BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2005_g1_i1 len=1009 path=[1:0-959 961:960-1008]

Length=1009
                                                                      Score     E

ref|XP_002522718.1|  conserved hypothetical protein                     226   2e-68   Ricinus communis
ref|XP_002277051.1|  PREDICTED: uncharacterized protein LOC100263170    223   4e-67   Vitis vinifera
ref|XP_009353217.1|  PREDICTED: universal stress protein A-like p...    217   3e-65   
ref|XP_008455370.1|  PREDICTED: uncharacterized protein C167.05 i...    218   4e-65   
ref|XP_008455371.1|  PREDICTED: uncharacterized protein C167.05 i...    217   1e-64   
ref|XP_004144481.1|  PREDICTED: uncharacterized protein C167.05-like    217   1e-64   
ref|XP_009629258.1|  PREDICTED: uncharacterized protein LOC104119...    217   1e-64   
ref|XP_009629257.1|  PREDICTED: uncharacterized protein LOC104119...    217   1e-64   
ref|XP_004159196.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    217   1e-64   
emb|CAN75054.1|  hypothetical protein VITISV_039450                     217   2e-64   Vitis vinifera
ref|XP_011095276.1|  PREDICTED: uncharacterized protein LOC105174785    215   3e-64   
ref|XP_008455372.1|  PREDICTED: uncharacterized protein C167.05 i...    215   4e-64   
ref|XP_009350375.1|  PREDICTED: uncharacterized protein C167.05-like    214   4e-64   
ref|XP_009629260.1|  PREDICTED: uncharacterized protein LOC104119...    214   4e-64   
gb|AFS65005.1|  universal stress protein                                213   9e-64   
ref|XP_009608133.1|  PREDICTED: uncharacterized protein LOC104102188    212   2e-63   
ref|XP_009629259.1|  PREDICTED: uncharacterized protein LOC104119...    212   3e-63   
ref|XP_009768401.1|  PREDICTED: uncharacterized protein LOC104219407    212   6e-63   
ref|XP_011096180.1|  PREDICTED: universal stress protein A-like p...    211   7e-63   
dbj|BAJ94495.1|  predicted protein                                      212   7e-63   
ref|XP_004232777.1|  PREDICTED: uncharacterized protein LOC101247579    211   8e-63   
ref|XP_008341946.1|  PREDICTED: uncharacterized protein C167.05-like    211   1e-62   
ref|XP_010247876.1|  PREDICTED: uncharacterized protein LOC104590...    211   1e-62   
gb|EYU27879.1|  hypothetical protein MIMGU_mgv1a012682mg                211   1e-62   
ref|XP_009419600.1|  PREDICTED: uncharacterized protein LOC103999...    211   1e-62   
ref|XP_010247877.1|  PREDICTED: uncharacterized protein LOC104590...    210   2e-62   
ref|XP_009419601.1|  PREDICTED: uncharacterized protein LOC103999...    210   2e-62   
gb|AID16047.1|  putative universal stress protein                       211   4e-62   
ref|XP_007149923.1|  hypothetical protein PHAVU_005G110500g             209   4e-62   
ref|XP_006347162.1|  PREDICTED: uncharacterized protein C167.05-like    208   7e-62   
ref|XP_006833097.1|  hypothetical protein AMTR_s00072p00034700          209   7e-62   
emb|CDO99659.1|  unnamed protein product                                208   1e-61   
ref|XP_009773853.1|  PREDICTED: uncharacterized protein LOC104224...    207   4e-61   
ref|XP_009773854.1|  PREDICTED: uncharacterized protein LOC104224...    207   4e-61   
emb|CDP11872.1|  unnamed protein product                                207   5e-61   
ref|XP_004248282.1|  PREDICTED: uncharacterized protein LOC101247371    207   6e-61   
ref|XP_009597385.1|  PREDICTED: uncharacterized protein LOC104093...    206   8e-61   
ref|XP_009597384.1|  PREDICTED: uncharacterized protein LOC104093...    206   9e-61   
ref|XP_006362927.1|  PREDICTED: uncharacterized protein C167.05-l...    206   9e-61   
gb|KHG28425.1|  Uncharacterized protein F383_15197                      206   1e-60   
ref|XP_004243417.1|  PREDICTED: universal stress protein A-like p...    205   1e-60   
ref|XP_008813303.1|  PREDICTED: uncharacterized protein LOC103723977    206   1e-60   
gb|KDP44611.1|  hypothetical protein JCGZ_19753                         206   1e-60   
ref|XP_010924024.1|  PREDICTED: uncharacterized protein LOC105046969    206   2e-60   
ref|NP_001044454.1|  Os01g0783500                                       206   2e-60   Oryza sativa Japonica Group [Japonica rice]
gb|EYU19169.1|  hypothetical protein MIMGU_mgv1a011259mg                207   2e-60   
gb|EEC71603.1|  hypothetical protein OsI_04001                          208   2e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_010268920.1|  PREDICTED: uncharacterized protein LOC104605731    205   2e-60   
ref|XP_008348125.1|  PREDICTED: uncharacterized protein LOC103411258    204   2e-60   
ref|XP_010931886.1|  PREDICTED: universal stress protein A-like p...    205   2e-60   
ref|XP_003597072.1|  hypothetical protein MTR_2g089350                  204   2e-60   
emb|CDM84442.1|  unnamed protein product                                206   3e-60   
ref|XP_006362926.1|  PREDICTED: uncharacterized protein C167.05-l...    205   3e-60   
ref|XP_009385068.1|  PREDICTED: uncharacterized protein LOC103972450    205   3e-60   
gb|EAZ13771.1|  hypothetical protein OsJ_03696                          206   3e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004487352.1|  PREDICTED: uncharacterized protein C167.05-like    204   4e-60   
ref|XP_010927720.1|  PREDICTED: uncharacterized protein LOC105049...    205   4e-60   
ref|XP_010095865.1|  hypothetical protein L484_022222                   205   7e-60   
ref|XP_006417363.1|  hypothetical protein EUTSA_v10008352mg             205   8e-60   
ref|XP_009148466.1|  PREDICTED: uncharacterized protein C167.05 i...    204   8e-60   
ref|XP_009402599.1|  PREDICTED: uncharacterized protein LOC103986...    203   9e-60   
emb|CDX97953.1|  BnaA06g07040D                                          204   1e-59   
ref|XP_009148467.1|  PREDICTED: uncharacterized protein C167.05 i...    203   1e-59   
ref|XP_010035643.1|  PREDICTED: uncharacterized protein LOC104424...    202   2e-59   
ref|XP_009402598.1|  PREDICTED: uncharacterized protein LOC103986...    202   2e-59   
ref|XP_009402600.1|  PREDICTED: uncharacterized protein LOC103986...    202   2e-59   
ref|XP_010927714.1|  PREDICTED: uncharacterized protein LOC105049...    204   2e-59   
ref|XP_008371242.1|  PREDICTED: uncharacterized protein C167.05-like    202   3e-59   
ref|XP_009372543.1|  PREDICTED: universal stress protein A-like p...    202   3e-59   
ref|XP_006360529.1|  PREDICTED: universal stress protein A-like p...    201   3e-59   
