subellipsoidea 
C-169]
Length=320

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 110/208 (53%), Gaps = 26/208 (13%)
 Frame = +3

Query  489   DASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVY--------  644
             DAS E++K AY    K CHPD  GD  E    C      Y ILS+P QR  Y        
Sbjct  25    DASFEEVKAAYRYLAKQCHPDFLGD--EGHELCA-----YSILSNPQQRQNYNARLQAQL  77

Query  645   -DEIHGYAATAINPFF--------DDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDF  797
              D++  Y   A++ +          D +    VFVDE SCIGCK C       F IE   
Sbjct  78    QDDLDDYTGKALSKWLVNHPMSKAKDPAETRAVFVDESSCIGCKQCVWCASATFRIEPTH  137

Query  798   GRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEM-RRVERVNVALMLSGMG  971
             GR+RV++Q    E LIQ +I++CPVDCIHW    QL  LE  M +R+ R NV +M++G G
Sbjct  138   GRSRVFAQWIDDEDLIQASIDACPVDCIHWVDRQQLPALEYVMQKRMGRTNVGVMMAGQG  197

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVR  1055
              ++ DVF +     ++R+A++  +A+ R
Sbjct  198   GSNGDVFELTLRFLKEREARLKERAESR  225



>ref|XP_002506005.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67263.1| predicted protein [Micromonas sp. RCC299]
Length=446

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 111/211 (53%), Gaps = 27/211 (13%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             DYY++L L  +A+ + +K+ Y    K CHPD++G  E   +  + +NE Y+ L D   R 
Sbjct  125   DYYSLLQLDFEATDKDVKRQYRQLQKWCHPDIAG--EAGNDLSIILNEAYDTLMDEKTRR  182

Query  639   VYD------------------EIHGYAATAINPFF-----DDSSPKDHVFVDEFSCIGCK  749
             VYD                  +   Y    ++ F      +  S    VFV+E +CIGC+
Sbjct  183   VYDKDLKEMRKQMDLAMELGADFKPYTGQPMSKFVGQDPTERGSNARAVFVNEAACIGCR  242

Query  750   NCANVCPKVFDIEEDFGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMR  926
              C +  PK F +E+++GRAR + Q + S E I  AIESCPVDCI+W     L +LE  M+
Sbjct  243   QCNHSAPKTFMMEDEWGRARAFQQWADSEEDITIAIESCPVDCIYWVKQRNLPILEYAMQ  302

Query  927   RVERVNVALMLSGMGAASIDVFRMASTRWEK  1019
             RVERV+V +M  G  A   D F +A+T   K
Sbjct  303   RVERVSVGMMNQG-SARVGDPFDVANTMIRK  332



>ref|XP_010067007.1| PREDICTED: uncharacterized protein LOC104454013 isoform X2 [Eucalyptus 
grandis]
 gb|KCW65069.1| hypothetical protein EUGRSUZ_G02581 [Eucalyptus grandis]
Length=491

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 102/188 (54%), Gaps = 12/188 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y +LG+   +SP QIK AY +  K CHPD++G   E  +  + +N+ Y +LSDP  R 
Sbjct  72   DLYDLLGIDSSSSPAQIKLAYRSLQKRCHPDIAG--PEGHDMSIILNDAYALLSDPASRA  129

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       E+ GY    I + +    S +  VFVDE  C+GC  CA    + F IE  
Sbjct  130  AYDKEQAKTSELRGYTGKPIYSVWLGSDSEQRAVFVDEVKCVGCLKCALCAERTFAIESV  189

Query  795  FGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG-M  968
            +GRARV +Q +     IQQAIE+CPVDCI     + L+ LE  M +  R NV +  S  +
Sbjct  190  YGRARVVAQWADPNHKIQQAIEACPVDCISIVERSDLAALEFLMSKQPRGNVRIGASNSV  249

Query  969  GAASIDVF  992
            G+   ++F
Sbjct  250  GSRVSNIF  257



>ref|XP_010067006.1| PREDICTED: uncharacterized protein LOC104454013 isoform X1 [Eucalyptus 
grandis]
 gb|KCW65070.1| hypothetical protein EUGRSUZ_G02581 [Eucalyptus grandis]
Length=492

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 102/188 (54%), Gaps = 12/188 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y +LG+   +SP QIK AY +  K CHPD++G   E  +  + +N+ Y +LSDP  R 
Sbjct  72   DLYDLLGIDSSSSPAQIKLAYRSLQKRCHPDIAG--PEGHDMSIILNDAYALLSDPASRA  129

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       E+ GY    I + +    S +  VFVDE  C+GC  CA    + F IE  
Sbjct  130  AYDKEQAKTSELRGYTGKPIYSVWLGSDSEQRAVFVDEVKCVGCLKCALCAERTFAIESV  189

Query  795  FGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG-M  968
            +GRARV +Q +     IQQAIE+CPVDCI     + L+ LE  M +  R NV +  S  +
Sbjct  190  YGRARVVAQWADPNHKIQQAIEACPVDCISIVERSDLAALEFLMSKQPRGNVRIGASNSV  249

Query  969  GAASIDVF  992
            G+   ++F
Sbjct  250  GSRVSNIF  257



>gb|KDP42595.1| hypothetical protein JCGZ_24369 [Jatropha curcas]
Length=469

 Score =   123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 82/251 (33%), Positives = 120/251 (48%), Gaps = 24/251 (10%)
 Frame = +3

Query  432   SAASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             +++S  + D D Y +LG+   +   QIK AY    K CHPD++G      +  + +NE Y
Sbjct  48    ASSSSSITDFDLYDLLGIDSSSDQSQIKTAYRTLQKRCHPDIAGPTGH--DMAIILNEAY  105

Query  609   EILSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANV  764
              +LSDP  RL YD       E+ GY    I + +F   S +  VFVDE  C+GC  CA  
Sbjct  106   SVLSDPNSRLAYDKEQAKIAELRGYTGKPIYSAWFGSESEERAVFVDEVKCVGCLKCALF  165

Query  765   CPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERV  941
               + F IE  +GRARV +Q    E  IQ AI+SCPVDCI       L+ LE  M +  R 
Sbjct  166   ADRTFAIESVYGRARVVAQWADPEHRIQAAIDSCPVDCISMVEREDLAALEFLMSKQPRG  225

Query  942   NVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKG-----------SDKSD  1088
             NV +  S      +    +   +++ R  + + +A    +K+             + +S 
Sbjct  226   NVRVGASNAVGGRVSNIFVDVKKFQNRAVEAINKANAESSKETDLQREARLSAIQAIRSI  285

Query  1089  SYWDYLWAKPR  1121
             S W Y W  P+
Sbjct  286   SNWLY-WQSPK  295



>ref|XP_004297730.1| PREDICTED: uncharacterized protein LOC101312533 [Fragaria vesca 
subsp. vesca]
Length=508

 Score =   123 bits (308),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 112/207 (54%), Gaps = 18/207 (9%)
 Frame = +3

Query  390  RRKGFGRI---RVAYQESAASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLS  557
            R   +G+I   R   + S++  ++ D D Y ++G+   +   +I++AY    K CHPD++
Sbjct  28   RTSSWGKITRWRCRARASSSGSDITDFDLYDLMGIDSSSDHSEIRRAYRTLQKKCHPDIA  87

Query  558  GDDEETTNFCMFINEIYEILSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDH  713
            G      +  + +NE Y +LSDP QR+ YD       E+ GY+   + + ++   + +  
Sbjct  88   GAAGH--DMAIILNEAYALLSDPNQRMAYDKEQSKIAELRGYSGKPLYSSWYGSETEERA  145

Query  714  VFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTS  890
            VFVDE +CIGC  CA    K F IE  +GRARV  Q    E  IQQAI++CPVDCI    
Sbjct  146  VFVDEVNCIGCLKCALCAEKTFAIESVYGRARVVGQWADPEHKIQQAIQACPVDCISVVE  205

Query  891  AAQLSLLEDEMRRVERVNVALMLSGMG  971
             + L+ LE  M +  R NV +   GMG
Sbjct  206  RSNLAALEFLMSKQPRGNVRI---GMG  229



>gb|ABD93569.1| chloroplast heat shock protein-binding protein, partial [Coffea 
canephora]
Length=55

 Score =   112 bits (281),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  576  TNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCI  740
            TNFCMFINE+Y +LSDP+QR++YDEIHGYA TAINPF DDS+PKDHVFVDEFSCI
Sbjct  1    TNFCMFINEVYSVLSDPLQRMIYDEIHGYALTAINPFLDDSAPKDHVFVDEFSCI  55



>ref|XP_003074178.1| DNAJ heat shock N-terminal domain-containing protein (ISS), partial 
[Ostreococcus tauri]
Length=468

 Score =   122 bits (305),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 83/142 (58%), Gaps = 14/142 (10%)
 Frame = +3

Query  540  CHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYD-EIHGYAATAINPFFDDSSPK---  707
            CHPD+SGD E+  + C+ +NE YEILSDP  R +YD E+      A + F  ++  K   
Sbjct  26   CHPDVSGD-EDGHDMCVLLNEAYEILSDPASRAMYDAELEQQRMDAADSFTGNAYSKWTT  84

Query  708  --------DHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIES  860
                      VFVDEF+CIGCK C    P  F + ED+GR+RV++Q  + E  IQQAI+S
Sbjct  85   RRAKPGEDRAVFVDEFTCIGCKQCVWAAPATFRMNEDYGRSRVFAQWLNNEDDIQQAIDS  144

Query  861  CPVDCIHWTSAAQLSLLEDEMR  926
            CPVDCIHW     L  LE   R
Sbjct  145  CPVDCIHWVKRDDLPYLEHVAR  166



>ref|XP_006847860.1| hypothetical protein AMTR_s00029p00078660 [Amborella trichopoda]
 gb|ERN09441.1| hypothetical protein AMTR_s00029p00078660 [Amborella trichopoda]
Length=470

 Score =   122 bits (305),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 117/226 (52%), Gaps = 14/226 (6%)
 Frame = +3

Query  441   SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILS  620
             S+E+  D Y +LG+   +   QIK AY +  K CHPD++G      +  + +N+ Y +LS
Sbjct  43    SQELDCDLYELLGIDSTSDQSQIKNAYRSLQKRCHPDIAGPAGH--DMAIILNQAYSVLS  100

Query  621   DPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
             DP  RL YD       E+ GY    I + +F  ++ +  VFVDE  C+GC  CA      
Sbjct  101   DPCSRLAYDKEQGKMAEVKGYTGKPIYSTWFGSANEQRAVFVDEVKCVGCLKCALAARNT  160

Query  777   FDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVAL  953
             F IE  +GRARV SQ    E  I+ AI++CPVDCI     ++L+ LE  M +  R NV +
Sbjct  161   FAIEAVYGRARVVSQWADPEDTIEAAIQACPVDCISVVERSKLAALEFLMSKQPRGNVRM  220

Query  954   ML-SGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSD  1088
                + +GA   +VF  A    +K   K+  Q     +   G ++SD
Sbjct  221   NNDNTVGARVANVFVDAERLQKKFNEKM--QKSTEKSHHAGPEESD  264



>gb|EYU45092.1| hypothetical protein MIMGU_mgv1a005727mg [Erythranthe guttata]
Length=473

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 106/211 (50%), Gaps = 12/211 (6%)
 Frame = +3

Query  390  RRKGFGRIRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDE  569
            RR      R ++     S     + Y +LG+   +   QIK+AY +  K CHPD++G   
Sbjct  43   RRGKLSVCRASWSSQQYSPMAEFNLYELLGIDASSDKAQIKEAYRSLQKRCHPDIAGPSG  102

Query  570  ETTNFCMFINEIYEILSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVD  725
               +  + +NE Y +LSDP  RL YD       ++ GY    I + +F   S +  VFVD
Sbjct  103  H--DMAIVLNEAYALLSDPTSRLAYDKELAKITDMQGYTGKPIYSSWFGSESEERAVFVD  160

Query  726  EFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQL  902
            E  CIGC  CA +    F +E  +GRARV SQ    E  IQ+AI +CPVDCI     + L
Sbjct  161  EVKCIGCLKCALLAENTFAVESVYGRARVVSQWADSENKIQEAIGACPVDCISIVERSNL  220

Query  903  SLLEDEMRRVERVNVALMLSGM-GAASIDVF  992
            + LE  M +  R  V +  S   G  ++D+F
Sbjct  221  AALEFVMSKQPRGKVRIGASNTAGERTLDIF  251



>gb|ABD93570.1| chloroplast heat shock protein-binding protein, partial [Lactuca 
sativa]
Length=55

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  576  TNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCI  740
            TNFC+FINEIYE+LSDP QR+VYDEIHGYA TAINPFFDDSSPKDHVFVDEFSCI
Sbjct  1    TNFCIFINEIYEVLSDPAQRMVYDEIHGYALTAINPFFDDSSPKDHVFVDEFSCI  55



>ref|XP_010250129.1| PREDICTED: uncharacterized protein LOC104592448 [Nelumbo nucifera]
Length=483

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 87/273 (32%), Positives = 123/273 (45%), Gaps = 28/273 (10%)
 Frame = +3

Query  270   SPVCTDILKFQNP--VHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQESAAS  443
             +P  + ++   NP  +H   P  R+     N NS+     +               S +S
Sbjct  10    TPSVSTVIGPSNPGRLHVYPPTTRTLYNNRNTNSIVCKAST---------------SPSS  54

Query  444   EEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSD  623
                  D Y +LG+   ++  QIK AY +  K CHPD++G      +  + +NE Y ILSD
Sbjct  55    SITEFDLYDLLGIDSTSNRSQIKAAYRSLQKQCHPDIAGPAGH--DMAIILNEAYSILSD  112

Query  624   PVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVF  779
             P  R VYD       E  GY    I + +F     +  VFVDE  CIGC  CA V    F
Sbjct  113   PSSRSVYDKEQAKIEEFRGYTGKPIYSTWFGSEKEERAVFVDEVKCIGCLKCALVAQNTF  172

Query  780   DIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  956
              IE  +GRAR   Q    EL IQ+AIE+CPVDCI     + L+ LE  M R  R +V + 
Sbjct  173   AIESVYGRARAVGQWADPELKIQEAIEACPVDCISMVERSNLAALEFLMFRQPRGSVRIS  232

Query  957   LSGMGAASIDVFRMASTRWEKRQAKVLGQAKVR  1055
                     +    +   +++ R  +  G+A  R
Sbjct  233   AGNAVGTRVSNIFVDVKKFQSRYQETKGKASQR  265



>ref|XP_008445880.1| PREDICTED: uncharacterized protein LOC103488766 [Cucumis melo]
Length=465

 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 98/188 (52%), Gaps = 14/188 (7%)
 Frame = +3

Query  435  AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
            AAS     D Y +LG+   ++P +IK AY    K CHPD++G      +  + +NE Y +
Sbjct  41   AASSITDFDLYDLLGIDNTSNPSRIKAAYRALQKHCHPDIAGPAGH--DMAIILNEAYSV  98

Query  615  LSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCP  770
            LSDP  RL YD       E+ GY    + + +    S +  VFVDE  CIGC  CA    
Sbjct  99   LSDPSSRLAYDKEQAKMAELRGYTGKPVYSVWLGSESEQRAVFVDEVKCIGCLKCALFAG  158

Query  771  KVFDIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV  947
            K F +E  +GRARV +Q    E  + +AIE+CPVDCI       L+ LE  M +  R NV
Sbjct  159  KTFAVESVYGRARVVAQWADPEYKVMEAIEACPVDCISMVERTDLAALEFLMSKQPRGNV  218

Query  948  ALMLSGMG  971
             +   GMG
Sbjct  219  RV---GMG  223



>ref|XP_010546245.1| PREDICTED: uncharacterized protein LOC104818375 [Tarenaya hassleriana]
Length=472

 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 92/172 (53%), Gaps = 11/172 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y +LG+  ++   QIK AY N  K CHPD++G      +  + +NE Y +LSDPV R 
Sbjct  52   DLYDLLGVHQNSDQSQIKAAYRNLQKRCHPDIAGISGH--DMAIILNEAYSLLSDPVSRH  109

Query  639  VYD-------EIHGYAATAINPFFDDSSPKDH-VFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       E+ GY    +   +  S  +   VFVDE  C+GC  CA    K F IE  
Sbjct  110  AYDKEQAKVAELKGYTGRPVYSVWCGSETEHRAVFVDEVKCVGCLKCALCADKTFAIETT  169

Query  795  FGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV  947
            +GRARV SQ    E  IQQAIE+CP+DCI     + L+ LE  M +  R NV
Sbjct  170  YGRARVVSQWADPEYKIQQAIEACPIDCISVVERSDLASLEFLMSKQPRGNV  221



>ref|XP_002972990.1| hypothetical protein SELMODRAFT_413357 [Selaginella moellendorffii]
 gb|EFJ26211.1| hypothetical protein SELMODRAFT_413357 [Selaginella moellendorffii]
Length=483

 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 101/191 (53%), Gaps = 12/191 (6%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   A   +IKKAY    K CHPD++G  E   +  + +NE Y ILSDP  R 
Sbjct  57    DLYELLGVENSAPQPEIKKAYRWLQKKCHPDVAG--ELGHDMSILLNEAYAILSDPTSRG  114

Query  639   VYDEIH-------GYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD +        G+    + + +   +S +  VFVDE  CIGC  CA +    F +E+ 
Sbjct  115   SYDAVRAEWIQFEGFTGEPLYSRWMGPASEEKAVFVDEVRCIGCLKCALIASNTFAVEKR  174

Query  795   FGRARVYSQSG-SGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML-SGM  968
             +GRAR  SQ G S  +I  AI +CPVDCI W    +L+ LE  M +  R  V +   +  
Sbjct  175   YGRARAVSQWGDSKPVIDDAIRACPVDCISWVDRGKLAALEYLMAKQPRYTVNIEPENSP  234

Query  969   GAASIDVFRMA  1001
             G  +IDVF+ A
Sbjct  235   GERAIDVFKSA  245



>ref|XP_004143617.1| PREDICTED: uncharacterized protein LOC101205271 [Cucumis sativus]
Length=460

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 97/188 (52%), Gaps = 14/188 (7%)
 Frame = +3

Query  435  AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
            AAS     D Y +LG+   + P +IK AY    K CHPD++G      +  + +NE Y +
Sbjct  41   AASSITDFDLYDLLGIDNTSHPSRIKAAYRALQKHCHPDIAGPAGH--DMAIILNEAYSV  98

Query  615  LSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCP  770
            LSDP  RL YD       E+ GY    + + +    S +  VFVDE  CIGC  CA    
Sbjct  99   LSDPSSRLAYDKEQAKMAELRGYTGKPVYSVWLGSESEQRAVFVDEVKCIGCLKCALFAG  158

Query  771  KVFDIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV  947
            K F +E  +GRARV +Q    E  + +AIE+CPVDCI       L+ LE  M +  R NV
Sbjct  159  KTFAVESVYGRARVVAQWADPEYKVMEAIEACPVDCISMVERTDLAALEFLMSKQPRGNV  218

Query  948  ALMLSGMG  971
             +   GMG
Sbjct  219  RV---GMG  223



>ref|XP_004165266.1| PREDICTED: uncharacterized protein LOC101229316 [Cucumis sativus]
Length=460