ref|XP_010547129.1|  PREDICTED: universal stress protein A-like p...    202   4e-59   
ref|XP_010035642.1|  PREDICTED: uncharacterized protein LOC104424...    201   4e-59   
ref|NP_563888.2|  adenine nucleotide alpha hydrolases-like protein      201   5e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008383973.1|  PREDICTED: uncharacterized protein C167.05-like    201   7e-59   
ref|XP_004244178.1|  PREDICTED: uncharacterized protein LOC101265561    201   8e-59   
ref|XP_010533858.1|  PREDICTED: universal stress protein A-like p...    201   1e-58   
ref|XP_004295362.1|  PREDICTED: uncharacterized protein LOC101303312    201   1e-58   
ref|XP_003540330.1|  PREDICTED: uncharacterized protein C167.05-like    200   1e-58   
ref|XP_008788982.1|  PREDICTED: uncharacterized protein LOC103706610    202   1e-58   
ref|XP_006360120.1|  PREDICTED: uncharacterized protein C167.05-like    200   1e-58   
gb|AID16046.1|  putative universal stress protein                       201   2e-58   
ref|NP_001159067.1|  USP family protein                                 201   2e-58   Zea mays [maize]
ref|XP_008793627.1|  PREDICTED: uncharacterized protein LOC103709881    201   2e-58   
ref|XP_003562944.1|  PREDICTED: uncharacterized protein LOC100824886    201   2e-58   
ref|XP_007043417.1|  Adenine nucleotide alpha hydrolases-like sup...    201   2e-58   
ref|XP_006657818.1|  PREDICTED: uncharacterized protein C167.05-like    199   2e-58   
ref|NP_001151050.1|  LOC100284683                                       201   2e-58   Zea mays [maize]
ref|XP_011043331.1|  PREDICTED: uncharacterized protein LOC105138...    199   3e-58   
ref|XP_011043334.1|  PREDICTED: uncharacterized protein LOC105138...    199   3e-58   
ref|XP_011043333.1|  PREDICTED: uncharacterized protein LOC105138...    199   3e-58   
gb|AFW84883.1|  USP family protein                                      200   3e-58   
ref|XP_011013955.1|  PREDICTED: uncharacterized protein LOC105117...    199   3e-58   
ref|XP_003564362.1|  PREDICTED: uncharacterized protein LOC100824166    200   3e-58   
ref|XP_011013952.1|  PREDICTED: uncharacterized protein LOC105117...    199   3e-58   
ref|XP_011043332.1|  PREDICTED: uncharacterized protein LOC105138...    199   4e-58   
ref|XP_007043418.1|  Adenine nucleotide alpha hydrolases-like sup...    200   4e-58   
ref|XP_011013953.1|  PREDICTED: uncharacterized protein LOC105117...    199   4e-58   
ref|XP_004957966.1|  PREDICTED: uncharacterized protein C167.05-like    200   4e-58   
ref|XP_006655460.1|  PREDICTED: uncharacterized protein C167.05-like    198   4e-58   
ref|XP_002892640.1|  predicted protein                                  200   4e-58   
ref|XP_011013956.1|  PREDICTED: uncharacterized protein LOC105117...    199   4e-58   
ref|XP_011013954.1|  PREDICTED: uncharacterized protein LOC105117...    199   5e-58   
ref|XP_003543370.1|  PREDICTED: uncharacterized protein C167.05         199   5e-58   
ref|XP_010907383.1|  PREDICTED: uncharacterized protein LOC105034060    199   6e-58   
ref|XP_007043416.1|  Adenine nucleotide alpha hydrolases-like sup...    199   7e-58   
ref|XP_009420770.1|  PREDICTED: uncharacterized protein LOC104000446    199   7e-58   
ref|XP_006646395.1|  PREDICTED: uncharacterized protein LOC102711036    199   9e-58   
emb|CDY19360.1|  BnaC05g08690D                                          201   1e-57   
ref|NP_001149193.1|  USP family protein                                 199   1e-57   Zea mays [maize]
ref|XP_007043419.1|  Adenine nucleotide alpha hydrolases-like sup...    200   1e-57   
ref|XP_010458526.1|  PREDICTED: uncharacterized protein C167.05-like    197   1e-57   
gb|EPS70507.1|  hypothetical protein M569_04246                         197   2e-57   
ref|XP_006343271.1|  PREDICTED: uncharacterized protein C167.05-l...    197   2e-57   
ref|XP_004970198.1|  PREDICTED: uncharacterized protein LOC101764...    197   3e-57   
dbj|BAK02323.1|  predicted protein                                      197   3e-57   
ref|XP_002316672.2|  hypothetical protein POPTR_0011s03970g             197   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004970197.1|  PREDICTED: uncharacterized protein LOC101764...    197   3e-57   
ref|XP_008803866.1|  PREDICTED: uncharacterized protein C167.05-like    197   4e-57   
ref|NP_001131438.1|  uncharacterized protein LOC100192770               196   6e-57   Zea mays [maize]
gb|AID16052.1|  putative universal stress protein                       194   6e-57   
tpg|DAA63063.1|  TPA: USP family protein isoform 1                      197   7e-57   
ref|XP_006343270.1|  PREDICTED: uncharacterized protein C167.05-l...    196   8e-57   
ref|XP_002316938.2|  hypothetical protein POPTR_0011s12800g             197   8e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004234137.1|  PREDICTED: universal stress protein A-like p...    196   8e-57   
tpg|DAA57347.1|  TPA: hypothetical protein ZEAMMB73_028214              196   1e-56   
ref|XP_008224913.1|  PREDICTED: uncharacterized protein C167.05         195   2e-56   
ref|XP_002458609.1|  hypothetical protein SORBIDRAFT_03g036580          196   2e-56   Sorghum bicolor [broomcorn]
gb|EMS67287.1|  hypothetical protein TRIUR3_25325                       197   2e-56   
ref|XP_011029385.1|  PREDICTED: uncharacterized protein LOC105129141    195   2e-56   
ref|XP_009616176.1|  PREDICTED: uncharacterized protein LOC104108761    195   2e-56   
ref|XP_008651511.1|  PREDICTED: LOC100284683 isoform X1                 196   2e-56   
ref|XP_007211971.1|  hypothetical protein PRUPE_ppa010857mg             194   2e-56   
ref|XP_006303262.1|  hypothetical protein CARUB_v10009983mg             195   2e-56   
ref|XP_006303261.1|  hypothetical protein CARUB_v10009983mg             196   3e-56   
ref|XP_010694460.1|  PREDICTED: uncharacterized protein LOC104907253    195   3e-56   
ref|XP_010646368.1|  PREDICTED: uncharacterized protein LOC100855106    194   4e-56   
ref|XP_006303263.1|  hypothetical protein CARUB_v10009983mg             195   4e-56   
gb|AAF16649.1|AC011661_27  T23J18.3                                     206   4e-56   Arabidopsis thaliana [mouse-ear cress]
gb|EMT17863.1|  hypothetical protein F775_30320                         196   5e-56   
emb|CDP05842.1|  unnamed protein product                                193   7e-56   
ref|XP_010476057.1|  PREDICTED: uncharacterized protein C167.05-like    192   2e-55   