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 97/188 (52%), Gaps = 14/188 (7%)
 Frame = +3

Query  435  AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
            AAS     D Y +LG+   + P +IK AY    K CHPD++G      +  + +NE Y +
Sbjct  41   AASSITDFDLYDLLGIDNTSHPSRIKAAYRALQKHCHPDIAGPAGH--DMAIILNEAYSV  98

Query  615  LSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCP  770
            LSDP  RL YD       E+ GY    + + +    S +  VFVDE  CIGC  CA    
Sbjct  99   LSDPSSRLAYDKEQAKMAELRGYTGKPVYSVWLGSESEQRAVFVDEVKCIGCLKCALFAG  158

Query  771  KVFDIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV  947
            K F +E  +GRARV +Q    E  + +AIE+CPVDCI       L+ LE  M +  R NV
Sbjct  159  KTFAVESVYGRARVVAQWADPEYKVMEAIEACPVDCISMVERTDLAALEFLMSKQPRGNV  218

Query  948  ALMLSGMG  971
             +   GMG
Sbjct  219  RV---GMG  223



>gb|KGN50447.1| hypothetical protein Csa_5G175710 [Cucumis sativus]
Length=465

 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 97/188 (52%), Gaps = 14/188 (7%)
 Frame = +3

Query  435  AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
            AAS     D Y +LG+   + P +IK AY    K CHPD++G      +  + +NE Y +
Sbjct  41   AASSITDFDLYDLLGIDNTSHPSRIKAAYRALQKHCHPDIAGPAGH--DMAIILNEAYSV  98

Query  615  LSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCP  770
            LSDP  RL YD       E+ GY    + + +    S +  VFVDE  CIGC  CA    
Sbjct  99   LSDPSSRLAYDKEQAKMAELRGYTGKPVYSVWLGSESEQRAVFVDEVKCIGCLKCALFAG  158

Query  771  KVFDIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV  947
            K F +E  +GRARV +Q    E  + +AIE+CPVDCI       L+ LE  M +  R NV
Sbjct  159  KTFAVESVYGRARVVAQWADPEYKVMEAIEACPVDCISMVERTDLAALEFLMSKQPRGNV  218

Query  948  ALMLSGMG  971
             +   GMG
Sbjct  219  RV---GMG  223



>gb|ABD93564.1| chloroplast heat shock protein-binding protein, partial [Solanum 
tuberosum]
 gb|ABD93566.1| chloroplast heat shock protein-binding protein, partial [Solanum 
lycopersicum]
Length=55

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  576  TNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCI  740
            TNFCMFINE+YEILSDPVQR VYDEIHGY ATAINPF  DSSPKDHVFVDEFSCI
Sbjct  1    TNFCMFINEVYEILSDPVQRRVYDEIHGYTATAINPFLSDSSPKDHVFVDEFSCI  55



>emb|CAN73797.1| hypothetical protein VITISV_018825 [Vitis vinifera]
Length=434

 Score =   119 bits (297),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 108/213 (51%), Gaps = 11/213 (5%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY    K CHPD++G      +  + +NE+Y +LSDP  RL
Sbjct  64    DLYDLLGIESSSDQWQIKMAYRKLQKRCHPDIAGPAGH--DMAIILNEVYSVLSDPNLRL  121

Query  639   VYDE-------IHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD+       + GY    + + ++   S +  VFVDE  C+GC  CA    K F IE  
Sbjct  122   AYDKEQAKIAGLRGYTGKPLYSVWYGSESEERAVFVDEVKCVGCLKCALFAEKTFAIESV  181

Query  795   FGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  IQQAI++CPVDCI     + L+ LE  M +  R +V +      
Sbjct  182   YGRARVVAQWADPEYKIQQAIDACPVDCISMVERSNLAALEFLMSKQPRGSVRMSAGNAV  241

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVRMTKQK  1070
              A +    +   +++ R    + +A    +K+K
Sbjct  242   GACVSNIFVDVKKFQTRFHDAMDKASTHGSKEK  274



>ref|XP_002984459.1| hypothetical protein SELMODRAFT_423510 [Selaginella moellendorffii]
 gb|EFJ14509.1| hypothetical protein SELMODRAFT_423510 [Selaginella moellendorffii]
Length=675

 Score =   120 bits (302),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 101/191 (53%), Gaps = 12/191 (6%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   A   +IKKAY    K CHPD++G  E   +  + +NE Y ILSDP  R 
Sbjct  249   DLYELLGVENSAPQPEIKKAYRWLQKKCHPDVAG--ELGHDMSILLNEAYAILSDPTSRG  306

Query  639   VYDEIH-------GYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD +        G+    + + +   +S +  VFVDE  CIGC  CA +    F +E+ 
Sbjct  307   SYDAVRAEWIQFEGFTGEPLYSRWMGPASEEKAVFVDEVRCIGCLKCALIASNTFAVEKR  366

Query  795   FGRARVYSQSG-SGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML-SGM  968
             +GRAR  SQ G S  +I  AI +CPVDCI W    +L+ LE  M +  R  V +   +  
Sbjct  367   YGRARAVSQWGDSKPVIDDAIRACPVDCISWVDRGKLAALEYLMAKQPRYTVNIEPENSP  426

Query  969   GAASIDVFRMA  1001
             G  +IDVF+ A
Sbjct  427   GERAIDVFKSA  437



>ref|NP_197715.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAB11179.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABO45691.1| At5g23240 [Arabidopsis thaliana]
 gb|AED93140.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
Length=465

 Score =   119 bits (297),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 113/222 (51%), Gaps = 16/222 (7%)
 Frame = +3

Query  432   SAASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIY  608
             +++S  + D D Y +LG+   +   QIK AY    K CHPD++GD     +  + +NE Y
Sbjct  40    TSSSSSITDFDLYDLLGIDRSSDKSQIKSAYRALQKRCHPDIAGDPGH--DMAIILNEAY  97

Query  609   EILSDPVQRLVYD-------EIHGYAATAINPFF-DDSSPKDHVFVDEFSCIGCKNCANV  764
             ++LSDP+ R  YD       E+ GY    I   +    + +   FVDE  C+GC  CA  
Sbjct  98    QLLSDPISRQAYDKEQAKLEELRGYTGKPIYSVWCGPETEQRAAFVDEVKCVGCLKCALC  157

Query  765   CPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERV  941
               K F IE  +GRARV +Q    E  I++AIE+CPVDCI     + L+ LE  M +  R 
Sbjct  158   AEKTFAIETAYGRARVVAQWADPESKIKEAIEACPVDCISMVERSDLAPLEFLMSKQPRG  217

Query  942   NVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQ  1067
             NV + +       +    +   ++++R AK +     R TK+
Sbjct  218   NVRIGVGNTVGERVSNVFVDVKKFQERYAKAMS----RTTKE  255



>ref|XP_002272283.1| PREDICTED: uncharacterized protein LOC100247733 [Vitis vinifera]
Length=482

 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 108/213 (51%), Gaps = 11/213 (5%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY    K CHPD++G      +  + +NE+Y +LSDP  RL
Sbjct  64    DLYDLLGIESSSDQWQIKMAYRKLQKRCHPDIAGPAGH--DMAIILNEVYSVLSDPNLRL  121

Query  639   VYDE-------IHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD+       + GY    + + ++   S +  VFVDE  C+GC  CA    K F IE  
Sbjct  122   AYDKEQAKIARLRGYTGKPLYSVWYGSESEERAVFVDEVKCVGCLKCALFAEKTFAIESV  181

Query  795   FGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  IQQAI++CPVDCI     + L+ LE  M +  R +V +      
Sbjct  182   YGRARVVAQWADPEYKIQQAIDACPVDCISMVERSNLAALEFLMSKQPRGSVRMSAGNAV  241

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVRMTKQK  1070
              A +    +   +++ R    + +A    +K+K
Sbjct  242   GACVSNIFVDVKKFQTRFHDAMDKASTHGSKEK  274



>ref|XP_010421122.1| PREDICTED: uncharacterized protein LOC104706624 [Camelina sativa]
Length=468

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 92/285 (32%), Positives = 138/285 (48%), Gaps = 23/285 (8%)
 Frame = +3

Query  318   LFPRKRSPILGT-NCNSVSSHGGSGRRKGFGRIRVAYQESAASEEVAD-DYYAVLGLLPD  491
             L P    P   T +CN+ +SH     R  F +++     S++S  + D D Y +LG+   
Sbjct  6     LTPTNLPPSTATWSCNT-TSHKLITFRSPF-KVKCRATSSSSSSSITDFDLYDLLGVDRS  63

Query  492   ASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYD-------E  650
             +   QIK AY    K CHPD++GD     +  + +NE Y++LSDP+ R  YD       E
Sbjct  64    SDTAQIKSAYRALQKRCHPDIAGDPGH--DMAIILNEAYQLLSDPIARHAYDKEQAKLEE  121

Query  651   IHGYAATAINPFFDDSSPKDH-VFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSG  827
             + GY    I   +  S  +    FVDE  C+GC  CA    K F IE  +GRARV +Q  
Sbjct  122   LRGYTGKPIYSVWCGSETEQRATFVDEVKCVGCLKCALCAEKTFAIETAYGRARVVAQWA  181

Query  828   SGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAASIDVFRMAS  1004
               E  I +AIE+CPVDCI     + L+ LE  M +  R NV + +       +    +  
Sbjct  182   DPESKIIEAIEACPVDCISIVERSDLAPLEFLMSKQPRGNVRIGVGNTVGERVSNVFVDV  241

Query  1005  TRWEKRQAKVL-------GQAKVRMTKQKGSDKSDSYWDYLWAKP  1118
              ++++R AK +        Q +VR++  +   +S S W Y  + P
Sbjct  242   KKFQERYAKAMSRTTKERSQTEVRISAVEAI-RSISNWLYWRSSP  285



>ref|XP_006286752.1| hypothetical protein CARUB_v10003126mg [Capsella rubella]
 gb|EOA19650.1| hypothetical protein CARUB_v10003126mg [Capsella rubella]
Length=472

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 117/236 (50%), Gaps = 19/236 (8%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY    K CHPD++GD     +  + +NE Y++LSDP+ R 
Sbjct  51    DLYDLLGVDRSSDKSQIKSAYRALQKRCHPDIAGDPGH--DMAIILNEAYQLLSDPIARH  108

Query  639   VYD-------EIHGYAATAINPFFDDSSPKDHV-FVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E+ GY    +   +  S  +    FVDE  C+GC  CA    K F IE  
Sbjct  109   AYDKEQAKLEELRGYTGKPLYSVWCGSETEQRAAFVDEVKCVGCLKCALCAEKTFAIETA  168

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  I++AIE+CPVDCI     + L+ LE  M +  R NV + +    
Sbjct  169   YGRARVVAQWADPESKIKEAIEACPVDCISMVERSDLAPLEFLMSKQPRGNVRIGVGNTV  228

Query  972   AASIDVFRMASTRWEKRQAKVL-------GQAKVRMTKQKGSDKSDSYWDYLWAKP  1118
                +    +   ++++R AK +        Q +VR++  +   +S S W Y  + P
Sbjct  229   GERVSNVFVDVKKFQERYAKTMSRNTKESSQTEVRISAVEAI-RSISNWLYWRSSP  283



>emb|CBI29047.3| unnamed protein product [Vitis vinifera]
Length=498

 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 108/213 (51%), Gaps = 11/213 (5%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY    K CHPD++G      +  + +NE+Y +LSDP  RL
Sbjct  64    DLYDLLGIESSSDQWQIKMAYRKLQKRCHPDIAGPAGH--DMAIILNEVYSVLSDPNLRL  121

Query  639   VYDE-------IHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD+       + GY    + + ++   S +  VFVDE  C+GC  CA    K F IE  
Sbjct  122   AYDKEQAKIARLRGYTGKPLYSVWYGSESEERAVFVDEVKCVGCLKCALFAEKTFAIESV  181

Query  795   FGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  IQQAI++CPVDCI     + L+ LE  M +  R +V +      
Sbjct  182   YGRARVVAQWADPEYKIQQAIDACPVDCISMVERSNLAALEFLMSKQPRGSVRMSAGNAV  241

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVRMTKQK  1070
              A +    +   +++ R    + +A    +K+K
Sbjct  242   GACVSNIFVDVKKFQTRFHDAMDKASTHGSKEK  274



>ref|XP_008811242.1| PREDICTED: uncharacterized protein LOC103722452 [Phoenix dactylifera]
Length=477

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 93/174 (53%), Gaps = 11/174 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y +LG+   +   QIK AY    K CHPD++G      +  + +NEIY ILSDP  R 
Sbjct  58   DLYEILGVESSSDQSQIKAAYRALQKRCHPDIAGPAGH--DMAIVLNEIYSILSDPTSRS  115

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       E  GY    I + +F   + +  VFVDE  C+GC  CA +  K F IE  
Sbjct  116  AYDQEQAKVSEFRGYTGKPIYSAWFGSKNEQRAVFVDEVRCVGCLKCALLARKTFAIESA  175

Query  795  FGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVAL  953
            +GRARV +Q +   E I  AI++CPVDCI     ++L+ LE  M +  R +V +
Sbjct  176  YGRARVVAQWADPEEKILDAIQTCPVDCISIVERSKLAALEYLMSKQPRGSVRM  229



>ref|XP_007043272.1| DNAJ heat shock N-terminal domain-containing protein, putative 
[Theobroma cacao]
 gb|EOX99103.1| DNAJ heat shock N-terminal domain-containing protein, putative 
[Theobroma cacao]
Length=473

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 107/212 (50%), Gaps = 11/212 (5%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   ++  QIK AY    K CHPD++G      +  + +NE Y +LSDP  RL
Sbjct  58    DLYDLLGIDSSSNHSQIKTAYRALQKRCHPDIAGPAGH--DMAIILNEAYSVLSDPGSRL  115

Query  639   VYD-------EIHGYAATAINPFFDDS-SPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E+ GY    +   +  S S +  VFVDE  C+GC  CA    K F IE  
Sbjct  116   AYDKEQAKMAELRGYTGKPLYSVWRGSESEQRAVFVDEVKCVGCLKCALFAEKTFAIESL  175

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  I +AIE+CPVDCI     + L+ LE  M +  R NV + +    
Sbjct  176   YGRARVVAQWADSEHKILEAIEACPVDCISIVERSDLAALEFLMSKQPRGNVRVGVGNTV  235

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVRMTKQ  1067
              A +    +   +++ R    + +A  + +K+
Sbjct  236   GARVSNIFVDVKKFQTRFVDAMDKAATKESKE  267



>gb|ABD93568.1| chloroplast heat shock protein-binding protein, partial [Capsicum 
annuum]
Length=55

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  576  TNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCI  740
            TNFCMFINE+YEILSDPVQR VYDEIHGYAATAINPF  DSS KDHVFVDEFSCI
Sbjct  1    TNFCMFINEVYEILSDPVQRRVYDEIHGYAATAINPFLSDSSAKDHVFVDEFSCI  55



>ref|XP_008221070.1| PREDICTED: uncharacterized protein LOC103321089 [Prunus mume]
Length=536

 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 111/220 (50%), Gaps = 16/220 (7%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y ++G+     P +IK+AY    K CHPD++G      +  + +NE Y +LSDP  R 
Sbjct  91    DLYELMGIDSSCDPSEIKRAYRTLQKRCHPDIAGPAGH--DMAIILNEAYALLSDPNSRS  148

Query  639   VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E+ GY+   I + +F   S +  VFVDE  CIGC  CA      F IE  
Sbjct  149   AYDKEQAKIAELRGYSGKPIYSVWFGSESEERAVFVDEVKCIGCLKCALCAENTFAIESV  208

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV  Q    E  IQ+AI++CPVDCI     + L+ LE  M +  R +V + +    
Sbjct  209   YGRARVVGQWADPESKIQEAIQACPVDCISIVERSNLAALEFLMSKQPRGSVRIGMGNTA  268

Query  972   AASI-DVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSD  1088
              A + ++F       +K Q +    AK + +  + S ++D
Sbjct  269   GARVSNIF----VDLKKFQTRFQDAAKQKASSTQTSSETD  304



>ref|XP_002310648.2| hypothetical protein POPTR_0007s07670g [Populus trichocarpa]
 gb|EEE91098.2| hypothetical protein POPTR_0007s07670g [Populus trichocarpa]
Length=476

 Score =   117 bits (293),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 93/172 (54%), Gaps = 11/172 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y +LG+   +   QIK AY    K CHPD++G      +  + +NE Y +LSDP  RL
Sbjct  63   DLYDLLGIDSSSDHSQIKTAYRTLQKRCHPDIAGPAGH--DMAIILNEAYSLLSDPNSRL  120

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       E+ GY+   I + +F   S +  VFVDE  C+GC  CA +  K F IE  
Sbjct  121  AYDKEQAKMAELRGYSGKPIYSVWFGSESEQRAVFVDEVKCVGCLKCALIAEKTFAIESL  180

Query  795  FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV  947
            +GRARV +Q    E  IQ AI++CPVDCI     + L+ LE  M +  R +V
Sbjct  181  YGRARVVAQWADPEHKIQAAIDACPVDCISTVERSDLAALEFLMSKQPRGSV  232



>ref|XP_008366971.1| PREDICTED: uncharacterized protein LOC103430601 [Malus domestica]
Length=519

 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 95/183 (52%), Gaps = 14/183 (8%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y ++G+       QIK AY N  K CHPD++G      +  + +NE Y +LSDP  R 
Sbjct  84   DLYDLMGIDSSCDRSQIKTAYRNLQKRCHPDIAGPAGH--DMAIILNEAYALLSDPNSRS  141

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       ++ GY    I + +F   S +  VFVDE  CIGC  CA    K F IE  
Sbjct  142  AYDKEQSKIAQLRGYTGKPIYSAWFGSESEERAVFVDEVKCIGCLKCALCAEKTFAIESV  201

Query  795  FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
            +GRARV  Q    E  IQ+AI++CPVDCI       L+ LE  M +  R +V +   GMG
Sbjct  202  YGRARVVGQWADPESKIQEAIQACPVDCISIVERENLAALEFLMSKQPRGSVRI---GMG  258

Query  972  AAS  980
             A+
Sbjct  259  NAA  261



>ref|XP_008350811.1| PREDICTED: uncharacterized protein LOC103414182 [Malus domestica]
Length=519

 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 95/183 (52%), Gaps = 14/183 (8%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y ++G+       QIK AY N  K CHPD++G      +  + +NE Y +LSDP  R 
Sbjct  84   DLYDLMGIDSSCDRSQIKTAYRNLQKRCHPDIAGPAGH--DMAIILNEAYALLSDPNSRS  141

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       ++ GY    I + +F   S +  VFVDE  CIGC  CA    K F IE  
Sbjct  142  AYDKEQSKIAQLRGYTGKPIYSAWFGSESEERAVFVDEVKCIGCLKCALCAEKTFAIESV  201

Query  795  FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
            +GRARV  Q    E  IQ+AI++CPVDCI       L+ LE  M +  R +V +   GMG
Sbjct  202  YGRARVVGQWADPESKIQEAIQACPVDCISIVERENLAALEFLMSKQPRGSVRI---GMG  258