gb|KHG08960.1|  Uncharacterized protein F383_12625                      192   3e-55   
ref|XP_006449181.1|  hypothetical protein CICLE_v10016399mg             192   3e-55   
ref|XP_010492698.1|  PREDICTED: uncharacterized protein C167.05-like    191   4e-55   
ref|XP_009767748.1|  PREDICTED: uncharacterized protein LOC104218860    191   4e-55   
gb|KDP20859.1|  hypothetical protein JCGZ_21330                         191   4e-55   
ref|XP_006467927.1|  PREDICTED: uncharacterized protein C167.05-like    191   5e-55   
ref|XP_006449182.1|  hypothetical protein CICLE_v10016399mg             190   1e-54   
gb|KDO75672.1|  hypothetical protein CISIN_1g0258351mg                  190   2e-54   
ref|XP_007025856.1|  Adenine nucleotide alpha hydrolases-like sup...    190   2e-54   
ref|XP_010057709.1|  PREDICTED: uncharacterized protein LOC104445502    189   2e-54   
gb|ABK21186.1|  unknown                                                 188   2e-54   Picea sitchensis
ref|XP_007021228.1|  Adenine nucleotide alpha hydrolases-like sup...    188   4e-54   
ref|NP_001055972.1|  Os05g0501700                                       189   7e-54   Oryza sativa Japonica Group [Japonica rice]
gb|ABK22111.1|  unknown                                                 188   8e-54   Picea sitchensis
ref|XP_003568163.1|  PREDICTED: uncharacterized protein LOC100823570    188   1e-53   
ref|XP_002462993.1|  hypothetical protein SORBIDRAFT_02g035950          188   1e-53   Sorghum bicolor [broomcorn]
ref|XP_011048505.1|  PREDICTED: uncharacterized protein LOC105142...    187   2e-53   
gb|EAY98599.1|  hypothetical protein OsI_20515                          188   2e-53   Oryza sativa Indica Group [Indian rice]
ref|NP_001059943.1|  Os07g0551400                                       187   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011048507.1|  PREDICTED: uncharacterized protein LOC105142...    187   3e-53   
ref|XP_010106722.1|  hypothetical protein L484_004891                   186   3e-53   
ref|XP_004961595.1|  PREDICTED: uncharacterized protein LOC101784949    187   3e-53   
gb|KDP38967.1|  hypothetical protein JCGZ_00724                         186   5e-53   
gb|EAZ04279.1|  hypothetical protein OsI_26421                          186   7e-53   Oryza sativa Indica Group [Indian rice]
dbj|BAC65369.1|  CHP-rich zinc finger protein-like                      186   8e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002326102.1|  hypothetical protein POPTR_0019s14190g             186   9e-53   Populus trichocarpa [western balsam poplar]
ref|XP_002987442.1|  hypothetical protein SELMODRAFT_48206              182   1e-52   
ref|XP_009418754.1|  PREDICTED: uncharacterized protein LOC103998872    186   1e-52   
ref|XP_006447353.1|  hypothetical protein CICLE_v10016651mg             184   2e-52   
gb|EEE67375.1|  hypothetical protein OsJ_24676                          186   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002980050.1|  hypothetical protein SELMODRAFT_58286              181   3e-52   
ref|XP_002319393.2|  hypothetical protein POPTR_0013s14650g             184   4e-52   Populus trichocarpa [western balsam poplar]
gb|EYU24834.1|  hypothetical protein MIMGU_mgv1a021721mg                184   4e-52   
ref|XP_001774052.1|  predicted protein                                  180   6e-52   
ref|XP_006401570.1|  hypothetical protein EUTSA_v10014526mg             183   7e-52   
ref|XP_004509978.1|  PREDICTED: uncharacterized protein LOC101498996    183   9e-52   
ref|XP_007211814.1|  hypothetical protein PRUPE_ppa010002mg             183   9e-52   
ref|XP_006464880.1|  PREDICTED: uncharacterized protein LOC102621041    182   1e-51   
ref|XP_002979362.1|  hypothetical protein SELMODRAFT_177600             180   1e-51   
ref|XP_010113086.1|  hypothetical protein L484_000044                   184   1e-51   
ref|XP_008454617.1|  PREDICTED: uncharacterized protein LOC103494984    182   1e-51   
ref|XP_011047501.1|  PREDICTED: uncharacterized protein LOC105141830    182   1e-51   
ref|XP_010060483.1|  PREDICTED: uncharacterized protein LOC104448384    183   2e-51   
gb|KDO74284.1|  hypothetical protein CISIN_1g024982mg                   182   2e-51   
ref|XP_002440029.1|  hypothetical protein SORBIDRAFT_09g024745          182   2e-51   Sorghum bicolor [broomcorn]
ref|XP_008454618.1|  PREDICTED: uncharacterized protein LOC103494986    182   2e-51   
gb|KHG07616.1|  Uncharacterized protein F383_34610                      182   2e-51   
ref|XP_007133081.1|  hypothetical protein PHAVU_011G149900g             182   2e-51   
ref|XP_002524715.1|  conserved hypothetical protein                     181   3e-51   Ricinus communis
ref|XP_006452025.1|  hypothetical protein CICLE_v10009334mg             181   3e-51   
ref|XP_006452024.1|  hypothetical protein CICLE_v10009334mg             181   3e-51   
ref|XP_008374204.1|  PREDICTED: uncharacterized protein C167.05-l...    182   4e-51   
ref|XP_008374205.1|  PREDICTED: uncharacterized protein C167.05-l...    182   4e-51   
ref|XP_003527284.1|  PREDICTED: uncharacterized protein LOC100817...    181   5e-51   
ref|XP_004294478.1|  PREDICTED: uncharacterized protein LOC101313290    181   7e-51   
ref|XP_001767941.1|  predicted protein                                  179   7e-51   
ref|NP_568808.1|  universal stress protein PHOS32                       180   7e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KGN59861.1|  hypothetical protein Csa_3G850650                       181   8e-51   
ref|NP_001148935.1|  LOC100282555                                       181   8e-51   Zea mays [maize]
ref|XP_010533511.1|  PREDICTED: uncharacterized protein LOC104809279    180   8e-51   
dbj|BAA97516.1|  unnamed protein product                                180   8e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146839.1|  PREDICTED: uncharacterized protein LOC101209390    181   8e-51   
ref|NP_001141066.1|  hypothetical protein                               179   9e-51   Zea mays [maize]
ref|XP_001758787.1|  predicted protein                                  178   1e-50   
gb|KEH15227.1|  universal stress family protein                         179   1e-50   
ref|XP_001753050.1|  predicted protein                                  176   2e-50   
ref|XP_006284359.1|  hypothetical protein CARUB_v10005532mg             180   2e-50   
ref|XP_003540075.1|  PREDICTED: uncharacterized protein LOC100805067    179   4e-50   