Query  972  AAS  980
             A+
Sbjct  259  NAA  261



>emb|CAJ86103.1| H0103C06.7 [Oryza sativa Indica Group]
 gb|EAY96031.1| hypothetical protein OsI_17904 [Oryza sativa Indica Group]
Length=485

 Score =   117 bits (292),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 105/198 (53%), Gaps = 13/198 (7%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   +IK AY +  K CHPD++G   +  +  + +NE+Y +LSDP  RL
Sbjct  65    DLYGLLGVERSSPQSEIKAAYRSLQKRCHPDVAG--AKGHDMAIVLNEVYSLLSDPAARL  122

Query  639   VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E  GY    + + +F   + +  VFVDE  C+GC  CA    K F +E  
Sbjct  123   AYDQEQAKQSEFVGYTGKPLYSAWFGGEAEQRAVFVDEVRCVGCLKCALYANKTFAVESV  182

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG-M  968
             +GRARV +Q    E  I  AI++CPVDCI     + L+ LE  M +  R  V +     +
Sbjct  183   YGRARVVAQWADAEDKILDAIQTCPVDCISMVERSDLAALEFLMSKQPRGRVRVSEGNTV  242

Query  969   GAASIDVFRMASTRWEKR  1022
             GA + D+F    T+++KR
Sbjct  243   GARAPDIFNEV-TKFQKR  259



>ref|XP_011002243.1| PREDICTED: uncharacterized protein LOC105109291 [Populus euphratica]
 ref|XP_011006774.1| PREDICTED: uncharacterized protein LOC105112694 [Populus euphratica]
Length=476

 Score =   116 bits (291),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 93/172 (54%), Gaps = 11/172 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y +LG+   +   QIK AY    K CHPD++G      +  + +NE Y +LSDP  RL
Sbjct  63   DLYDLLGIDSSSDHSQIKIAYRTLQKRCHPDIAGPAGH--DMAIILNEAYSLLSDPNSRL  120

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       E+ GY+   I + +F   S +  VFVDE  C+GC  CA +  K F IE  
Sbjct  121  AYDKEQAKMAELRGYSGKPIYSVWFGSESEQRAVFVDEVKCVGCLKCALIAEKTFAIESV  180

Query  795  FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV  947
            +GRARV +Q    E  IQ AI++CPVDCI     + L+ LE  M +  R +V
Sbjct  181  YGRARVVAQWADPEHKIQAAIDACPVDCISTVERSDLAALEFLMSKQPRGSV  232



>ref|XP_009602427.1| PREDICTED: uncharacterized protein LOC104097550 [Nicotiana tomentosiformis]
Length=468

 Score =   116 bits (291),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 82/250 (33%), Positives = 120/250 (48%), Gaps = 23/250 (9%)
 Frame = +3

Query  276  VCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQESAASEEVA  455
            V   I    N   N  P  R+P+     NS  SH      K     R      A S  + 
Sbjct  4    VTLPIQTIPNKSINKLPNPRTPL----ANSWKSHNNINTNKCLMICR------AYSSSIT  53

Query  456  D-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQ  632
            D D Y +LG+   ++  QIK AY    K CHPD++G      +  + +NE Y +LSDP+ 
Sbjct  54   DFDLYDLLGVDSSSNQAQIKLAYRMLQKRCHPDIAGASGH--DMAIILNEAYALLSDPIA  111

Query  633  RLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIE  788
            R+ YD       ++ GY    + + +    + +  VFVDE  C+GC  CA    K F +E
Sbjct  112  RMAYDKELTKIADLRGYTGKPLYSAWCGPENEERAVFVDEVKCVGCLKCALFAEKTFAVE  171

Query  789  EDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG  965
              +GRARV +Q    E  IQ+AI++CPVDCI     + L+ LE  M +  R +V +    
Sbjct  172  SVYGRARVVAQWADTEPKIQEAIDACPVDCISVVERSNLAALEFLMSKKPRGSVRIGAGN  231

Query  966  -MGAASIDVF  992
             +GA + ++F
Sbjct  232  TVGARTSNIF  241



>ref|XP_010493438.1| PREDICTED: uncharacterized protein LOC104770675 isoform X1 [Camelina 
sativa]
Length=469

 Score =   116 bits (290),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 116/236 (49%), Gaps = 19/236 (8%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY    K CHPD++GD     +  + +NE Y++LSDP+ R 
Sbjct  53    DLYDLLGVDRSSDTAQIKSAYRALQKRCHPDIAGDPGH--DMAIILNEAYQLLSDPIARH  110

Query  639   VYD-------EIHGYAATAINPFFDDSSPKDH-VFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E+ GY    I   +  S  +    FVDE  C+GC  CA    K F IE  
Sbjct  111   AYDKEEAKLEELRGYTGKPIYSVWCGSETEQRATFVDEVKCVGCLKCALCAEKTFAIETA  170

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  I +AIE+CPVDCI     + L+ LE  M +  R NV + +    
Sbjct  171   YGRARVVAQWADPESKIIEAIEACPVDCISIVERSDLAPLEFLMSKQPRGNVRIGVGNTV  230

Query  972   AASIDVFRMASTRWEKRQAKVLG-------QAKVRMTKQKGSDKSDSYWDYLWAKP  1118
                +    +   ++++R AK +        Q +VR++  +   +S S W Y  + P
Sbjct  231   GERVSNVFVDVKKFQERYAKSMSRTTKERTQTEVRISAVEAI-RSISNWLYWRSSP  285



>ref|XP_007222154.1| hypothetical protein PRUPE_ppa005756mg [Prunus persica]
 gb|EMJ23353.1| hypothetical protein PRUPE_ppa005756mg [Prunus persica]
Length=445

 Score =   115 bits (289),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 110/215 (51%), Gaps = 16/215 (7%)
 Frame = +3

Query  474   LGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYD--  647
             +G+     P +IK+AY    K CHPD++G      +  + +NE Y +LSDP  R  YD  
Sbjct  1     MGIDSSCDPSEIKRAYRTLQKRCHPDIAGPAGH--DMAIILNEAYALLSDPNSRSAYDKE  58

Query  648   -----EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRAR  809
                  E+ GY+   I + +F   S +  VFVDE  CIGC  CA    K F IE  +GRAR
Sbjct  59    QAKIAELRGYSGKPIYSVWFGSESEERAVFVDEVKCIGCLKCALCAEKTFAIESVYGRAR  118

Query  810   VYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVAL-MLSGMGAASI  983
             V  Q    E  IQ+AI++CPVDCI     + L+ LE  M +  R +V + M +  GA   
Sbjct  119   VVGQWADPESKIQEAIQACPVDCISIVERSNLAALEFLMSKQPRGSVRIGMGTTAGARVS  178

Query  984   DVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSD  1088
             ++F       +K Q +    AK + +  + S ++D
Sbjct  179   NIF----VDLKKFQTRFQDAAKQKASSTQTSSETD  209



>ref|XP_006484525.1| PREDICTED: uncharacterized protein LOC102629406 [Citrus sinensis]
Length=410

 Score =   115 bits (288),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 104/208 (50%), Gaps = 15/208 (7%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY    K CHPD++G      +  + +NE Y +LSDP  RL
Sbjct  4     DLYDLLGIDSSSDQSQIKTAYRMLQKRCHPDIAGSAGH--DMAIILNEAYSVLSDPNSRL  61

Query  639   VYDE-------IHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD+       + GY    I + +F   S +  VFVDE  C+GC  CA    K F IE  
Sbjct  62    AYDKEQAKTAGLRGYTGKPIYSVWFGSESEQRAVFVDEVKCVGCLKCALFAGKTFAIESA  121

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  I +AIE+CPVDCI     + L+ LE  M +  R  V +      
Sbjct  122   YGRARVVAQWADPEHKILEAIETCPVDCISIVERSDLAALEYLMAKQPRGTVRVGAGNTA  181

Query  972   AASI-DVF---RMASTRWEKRQAKVLGQ  1043
              A + ++F   +   T++E    K  G+
Sbjct  182   GARVSNIFVDVKKFQTQYEDAMKKAAGK  209



>ref|XP_010493439.1| PREDICTED: uncharacterized protein LOC104770675 isoform X2 [Camelina 
sativa]
Length=469

 Score =   116 bits (290),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 116/236 (49%), Gaps = 19/236 (8%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY    K CHPD++GD     +  + +NE Y++LSDP+ R 
Sbjct  53    DLYDLLGVDRSSDTAQIKSAYRALQKRCHPDIAGDPGH--DMAIILNEAYQLLSDPIARH  110

Query  639   VYD-------EIHGYAATAINPFFDDSSPKDH-VFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E+ GY    I   +  S  +    FVDE  C+GC  CA    K F IE  
Sbjct  111   AYDKEEAKLEELRGYTGKPIYSVWCGSETEQRATFVDEVKCVGCLKCALCAEKTFAIETA  170

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  I +AIE+CPVDCI     + L+ LE  M +  R NV + +    
Sbjct  171   YGRARVVAQWADPESKIIEAIEACPVDCISIVERSDLAPLEFLMSKQPRGNVRIGVGNTV  230

Query  972   AASIDVFRMASTRWEKRQAKVLG-------QAKVRMTKQKGSDKSDSYWDYLWAKP  1118
                +    +   ++++R AK +        Q +VR++  +   +S S W Y  + P
Sbjct  231   GERVSNVFVDVKKFQERYAKSMSRTTKERTQTEVRISAVEAI-RSISNWLYWRSSP  285



>emb|CDY02215.1| BnaA03g39520D [Brassica napus]
Length=470

 Score =   116 bits (290),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 114/225 (51%), Gaps = 13/225 (6%)
 Frame = +3

Query  435   AASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
             A S  + D D Y +LG+   +   QIK AY N  K CHPD++G      +  + +NE Y+
Sbjct  39    ATSSSITDFDLYDLLGIDRGSDKSQIKTAYRNLQKRCHPDIAGVPGH--DMAIILNEAYK  96

Query  612   ILSDPVQRLVYD-------EIHGYAATAINPFF-DDSSPKDHVFVDEFSCIGCKNCANVC  767
             +LSDP+ R  YD       E+ GY    +   +    + +  VFVDE  C+GC  CA   
Sbjct  97    LLSDPISRQAYDKEQAKLEELRGYTGKPVYSVWCGPETEQRAVFVDEVKCVGCLKCALCA  156

Query  768   PKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVN  944
              + F IE   GRARV +Q    E  I++AIE+CP+DCI     + L+ LE  M +  R N
Sbjct  157   ERTFAIETAHGRARVVAQWADPESKIKEAIEACPIDCISMVERSDLAPLEFLMSKQPRGN  216

Query  945   VALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSD  1079
             V + +       +    +   ++++R A+ + +   R + Q+ SD
Sbjct  217   VRIGVGNTVGERVSNVFVDVKKFQQRYAEAMSKT-TRDSSQQESD  260



>ref|XP_010454604.1| PREDICTED: uncharacterized protein LOC104736336 [Camelina sativa]
Length=469

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 115/236 (49%), Gaps = 19/236 (8%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY    K CHPD++GD     +  + +NE Y++LSDP+ R 
Sbjct  53    DLYDLLGVDRGSDTAQIKSAYRALQKRCHPDIAGDPGH--DMAIILNEAYQLLSDPIARH  110

Query  639   VYD-------EIHGYAATAINPFFDDSSPKDH-VFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E+ GY    I   +  S  +    FVDE  C+GC  CA    K F IE  
Sbjct  111   AYDKEQAKLEELRGYTGKPIYSVWCGSETEQRATFVDEVKCVGCLKCALCAEKTFAIETA  170

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  I +AIE+CPVDCI     + L+ LE  M +  R NV + +    
Sbjct  171   YGRARVVAQWADPESKIIEAIEACPVDCISIVERSDLAPLEFLMSKQPRGNVRIGVGNTV  230

Query  972   AASIDVFRMASTRWEKRQAKVL-------GQAKVRMTKQKGSDKSDSYWDYLWAKP  1118
                +    +   ++++R AK +        Q  VR++  +   +S S W Y  + P
Sbjct  231   GERVSNIFVDVKKFQERYAKTMSRKTKERSQTDVRISAIEAI-RSISNWLYWRSSP  285



>ref|XP_006437599.1| hypothetical protein CICLE_v10031498mg [Citrus clementina]
 gb|ESR50839.1| hypothetical protein CICLE_v10031498mg [Citrus clementina]
Length=456

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 104/208 (50%), Gaps = 15/208 (7%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY    K CHPD++G      +  + +NE Y +LSDP  RL
Sbjct  50    DLYDLLGIDSSSDQSQIKTAYRMLQKRCHPDIAGSAGH--DMAIILNEAYSVLSDPNSRL  107

Query  639   VYDE-------IHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD+       + GY    I + +F   S +  VFVDE  C+GC  CA    K F IE  
Sbjct  108   AYDKEQAKTAGLRGYTGKPIYSVWFGSESEQRAVFVDEVKCVGCLKCALFAGKTFAIESA  167

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  I +AIE+CPVDCI     + L+ LE  M +  R  V +      
Sbjct  168   YGRARVVAQWADPEHKILEAIETCPVDCISIVERSDLAALEYLMAKQPRGTVRVGAGNTA  227

Query  972   AASI-DVF---RMASTRWEKRQAKVLGQ  1043
              A + ++F   +   T++E    K  G+
Sbjct  228   GARVSNIFVDVKKFQTQYEGAMKKAAGK  255



>ref|XP_010940344.1| PREDICTED: uncharacterized protein LOC105058955 [Elaeis guineensis]
Length=484

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 89/174 (51%), Gaps = 11/174 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y +LG+   +   QIK AY    K CHPD++G      +  + +NEIY ILSDP  R 
Sbjct  65   DLYEILGVESSSDQSQIKAAYRALQKRCHPDIAGPAGH--DMAIVLNEIYSILSDPASRS  122

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       E  GY    I + +F   + +  VFVDE  C+GC  CA    K F IE  
Sbjct  123  AYDQEQAKVSEFRGYTGKPIYSTWFGSENEQRAVFVDEVRCVGCLKCALFASKTFAIESV  182

Query  795  FGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVAL  953
            +GRAR  +Q +   E I  AI++CPVDCI     + L+  E  M +  R NV +
Sbjct  183  YGRARAVAQWADPEEKILDAIQTCPVDCISIVERSNLAAFEYLMSKEPRSNVRM  236



>ref|NP_001054247.1| Os04g0675400 [Oryza sativa Japonica Group]
 emb|CAE03244.2| OSJNBa0018M05.19 [Oryza sativa Japonica Group]
 dbj|BAF16161.1| Os04g0675400 [Oryza sativa Japonica Group]
 dbj|BAG90793.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61899.1| hypothetical protein OsJ_16608 [Oryza sativa Japonica Group]
Length=486

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 105/198 (53%), Gaps = 13/198 (7%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   +IK AY +  K CHPD++G   +  +  + +NE+Y +LSDP  RL
Sbjct  65    DLYGLLGVERSSPQSEIKAAYRSLQKRCHPDVAG--AKGHDMAIVLNEVYSLLSDPAARL  122

Query  639   VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E  GY    + + +F   + +  VFVDE  C+GC  CA    K F +E  
Sbjct  123   AYDQEQAKQSEFVGYTGKPLYSAWFGGEAEQRAVFVDEVRCVGCLKCALYANKTFAVESV  182

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG-M  968
             +GRARV +Q    E  I  AI++CPVDCI     + L+ LE  M +  R  V +     +
Sbjct  183   YGRARVVAQWADAEDKILDAIQTCPVDCISMVERSDLAALEFLMSKQPRGRVRVSEGNTV  242

Query  969   GAASIDVFRMASTRWEKR  1022
             GA + D+F   S +++KR
Sbjct  243   GARAPDIFNEVS-KFQKR  259



>gb|KFK27645.1| hypothetical protein AALP_AA8G410200 [Arabis alpina]
Length=468

 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 105/205 (51%), Gaps = 11/205 (5%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY    K CHPD++G      +  + +NE Y++LSDP+ R 
Sbjct  50    DLYDLLGIDRSSDKSQIKAAYRTLQKRCHPDIAGVPGH--DMAIILNEAYKLLSDPILRQ  107

Query  639   VYD-------EIHGYAATAINPFF-DDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E+ GY    I   +    + +  VFVDE  C+GC  CA    K F IE  
Sbjct  108   AYDTEQAKLEELRGYTGKPIYSVWCGPETEQRAVFVDEVKCVGCLKCALCAEKTFAIETA  167

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  I+QAIE+CPVDCI     + L+ LE  M +  R NV + +    
Sbjct  168   YGRARVVAQWADPESKIKQAIEACPVDCISEVERSDLAPLEFLMSKQPRGNVRIGIGNTV  227

Query  972   AASIDVFRMASTRWEKRQAKVLGQA  1046
                +    +   ++++R A+ + ++
Sbjct  228   GERVSNVFVDVKKFQERYAQAMSRS  252



>ref|XP_006394593.1| hypothetical protein EUTSA_v10005272mg [Eutrema salsugineum]
 gb|ESQ31879.1| hypothetical protein EUTSA_v10005272mg [Eutrema salsugineum]
Length=470

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 131/259 (51%), Gaps = 27/259 (10%)
 Frame = +3

Query  411   IRVAYQESAASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFC  587
             +++  + +++S  + D D Y +LG+   +   QIK AY +  K CHPD++G      +  
Sbjct  33    LKLKCRATSSSSSITDLDLYDLLGIDRSSDKSQIKAAYRSLQKRCHPDIAGVPGH--DMA  90

Query  588   MFINEIYEILSDPVQRLVYD-------EIHGYAATAINPFFDDSSPKDH-VFVDEFSCIG  743
             + +NE Y++LSDP+ R  YD       E+ GY    I   +  S  +   VFVDE  C+G
Sbjct  91    IILNEAYKLLSDPISRQAYDKEQAKLEELRGYTGKPIYSVWCGSETEQRAVFVDEVKCVG  150

Query  744   CKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDE  920
             C  CA +  + F IE   GRARV +Q    E  I++AIE+CP+DCI     + L+ LE  
Sbjct  151   CLKCALIAERTFAIETAHGRARVVAQWADPEPKIKEAIEACPIDCISMVERSDLAPLEFL  210

Query  921   MRRVERVNVALML-SGMGAASIDVF------------RMASTRWEKRQAKVLGQAKVRMT  1061
             M +  R  V + + + +G    +VF             M+ T  E  Q + L Q++VRM 
Sbjct  211   MSKQPRGKVRIGVGNTVGERVSNVFVDVKKFQERYAEAMSRTTRESSQERDL-QSEVRM-  268

Query  1062  KQKGSDKSDSYWDYLWAKP  1118
             +   + +S S W Y  + P
Sbjct  269   RAVEAIRSISSWLYWRSSP  287



>ref|XP_003556599.2| PREDICTED: uncharacterized protein LOC100785995 [Glycine max]
Length=491

 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 88/253 (35%), Positives = 125/253 (49%), Gaps = 25/253 (10%)
 Frame = +3

Query  426   QESAASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINE  602
             + S++S  + D D Y +LG+       Q+K AY +  K CHPD++G      +  + +NE
Sbjct  65    KASSSSSTMMDFDLYDLLGIDSSCDQSQVKVAYRSLQKRCHPDIAGPAGH--DMAIILNE  122