ref|XP_004169716.1|  PREDICTED: uncharacterized protein LOC101225643    179   4e-50   
ref|XP_011002470.1|  PREDICTED: probable serine/threonine-protein...    178   5e-50   
ref|XP_009143310.1|  PREDICTED: uncharacterized protein LOC103867033    178   8e-50   
ref|XP_004146840.1|  PREDICTED: uncharacterized protein LOC101209635    177   1e-49   
ref|XP_010482852.1|  PREDICTED: uncharacterized protein LOC104761464    177   1e-49   
ref|XP_009377304.1|  PREDICTED: uncharacterized protein LOC103965...    177   1e-49   
ref|XP_009377305.1|  PREDICTED: uncharacterized protein LOC103965...    177   2e-49   
ref|XP_006413090.1|  hypothetical protein EUTSA_v10026025mg             176   4e-49   
ref|XP_002864334.1|  hypothetical protein ARALYDRAFT_918574             176   5e-49   
ref|XP_009109143.1|  PREDICTED: uncharacterized protein C167.05-like    174   7e-49   
dbj|BAD43031.1|  unknown protein                                        175   9e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CAA19726.1|  putative protein                                       175   1e-48   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43646.1|  unknown protein                                        175   1e-48   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44118.1|  unknown protein                                        175   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567770.1|  universal stress protein PHOS34                       175   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867512.1|  predicted protein                                  175   1e-48   
dbj|BAD44623.1|  unknown protein                                        175   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443018.1|  PREDICTED: uncharacterized protein LOC104725962    174   1e-48   
dbj|BAD44582.1|  unknown protein                                        175   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127088.1|  PREDICTED: uncharacterized protein LOC103851961    174   2e-48   
ref|XP_010433382.1|  PREDICTED: uncharacterized protein LOC104717504    173   5e-48   
ref|XP_010448153.1|  PREDICTED: uncharacterized protein LOC104730647    172   5e-48   
ref|XP_010448151.1|  PREDICTED: uncharacterized protein LOC104730649    173   6e-48   
ref|XP_011100324.1|  PREDICTED: uncharacterized protein LOC105178...    174   7e-48   
ref|XP_011100323.1|  PREDICTED: uncharacterized protein LOC105178...    174   7e-48   
ref|XP_010438630.1|  PREDICTED: uncharacterized protein LOC104722194    172   1e-47   
ref|XP_010274682.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    171   3e-47   
ref|XP_006281006.1|  hypothetical protein CARUB_v10027020mg             171   3e-47   
ref|XP_007216703.1|  hypothetical protein PRUPE_ppa026633mg             167   6e-47   
ref|XP_009137740.1|  PREDICTED: uncharacterized protein LOC103861788    169   1e-46   
ref|XP_011079191.1|  PREDICTED: uncharacterized protein LOC105162768    170   7e-46   
ref|XP_006370361.1|  hypothetical protein POPTR_0001s41960g             166   7e-46   
ref|XP_008226788.1|  PREDICTED: uncharacterized protein LOC103326349    166   1e-45   
gb|ACJ84662.1|  unknown                                                 162   2e-44   Medicago truncatula
ref|XP_007021229.1|  Adenine nucleotide alpha hydrolases-like sup...    152   4e-41   
gb|AFK38246.1|  unknown                                                 153   5e-41   
ref|XP_008230189.1|  PREDICTED: uncharacterized protein LOC103329491    151   5e-40   
gb|AFW67672.1|  hypothetical protein ZEAMMB73_069074                    142   4e-37   
gb|EMS64464.1|  hypothetical protein TRIUR3_19232                       127   1e-31   
ref|NP_188758.2|  zinc ion binding protein                              126   3e-28   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB01712.1|  unnamed protein product                                125   4e-28   Arabidopsis thaliana [mouse-ear cress]
gb|EEE64268.1|  hypothetical protein OsJ_19101                          114   2e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAQ57264.1|  anti-bacterial protein                                  106   1e-22   Solanum tuberosum [potatoes]
gb|ABD32237.2|  hypothetical protein MtrDRAFT_AC148815g33v2           95.1    4e-20   Medicago truncatula
emb|CBI40875.3|  unnamed protein product                              89.7    3e-18   
ref|XP_006601309.1|  PREDICTED: uncharacterized protein LOC100807281  84.7    1e-16   
ref|XP_004959654.1|  PREDICTED: uncharacterized protein LOC101756170  84.3    2e-16   
ref|XP_004955269.1|  PREDICTED: uncharacterized protein LOC101763441  84.7    3e-16   
ref|XP_004986295.1|  PREDICTED: uncharacterized protein LOC101781490  84.3    3e-16   
ref|XP_004964191.1|  PREDICTED: uncharacterized protein LOC101773908  84.3    3e-16   
gb|EMT12797.1|  hypothetical protein F775_30117                       81.6    2e-15   
ref|XP_004978217.1|  PREDICTED: uncharacterized protein LOC101759018  80.5    7e-15   
gb|AAK91432.1|  At1g11360/T23J18_35                                   75.9    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008448127.1|  PREDICTED: uncharacterized protein LOC103490416  78.6    8e-13   
ref|XP_003596506.1|  hypothetical protein MTR_2g081250                74.7    2e-12   
emb|CBI17996.3|  unnamed protein product                              68.6    5e-11   
ref|XP_009416236.1|  PREDICTED: uncharacterized protein LOC103996900  65.5    3e-09   
ref|XP_008463151.1|  PREDICTED: universal stress protein A-like p...  63.2    2e-08   
ref|XP_010268016.1|  PREDICTED: universal stress protein A-like p...  60.5    1e-07   
ref|XP_010228719.1|  PREDICTED: universal stress protein A-like p...  60.1    1e-07   
ref|XP_003558090.1|  PREDICTED: uncharacterized protein C167.05-l...  60.1    2e-07   
ref|XP_006429235.1|  hypothetical protein CICLE_v10012955mg           59.7    2e-07   
ref|XP_006338073.1|  PREDICTED: universal stress protein A-like p...  59.3    3e-07   
ref|NP_001237625.1|  uncharacterized protein LOC100305594             59.3    3e-07   
ref|XP_002525794.1|  conserved hypothetical protein                   58.2    3e-07   Ricinus communis
ref|XP_009770125.1|  PREDICTED: universal stress protein A-like p...  58.9    4e-07   
ref|XP_010675243.1|  PREDICTED: universal stress protein A-like p...  58.5    5e-07   
gb|KHG02876.1|  hypothetical protein F383_26328                       58.2    7e-07   
ref|XP_010548996.1|  PREDICTED: universal stress protein A-like p...  58.2    8e-07   
gb|EMS53055.1|  Universal stress protein A-like protein               58.2    8e-07   
ref|XP_003559418.1|  PREDICTED: universal stress protein A-like p...  58.5    1e-06   
ref|XP_003554619.1|  PREDICTED: universal stress protein A-like p...  57.8    1e-06   
ref|XP_008454297.1|  PREDICTED: uncharacterized protein C167.05       57.4    1e-06   
gb|EMT11347.1|  Universal stress protein A-like protein               57.0    2e-06   
ref|XP_010259333.1|  PREDICTED: universal stress protein A-like p...  57.0    2e-06   
gb|KHN23151.1|  Universal stress protein A-like protein               57.0    2e-06   
ref|XP_002980442.1|  hypothetical protein SELMODRAFT_112416           57.0    2e-06   
ref|XP_004495667.1|  PREDICTED: universal stress protein A-like p...  56.6    2e-06   
gb|ADB54811.1|  universal stress protein 1561                         56.6    2e-06   
gb|AID16039.1|  putative universal stress protein                     56.2    3e-06   
ref|XP_010096805.1|  Universal stress protein A-like protein          56.6    3e-06   
gb|ACU19158.1|  unknown                                               56.6    3e-06   
ref|XP_009416216.1|  PREDICTED: universal stress protein A-like p...  56.2    3e-06   
gb|AAX13276.1|  USP family protein                                    56.2    3e-06   
dbj|BAJ92093.1|  predicted protein                                    56.2    3e-06   
gb|ABB13620.1|  USP-like protein                                      56.2    3e-06   
ref|XP_006647942.1|  PREDICTED: uncharacterized protein C167.05-like  56.2    3e-06   
ref|XP_002962652.1|  hypothetical protein SELMODRAFT_79236            56.2    4e-06   
gb|EMT05701.1|  Universal stress protein A-like protein               55.8    4e-06   
ref|XP_003591211.1|  Universal stress protein A-like protein          55.8    4e-06   
ref|XP_003591542.1|  Universal stress protein                         55.8    4e-06   
ref|XP_010105075.1|  Universal stress protein A-like protein          56.2    5e-06   
ref|NP_001048190.1|  Os02g0760500                                     55.8    5e-06   
gb|ADB54802.1|  universal stress protein 3739                         55.8    5e-06   
dbj|BAG74754.1|  universal stress protein                             55.5    6e-06   
ref|XP_003591541.1|  Universal stress protein                         55.5    6e-06   
ref|XP_006576202.1|  PREDICTED: uncharacterized protein LOC100527...  55.5    6e-06   
ref|XP_007145154.1|  hypothetical protein PHAVU_007G214800g           55.1    6e-06   
ref|XP_004152228.1|  PREDICTED: universal stress protein MJ0531-like  55.5    6e-06   
ref|XP_010228718.1|  PREDICTED: uncharacterized protein LOC100836...  55.5    7e-06   
ref|XP_009588034.1|  PREDICTED: universal stress protein A-like p...  55.1    7e-06   
ref|XP_006444481.1|  hypothetical protein CICLE_v10022542mg           54.3    1e-05   
emb|CDP11494.1|  unnamed protein product                              54.3    1e-05   
ref|XP_010228717.1|  PREDICTED: uncharacterized protein LOC100836...  54.7    1e-05   
ref|XP_006841415.1|  hypothetical protein AMTR_s00003p00027540        54.3    1e-05   
ref|XP_003591417.1|  Universal stress protein A-like protein          54.3    1e-05   
gb|ADB54801.1|  universal stress protein 3739                         54.3    2e-05   
ref|XP_008781084.1|  PREDICTED: universal stress protein A-like p...  53.9    2e-05   
ref|XP_004487759.1|  PREDICTED: universal stress protein A-like p...  53.5    2e-05   
ref|XP_002440642.1|  hypothetical protein SORBIDRAFT_09g004470        53.9    2e-05   
ref|XP_005097873.1|  PREDICTED: universal stress protein A-like p...  53.5    2e-05   
ref|XP_006650590.1|  PREDICTED: universal stress protein A-like p...  53.5    2e-05   
ref|XP_003570587.1|  PREDICTED: uncharacterized protein C167.05 i...  53.5    2e-05   
ref|XP_004495908.1|  PREDICTED: universal stress protein A-like p...  53.1    3e-05   
ref|XP_008240065.1|  PREDICTED: uncharacterized protein C167.05-like  53.1    3e-05   
dbj|BAJ97715.1|  predicted protein                                    53.1    4e-05   
ref|XP_009588426.1|  PREDICTED: universal stress protein A-like p...  53.1    4e-05   
ref|XP_008781085.1|  PREDICTED: uncharacterized protein LOC103700...  52.8    4e-05   
ref|XP_004144759.1|  PREDICTED: universal stress protein MJ0577-l...  52.8    4e-05   
ref|XP_007018204.1|  Adenine nucleotide alpha hydrolases-like sup...  52.8    5e-05   
ref|XP_008781086.1|  PREDICTED: universal stress protein A-like p...  52.8    5e-05   
ref|XP_011023763.1|  PREDICTED: universal stress protein A-like p...  52.8    5e-05   
ref|XP_010938295.1|  PREDICTED: universal stress protein A-like p...  52.8    5e-05   
ref|XP_010107691.1|  Universal stress protein A-like protein          52.8    5e-05   
ref|NP_001235063.1|  uncharacterized protein LOC100527623             52.8    6e-05   
gb|KDP28246.1|  hypothetical protein JCGZ_14017                       52.4    6e-05   
ref|XP_004302247.1|  PREDICTED: universal stress protein A-like p...  52.4    6e-05   
emb|CDS29066.1|  universal stress protein in QAH:OAS                  52.4    6e-05   
gb|ADE77956.1|  unknown                                               54.3    6e-05   
gb|AAD46412.1|AF096262_1  ER6 protein                                 52.4    7e-05   
gb|KFK35112.1|  hypothetical protein AALP_AA5G237800                  52.8    7e-05   
gb|EMT31582.1|  Universal stress protein A-like protein               52.0    9e-05   
emb|CDJ05760.1|  universal stress protein                             52.4    9e-05   
gb|KDP23405.1|  hypothetical protein JCGZ_23238                       51.6    1e-04   
gb|KCW48157.1|  hypothetical protein EUGRSUZ_K01888                   52.4    1e-04   
ref|XP_004302246.1|  PREDICTED: universal stress protein A-like p...  51.6    1e-04   
ref|XP_010236087.1|  PREDICTED: uncharacterized protein LOC100839...  52.0    1e-04   
gb|KHN30645.1|  Universal stress protein A-like protein               51.2    1e-04   
ref|XP_002454587.1|  hypothetical protein SORBIDRAFT_04g033920        51.2    1e-04   
ref|XP_009804590.1|  PREDICTED: universal stress protein A-like p...  51.6    1e-04   
gb|AFK46242.1|  unknown                                               51.2    1e-04   
ref|XP_004206820.1|  PREDICTED: universal stress protein Rv2005c/...  51.2    1e-04   
ref|XP_002319486.1|  hypothetical protein POPTR_0013s01110g           51.6    1e-04   