Query  603   IYEILSDPVQRLVYD-------EIHGYAATAINPFFDDS-SPKDHVFVDEFSCIGCKNCA  758
              Y ILSDP  RL YD       E  G+    I   +  S S +  +FVDE  C+GC  CA
Sbjct  123   AYSILSDPNARLAYDKEQAKSSEFKGFTGRPIYSVWCGSESEQRAIFVDEIKCVGCLKCA  182

Query  759   NVCPKVFDIEEDFGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVE  935
              +  K F +E  +GRARV SQ + S   I +AIESCPV+CI     + L+ LE  M +  
Sbjct  183   LLAEKTFAVESVYGRARVVSQWADSPNKIDEAIESCPVNCISVVERSNLAALEFLMSKQP  242

Query  936   RVNV---ALMLSGMGAASIDV--------FRMASTRWEKRQAKVLGQAKVRMTKQKGSDK  1082
             R NV   A   +G   ++I V        F+ A  +  K   +   Q + RM+  +   +
Sbjct  243   RGNVRVGAAHTAGARVSNIFVDVEKFQTRFQEAMEKANKCSKETDLQRESRMSAIQA-IR  301

Query  1083  SDSYWDYLWAKPR  1121
             S S W Y W  PR
Sbjct  302   SISNWLY-WQTPR  313



>gb|KHN07249.1| Chaperone protein dnaJ 20, chloroplastic [Glycine soja]
Length=489

 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 88/253 (35%), Positives = 125/253 (49%), Gaps = 25/253 (10%)
 Frame = +3

Query  426   QESAASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINE  602
             + S++S  + D D Y +LG+       Q+K AY +  K CHPD++G      +  + +NE
Sbjct  63    KASSSSSTMMDFDLYDLLGIDSSCDQSQVKVAYRSLQKRCHPDIAGPAGH--DMAIILNE  120

Query  603   IYEILSDPVQRLVYD-------EIHGYAATAINPFFDDS-SPKDHVFVDEFSCIGCKNCA  758
              Y ILSDP  RL YD       E  G+    I   +  S S +  +FVDE  C+GC  CA
Sbjct  121   AYSILSDPNARLAYDKEQAKSSEFKGFTGRPIYSVWCGSESEQRAIFVDEIKCVGCLKCA  180

Query  759   NVCPKVFDIEEDFGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVE  935
              +  K F +E  +GRARV SQ + S   I +AIESCPV+CI     + L+ LE  M +  
Sbjct  181   LLAEKTFAVESVYGRARVVSQWADSPNKIDEAIESCPVNCISVVERSNLAALEFLMSKQP  240

Query  936   RVNV---ALMLSGMGAASIDV--------FRMASTRWEKRQAKVLGQAKVRMTKQKGSDK  1082
             R NV   A   +G   ++I V        F+ A  +  K   +   Q + RM+  +   +
Sbjct  241   RGNVRVGAAHTAGARVSNIFVDVEKFQTRFQEAMEKANKCSKETDLQRESRMSAIQA-IR  299

Query  1083  SDSYWDYLWAKPR  1121
             S S W Y W  PR
Sbjct  300   SISNWLY-WQTPR  311



>ref|XP_010688676.1| PREDICTED: uncharacterized protein LOC104902564 [Beta vulgaris 
subsp. vulgaris]
Length=469

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 96/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y +LG+   +   QIK+AY +  K CHPD++G      +  + +NE Y ILSDP+ R 
Sbjct  68   DLYDLLGIDSSSDQGQIKRAYRSLQKRCHPDIAGLAGH--DMAIILNEAYAILSDPISRY  125

Query  639  VYD-------EIHGYAATAINPFFDDSSPKDH-VFVDEFSCIGCKNCANVCPKVFDIEED  794
            VYD       E+ GY    +   +  S  ++  VFVDE  C+GC  CA    K F IE  
Sbjct  126  VYDKEQAKLTELKGYTGRPMYSVWQGSETEERAVFVDEVRCVGCLKCALFADKTFAIEST  185

Query  795  FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
            +GRARV +Q    E  IQ +I+ CPV CI     + L+ LE  M +  R  V +     G
Sbjct  186  YGRARVVAQWADPEDKIQASIDVCPVSCISMVERSDLAALEFIMSKQPRGKVRIGAGTTG  245

Query  972  AA-SIDVF  992
               + DVF
Sbjct  246  GVRTFDVF  253



>gb|KHM99065.1| Chaperone protein dnaJ 20, chloroplastic [Glycine soja]
Length=419

 Score =   114 bits (284),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 118/241 (49%), Gaps = 24/241 (10%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+       Q+K AY +  K CHPD++G      +  + +NE Y ILSDP  RL
Sbjct  5     DLYDLLGIDSSCDQSQVKVAYRSLQKRCHPDIAGPAGH--DMAIILNEAYSILSDPNARL  62

Query  639   VYD-------EIHGYAATAINPFFDDS-SPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E  G+    I   +  S S +  +FVDE  C+GC  CA +  K F +E  
Sbjct  63    AYDKEQAKSSEFKGFTGRPIYSVWCGSESEQRAIFVDEIKCVGCLKCALLAEKTFAVESV  122

Query  795   FGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV---ALMLS  962
             +GRARV SQ + S   I +AIESCPV+CI     + L+ LE  M +  R NV   A   +
Sbjct  123   YGRARVVSQWADSPNKIDEAIESCPVNCISVVERSNLAALEFLMSKQPRGNVRVGAAHTA  182

Query  963   GMGAASIDV--------FRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKP  1118
             G   ++I V        F+ A  +  K   +   Q + RM+  +   +S S W Y W  P
Sbjct  183   GARVSNIFVDVEKFQTRFQEAMEKANKCSKETDLQRESRMSAIQAI-RSISNWLY-WQTP  240

Query  1119  R  1121
             R
Sbjct  241   R  241



>ref|XP_009779297.1| PREDICTED: uncharacterized protein LOC104228512 [Nicotiana sylvestris]
Length=469

 Score =   114 bits (285),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 125/262 (48%), Gaps = 35/262 (13%)
 Frame = +3

Query  255  MAQLLSPVCTDILKFQNPVHNLFPRKRSPILGTNCNSVSSHGGSGRRKGFGRIRVAYQES  434
            M  L  P+ T      N   N  P  R+P+     NS  SH           I +   +S
Sbjct  1    MHSLTLPIQT----IPNKSINKLPNPRTPL----ANSWKSHNN---------ININTNKS  43

Query  435  -----AASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFI  596
                 A S  + D D Y +LG+   ++  QIK AY    K CHPD++G      +  + +
Sbjct  44   LMICRAYSSSITDFDLYDLLGVDSSSNQAQIKLAYRMLQKRCHPDIAGVPGH--DMAIIL  101

Query  597  NEIYEILSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKN  752
            NE Y +LSDP+ R+ YD       ++ GY    + + +    + +  VFVDE  C+GC  
Sbjct  102  NEAYALLSDPIARMAYDKELTKIADLRGYTGKPLYSAWCGPENEERAVFVDEVKCVGCLK  161

Query  753  CANVCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRR  929
            CA    K F +E  +GRARV +Q    E  IQ+AI++CPVDCI     + L+ LE  M +
Sbjct  162  CALFAEKTFAVESVYGRARVVAQWADTEPKIQEAIDACPVDCISVVERSNLAALEFLMSK  221

Query  930  VERVNVALMLSG-MGAASIDVF  992
              R NV +     +GA + ++F
Sbjct  222  KPRGNVRIGAGNTVGARTSNIF  243



>emb|CDY61909.1| BnaC07g49690D [Brassica napus]
Length=474

 Score =   114 bits (285),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 76/241 (32%), Positives = 117/241 (49%), Gaps = 24/241 (10%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY N  K CHPD++G      +  + +NE Y++LSDP+ R 
Sbjct  52    DLYDLLGIDRGSDKSQIKTAYRNLQKRCHPDIAGVPGH--DMAIILNEAYKLLSDPISRQ  109

Query  639   VYD-------EIHGYAATAINPFF-DDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E+ GY    +   +    + +  VFVDE  C+GC  CA    + F IE  
Sbjct  110   AYDKEQAKLEELRGYTGKPVYSVWCGPETEQRAVFVDEVKCVGCLKCALCAERTFAIETA  169

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
              GRARV +Q    E  I++AIE+CP+DCI     + L+ LE  M +  R NV + +    
Sbjct  170   HGRARVVAQWADPESKIKEAIEACPIDCISMVERSDLAPLEFLMSKQPRGNVRIGVGNTV  229

Query  972   AASIDVFRMASTRWEKRQAKVLG------------QAKVRMTKQKGSDKSDSYWDYLWAK  1115
                +    +   ++++R A+ +             Q +VRM+  +   +S S W Y  + 
Sbjct  230   GERVSNVFVDVKKFQQRYAEAMSKTTRDSSQESDLQREVRMSAVEAI-RSISNWLYWRSS  288

Query  1116  P  1118
             P
Sbjct  289   P  289



>gb|EYU44777.1| hypothetical protein MIMGU_mgv1a011175mg [Erythranthe guttata]
Length=290

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 11/182 (6%)
 Frame = +3

Query  447  EVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDP  626
            E  ++YY +LG+  DASP++IK AY    K  HPD++G  E+     + +N++YE+L   
Sbjct  43   ESKNNYYELLGVSTDASPQEIKDAYRKLQKIYHPDIAG--EKGHESTLMLNKVYEVLMKD  100

Query  627  VQRLVYDE--------IHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFD  782
              R  YD         + G    A    ++  S    +FVDE +CIGC+ C       F 
Sbjct  101  DLRKEYDSSIGRISVGVFGKEVEAFGSTWNGPSRPHALFVDENACIGCRQCVEQAGNTFT  160

Query  783  IEEDFGRARVYSQSG-SGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML  959
            ++E FG ARV  Q G   E I+ +++SCPV+CIHW     L++LE  ++   +V   +  
Sbjct  161  MDEAFGTARVKVQYGDDDEKIEISVDSCPVNCIHWVDKEDLAVLEHLIKPQPKVGYGIYG  220

Query  960  SG  965
             G
Sbjct  221  QG  222



>ref|XP_009136377.1| PREDICTED: uncharacterized protein LOC103860517 [Brassica rapa]
Length=472

 Score =   114 bits (284),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/241 (32%), Positives = 117/241 (49%), Gaps = 24/241 (10%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY N  K CHPD++G      +  + +NE Y++LSDP+ R 
Sbjct  51    DLYDLLGIDRGSDKSQIKTAYRNLQKRCHPDIAGVPGH--DMAIILNEAYKLLSDPISRQ  108

Query  639   VYD-------EIHGYAATAINPFF-DDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E+ GY    +   +    + +  VFVDE  C+GC  CA    + F IE  
Sbjct  109   AYDKEQAKLEELRGYTGKPVYSVWCGPETEQRAVFVDEVKCVGCLKCALCAERTFAIETA  168

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
              GRARV +Q    E  I++AIE+CP+DCI     + L+ LE  M +  R NV + +    
Sbjct  169   HGRARVVAQWADPESKIKEAIEACPIDCISMVERSDLAPLEFLMSKQPRGNVRIGVGNTV  228

Query  972   AASIDVFRMASTRWEKRQAKVLG------------QAKVRMTKQKGSDKSDSYWDYLWAK  1115
                +    +   ++++R A+ +             Q +VRM+  +   +S S W Y  + 
Sbjct  229   GERVSNVFVDVKKFQQRYAEAMSKTTRDSSQESDLQREVRMSAVEAI-RSISNWLYWRSS  287

Query  1116  P  1118
             P
Sbjct  288   P  288



>ref|XP_003589717.1| Chaperone protein dnaJ [Medicago truncatula]
 gb|AES59968.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=459

 Score =   114 bits (284),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 101/205 (49%), Gaps = 11/205 (5%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+       QIK AY +  K CHPD++G      +  + +N+ Y ILSDP  R 
Sbjct  50    DLYDLLGIDSSCDQSQIKTAYRSLQKRCHPDIAGPSGH--DMAIILNDAYAILSDPFARF  107

Query  639   VYDEIHG----YAATAINPFFD----DSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD+ H     +      P +       S +  +FVDE  C+GC  CA +  K F IE  
Sbjct  108   AYDKEHAKITEFKGFTGRPLYSVWCGSQSEQRAIFVDEVKCVGCLKCALLAEKTFAIESV  167

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV SQ    E  I +AI++CPV+CI     + L+ LE  M +  R NV +  S   
Sbjct  168   YGRARVVSQWADSEPQIDEAIQACPVNCISVVERSNLAALEFLMSKQPRGNVRVGASHTA  227

Query  972   AASIDVFRMASTRWEKRQAKVLGQA  1046
              A +    +   R++ R  + + +A
Sbjct  228   GARVSNIFVDVERFQTRFQETMQKA  252



>ref|XP_004498122.1| PREDICTED: uncharacterized protein LOC101499169 [Cicer arietinum]
Length=491

 Score =   114 bits (285),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 104/205 (51%), Gaps = 11/205 (5%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+       QIK AY +  K CHPD++G      +  + +N+ Y ILSDP  RL
Sbjct  80    DLYDLLGIDSSCDQSQIKTAYRSLQKRCHPDIAGPSGH--DMAIILNDAYAILSDPSARL  137

Query  639   VYDEIH-------GYAATAINPFFDDS-SPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD+ H       G+    I   +  S S +  +FVDE  C+GC  CA +  K F IE  
Sbjct  138   AYDKEHAKTTEFKGFTGRPIYSVWCGSESEQKAIFVDEVKCVGCLKCALLAEKTFAIESV  197

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV SQ    E  I +AI++CPV+CI     + L+ LE  M +  R NV +  S   
Sbjct  198   YGRARVVSQWADSEHKIDEAIQACPVNCISVVERSNLAALEFLMSKQPRGNVRIGASNTA  257

Query  972   AASIDVFRMASTRWEKRQAKVLGQA  1046
              A +    +   +++ R  + + +A
Sbjct  258   GARVSNIFVDVEKFQTRFQETMEKA  282



>ref|XP_003528458.2| PREDICTED: uncharacterized protein LOC100812414 [Glycine max]
Length=489

 Score =   114 bits (284),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 118/241 (49%), Gaps = 24/241 (10%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+       Q+K AY +  K CHPD++G      +  + +NE Y ILSDP  RL
Sbjct  75    DLYDLLGIDSSCDQSQVKVAYRSLQKRCHPDIAGPAGH--DMAIILNEAYSILSDPNARL  132

Query  639   VYD-------EIHGYAATAINPFFDDS-SPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E  G+    I   +  S S +  +FVDE  C+GC  CA +  K F +E  
Sbjct  133   AYDKEQAKSSEFKGFTGRPIYSVWCGSESEQRAIFVDEIKCVGCLKCALLAEKTFAVESV  192

Query  795   FGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV---ALMLS  962
             +GRARV SQ + S   I +AIESCPV+CI     + L+ LE  M +  R NV   A   +
Sbjct  193   YGRARVVSQWADSPNKIDEAIESCPVNCISVVERSNLAALEFLMSKQPRGNVRVGAAHTA  252

Query  963   GMGAASIDV--------FRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKP  1118
             G   ++I V        F+ A  +  K   +   Q + RM+  +   +S S W Y W  P
Sbjct  253   GARVSNIFVDVEKFQTRFQEAMEKANKCSKETDLQRESRMSAIQAI-RSISNWLY-WQTP  310

Query  1119  R  1121
             R
Sbjct  311   R  311



>ref|XP_002874118.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH50377.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=469

 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 106/212 (50%), Gaps = 15/212 (7%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   QIK AY    K CHPD++GD     +  + +NE Y++LSDP+ R 
Sbjct  53    DLYDLLGIDRSSDKSQIKAAYRALQKRCHPDIAGDPGH--DMAIILNEAYQLLSDPITRQ  110

Query  639   VYD-------EIHGYAATAINPFF-DDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E+ GY    I   +    + +   FVDE  C+GC  CA    K F IE  
Sbjct  111   AYDKEQAKLEELRGYTGKPIYSVWCGPETEQRAAFVDEVKCVGCLKCALCAEKTFAIETA  170

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q    E  I++AIE+C VDCI     + L+ LE  M +  R NV + +    
Sbjct  171   YGRARVVAQWADPESKIKEAIEACLVDCISMVERSDLAPLEFLMSKQPRGNVRIGVGNTV  230

Query  972   AASIDVFRMASTRWEKRQAKVLGQAKVRMTKQ  1067
                +    +   ++++R AK +     R TK+
Sbjct  231   GERVSNVFVDVKKFQERYAKAMS----RTTKE  258



>ref|XP_011083757.1| PREDICTED: uncharacterized protein LOC105166195 [Sesamum indicum]
Length=480

 Score =   113 bits (283),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 96/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            + Y +LG+   +   QIK+AY    K CHPD++G         + +NE Y +LSDP  RL
Sbjct  72   NLYELLGVEASSDTAQIKEAYRGLQKRCHPDIAGPSGH--EMAIVLNEAYALLSDPNSRL  129

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       ++ GY    I + +    S +  VFVDE  C+GC  CA    K F +E  
Sbjct  130  AYDKELAKVADLQGYTGKPIYSVWLGSESEERAVFVDEVKCVGCLKCALFAEKTFAVESV  189

Query  795  FGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG-M  968
            +GRARV +Q    E  IQ+AI +CPVDCI     + L+ LE  M +  R  V +     +
Sbjct  190  YGRARVVAQWADPEYKIQEAIGACPVDCISIVERSNLAALEFVMSKQPRGRVRIGTGNTV  249

Query  969  GAASIDVF  992
            G  + D+F
Sbjct  250  GVRASDIF  257



>ref|XP_002961980.1| hypothetical protein SELMODRAFT_403442 [Selaginella moellendorffii]
 gb|EFJ37240.1| hypothetical protein SELMODRAFT_403442 [Selaginella moellendorffii]
Length=409

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 95/188 (51%), Gaps = 20/188 (11%)
 Frame = +3

Query  426  QESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
            QE         DYY +LG+LP +S E I+KAY N  K  HPD+SG         + +NE 
Sbjct  37   QEHTGRSTNQQDYYEILGVLPGSSMEDIRKAYRNLQKQHHPDISGSKGHA--MTLMLNEA  94

Query  606  YEILSDPVQRLVYDE--IHGYAATAINPFFDDSS--------------PKDHVFVDEFSC  737
            Y++LSD   R  YD    H  +   +N ++   S              P+  +FVDE +C
Sbjct  95   YQVLSDERLRSKYDASLPHLASTRTMNYYYSKPSFTGSMYSTWNGPDRPQG-IFVDENAC  153

Query  738  IGCKNCANVCPKVFDIEEDFGRARVYSQSGSG-ELIQQAIESCPVDCIHWTSAAQLSLLE  914
            IGC+ CA      F  +E  G ARV +Q G   + ++ AI++CPV+CIHW   + L +LE
Sbjct  154  IGCRECAFAAKNTFLFDESTGCARVKAQWGDADDTVKVAIQTCPVNCIHWVERSDLPILE  213

Query  915  DEMRRVER  938
              +R   R
Sbjct  214  YLIRPQPR  221



>ref|XP_001781183.1| predicted protein [Physcomitrella patens]
 gb|EDQ53968.1| predicted protein [Physcomitrella patens]
Length=521

 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 106/216 (49%), Gaps = 12/216 (6%)
 Frame = +3

Query  384   SGRRKGFGRIRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGD  563
             S RR+  G +  A+    ++ +   D Y +LG+  DA   +IK+AY    K CHPD++G 
Sbjct  51    SSRRRNNGLVTAAHTARGSAIDHGYDLYELLGVETDAPFPEIKQAYRWLQKRCHPDIAGP  110

Query  564   DEETTNFCMFINEIYEILSDPVQRLVYD-------EIHGYAATAINPFFDDSSPKDH-VF  719
                  +  + +N+ Y  L DP+QR  YD          GY    +   +     +D  +F
Sbjct  111   IGH--DMSILLNDAYATLQDPMQRAAYDVKRVERAAFDGYTGKPLYSKWLGPEEEDRAIF  168

Query  720   VDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAA  896
             VDE  C+GC  CA +    F IE  +GRAR   Q G+ E  I  AI +CPVDCI +    
Sbjct  169   VDESQCVGCLKCALIASNTFAIENRYGRARAVGQWGNSEATISDAIRACPVDCISFVQRD  228

Query  897   QLSLLEDEMRRVERVNVAL-MLSGMGAASIDVFRMA  1001
             +L  LE  M +  RV V + M S  G  + +VF  A
Sbjct  229   KLPALEFVMTKQPRVIVGVDMYSYGGQRNENVFAAA  264



>ref|XP_002971106.1| hypothetical protein SELMODRAFT_147630 [Selaginella moellendorffii]
 gb|EFJ27704.1| hypothetical protein SELMODRAFT_147630 [Selaginella moellendorffii]
Length=450

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 96/188 (51%), Gaps = 20/188 (11%)
 Frame = +3

Query  426  QESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
            QE   S     DYY +LG+LP +S E I+KAY    K  HPD+SG         + +NE 
Sbjct  25   QEHTGSGTNQQDYYEILGVLPGSSMEAIRKAYRKLQKQHHPDISGSKGHA--MTLMLNEA  82

Query  606  YEILSDPVQRLVYD--EIHGYAATAINPFFDDSS--------------PKDHVFVDEFSC  737
            Y++LSD   R  YD  + H  +   +N ++   S              P+  +FVDE  C
Sbjct  83   YQVLSDERLRSKYDASQPHLASTRTMNYYYSKPSFTGSMYSTWNGPDRPQG-IFVDENVC  141

Query  738  IGCKNCANVCPKVFDIEEDFGRARVYSQSG-SGELIQQAIESCPVDCIHWTSAAQLSLLE  914
            IGC+ CA      F  +E  G ARV +Q G S E ++ AI++CPV+CIHW   + LS+ E
Sbjct  142  IGCRECAFAAKNTFLFDESTGCARVKAQWGDSDETVKVAIQTCPVNCIHWVERSDLSIYE  201

Query  915  DEMRRVER  938
              +R   R
Sbjct  202  YLIRPQPR  209



>ref|XP_009385991.1| PREDICTED: uncharacterized protein LOC103973215 [Musa acuminata 
subsp. malaccensis]
Length=478

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 92/174 (53%), Gaps = 11/174 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y +LG+   +   +IKKAY    K CHPD++G      +  + +NEIY +LSDP+ R 
Sbjct  63   DLYDLLGVDRCSDQFEIKKAYRALQKRCHPDIAGPAGH--DMAILLNEIYSVLSDPIARG  120

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       E  GY    + + +F     +  VFVDE  C+GC  CA    K F IE  
Sbjct  121  AYDHEQAKLSEFQGYTGKPVYSTWFGPEDEERAVFVDELKCVGCLKCALFASKTFAIESA  180

Query  795  FGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVAL  953
            +GRARV  Q +   E I  A+++CPVDCI +   + L+ LE  M +  R +V +
Sbjct  181  YGRARVVGQWADPEERILDAVKTCPVDCISFVERSNLAALEFLMSKQPRGSVRI  234



>emb|CDP14399.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 108/220 (49%), Gaps = 22/220 (10%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+       QIK AY    K CHPD++G      +  + +NE Y +LSDP  R+
Sbjct  60    DLYELLGIESSCDQAQIKLAYRALQKRCHPDIAGPSGH--DMAIILNEAYAVLSDPSSRM  117

Query  639   VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       ++ GY    + + +    + K  VFVDE  C+GC  CA    K F +E  
Sbjct  118   AYDKEQEKFADLRGYTGKPLYSVWLGPENEKRAVFVDEVKCVGCLKCALFAEKTFAVESV  177

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG-M  968
             +GRARV +Q    E  IQ AI++CPVDCI     + L+ LE  M +  R  V +     +
Sbjct  178   YGRARVVAQWADPEDKIQAAIQTCPVDCISTVERSNLAALEFLMSKKPRGKVRIGFGNTV  237

Query  969   GAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSD  1088
             GA + ++F       EK       QA+  MT  K + +SD
Sbjct  238   GACASNIF----DDLEK------FQARYDMTSSKTTKESD  267



>dbj|BAJ89861.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   112 bits (279),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 115/228 (50%), Gaps = 22/228 (10%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETT------NFCMFINEIYEILS  620
             D Y +LG+ P +    IK AY    K CHPD++  + + +      +  + +NE+Y +LS
Sbjct  53    DLYELLGVEPTSPQADIKAAYRALQKRCHPDVAAGNGDASAGPSSHDMAVVLNEVYALLS  112

Query  621   DPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
             DP QR  YD       E  GY    + + +    +    VFVDE +C+GC  CA    + 
Sbjct  113   DPAQRRAYDREHARRSEFQGYTGRPLYSSWRGGDAETRAVFVDEVACVGCLKCALHAGRT  172

Query  777   FDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVAL  953
             F IE   GRARV +Q    E  I  A+++CPVDCI +   + L+ LE  M ++ R  V +
Sbjct  173   FAIESVHGRARVVAQWADPEDRIADAVQTCPVDCISYVERSDLAALEFLMSKLPRRRVRV  232

Query  954   MLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYW  1097
               +   A S D+F    T+++ R  K+  ++  R      S++S++ W
Sbjct  233   SEAN-AAGSPDIF-AEVTKFKARFEKMENKSATRQ-----SEESEATW  273



>ref|XP_002456296.1| hypothetical protein SORBIDRAFT_03g033630 [Sorghum bicolor]
 gb|EES01416.1| hypothetical protein SORBIDRAFT_03g033630 [Sorghum bicolor]
Length=85

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 70/126 (56%), Gaps = 42/126 (33%)
 Frame = +3

Query  483  LPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYDEIHGY  662
            +PD + +QIKKAYYNCMK+CHPDLSG+D + TNFCMFINE+Y                  
Sbjct  1    MPDVTLKQIKKAYYNCMKSCHPDLSGNDPDMTNFCMFINEVY------------------  42

Query  663  AATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGELI  842
                              ++D  + + C        + F IEEDFGRARVY QSGS ELI
Sbjct  43   ------------------YMDARTMLTC------VLRSFKIEEDFGRARVYDQSGSTELI  78

Query  843  QQAIES  860
            Q+AI+S
Sbjct  79   QKAIDS  84



>ref|XP_007153072.1| hypothetical protein PHAVU_003G004300g [Phaseolus vulgaris]
 gb|ESW25066.1| hypothetical protein PHAVU_003G004300g [Phaseolus vulgaris]
Length=511

 Score =   111 bits (277),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 83/238 (35%), Positives = 121/238 (51%), Gaps = 23/238 (10%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+       ++K AY +  K CHPD++G      +  + +NE Y ILSDP  R 
Sbjct  104   DLYELLGIDSSCDQSEVKGAYRSLQKRCHPDIAGPAGH--DMAIILNEAYAILSDPNARF  161

Query  639   VYD-------EIHGYAATAINPFFDDS-SPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E  G+    I   +  S S +  +FVDE  C+GC  CA +  K F +E  
Sbjct  162   AYDKEQAKSSEFKGFTGRPIYSVWRGSESEQRAIFVDEIKCVGCLKCALLAEKTFAVESV  221

Query  795   FGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNV---ALMLS  962
             +GRARV +Q + S + I  AIESCPV+CI     + L+ LE  M +  R NV   A   +
Sbjct  222   YGRARVVAQWADSPQKIDAAIESCPVNCISVVERSNLAALEFLMSKQPRGNVRVGAAHTA  281

Query  963   GMGAASI--DVFRMASTRWEKRQAKVLG----QAKVRMTKQKGSDKSDSYWDYLWAKP  1118
             G   A+I  DV +  S R++++ +K       Q + RM+  + + +S S W Y W  P
Sbjct  282   GARVANIFVDVEKFQS-RFQEKASKSSKETNLQKESRMSAIQ-AIRSISNWLY-WQSP  336



>ref|XP_004231500.1| PREDICTED: uncharacterized protein LOC101265380 [Solanum lycopersicum]
Length=457

 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 101/188 (54%), Gaps = 12/188 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y + G+   ++  QIK AY    K CHPD++G         + +N+ Y +LSDPV R+
Sbjct  55   DLYDLFGVESSSNQAQIKLAYRMLQKRCHPDIAGPSGH--EMAIILNQAYALLSDPVARM  112

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       ++ GY    + + +  + + +  VFVDE  C+GC  CA +  K F +E  
Sbjct  113  AYDKEVTKVADLKGYTGKPLYSAWCGEDNEERAVFVDEVKCVGCLKCALLAEKTFAVECV  172

Query  795  FGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG-M  968
            +GRARV +Q    E  IQ+AI++CPVDCI     + L+ LE  M +  R NV +     +
Sbjct  173  YGRARVVAQWADTEAKIQEAIDACPVDCISVVERSNLAALEFLMSKKPRGNVRIGTGNTV  232

Query  969  GAASIDVF  992
            GA + ++F
Sbjct  233  GARTSNIF  240



>gb|KHN29584.1| Chaperone protein dnaJ 20, chloroplastic [Glycine soja]
Length=464

 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 117/241 (49%), Gaps = 24/241 (10%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+       Q+K AY +  K CHPD++G      +  + +N+ Y ILSDP  RL
Sbjct  54    DLYDLLGIDNSCDQSQVKVAYRSLQKRCHPDIAGPAGH--DMAIILNDAYAILSDPNARL  111

Query  639   VYD-------EIHGYAATAINPFFDDS-SPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E  G+    I   +  S S +  +FVDE  C+GC  CA +  K F +E  
Sbjct  112   AYDKEQAKSSEFKGFTGRPIYSVWCGSESEQRAIFVDEIKCVGCLKCALLAEKTFAVESV  171

Query  795   FGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q + S   I +AIESCPV+CI     + L+ LE  M +  R NV +      
Sbjct  172   YGRARVVAQWADSPNKIDEAIESCPVNCISVVERSNLAALEFLMSKQPRGNVRVGAGHTA  231

Query  972   AAS-----IDV------FRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWDYLWAKP  1118
              A      +DV      F+ A  +  K   +   Q + RM+  + + +S S W Y W  P
Sbjct  232   GARVSNIFVDVEKFQTRFQEAMEKANKCSKETDLQRESRMSAIQ-AIRSISNWLY-WQTP  289

Query  1119  R  1121
             R
Sbjct  290   R  290



>gb|EPS72837.1| hypothetical protein M569_01924, partial [Genlisea aurea]
Length=417

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 101/201 (50%), Gaps = 16/201 (8%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             + Y +LG+   +   QIK+AY    K CHPD++G      +  + +NE Y +LSD   R 
Sbjct  4     NLYELLGVDSSSEKAQIKEAYRALQKRCHPDVAGPSGH--DMAIVLNEAYALLSDERTRT  61

Query  639   VYD-------EIHGYAATAINPFFDDSSPKDH-VFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       ++ GY    +   ++ S  +   VFVDE  C+GC  CA    K F IE  
Sbjct  62    AYDKELAKFADLQGYTGRPLYSVWNGSDDEGRAVFVDEGKCVGCLKCALFAEKTFAIESV  121

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLS-GM  968
             +GRARV +Q    E  IQ+AI SCPVDCI     + L  LE  M +  R NV +  S   
Sbjct  122   YGRARVVAQWADSEHKIQEAIGSCPVDCISIVDRSNLPALEFIMSKQPRGNVRVGASDAA  181

Query  969   GAASIDVFRMASTRWEKRQAK  1031
             GA + DVF       EK QA+
Sbjct  182   GARTPDVF----NELEKFQAR  198



>ref|XP_001762380.1| predicted protein [Physcomitrella patens]
 gb|EDQ72847.1| predicted protein [Physcomitrella patens]
Length=430

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 98/200 (49%), Gaps = 11/200 (6%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+  DAS  +IK+AY    K CHPD++G      +  + +N+ Y  LSDP QR 
Sbjct  7     DVYELLGVKSDASMPEIKQAYRWLQKRCHPDIAGPIGH--DMAILLNDAYATLSDPNQRA  64

Query  639   VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E  GY    + + +   +     +FVDE  C+GC  CA +    F IE  
Sbjct  65    AYDVKRVERAEFDGYTGKPLYSKWLGPAEEGRAIFVDESHCVGCLKCALIASNTFAIETR  124

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRAR   Q G  E  +  AI +CPVDCI +    +L  LE  M +  R  V +     G
Sbjct  125   YGRARAVGQWGDSEGTVNDAIRACPVDCISFVPREKLPALEFVMTKQPRFAVGIDAHSNG  184

Query  972   AASIDVFRMASTRWEKRQAK  1031
                ++    A+ ++ K+ A+
Sbjct  185   GHRVENVFTATEKFLKKCAE  204



>emb|CBG76273.1| OO_Ba0005L10-OO_Ba0081K17.24 [Oryza officinalis]
Length=5010

 Score =   112 bits (279),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 105/198 (53%), Gaps = 13/198 (7%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+   +   +IK AY +  K CHPD++G   +  +  + +NE+Y +LSDP  RL
Sbjct  4593  DLYELLGVERSSPQSEIKAAYRSLQKRCHPDVAG--AKGHDMAIVLNEVYSLLSDPAARL  4650

Query  639   VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E  GY    + + +F   + +  VFVDE  C+GC  CA    K F +E  
Sbjct  4651  AYDQEQAKQSEFVGYTGKPLYSAWFGGEAEQRAVFVDEVRCVGCLKCALYANKTFAVESV  4710

Query  795   FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSG-M  968
             +GRARV +Q    E  I  AI++CPVDCI     + L+ LE  M +  R  V +     +
Sbjct  4711  YGRARVVAQWADAEDKILDAIQTCPVDCISMVERSDLAALEFLMSKQPRGRVRVSEGNTV  4770

Query  969   GAASIDVFRMASTRWEKR  1022
             GA + D+F   S +++KR
Sbjct  4771  GARAPDIFNEVS-KFQKR  4787



>ref|XP_003534680.2| PREDICTED: uncharacterized protein LOC100783616 [Glycine max]
Length=484

 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 117/241 (49%), Gaps = 24/241 (10%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             D Y +LG+       Q+K AY +  K CHPD++G      +  + +N+ Y ILSDP  RL
Sbjct  74    DLYDLLGIDNSCDQSQVKVAYRSLQKRCHPDIAGPAGH--DMAIILNDAYAILSDPNARL  131

Query  639   VYD-------EIHGYAATAINPFFDDS-SPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
              YD       E  G+    I   +  S S +  +FVDE  C+GC  CA +  K F +E  
Sbjct  132   AYDKEQAKSSEFKGFTGRPIYSVWCGSESEQRAIFVDEIKCVGCLKCALLAEKTFAVESV  191

Query  795   FGRARVYSQ-SGSGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG  971
             +GRARV +Q + S   I +AIESCPV+CI     + L+ LE  M +  R NV +      
Sbjct  192   YGRARVVAQWADSPNKIDEAIESCPVNCISVVERSNLAALEFLMSKQPRGNVRVGAGHTA  251

Query  972   AASIDVFRMASTRWEKRQAKVLGQA-----------KVRMTKQKGSDKSDSYWDYLWAKP  1118
              A +    +   +++ R  + + +A           + RM+  + + +S S W Y W  P
Sbjct  252   GARVSNIFVDVEKFQTRFQEAMEKANKCSKETDLQRESRMSAIQ-AIRSISNWLY-WQTP  309

Query  1119  R  1121
             R
Sbjct  310   R  310



>gb|AFW78770.1| hypothetical protein ZEAMMB73_356788 [Zea mays]
Length=149

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +3

Query  438  ASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
            + E+VADDYY+VLG++PDA+PE+IKKAYY+CMK CHPDLSGD  + TNFCMFINE+Y +
Sbjct  68   SEEDVADDYYSVLGVMPDATPEEIKKAYYSCMKECHPDLSGDHPDVTNFCMFINEVYSV  126



>ref|XP_006350359.1| PREDICTED: uncharacterized protein LOC102586830 [Solanum tuberosum]
Length=491

 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 104/197 (53%), Gaps = 13/197 (7%)
 Frame = +3

Query  435  AASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
            A S  + D D Y + G+   ++  QIK AY    K CHPD++G         + +N+ Y 
Sbjct  77   ANSSSITDFDLYDLFGVESSSNQAQIKLAYRTLQKRCHPDIAGPSGH--EMAIILNQAYA  134

Query  612  ILSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVC  767
            +LSDPV R+ YD       ++ GY    + + +  + + +  VFVDE  C+GC  CA + 
Sbjct  135  LLSDPVARMAYDKEVTKIADLKGYTGKPLYSAWCGEDNEERAVFVDEVKCVGCLKCALLA  194

Query  768  PKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVN  944
               F +E  +GRARV +Q    E  IQ+AI++CPVDCI     + L+ LE  M +  R N
Sbjct  195  ENTFAVECLYGRARVVAQWADTESKIQEAIDACPVDCISVVERSNLAALEFLMSKKPRGN  254

Query  945  VALMLSG-MGAASIDVF  992
            V +     +GA + ++F
Sbjct  255  VRIGAGNTVGARTSNIF  271



>ref|XP_004960085.1| PREDICTED: uncharacterized protein LOC101773612 [Setaria italica]
Length=494

 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 98/188 (52%), Gaps = 11/188 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y +LG+   +   +IK AY +  K CHPD++G   +  +  + +NE+Y +LSDP  RL
Sbjct  66   DLYELLGVERSSPQSEIKAAYRSLQKRCHPDVAGA-ADGHDMAIVLNEVYALLSDPAARL  124

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       E  GY    + + +    + +  VFVDE  C+GC  CA    + F +E  
Sbjct  125  AYDQEQARRSEFAGYTGRPLYSSWLGADAERRAVFVDEVRCVGCLKCALHASRTFAVESV  184

Query  795  FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML-SGM  968
            +GRARV +Q    E  I  AI +CPVDCI     + L+ LE  M +  R  V +   + +
Sbjct  185  YGRARVVAQWADDEDKITDAISTCPVDCISMVERSDLAALEFLMSKQPRGRVRVSEGNAV  244

Query  969  GAASIDVF  992
            GA + ++F
Sbjct  245  GARAPNIF  252



>ref|XP_009393615.1| PREDICTED: uncharacterized protein LOC103979262 [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 94/177 (53%), Gaps = 11/177 (6%)
 Frame = +3