ref|XP_010036539.1|  PREDICTED: universal stress protein A-like p...  52.8    1e-04   
ref|XP_002514027.1|  conserved hypothetical protein                   51.6    1e-04   
ref|XP_006472185.1|  PREDICTED: universal stress protein A-like p...  51.2    1e-04   
ref|XP_006424952.1|  hypothetical protein CICLE_v10029414mg           51.2    1e-04   
ref|XP_008444941.1|  PREDICTED: uncharacterized protein LOC103488134  51.6    1e-04   
gb|KDO66689.1|  hypothetical protein CISIN_1g041485mg                 51.6    1e-04   
gb|EUB60809.1|  hypothetical protein EGR_04248                        51.2    1e-04   
emb|CDO97039.1|  unnamed protein product                              51.2    1e-04   
ref|NP_001236412.1|  uncharacterized protein LOC100306535             51.2    2e-04   
ref|XP_004230297.1|  PREDICTED: universal stress protein A-like p...  51.2    2e-04   
ref|XP_004237985.1|  PREDICTED: universal stress protein A-like p...  51.2    2e-04   
ref|XP_004290788.1|  PREDICTED: universal stress protein MJ0531-like  51.2    2e-04   
ref|XP_006472184.1|  PREDICTED: universal stress protein A-like p...  51.2    2e-04   
emb|CDS17978.1|  universal stress protein                             51.2    2e-04   
ref|XP_010259332.1|  PREDICTED: universal stress protein A-like p...  50.8    2e-04   
gb|EKC23535.1|  Stress response protein nhaX                          50.8    2e-04   
ref|XP_004230296.1|  PREDICTED: universal stress protein A-like p...  50.8    2e-04   
gb|AFK39818.1|  unknown                                               50.4    2e-04   
ref|XP_004148419.1|  PREDICTED: universal stress protein A-like p...  50.8    2e-04   
ref|XP_004490794.1|  PREDICTED: universal stress protein A-like p...  50.8    2e-04   
ref|XP_011016913.1|  PREDICTED: uncharacterized protein LOC105120...  50.8    2e-04   
ref|XP_004295087.1|  PREDICTED: uncharacterized protein C167.05-like  50.4    2e-04   
ref|XP_004953997.1|  PREDICTED: uncharacterized protein C167.05-like  50.4    3e-04   
ref|XP_006402787.1|  hypothetical protein EUTSA_v10006473mg           50.8    3e-04   
ref|XP_001763629.1|  predicted protein                                50.4    3e-04   
ref|XP_006344751.1|  PREDICTED: uncharacterized protein C167.05-like  50.4    3e-04   
ref|XP_011016909.1|  PREDICTED: uncharacterized protein LOC105120...  50.4    3e-04   
ref|XP_004144758.1|  PREDICTED: universal stress protein MJ0577-l...  50.4    3e-04   
ref|XP_003615271.1|  Universal stress protein A-like protein          50.4    3e-04   
ref|XP_007163325.1|  hypothetical protein PHAVU_001G225300g           50.4    3e-04   
ref|NP_001236285.1|  uncharacterized protein LOC100527197             50.1    3e-04   
ref|XP_006677779.1|  hypothetical protein BATDEDRAFT_16272            50.8    3e-04   
ref|XP_004495909.1|  PREDICTED: universal stress protein A-like p...  50.1    3e-04   
ref|XP_009135195.1|  PREDICTED: uncharacterized protein LOC103859...  50.8    3e-04   
ref|XP_007026862.1|  Adenine nucleotide alpha hydrolases-like sup...  50.1    3e-04   
ref|XP_004303418.1|  PREDICTED: universal stress protein YxiE-like    50.8    4e-04   
ref|XP_010544073.1|  PREDICTED: uncharacterized protein C167.05       50.1    4e-04   
ref|XP_002515296.1|  conserved hypothetical protein                   50.1    4e-04   
emb|CDY20676.1|  BnaC08g13820D                                        50.1    4e-04   
ref|XP_006649957.1|  PREDICTED: uncharacterized protein C167.05-like  50.1    4e-04   
gb|KDP41468.1|  hypothetical protein JCGZ_15875                       50.4    4e-04   
gb|ABK23398.1|  unknown                                               49.7    4e-04   
gb|AFW73547.1|  ER6 protein                                           49.7    4e-04   
ref|XP_006407393.1|  hypothetical protein EUTSA_v10021565mg           50.4    4e-04   
ref|XP_010549540.1|  PREDICTED: universal stress protein A-like p...  49.7    4e-04   
ref|XP_009804591.1|  PREDICTED: universal stress protein A-like p...  49.7    5e-04   
ref|XP_006422530.1|  hypothetical protein CICLE_v10030411mg           49.7    5e-04   
ref|XP_008386015.1|  PREDICTED: uncharacterized protein LOC103448528  49.7    5e-04   
ref|XP_006433519.1|  hypothetical protein CICLE_v10002689mg           49.7    5e-04   
gb|EKC34279.1|  Stress response protein nhaX                          49.7    5e-04   
gb|ABR16994.1|  unknown                                               49.3    5e-04   
gb|KDO71923.1|  hypothetical protein CISIN_1g031168mg                 49.7    5e-04   
ref|XP_006296620.1|  hypothetical protein CARUB_v10014583mg           50.4    6e-04   
ref|XP_007026861.1|  Adenine nucleotide alpha hydrolases-like sup...  49.7    6e-04   
ref|XP_010921509.1|  PREDICTED: uncharacterized protein LOC105045047  49.3    6e-04   
ref|XP_002275745.1|  PREDICTED: universal stress protein A-like p...  49.3    6e-04   
ref|XP_009630150.1|  PREDICTED: universal stress protein A-like p...  49.7    6e-04   
ref|XP_006296619.1|  hypothetical protein CARUB_v10014583mg           50.4    6e-04   
gb|EKC40836.1|  hypothetical protein CGI_10026523                     49.7    6e-04   
ref|XP_009135196.1|  PREDICTED: uncharacterized protein LOC103859...  50.1    6e-04   
ref|XP_006419393.1|  hypothetical protein CICLE_v10006081mg           49.3    7e-04   
gb|ACZ74623.1|  cold stress protein-like protein                      49.3    7e-04   
ref|XP_003615270.1|  Universal stress protein A-like protein          49.3    7e-04   
ref|XP_010259331.1|  PREDICTED: universal stress protein A-like p...  49.3    7e-04   
ref|XP_011077614.1|  PREDICTED: universal stress protein A-like p...  49.3    7e-04   
ref|XP_006349538.1|  PREDICTED: universal stress protein A-like p...  49.3    8e-04   
ref|XP_004236679.1|  PREDICTED: universal stress protein A-like p...  48.9    8e-04   
emb|CDJ04089.1|  universal stress protein in QAH:OAS                  48.9    8e-04   
ref|XP_010060094.1|  PREDICTED: uncharacterized protein LOC104448021  49.3    8e-04   
ref|XP_002882756.1|  universal stress protein family protein          49.7    8e-04   
gb|KFK35113.1|  hypothetical protein AALP_AA5G237800                  49.7    9e-04   
ref|XP_004495963.1|  PREDICTED: universal stress protein A-like p...  48.9    0.001   
ref|XP_009342098.1|  PREDICTED: universal stress protein A-like p...  48.9    0.001   
ref|XP_010464928.1|  PREDICTED: universal stress protein A-like p...  49.3    0.001   