Query  411  IRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCM  590
            IR    +    + V  +YY +LG+  D++P+QIK AY +  K  HPD++G  ++  ++ +
Sbjct  48   IRCCSGKKGREDSVPRNYYELLGVSTDSTPQQIKDAYRSLQKKHHPDIAG--QKGHDYTL  105

Query  591  FINEIYEILSDPVQRLVYDEIHGYAATAINPFFDD------SSP--KDHVFVDEFSCIGC  746
             +N+ Y  L     R  YD   G  +      F        + P     +FVDE  CIGC
Sbjct  106  MLNQAYRTLMREESRSRYDTACGRRSEWSGSNFSGLGYSSWNGPLGSQALFVDEHRCIGC  165

Query  747  KNCANVCPKVFDIEEDFGRARVYSQSG-SGELIQQAIESCPVDCIHWTSAAQLSLLE  914
            + C +   + F+++E FG ARV  Q G   + I+ +++SCPV+CIHW  A +L LLE
Sbjct  166  QECVHHASETFEMDEAFGSARVKVQFGDHAKNIEVSVDSCPVNCIHWVDAEELPLLE  222



>ref|XP_011098439.1| PREDICTED: uncharacterized protein LOC105177106 [Sesamum indicum]
Length=290

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 69/218 (32%), Positives = 114/218 (52%), Gaps = 11/218 (5%)
 Frame = +3

Query  447   EVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDP  626
             E + +YY +LG+  DAS ++IK AY    K  HPD++G  E+     + +N+ Y++L   
Sbjct  49    EESKNYYELLGVCVDASSQEIKDAYRKLQKKYHPDIAG--EKGHESTLMLNKAYKVLVKD  106

Query  627   VQRLVYDEIHGYAAT--AINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFG  800
               R  YD   G  +    I   ++ S     +FVDE +CIGC+ C +     F ++E FG
Sbjct  107   DLRKQYDASIGKISNNLRIGSIWEGSLRSQALFVDENACIGCRECVHHAGNTFMMDEGFG  166

Query  801   RARVYSQSGSG-ELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGAA  977
              ARV  Q G   E I+ +++SCPV+CIHW    +L +LE  ++   +V   +   G    
Sbjct  167   TARVKVQYGDDEERIEISVDSCPVNCIHWVDTEELEVLEYLIQPQPKVGYGIYGQGWERP  226

Query  978   SIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDS  1091
             + +VF MA+  + K+    L Q +    + K +D+ ++
Sbjct  227   A-NVF-MAAKSFNKQ----LKQQEENQQRSKSTDEEET  258



>dbj|BAJ88021.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=303

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 90/169 (53%), Gaps = 11/169 (7%)
 Frame = +3

Query  432  SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
            S A  +   DYY VLG+   ++P +IK+AY    K  HPD++GD  +  ++ + +NE YE
Sbjct  43   STAKGKARRDYYEVLGVATHSTPHEIKEAYRKLQKQHHPDIAGD--KGHDYALLLNEAYE  100

Query  612  IL-------SDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCP  770
            +L       +D   +       GY     +  ++       +FVDE  CIGC+ C +   
Sbjct  101  VLMRSSSRKADGFGKSRGGFGSGYTGDGCSS-WNGPMRSQALFVDENKCIGCRECVHHAG  159

Query  771  KVFDIEEDFGRARVYSQSGSG-ELIQQAIESCPVDCIHWTSAAQLSLLE  914
            + F +++  G ARV  Q G   + IQ A+ESCPV+CIHW  + +L +LE
Sbjct  160  ETFAMDDVLGSARVQVQFGDADQQIQVAVESCPVNCIHWVGSQELPVLE  208



>gb|ACR35926.1| unknown [Zea mays]
 gb|AFW59880.1| dnaJ domain containing protein [Zea mays]
Length=473

 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 103/199 (52%), Gaps = 12/199 (6%)
 Frame = +3

Query  429  ESAASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
            E++ S  V+D D Y +LG+   +   +IK AY +  K CHPD++G      +  + +NE+
Sbjct  41   EASGSSWVSDYDLYELLGVERSSPQSEIKAAYRSLQKRCHPDVAGA-AGGHDMAVVLNEV  99

Query  606  YEILSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCAN  761
            Y +LSDP  RL YD       E  GY    + + +    S +  VFVDE  C+GC  CA 
Sbjct  100  YALLSDPDARLAYDQEQARRSEFAGYTGRPLYSSWVGAESERRAVFVDEVRCVGCLKCAL  159

Query  762  VCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVER  938
               + F +E  +GRAR  +Q    E  I  AI +CPVDCI     + L+ LE  M +  R
Sbjct  160  HASRTFAVESVYGRARAVAQWADDEDRIVDAINTCPVDCISMVERSDLAALEFLMSKQPR  219

Query  939  VNVALML-SGMGAASIDVF  992
              V +   + +GA + ++F
Sbjct  220  GRVRVSEGNAVGARAPNIF  238



>ref|NP_001148244.1| dnaJ domain containing protein [Zea mays]
 gb|ACG30282.1| dnaJ domain containing protein [Zea mays]
Length=475

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 103/199 (52%), Gaps = 12/199 (6%)
 Frame = +3

Query  429  ESAASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
            E++ S  V+D D Y +LG+   +   +IK AY +  K CHPD++G      +  + +NE+
Sbjct  41   EASGSSWVSDYDLYELLGVERSSPQSEIKAAYRSLQKRCHPDVAGA-AGGHDMAVVLNEV  99

Query  606  YEILSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCAN  761
            Y +LSDP  RL YD       E  GY    + + +    S +  VFVDE  C+GC  CA 
Sbjct  100  YALLSDPDARLAYDQEQARRSEFAGYTGRPLYSSWVGAESERRAVFVDEVRCVGCLKCAL  159

Query  762  VCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVER  938
               + F +E  +GRAR  +Q    E  I  AI +CPVDCI     + L+ LE  M +  R
Sbjct  160  HASRTFAVESVYGRARAVAQWADDEDRIVDAINTCPVDCISMVERSDLAALEFLMSKQPR  219

Query  939  VNVALML-SGMGAASIDVF  992
              V +   + +GA + ++F
Sbjct  220  GRVRVSEGNAVGARAPNIF  238



>ref|XP_002447316.1| hypothetical protein SORBIDRAFT_06g032790 [Sorghum bicolor]
 gb|EES11644.1| hypothetical protein SORBIDRAFT_06g032790 [Sorghum bicolor]
Length=494

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 96/188 (51%), Gaps = 11/188 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D Y +LG+   +   +IK AY +  K CHPD++G      +  + +NE+Y +LSDP  RL
Sbjct  67   DLYELLGVERSSPQSEIKAAYRSLQKRCHPDVAGA-AGGHDMAVVLNEVYALLSDPDARL  125

Query  639  VYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD       E  GY    + + +    S +  VFVDE  C+GC  CA    + F +E  
Sbjct  126  AYDQEQARRSEFAGYTGRPLYSSWLGPESERRAVFVDEVRCVGCLKCALHASRTFAVESV  185

Query  795  FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML-SGM  968
            +GRAR  +Q    E  I  AI +CPVDCI     + L+ LE  M +  R  V +   + +
Sbjct  186  YGRARAVAQWADDEDRIVDAINTCPVDCISMVERSDLAALEFLMSKQPRGRVRVSEGNAV  245

Query  969  GAASIDVF  992
            GA + +VF
Sbjct  246  GARAPNVF  253



>ref|XP_004306359.1| PREDICTED: uncharacterized protein LOC101298739 [Fragaria vesca 
subsp. vesca]
Length=292

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 99/184 (54%), Gaps = 12/184 (7%)
 Frame = +3

Query  393  RKGFGRIRVAYQESAA-SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDE  569
            R+G   IR   +ES   +     +YY +LG+  D++P+ IK+AY N  K  HPD++G  +
Sbjct  32   RQGCSGIRCCNKESGERASTTGKNYYELLGVDADSNPQIIKQAYRNLQKKYHPDIAG--Q  89

Query  570  ETTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAI---NPFFDDSS-----PKDHVFVD  725
            E   + + +NE Y++L     R  YD   G    ++   +  FD SS         +FVD
Sbjct  90   EGHEYTLKLNEAYKVLIKENLRKEYDASIGQRRVSVRGNSSTFDGSSWNGVLRPQALFVD  149

Query  726  EFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSG-SGELIQQAIESCPVDCIHWTSAAQL  902
            E +CIGC+ C +     +  +E  G ARV  Q G   + I+ +++SCPV+CIHW    +L
Sbjct  150  ENACIGCRQCVHQASATYMFDEVLGCARVKLQYGDDDQRIEVSVDSCPVNCIHWVEREEL  209

Query  903  SLLE  914
            ++LE
Sbjct  210  AVLE  213



>ref|NP_001150750.1| 3Fe-4S ferredoxin [Zea mays]
 gb|ACG40210.1| 3Fe-4S ferredoxin [Zea mays]
 gb|ACN28690.1| unknown [Zea mays]
 gb|AFW76715.1| 3Fe-4S ferredoxin [Zea mays]
Length=304

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 94/186 (51%), Gaps = 15/186 (8%)
 Frame = +3

Query  393  RKGFGRIRVAYQ--ESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDD  566
            R+  GR R A +   S A     D YY VLG+   ++P+QIK+AY    K  HPD++G  
Sbjct  29   RRHHGRPRSAIRCCSSTARGRTRDYYYQVLGIAIQSTPQQIKEAYRKLQKQHHPDIAG--  86

Query  567  EETTNFCMFINEIYEIL---------SDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVF  719
             +  ++ + +NE Y++L         +D   R       GY     +  ++       +F
Sbjct  87   YKGHDYTLLLNEAYKVLMRDVSSSRHADGRGRSRVGSGAGYTGDGYSS-WEGPVRSQALF  145

Query  720  VDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAA  896
            VDE  CIGC+ C +   + F +++  G A V  Q G  E  IQ A+ESCPVDCIHW  + 
Sbjct  146  VDENKCIGCRECVHHAARTFAMDDVLGSAHVEVQFGDLEQQIQLAVESCPVDCIHWVESH  205

Query  897  QLSLLE  914
             L +LE
Sbjct  206  DLPVLE  211



>ref|XP_005643297.1| Six-hairpin glycosidase [Coccomyxa subellipsoidea C-169]
 gb|EIE18753.1| Six-hairpin glycosidase [Coccomyxa subellipsoidea C-169]
Length=846

 Score =   106 bits (264),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 90/175 (51%), Gaps = 11/175 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            D++ +L L   A+P  +K +Y    +  HPDL GD        + +N  Y  L D   R 
Sbjct  80   DFFQLLNLDLGATPLDVKASYRALQRLVHPDLIGD--AANELAVILNIAYSTLMDDNARD  137

Query  639  VY--------DEIHGYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEED  794
            +Y         E H Y    ++ +         VFVDE +C+GC++C    P  F +EE 
Sbjct  138  IYLQDAERFRKEGHAYDGRPVSKWMGQEHEHRAVFVDETTCVGCRHCTYCAPNTFGMEEH  197

Query  795  FGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALM  956
            +GRARV++Q G  E  +++A++ CPVDCI + +  QL LLE  ++   R + A+M
Sbjct  198  YGRARVHTQWGDDEDAVKEAVDMCPVDCISFVNRKQLVLLEFVLKACPREDTAIM  252



>gb|ABR17679.1| unknown [Picea sitchensis]
Length=460

 Score =   104 bits (260),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 111/242 (46%), Gaps = 23/242 (10%)
 Frame = +3

Query  444   EEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSD  623
             +E   DYY VLG+   A+P+ I+KAY    K  HPD++G  E+     + +NE Y+IL  
Sbjct  48    KEGQQDYYQVLGVPVGATPQDIRKAYRKLQKKYHPDIAG--EKGHAMTLLLNEAYQILMR  105

Query  624   PVQRLVYDEIHGYAATAINPF-------FDDSSPKDHVFVDEFSCIGCKNCANVCPKVFD  782
                R  YD  +G  +   + F       ++     + +FVDE +CIGC+ C     K F 
Sbjct  106   DDLRAKYDVSNGKNSQMNSQFTGLAYSSWNGPERPEALFVDENTCIGCRECVFHASKTFI  165

Query  783   IEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALML  959
             ++E  G ARV  Q G  +  I+ +++SCPV+CIHW     L +LE   R   + +  +  
Sbjct  166   MDEALGCARVKVQFGDDDSQIKASLDSCPVNCIHWVDREDLPILEFLARPHPKTSNGVFG  225

Query  960   SGMGAASIDVFRMASTRWEKRQ------------AKVLGQAKVRMTKQKGSDKSDSYWDY  1103
              G    S +VF  A T   K               + + Q K RM  Q        +W +
Sbjct  226   GGWERPS-NVFMAAKTYKRKMNEMQISKTESSASEETVAQHKARMNAQLKLRMGTLWWFW  284

Query  1104  LW  1109
              W
Sbjct  285   SW  286



>ref|XP_007031547.1| DNAJ heat shock N-terminal domain-containing protein [Theobroma 
cacao]
 gb|EOY02473.1| DNAJ heat shock N-terminal domain-containing protein [Theobroma 
cacao]
Length=301

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/257 (29%), Positives = 123/257 (48%), Gaps = 15/257 (6%)
 Frame = +3

Query  306   PVHNLFPRKRSPILGT-NCNSVSSHGGSGRRKGFGRIRVAYQESAASEEVADDYYAVLGL  482
             P++     K S I G  N N  +S  G    K +  IR   Q          +YY +LG+
Sbjct  7     PIYQFSVPKSSHIYGKFNPNKSNSRWG----KKWTEIRCCNQRVGEKARAKKNYYELLGV  62

Query  483   LPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRLVYDE----  650
               D++P++IK+AY    K  HPD++G  +E   + + +NE Y++L     R  YD     
Sbjct  63    SADSNPQEIKEAYRRLQKKYHPDIAG--QEGHEYTLMLNEAYQVLIKDDLRRNYDASIGP  120

Query  651   IHGYAATAINPFFDDSSP--KDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQS  824
             I       ++ +     P     +FVD  +CIGC+ C +     F ++E  G ARV  Q 
Sbjct  121   IKVQFGNTVSGYSSWKGPLRPQALFVDGNACIGCRECVHHASNTFVMDEALGCARVRVQY  180

Query  825   G-SGELIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMG-AASIDVFRM  998
             G   + I  +++SCPV+CIHW    +L++LE  ++   +    +   G    A++ V   
Sbjct  181   GDDDQKIDVSVDSCPVNCIHWVDREELAVLEFLIQPQPKEGYGVYGGGWERPANVFVAAK  240

Query  999   ASTRWEKRQAKVLGQAK  1049
             A ++  K+QA+  GQ +
Sbjct  241   AFSKQLKQQAEAEGQQR  257



>gb|ABD93567.1| chloroplast heat shock protein-binding protein, partial [Helianthus 
annuus]
Length=55

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  576  TNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDHVFVDEFSCI  740
            T F MF  E +E+LSDP QR+VYDEIHGYA +AINPF DD+ PKDHVFVDEFSCI
Sbjct  1    TKFXMFXKEGFEVLSDPAQRMVYDEIHGYALSAINPFLDDTYPKDHVFVDEFSCI  55



>ref|XP_010240605.1| PREDICTED: uncharacterized protein LOC100821370 [Brachypodium 
distachyon]
Length=523

 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 99/213 (46%), Gaps = 23/213 (11%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDL----------SGDDEETTNFCMFINEIY  608
             D Y +LG+ P +   +IK AY    K CHPD+           G      +  + +NE+Y
Sbjct  84    DLYELLGVEPTSPHAEIKAAYRALQKRCHPDVVAASSSSASGDGGTPSAHDMAVVLNEVY  143

Query  609   EILSDPVQRLVYD-------EIHGYAATAI-NPFFDDSSPKDHVFVDEFSCIGCKNCANV  764
              +LSDP  R  YD       E  GY    + + +         VFVDE +C+GC  CA  
Sbjct  144   ALLSDPAARRAYDREHAARSEFQGYTGRPLYSSWRGGEGETRAVFVDEVACVGCLKCALH  203

Query  765   CPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERV  941
               + F IE   GRARV +Q    E  I  AI +CPVDCI     + L+ LE  M +  R 
Sbjct  204   AGRTFAIESAHGRARVVAQWADEEDRIVDAINTCPVDCISIVERSDLAALEYLMSKQPRR  263

Query  942   NVALMLSGMGAASIDVF---RMASTRWEKRQAK  1031
              V +  S  GA S ++F   R    R+E+ + K
Sbjct  264   RVRVSESS-GAGSPNIFAEVRKFKARFEQMEHK  295



>ref|XP_001415419.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO93711.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=167

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 75/126 (60%), Gaps = 8/126 (6%)
 Frame = +3

Query  714   VFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTS  890
             VFVDEF+CIGCK C    P  F + +D+GR+RV++Q  + E  IQ AI+SCPVDCIHW  
Sbjct  22    VFVDEFTCIGCKQCVWQAPATFRMNDDYGRSRVFAQWLNDEDDIQCAIDSCPVDCIHWVE  81

Query  891   AAQLSLLEDEMRRVERVNVALMLSGMGAASIDVFRMASTRWEKRQAKV------LGQAKV  1052
               QL  LE      E+V+V +M S  G  + D F  AS+  + RQ K+      L + + 
Sbjct  82    REQLPFLEHVAVNYEKVSVGIMQSQTGVVT-DPFEAASSFQKMRQRKIDARAEELAEQRR  140

Query  1053  RMTKQK  1070
             RMT ++
Sbjct  141   RMTDEE  146



>ref|XP_009802151.1| PREDICTED: uncharacterized protein LOC104247753 [Nicotiana sylvestris]
Length=255

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 108/213 (51%), Gaps = 14/213 (7%)
 Frame = +3

Query  426   QESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEI  605
             +E+  S+    +YY +LG+   +SP++IK+AY    K  HPD++G   +  ++ + +NE 
Sbjct  2     REAEVSQGRKKNYYDLLGIPIHSSPQKIKEAYRKLQKIYHPDIAGP--KGHDYTLVLNEA  59

Query  606   YEILSDPVQRLVYD------EIHGYAATAINPFFDDSSP--KDHVFVDEFSCIGCKNCAN  761
             Y++L     R  YD       +     +++  +     P     +FVDE +CIGC  C +
Sbjct  60    YKVLMREDLRREYDVSIGQIRVGSGKGSSLQGYSSWKGPLRPQALFVDENTCIGCAECVH  119

Query  762   VCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLEDEMRRVER  938
                  F ++E   RARV  Q G  +  IQ +IESCPV+CIHW    +L +LE   R  ++
Sbjct  120   HARNTFVMDEALARARVRVQYGDDDSQIQVSIESCPVNCIHWVDTEELRVLEHLSRPQQK  179

Query  939   VNVALMLSGMGAASIDVFRMAST--RWEKRQAK  1031
                 +   G   + I+ F+ A +     K+QAK
Sbjct  180   DGHGIYGQGW-ESPINAFKAAKSFHNQLKKQAK  211