>ref|XP_002522718.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39680.1| conserved hypothetical protein [Ricinus communis]
Length=248

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 171/245 (70%), Gaps = 14/245 (6%)
 Frame = +3

Query  189  HFEPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHY  368
            + +P    P+  ++ L I P   P + T   + T +RR+AIAVDLSDESA+AV+WAV +Y
Sbjct  4    NHQPESDLPLPQLSSLRIRPSSSPSLTTQTPTSTAQRRIAIAVDLSDESAYAVKWAVNNY  63

Query  369  LRPGDGVVLLHVQPTAVLYGADWGI------STPSDHApppppQTAAEEEDIIDDLTSAK  530
            LRPGD V+LLHV+PT+VLYGADWG          +D+  P   +   + ED  D+ T+ K
Sbjct  64   LRPGDAVILLHVRPTSVLYGADWGSIKLHINDDENDNNTPLSERDQQKLEDDFDNFTATK  123

Query  531  AEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVE-  707
            A  LA+PL++A +PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R S +  
Sbjct  124  ANSLAQPLLDAGIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRSSNLNG  182

Query  708  ---RLGSVSDYcvhhcicpvvvvRYPDGDG---GGGAATEVVVDLHPVPEDKEYEYHDNA  869
                LGSVSDYCVHHC+CPVVVVRYPD +    GG    + V DLHPVPE+ + EYHD +
Sbjct  183  KGRLLGSVSDYCVHHCVCPVVVVRYPDDENDVAGGNFGKDEVADLHPVPEEDDQEYHDAS  242

Query  870  DDEVD  884
            D+  D
Sbjct  243  DEHTD  247



>ref|XP_002277051.1| PREDICTED: uncharacterized protein LOC100263170 [Vitis vinifera]
 ref|XP_003633322.1| PREDICTED: uncharacterized protein LOC100263170 [Vitis vinifera]
Length=249

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 174/252 (69%), Gaps = 22/252 (9%)
 Frame = +3

Query  180  KSVHFEPGYRRPVRNVTPLAIAP--PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRW  353
            K    EP     +  V  + + P  P  P   +   +    RR+AIAVDLSDESA+AV+W
Sbjct  4    KQSQMEPDRPSTLPPVKAIHVQPSSPRFPLSSSNTPTAGANRRIAIAVDLSDESAYAVKW  63

Query  354  AVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHApppppQTAAEEEDIIDDLTS  524
            AV+HYLRPGD V+LLHV+PT+VLYGADWG   ++  +D++     Q     ED  D  T+
Sbjct  64   AVQHYLRPGDAVILLHVRPTSVLYGADWGSIDLAVDTDNSTEESQQKL---EDDFDTFTT  120

Query  525  AKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKV  704
             KA  LA+PLV A +PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR SK 
Sbjct  121  TKASDLAQPLVEAQIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRTSK-  178

Query  705  ERLGSVSDYcvhhcicpvvvvRYPD-GDGG------GGAATEVV----VDLHPVPEDKEY  851
             RLGSVSDYCVHHC+CPVVVVRYPD  DGG      GG A + V    V+LHPVPE+ E 
Sbjct  179  GRLGSVSDYCVHHCVCPVVVVRYPDEKDGGAGAESPGGVAGKAVLGEEVELHPVPEE-EQ  237

Query  852  EYHDNADDEVDE  887
            EYHD +D++ D+
Sbjct  238  EYHDASDEQKDD  249



>ref|XP_009353217.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
 ref|XP_009341456.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=230

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 159/221 (72%), Gaps = 8/221 (4%)
 Frame = +3