>ref|XP_010251143.1| PREDICTED: uncharacterized protein LOC104593132 [Nelumbo nucifera]
Length=272

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 88/165 (53%), Gaps = 11/165 (7%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            DYY +LG+  D+ P++IK+AY    K  HPD++G  +    + + +NE Y +L     R 
Sbjct  26   DYYELLGVTADSKPQEIKEAYRKLQKKHHPDIAG--QRGHEYTLRLNEAYRVLMREDLRR  83

Query  639  VYDEIHGYAATAINPFFDD---SSPK-----DHVFVDEFSCIGCKNCANVCPKVFDIEED  794
             YD   G  +      F     SS K       +FVDE +CIGC+ C +     F ++E 
Sbjct  84   EYDGFIGKTSGGFGRDFTGLTYSSWKGPFRSQALFVDENACIGCQECVHHASNTFMMDEA  143

Query  795  FGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMR  926
             G ARV  Q G  +  I+ +++SCPV+CIHW    +L++LE  +R
Sbjct  144  LGCARVKVQFGDDDRSIEVSVDSCPVNCIHWVDREELAVLEFLIR  188



>ref|XP_003634709.1| PREDICTED: uncharacterized protein LOC100854700 [Vitis vinifera]
 emb|CBI23951.3| unnamed protein product [Vitis vinifera]
Length=302

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 91/183 (50%), Gaps = 11/183 (6%)
 Frame = +3

Query  393  RKGFGRIRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEE  572
            R  F  +R + +    S      YY +LG+  D++P++IK+AY    K  HPD++G  ++
Sbjct  30   RHKFTSVRCSSRSDGQSARTRKSYYELLGVSVDSNPQEIKEAYRKLQKKYHPDVAG--QK  87

Query  573  TTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDD------SSP--KDHVFVDE  728
               + + +NE Y +L+    R  YD   G         F          P     +FVDE
Sbjct  88   GHEYSLMLNEAYRVLAREDLRREYDASIGKMRVGFGGIFSGMGYSAWKGPLRPQALFVDE  147

Query  729  FSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLS  905
              CIGC+ C +     F +++  G ARV  Q G  +  I+ +++SCPV+CIHW    +L+
Sbjct  148  NKCIGCRECVHHAGNTFVMDDALGCARVKVQYGDDDKKIEVSVDSCPVNCIHWVDREELA  207

Query  906  LLE  914
            +LE
Sbjct  208  ILE  210



>ref|XP_004965401.1| PREDICTED: uncharacterized protein LOC101776206 isoform X1 [Setaria 
italica]
Length=303

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 89/167 (53%), Gaps = 9/167 (5%)
 Frame = +3

Query  432  SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
            S A     D YY VLG+   ++P++IK+AY    K  HPD++G   ++ ++ + +NE Y 
Sbjct  43   STARGRTRDYYYQVLGVTVHSTPQEIKEAYRKLQKQHHPDIAG--YKSHDYTLLLNEAYN  100

Query  612  ILSDPVQRLVYDEIH-----GYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
            +L   + R V  +       GY     +  ++       +FVDE  CIGC+ C +   + 
Sbjct  101  VLMRNLSRHVDGKSRAGTGSGYTGDGYSS-WNGPVRSQALFVDENKCIGCRECVHHAART  159

Query  777  FDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLE  914
            F +++  G A V  Q G  E  IQ A+ESCPV+CIHW  + +L +LE
Sbjct  160  FSMDDVLGSAHVDIQFGDLEQQIQLAVESCPVNCIHWVESQELPVLE  206



>ref|XP_004965402.1| PREDICTED: uncharacterized protein LOC101776206 isoform X2 [Setaria 
italica]
Length=302

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 89/167 (53%), Gaps = 9/167 (5%)
 Frame = +3

Query  432  SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
            S A     D YY VLG+   ++P++IK+AY    K  HPD++G   ++ ++ + +NE Y 
Sbjct  43   STARGRTRDYYYQVLGVTVHSTPQEIKEAYRKLQKQHHPDIAG--YKSHDYTLLLNEAYN  100

Query  612  ILSDPVQRLVYDEIH-----GYAATAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKV  776
            +L   + R V  +       GY     +  ++       +FVDE  CIGC+ C +   + 
Sbjct  101  VLMRNLSRHVDGKSRAGTGSGYTGDGYSS-WNGPVRSQALFVDENKCIGCRECVHHAART  159

Query  777  FDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLE  914
            F +++  G A V  Q G  E  IQ A+ESCPV+CIHW  + +L +LE
Sbjct  160  FSMDDVLGSAHVDIQFGDLEQQIQLAVESCPVNCIHWVESQELPVLE  206



>ref|XP_010112538.1| Chaperone protein DnaJ [Morus notabilis]
 gb|EXC33991.1| Chaperone protein DnaJ [Morus notabilis]
Length=533

 Score =   102 bits (254),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 96/348 (28%), Positives = 138/348 (40%), Gaps = 74/348 (21%)
 Frame = +3

Query  306   PVHNLFPRKRSPILGTNCNS---VSSHGGSGRRKGFG-------RIRVAYQESAASEEVA  455
             P+H            +N NS    +SHG   +  G G       R R +   S++S    
Sbjct  7     PLHTPLAASTRITKLSNLNSNFLANSHGKYSKINGIGNNKSVPCRARASSSSSSSSSFTD  66

Query  456   DDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQR  635
              D Y +LG+   +   QIK AY +  K CHPD++G      +  + +NE Y +LS+P  R
Sbjct  67    FDLYDLLGIDSSSDQSQIKNAYRSLQKRCHPDIAGPAGH--DMAIILNEAYALLSNPSHR  124

Query  636   LVYD------------------------------------------------EIHGYAAT  671
               YD                                                E+ GY   
Sbjct  125   SAYDKVGACFCRYVIWLVGFSVPVVDVLISNFFMELQFDYGNTLVKEQAKTAELRGYTGK  184

Query  672   AI-NPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGEL-IQ  845
              I + +    + +  VFVDE  C+GC  CA    K F IE  +GRARV +Q    E  IQ
Sbjct  185   PIYSAWLGSENEERAVFVDEVKCVGCLKCALFAQKTFAIESVYGRARVVAQWADPEFKIQ  244

Query  846   QAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVAL-MLSGMGAASIDVF---RMASTRW  1013
              AI +CPVDCI     + L+ LE  M +  R NV + M +  GA   ++F   +    R+
Sbjct  245   DAIGACPVDCISMVERSNLAALEFLMSKQPRGNVRVGMGNAAGARVSNIFADVKKFQIRY  304

Query  1014  EKRQAKVLGQAKVRMTKQKGSD-------KSDSYWDYLWAKPRDYQTT  1136
             ++ + K   Q       QK +        +S S W Y W  P    +T
Sbjct  305   QEAREKASSQYSKEADLQKAARMSAIQAIRSISNWFY-WQTPNSVGST  351



>ref|XP_008341430.1| PREDICTED: uncharacterized protein LOC103404310 isoform X2 [Malus 
domestica]
Length=303

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 98/186 (53%), Gaps = 15/186 (8%)
 Frame = +3

Query  393  RKGFGRIRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEE  572
            +K   RIR   +E A       +YY +LG+  D++P++I++AY    K  HPD++G  +E
Sbjct  26   KKPIWRIRCK-KEGAEEMATGKNYYELLGVSVDSNPKKIRQAYRKLQKKYHPDVAG--QE  82

Query  573  TTNFCMFINEIYEILSDPVQRLVYD------EIHGYAA-----TAINPFFDDSSPKDHVF  719
               + + +NE Y++L     R  YD       + G+ A     +++   ++       +F
Sbjct  83   GHEYTLKLNEAYKVLMRENLRKEYDASIGKVRVAGFRAGNTPSSSLGSSWNGPFRPQALF  142

Query  720  VDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAA  896
            VDE +CIGC+ C +     F  ++  G ARV  Q G  E  I+ +++SCPV+CIHW    
Sbjct  143  VDENACIGCRECVHHASSTFMFDDALGCARVKVQYGDDEQKIEVSVDSCPVNCIHWVEKE  202

Query  897  QLSLLE  914
            +L +LE
Sbjct  203  ELPVLE  208



>ref|XP_008230562.1| PREDICTED: uncharacterized protein LOC103329820 [Prunus mume]
Length=312

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 104/187 (56%), Gaps = 14/187 (7%)
 Frame = +3

Query  390  RRKG--FGRIRVAYQESAA--SEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLS  557
            RR+G    RIR   +E+    +  +  +YY +LG+  D++ ++IK+AY N  K  HPD++
Sbjct  34   RRQGSPASRIRCGKREAGEMLATSMGKNYYELLGVSVDSNAQKIKQAYRNLQKKYHPDVA  93

Query  558  GDDEETTNFCMFINEIYEILSDPVQRLVYD----EIHG-YAATAINPFFDDSSP--KDHV  716
            G  +E   + + +NE Y++L     R  YD    E+ G Y+++++      + P     +
Sbjct  94   G--QEGHEYTLKLNEAYKVLMRENLRKEYDASIGEMRGNYSSSSLGRTSSWNGPLRPQGL  151

Query  717  FVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSA  893
            FVDE +CIGC+ C +     F  +E  G ARV  Q G  E  I+ +++SCPV+CIHW   
Sbjct  152  FVDENACIGCRECVHHASSTFIFDEALGCARVKLQYGDDEQKIEVSVDSCPVNCIHWVEK  211

Query  894  AQLSLLE  914
             +L +LE
Sbjct  212  EELPVLE  218



>ref|XP_002298530.2| hypothetical protein POPTR_0001s35100g [Populus trichocarpa]
 gb|EEE83335.2| hypothetical protein POPTR_0001s35100g [Populus trichocarpa]
Length=299

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 91/179 (51%), Gaps = 13/179 (7%)
 Frame = +3

Query  411  IRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCM  590
            +R   +    S     +YY +LG+  D+S ++IK+AY    K  HPD++G   +   + +
Sbjct  38   VRCCDRRREGSARTKKNYYELLGVSVDSSTQKIKEAYRKLQKKYHPDIAG--HKGHEYAL  95

Query  591  FINEIYEILSDPVQRLVYDEIHGYAATAINP-----FFDDSSPK-----DHVFVDEFSCI  740
             +NE Y +L     R  YD   G+    I           SS K       +FVDE +CI
Sbjct  96   MLNEAYNVLMTDDLRTKYDASIGHMTVQIGKNNYVNVMGSSSWKGPLRPQALFVDENACI  155

Query  741  GCKNCANVCPKVFDIEEDFGRARVYSQSG-SGELIQQAIESCPVDCIHWTSAAQLSLLE  914
            GC+ C +     F ++E  G ARV +Q G   + I+ +IESCPV+CI+W    +L+LLE
Sbjct  156  GCRECVHHASNTFILDESIGCARVKTQYGDDDQKIEVSIESCPVNCIYWVDREELALLE  214



>ref|XP_008341428.1| PREDICTED: uncharacterized protein LOC103404310 isoform X1 [Malus 
domestica]
Length=304

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 97/183 (53%), Gaps = 15/183 (8%)
 Frame = +3

Query  402  FGRIRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTN  581
            + RIR   +E A       +YY +LG+  D++P++I++AY    K  HPD++G  +E   
Sbjct  30   WSRIRCK-KEGAEEMATGKNYYELLGVSVDSNPKKIRQAYRKLQKKYHPDVAG--QEGHE  86

Query  582  FCMFINEIYEILSDPVQRLVYD------EIHGYAA-----TAINPFFDDSSPKDHVFVDE  728
            + + +NE Y++L     R  YD       + G+ A     +++   ++       +FVDE
Sbjct  87   YTLKLNEAYKVLMRENLRKEYDASIGKVRVAGFRAGNTPSSSLGSSWNGPFRPQALFVDE  146

Query  729  FSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLS  905
             +CIGC+ C +     F  ++  G ARV  Q G  E  I+ +++SCPV+CIHW    +L 
Sbjct  147  NACIGCRECVHHASSTFMFDDALGCARVKVQYGDDEQKIEVSVDSCPVNCIHWVEKEELP  206

Query  906  LLE  914
            +LE
Sbjct  207  VLE  209



>ref|XP_006656965.1| PREDICTED: uncharacterized protein LOC102699516 [Oryza brachyantha]
Length=287

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 93/166 (56%), Gaps = 7/166 (4%)
 Frame = +3

Query  432  SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
            S A  +V +DYY  LG+  +++P++IK+AY    K  HPD++G   +  ++ + +NE Y+
Sbjct  29   STARGKVREDYYQALGVTVNSTPQEIKEAYRKLQKQHHPDIAG--YKGHDYTLLLNEAYK  86

Query  612  ILSDPVQRLVYDEI-HGYAATAI-NPFFDDSSP--KDHVFVDEFSCIGCKNCANVCPKVF  779
            +L    +    +    G+ +    N +   + P     +FVDE  CIGC+ C +   + F
Sbjct  87   VLMSSSRNANANASGRGFGSGFTGNGYSSWNGPVRSQALFVDENKCIGCRECVHHARETF  146

Query  780  DIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTSAAQLSLLE  914
             +++  G A V  Q G  E  IQ A++SCPV+CIHW  + +L++LE
Sbjct  147  AMDDVLGSAHVEVQFGDLEQQIQVAVDSCPVNCIHWVGSQELAVLE  192



>ref|XP_004142792.1| PREDICTED: uncharacterized protein LOC101222804 [Cucumis sativus]
 ref|XP_004156687.1| PREDICTED: uncharacterized LOC101222804 [Cucumis sativus]
 gb|KGN51371.1| hypothetical protein Csa_5G523160 [Cucumis sativus]
Length=301

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 92/176 (52%), Gaps = 17/176 (10%)
 Frame = +3

Query  387  GRRKGFGRIRVAYQESAASEEVAD-DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGD  563
            GRR+    IR +     ASE V + +YY +LG+  D++ ++IK+AY    K  HPD++G 
Sbjct  38   GRRQRLTSIRCS-----ASERVNEMNYYELLGVSADSNTQEIKEAYRKLQKKFHPDIAG-  91

Query  564  DEETTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPF--------FDDSSPKDHVF  719
             +E   + + +NE Y +L    +R  YD   G        F        ++       +F
Sbjct  92   -QEGHEYTLRLNEAYGVLMREDRRKQYDTYTGGMRVRFGNFGTGLGYSSWNGPLRPQALF  150

Query  720  VDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHW  884
            VD  +CIGC+ C +     F ++E  GRARV  Q G  +  IQ ++ESCPV+CI+W
Sbjct  151  VDGNACIGCRECVHNASNTFTMDETLGRARVKVQYGDNDKKIQVSVESCPVNCIYW  206



>gb|AFK44586.1| unknown [Lotus japonicus]
Length=301

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/245 (29%), Positives = 114/245 (47%), Gaps = 21/245 (9%)
 Frame = +3

Query  393   RKGFGRIRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEE  572
             R+    +R   + S       ++YY +LG+  D+   QIK+AY    K  HPD+ G  ++
Sbjct  32    RQNVTVVRCCNRRSWEKPRAQNNYYELLGVSVDSDTHQIKEAYRKLQKKYHPDIVG--QK  89

Query  573   TTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDH-----------VF  719
                + + +N+ YE+L    +R  YDE  G          ++S+P  +           +F
Sbjct  90    GHEYTLMLNKAYEVLMTEDRRRKYDESIGQMRLRFGE--NNSAPLGYSTWNGPLRPQALF  147

Query  720   VDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGS-GELIQQAIESCPVDCIHWTSAA  896
             VDE +CIGC+ C +     F ++E  G ARV  Q G   + I+ ++ESCPV+CIHW    
Sbjct  148   VDENACIGCRECLHHASHTFIMDEAVGCARVKVQYGDIDKNIEVSMESCPVNCIHWVETE  207

Query  897   QLSLLEDEMRRVERVNVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGS  1076
              L  LE  M+   +    +   G    S +VF  A +       ++ GQA  R  ++ G 
Sbjct  208   DLPTLEFLMQPQPKEGYGIFGGGWERPS-NVFTAAKS----FNKQLKGQATTRPYERTGG  262

Query  1077  DKSDS  1091
                +S
Sbjct  263   IDQES  267



>gb|KHG00215.1| Chaperone DnaJ [Gossypium arboreum]
Length=305

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 89/159 (56%), Gaps = 9/159 (6%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            +YY +LG+  D++ +QIK+AY    K  HPD++G  +E   + + +NE Y++L    QR 
Sbjct  58   NYYELLGIPFDSNMQQIKEAYRKLQKKYHPDIAG--QEGHEYTLMLNEAYKVLIKDDQRK  115

Query  639  VYD----EIHGYAATAINPFFDDSSP--KDHVFVDEFSCIGCKNCANVCPKVFDIEEDFG  800
             YD     +     + ++ F     P     +FVD  +CIGC+ C +     F+++E  G
Sbjct  116  EYDASIGSMKAKFGSNVSGFSSWKGPLRPQALFVDANNCIGCRECVHHASNTFEMDEALG  175

Query  801  RARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLE  914
             ARV  Q G  +  I  +++SCPV+CIHW  + +L++LE
Sbjct  176  CARVKVQYGDDDRKIDVSVDSCPVNCIHWVDSEELAVLE  214



>ref|XP_011047334.1| PREDICTED: uncharacterized protein LOC105141715 isoform X2 [Populus 
euphratica]
Length=299

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 92/179 (51%), Gaps = 13/179 (7%)
 Frame = +3

Query  411  IRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCM  590
            +R   +    S  +  +YY +LG+  D+S ++IK+AY    K  HPD++G  ++     +
Sbjct  38   VRCCDRRREGSARIKKNYYELLGVSVDSSNQKIKEAYRKLQKKYHPDIAG--QKGHEDAL  95

Query  591  FINEIYEILSDPVQRLVYDEIHGYAATAINP-----FFDDSSPK-----DHVFVDEFSCI  740
             +NE Y +L     R  YD   G+    I           SS K       +FVDE +CI
Sbjct  96   MLNEAYNVLMTDDLRTKYDASIGHMTVQIGKNNYVNVMGSSSWKGPLRPQALFVDENACI  155

Query  741  GCKNCANVCPKVFDIEEDFGRARVYSQSG-SGELIQQAIESCPVDCIHWTSAAQLSLLE  914
            GC+ C +     F ++E  G ARV +Q G   + I+ ++ESCPV+CI+W    +L+LLE
Sbjct  156  GCRECVHHASNTFILDESIGCARVKTQYGDDDQKIEVSVESCPVNCIYWVDREELALLE  214



>ref|XP_011047333.1| PREDICTED: uncharacterized protein LOC105141715 isoform X1 [Populus 
euphratica]
Length=301

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 92/179 (51%), Gaps = 13/179 (7%)
 Frame = +3

Query  411  IRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCM  590
            +R   +    S  +  +YY +LG+  D+S ++IK+AY    K  HPD++G  ++     +
Sbjct  40   VRCCDRRREGSARIKKNYYELLGVSVDSSNQKIKEAYRKLQKKYHPDIAG--QKGHEDAL  97

Query  591  FINEIYEILSDPVQRLVYDEIHGYAATAINP-----FFDDSSPK-----DHVFVDEFSCI  740
             +NE Y +L     R  YD   G+    I           SS K       +FVDE +CI
Sbjct  98   MLNEAYNVLMTDDLRTKYDASIGHMTVQIGKNNYVNVMGSSSWKGPLRPQALFVDENACI  157

Query  741  GCKNCANVCPKVFDIEEDFGRARVYSQSG-SGELIQQAIESCPVDCIHWTSAAQLSLLE  914
            GC+ C +     F ++E  G ARV +Q G   + I+ ++ESCPV+CI+W    +L+LLE
Sbjct  158  GCRECVHHASNTFILDESIGCARVKTQYGDDDQKIEVSVESCPVNCIYWVDREELALLE  216



>ref|XP_008368418.1| PREDICTED: uncharacterized protein LOC103432030 isoform X2 [Malus 
domestica]
Length=305

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 101/190 (53%), Gaps = 21/190 (11%)
 Frame = +3

Query  393  RKGFGRIRVAYQESAASEEVAD----DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSG  560
            +K   RIR    +   +EE+A     +YY +LG+  D++P++I++AY    K  HPD++G
Sbjct  26   KKPIWRIRC---KKEGAEEMATXKNYNYYELLGVSXDSNPKKIRQAYRKLQKKYHPDVAG  82

Query  561  DDEETTNFCMFINEIYEILSDPVQRLVYD------EIHGYAA-----TAINPFFDDSSPK  707
              +E   + + +NE Y++L     R  YD       + G+ A     +++   ++     
Sbjct  83   --QEGHEYTLKLNEAYKVLMRENLRKEYDASIGKVRVAGFRAGNTPSSSLGSSWNGPFRP  140

Query  708  DHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHW  884
              +FVDE +CIGC+ C +     F  ++  G ARV  Q G  E  I+ +++SCPV+CIHW
Sbjct  141  QALFVDENACIGCRECVHHASSTFMFDDALGCARVKVQYGDDEQKIEVSVDSCPVNCIHW  200

Query  885  TSAAQLSLLE  914
                +L +LE
Sbjct  201  VEKEELPVLE  210



>ref|XP_010033304.1| PREDICTED: uncharacterized protein LOC104422627 isoform X1 [Eucalyptus 
grandis]
Length=306

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 94/186 (51%), Gaps = 17/186 (9%)
 Frame = +3

Query  393  RKGFGRIRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEE  572
            R+ +G +      +  S     +YY +LG+  D+S  +I++AY    K  HPD++G  ++
Sbjct  34   RQRYGVVTCCGGRAKRSFRSEKNYYELLGVSADSSSREIREAYRKLQKKHHPDVAG--QK  91

Query  573  TTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDH-----------VF  719
               + + +NE Y +L     R  YD I G A T    F  D S   +           +F
Sbjct  92   GHEYTLLLNEAYAVLMRDNLRRDYDAITGQARTR---FRGDCSNIGYSSWKGPLRSQALF  148

Query  720  VDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAA  896
            VD  +CIGC+ C +     F ++E+ G A+V  Q G  E  +Q ++ESCPV+CI+W    
Sbjct  149  VDANACIGCRECVHHSSNTFVMDEELGCAKVRVQYGDDEQKLQVSVESCPVNCIYWVERE  208

Query  897  QLSLLE  914
            +L LLE
Sbjct  209  ELGLLE  214



>ref|XP_010033306.1| PREDICTED: uncharacterized protein LOC104422627 isoform X2 [Eucalyptus 
grandis]
 gb|KCW52916.1| hypothetical protein EUGRSUZ_J02231 [Eucalyptus grandis]
Length=304

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 94/186 (51%), Gaps = 17/186 (9%)
 Frame = +3

Query  393  RKGFGRIRVAYQESAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEE  572
            R+ +G +      +  S     +YY +LG+  D+S  +I++AY    K  HPD++G  ++
Sbjct  32   RQRYGVVTCCGGRAKRSFRSEKNYYELLGVSADSSSREIREAYRKLQKKHHPDVAG--QK  89

Query  573  TTNFCMFINEIYEILSDPVQRLVYDEIHGYAATAINPFFDDSSPKDH-----------VF  719
               + + +NE Y +L     R  YD I G A T    F  D S   +           +F
Sbjct  90   GHEYTLLLNEAYAVLMRDNLRRDYDAITGQARTR---FRGDCSNIGYSSWKGPLRSQALF  146

Query  720  VDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAA  896
            VD  +CIGC+ C +     F ++E+ G A+V  Q G  E  +Q ++ESCPV+CI+W    
Sbjct  147  VDANACIGCRECVHHSSNTFVMDEELGCAKVRVQYGDDEQKLQVSVESCPVNCIYWVERE  206

Query  897  QLSLLE  914
            +L LLE
Sbjct  207  ELGLLE  212



>ref|XP_009377190.1| PREDICTED: uncharacterized protein LOC103965824 isoform X2 [Pyrus 
x bretschneideri]
Length=303

 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 110/222 (50%), Gaps = 21/222 (9%)
 Frame = +3

Query  459   DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
             +YY +LG+  D++P++I++AY    K  HPD++G  +E   + + +NE Y++L     R 
Sbjct  47    NYYELLGVSADSNPKKIRQAYRKLQKKYHPDVAG--QEGHEYTLKLNEAYKVLMRENLRK  104

Query  639   VYD------EIHGYAA-----TAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
              YD       + G+ A     +++   ++       +FVDE +CIGC+ C +     F  
Sbjct  105   EYDASIGKVRVAGFRAGNTPSSSLGSSWNGPFRPQALFVDENACIGCRECVHHASSTFMF  164

Query  786   EEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLS  962
             ++  G ARV  Q G  E  I+ +++SCPV+CIHW    +L +LE  + + +      +  
Sbjct  165   DDALGCARVKVQYGDDEQKIEVSVDSCPVNCIHWVEKEELPVLEF-LSQPQPTEGYGIFG  223

Query  963   GMGAASIDVFRMAST------RWEKRQAKVLGQAKVRMTKQK  1070
             G      +VF  A +      RW++       Q K R T ++
Sbjct  224   GGWERPANVFMAAKSYNKQQQRWQEEAENENNQRKSRATAEE  265



>ref|XP_009377189.1| PREDICTED: uncharacterized protein LOC103965824 isoform X1 [Pyrus 
x bretschneideri]
Length=304

 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 90/164 (55%), Gaps = 14/164 (9%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            +YY +LG+  D++P++I++AY    K  HPD++G  +E   + + +NE Y++L     R 
Sbjct  48   NYYELLGVSADSNPKKIRQAYRKLQKKYHPDVAG--QEGHEYTLKLNEAYKVLMRENLRK  105

Query  639  VYD------EIHGYAA-----TAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDI  785
             YD       + G+ A     +++   ++       +FVDE +CIGC+ C +     F  
Sbjct  106  EYDASIGKVRVAGFRAGNTPSSSLGSSWNGPFRPQALFVDENACIGCRECVHHASSTFMF  165

Query  786  EEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLE  914
            ++  G ARV  Q G  E  I+ +++SCPV+CIHW    +L +LE
Sbjct  166  DDALGCARVKVQYGDDEQKIEVSVDSCPVNCIHWVEKEELPVLE  209



>ref|WP_007306952.1| ferredoxin [Crocosphaera watsonii]
 gb|EAM49317.1| similar to Ferredoxin [Crocosphaera watsonii WH 8501]
 gb|EHJ11174.1| Ferredoxin [Crocosphaera watsonii WH 0003]
 emb|CCQ60135.1| Ferredoxin [Crocosphaera watsonii WH 0401]
 emb|CCQ51552.1| Ferredoxin [Crocosphaera watsonii WH 8502]
 emb|CCQ55419.1| Ferredoxin [Crocosphaera watsonii WH 0005]
 emb|CCQ65461.1| Ferredoxin [Crocosphaera watsonii WH 0402]
Length=144

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +3

Query  669  TAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQ  845
            T   P       +  V+VDE +CIGCKNC +  P  F +EE++GRARVY+Q G  E  IQ
Sbjct  28   TGFEPELGGQLRQKGVYVDELTCIGCKNCVHFAPNTFYVEENYGRARVYNQDGDEEDTIQ  87

Query  846  QAIESCPVDCIHWTSAAQLSLLED  917
            +AI++CPVDCIHW    +L  LED
Sbjct  88   EAIDTCPVDCIHWVDYTELEELED  111



>gb|KDP45321.1| hypothetical protein JCGZ_09570 [Jatropha curcas]
Length=297

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 88/169 (52%), Gaps = 11/169 (7%)
 Frame = +3

Query  435  AASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEI  614
            A S  +  +YY +LG+  D+  ++IK+AY    K  HPD++G  ++     + +NE Y++
Sbjct  42   AESARIEKNYYELLGVSVDSDSKEIKEAYRRLQKKYHPDIAG--QKGHECTLMLNEAYKV  99

Query  615  LSDPVQRLVYDEIHGYAATA------INPFFDDSSPKDH--VFVDEFSCIGCKNCANVCP  770
            L     R  YD   G           +  F     P  H  +FVDE +C+GC+ C +   
Sbjct  100  LMREDLRRKYDISIGQLRMGTGRNNNVMGFSSWKGPVRHQALFVDENACVGCRECVHHAS  159

Query  771  KVFDIEEDFGRARVYSQSG-SGELIQQAIESCPVDCIHWTSAAQLSLLE  914
              F ++E  G ARV  Q G   E IQ +++SCPV+CIHW    +L++LE
Sbjct  160  NTFSMDEAHGCARVKVQFGDDDEKIQVSVDSCPVNCIHWVDKEELTVLE  208



>ref|XP_008368417.1| PREDICTED: uncharacterized protein LOC103432030 isoform X1 [Malus 
domestica]
Length=306

 Score = 96.7 bits (239),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 100/187 (53%), Gaps = 21/187 (11%)
 Frame = +3

Query  402  FGRIRVAYQESAASEEVAD----DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDE  569
            + RIR    +   +EE+A     +YY +LG+  D++P++I++AY    K  HPD++G  +
Sbjct  30   WSRIRC---KKEGAEEMATXKNYNYYELLGVSXDSNPKKIRQAYRKLQKKYHPDVAG--Q  84

Query  570  ETTNFCMFINEIYEILSDPVQRLVYD------EIHGYAA-----TAINPFFDDSSPKDHV  716
            E   + + +NE Y++L     R  YD       + G+ A     +++   ++       +
Sbjct  85   EGHEYTLKLNEAYKVLMRENLRKEYDASIGKVRVAGFRAGNTPSSSLGSSWNGPFRPQAL  144

Query  717  FVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSA  893
            FVDE +CIGC+ C +     F  ++  G ARV  Q G  E  I+ +++SCPV+CIHW   
Sbjct  145  FVDENACIGCRECVHHASSTFMFDDALGCARVKVQYGDDEQKIEVSVDSCPVNCIHWVEK  204

Query  894  AQLSLLE  914
             +L +LE
Sbjct  205  EELPVLE  211



>ref|WP_017300659.1| hypothetical protein [Nodosilinea nodulosa]
Length=156

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 52/129 (40%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = +3

Query  669   TAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSG-SGELIQ  845
             T   P       +  V+VDE +CIGCK+CA+V    F IE D+GR+RVY Q G S +LIQ
Sbjct  28    TGFEPELGGQLRQKGVYVDELTCIGCKHCAHVARNTFYIEPDYGRSRVYRQDGDSQDLIQ  87

Query  846   QAIESCPVDCIHWTSAAQLSLLEDEMRRVERVNVALMLSGMGA-ASIDVFRMASTRWEKR  1022
             +AI++CPVDCIHW    +L  LE      +R +  + ++G     ++   RM   R  KR
Sbjct  88    EAIDTCPVDCIHWIDYTELKQLER-----DRKHQVIPVAGFPVDKAMSTLRM---RKAKR  139

Query  1023  QAKVLGQAK  1049
             Q+++ GQ +
Sbjct  140   QSQIQGQTQ  148



>gb|EEC80606.1| hypothetical protein OsI_22964 [Oryza sativa Indica Group]
Length=378

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 91/165 (55%), Gaps = 6/165 (4%)
 Frame = +3

Query  432  SAASEEVADDYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYE  611
            S    +  +DYY VLG+  +++P++IK+AY    K  HPD++G   +  ++ + +NE Y+
Sbjct  120  STTRGKAREDYYQVLGVTVNSTPQEIKEAYRKLQKRHHPDIAG--YKGHDYTLLLNEAYK  177

Query  612  IL-SDPVQRLVYDEIHGYAATAINPFFDDSSP-KDH-VFVDEFSCIGCKNCANVCPKVFD  782
            +L  +  +               N +   + P + H +FVDE  CIGC+ C +   + F 
Sbjct  178  VLMRNSPRNACASGRGFGRGFTGNGYSCWNGPVRSHALFVDENKCIGCRECVHHAGETFA  237

Query  783  IEEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLE  914
            +++  G A V  Q G  E  IQ A+ESCPV+CIHW  + +L++LE
Sbjct  238  MDDVLGSAHVEVQFGDQEQKIQVAVESCPVNCIHWVMSEELAVLE  282



>emb|CDP02083.1| unnamed protein product [Coffea canephora]
Length=259

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 89/164 (54%), Gaps = 17/164 (10%)
 Frame = +3

Query  459  DYYAVLGLLPDASPEQIKKAYYNCMKACHPDLSGDDEETTNFCMFINEIYEILSDPVQRL  638
            +YY +LG+  D++ +QIK+AY    K  HPD++G  ++  +  + +NE Y++L     R 
Sbjct  57   NYYTLLGVSIDSTSQQIKEAYRKLQKKYHPDIAG--QKGHDRALLMNEAYKVLMSRDMRR  114

Query  639  VYDEIHGYAATAINPFFDDSSPKDH-----------VFVDEFSCIGCKNCANVCPKVFDI  785
             Y+   G+     N F  D+S  D+           +FVD+ +CIGC+ C       F +
Sbjct  115  QYNASIGWFQ---NSFGKDASGVDYSVWNGPLRPQALFVDQNACIGCRECVYHARNTFTM  171

Query  786  EEDFGRARVYSQSGSGEL-IQQAIESCPVDCIHWTSAAQLSLLE  914
            +E  G ARV  Q G  E  IQ +++ CPV+CI+W  A +L +LE
Sbjct  172  DESLGCARVKVQYGDDETEIQVSVDLCPVNCIYWVDAEELQVLE  215



>ref|XP_008666436.1| PREDICTED: uncharacterized protein LOC103645090 [Zea mays]
Length=196

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 72/130 (55%), Gaps = 25/130 (19%)
 Frame = +3

Query  741   GCKNCANVCPKVFDIEEDFGRARVYSQSGSGELIQQAIESCPVDCIHWTSAAQLSLLEDE  920
             GCKNCANVC KVF IE+DFGRARVY QSGS ELIQ+AI+S    C+   S   + L+E  
Sbjct  85    GCKNCANVCSKVFQIEDDFGRARVYDQSGSTELIQEAIDSWYQSCLL-GSFQTVELIETF  143

Query  921   MRRVERVNVALMLSGMGAASIDVFRMASTRWEKRQAKVLGQAKVRMTKQKGSDKSDSYWD  1100
             M                         AS+RWEKRQAKVL + + RM+ Q  S K  S W 
Sbjct  144   MN----------------------YQASSRWEKRQAKVLEKVRRRMS-QDDSRKGGS-WS  179

Query  1101  YLWAKPRDYQ  1130
              +W  P  Y+
Sbjct  180   DIWGAPTRYE  189



>ref|WP_015223402.1| ferredoxin [Cyanobacterium stanieri]
 ref|YP_007165736.1| ferredoxin [Cyanobacterium stanieri PCC 7202]
 gb|AFZ48087.1| ferredoxin [Cyanobacterium stanieri PCC 7202]
Length=136

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/90 (46%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = +3

Query  669  TAINPFFDDSSPKDHVFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQ  845
            T   P       +  V+VDE +CIGCKNC +V P  F IE++FGR+RVY+Q+G  E ++Q
Sbjct  28   TGFEPELGGHVRQKGVYVDEVTCIGCKNCVHVAPNTFYIEDNFGRSRVYNQNGDEEDIVQ  87

Query  846  QAIESCPVDCIHWTSAAQLSLLEDEMRRVE  935
            +AI++CPVDCIHW    ++   E+E +  E
Sbjct  88   EAIDTCPVDCIHWLDYTEVRQKEEERKNQE  117



>ref|WP_017288848.1| hypothetical protein [Leptolyngbya boryana]
Length=159

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +3

Query  714  VFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSG-ELIQQAIESCPVDCIHWTS  890
            V+VDE +CIGCK+CA+V    F IE D+GR+RV  Q G   ELIQ+AIE+CPVDCIHW +
Sbjct  54   VYVDEITCIGCKHCAHVARNTFYIEPDYGRSRVIRQDGDAEELIQEAIETCPVDCIHWVN  113

Query  891  AAQLSLLEDEMRRVERVNVA  950
             A+L  LE+E R+ + + VA
Sbjct  114  YAELKRLEEE-RKYQVIPVA  132



>ref|WP_010873983.1| ferredoxin [Synechocystis sp. PCC 6803]
 ref|NP_442688.1| ferredoxin [Synechocystis sp. PCC 6803]
 ref|YP_005384557.1| bacterial type ferredoxin family protein [Synechocystis sp. PCC 
6803 substr. GT-I]
 ref|YP_005387726.1| bacterial type ferredoxin family protein [Synechocystis sp. PCC 
6803 substr. PCC-P]
 ref|YP_005410433.1| bacterial type ferredoxin family protein [Synechocystis sp. PCC 
6803 substr. PCC-N]
 ref|YP_005652749.1| bacterial type ferredoxin family protein [Synechocystis sp. PCC 
6803]
 ref|YP_007452564.1| ferredoxin (bacterial type ferredoxin family) [Synechocystis 
sp. PCC 6803]
 dbj|BAA10759.1| ferredoxin (bacterial type ferredoxin family) [Synechocystis 
sp. PCC 6803]
 dbj|BAK51544.1| bacterial type ferredoxin family protein [Synechocystis sp. PCC 
6803]
 dbj|BAL30542.1| bacterial type ferredoxin family protein [Synechocystis sp. PCC 
6803 substr. GT-I]
 dbj|BAL33711.1| bacterial type ferredoxin family protein [Synechocystis sp. PCC 
6803 substr. PCC-N]
 dbj|BAL36880.1| bacterial type ferredoxin family protein [Synechocystis sp. PCC 
6803 substr. PCC-P]
 dbj|BAM53645.1| ferredoxin [Synechocystis sp. PCC 6803]
 gb|AGF53050.1| ferredoxin (bacterial type ferredoxin family) [Synechocystis 
sp. PCC 6803]
Length=133

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  714  VFVDEFSCIGCKNCANVCPKVFDIEEDFGRARVYSQSGSGE-LIQQAIESCPVDCIHWTS  890
            V+VDE +CIGCKNCA+V P  F IE++ GR+R +SQ+G  E +IQ+AI++CPVDCIHW  
Sbjct  46   VYVDEVTCIGCKNCAHVAPNTFTIEQEHGRSRAFSQNGDDEAVIQEAIDTCPVDCIHWVP  105

Query  891  AAQLSLLEDEMR  926
              +L  LE++ +
Sbjct  106  YDELKHLEEKRK  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4065968517228