Query  222  NVTPLAIAPPLLPRVFTPVLSPT---QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVV  392
            N  P  +  P  PR  T  ++PT     R+VAIAVDLS+ESAFAVRWAV++YLRPGD VV
Sbjct  2    NQPPPVLIQPSSPR-LTNTITPTPDGTHRKVAIAVDLSEESAFAVRWAVQNYLRPGDSVV  60

Query  393  LLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVP  572
            LLHV+PT+VLYGADWG   P+D A     ++  + ED  D  T+ KA  LA+PLV A  P
Sbjct  61   LLHVRPTSVLYGADWGSVDPND-AVSSSSESQQKLEDDFDAFTTTKAADLAQPLVEAQFP  119

Query  573  FTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcic  752
            F IHIVKDHD+KERLCLEVERL LS +IMGSRGFG+ +KR +KV RLGSV+DYCV HC+C
Sbjct  120  FKIHIVKDHDMKERLCLEVERLWLSVVIMGSRGFGA-TKRAAKVGRLGSVTDYCVQHCVC  178

Query  753  pvvvvRYPDGD--GGGGAATEVVVDLHPVPEDKEYEYHDNA  869
            PVVVVRYPD     G G   +  V+LHPVPE+   E++D +
Sbjct  179  PVVVVRYPDDSDRSGAGGEPDGPVELHPVPEEDPEEFNDGS  219



>ref|XP_008455370.1| PREDICTED: uncharacterized protein C167.05 isoform X1 [Cucumis 
melo]
Length=264

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 165/235 (70%), Gaps = 21/235 (9%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPT  413
            + I P       +P  S   +RR+AIAVDLSDESA+AVRWAV++YLRPGD V  LHVQPT
Sbjct  24   VQIQPSSPGSFLSPRHSLDSQRRIAIAVDLSDESAYAVRWAVQNYLRPGDLVFFLHVQPT  83

Query  414  AVLYGADWGISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFT  578
            +VLYGADWG S           + +AEE     ED  D+ T+ KA  LA+PLV AN+PF 
Sbjct  84   SVLYGADWG-SVDLHQRNSSSDEVSAEETQRKMEDDFDNFTTTKAADLAQPLVEANIPFK  142

Query  579  IHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpv  758
            IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR +K  RLGSVSDYCVHHC+CPV
Sbjct  143  IHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRITK-GRLGSVSDYCVHHCVCPV  200

Query  759  vvvRYPDGDGG--------GGAATEVV---VDLHPVPEDKEYEYHDNADDEVDEL  890
            VVVRYPD   G        GG+   ++   V+L PVPED E EYHD  D+EV E+
Sbjct  201  VVVRYPDDKDGSRDGDAETGGSVKSIIREEVELDPVPED-EQEYHD-GDEEVKEI  253



>ref|XP_008455371.1| PREDICTED: uncharacterized protein C167.05 isoform X2 [Cucumis 
melo]
Length=256

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPT  413
            + I P       +P  S   +RR+AIAVDLSDESA+AVRWAV++YLRPGD V  LHVQPT
Sbjct  24   VQIQPSSPGSFLSPRHSLDSQRRIAIAVDLSDESAYAVRWAVQNYLRPGDLVFFLHVQPT  83

Query  414  AVLYGADWGISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFT  578
            +VLYGADWG S           + +AEE     ED  D+ T+ KA  LA+PLV AN+PF 
Sbjct  84   SVLYGADWG-SVDLHQRNSSSDEVSAEETQRKMEDDFDNFTTTKAADLAQPLVEANIPFK  142

Query  579  IHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpv  758
            IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR +K  RLGSVSDYCVHHC+CPV
Sbjct  143  IHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRITK-GRLGSVSDYCVHHCVCPV  200

Query  759  vvvRYPDGDGG--------GGAATEVV---VDLHPVPEDKEYEYHDNADDEVDE  887
            VVVRYPD   G        GG+   ++   V+L PVPED E EYHD  D+EV E
Sbjct  201  VVVRYPDDKDGSRDGDAETGGSVKSIIREEVELDPVPED-EQEYHD-GDEEVKE  252



>ref|XP_004144481.1| PREDICTED: uncharacterized protein C167.05-like [Cucumis sativus]
 gb|KGN43566.1| hypothetical protein Csa_7G045550 [Cucumis sativus]
Length=264

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPT  413
            + I P       +P  S   +RR+AIAVDLSDESA+AVRWAV++YLRPGD V  LHVQPT
Sbjct  24   VQIQPSSPGSFLSPRHSLDSQRRIAIAVDLSDESAYAVRWAVQNYLRPGDLVFFLHVQPT  83

Query  414  AVLYGADWGISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFT  578
            +VLYGADWG S           + +AEE     ED  D+ T+ KA  LA+PLV AN+PF 
Sbjct  84   SVLYGADWG-SVDLHQRNSSSDEVSAEETQRKMEDDFDNFTTTKAADLAQPLVEANIPFK  142

Query  579  IHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpv  758
            IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR +K  RLGSVSDYCVHHC+CPV
Sbjct  143  IHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRITK-GRLGSVSDYCVHHCVCPV  200

Query  759  vvvRYPDGDGG--------GGAATEVV---VDLHPVPEDKEYEYHDNADDEVDE  887
            VVVRYPD   G        GG+   ++   V+L PVPED E EYHD  D+EV E
Sbjct  201  VVVRYPDDKDGSRHGDAEAGGSVKSIIREEVELDPVPED-EQEYHD-GDEEVKE  252



>ref|XP_009629258.1| PREDICTED: uncharacterized protein LOC104119448 isoform X2 [Nicotiana 
tomentosiformis]
Length=266

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 143/241 (59%), Positives = 162/241 (67%), Gaps = 19/241 (8%)
 Frame = +3

Query  231  PLAIA-PPLLPRVFTPVLSPTQR--RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLH  401
            P AI   P  PR   P  +PT R  R++AIAVDLSDESA+AV+WAV++YLRPGDGV+LLH
Sbjct  15   PTAIMHQPASPRF--PSGTPTSRANRKIAIAVDLSDESAYAVKWAVQNYLRPGDGVILLH  72

Query  402  VQPTAVLYGADWG-ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFT  578
            V+PT+VLYGADWG I    D       Q     ED  D+ T+ KA  LA+PLV  N+PF 
Sbjct  73   VRPTSVLYGADWGAIDVSVDTTNEESQQKL---EDDFDNFTTTKANDLAQPLVEGNIPFK  129

Query  579  IHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpv  758
            IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R  K  RLGSVSDYCVHHC+CPV
Sbjct  130  IHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRSIKGGRLGSVSDYCVHHCVCPV  188

Query  759  vvvRYPDGDGG--------GGAATEVVVDLHPVPEDKEYEYHDNADDEVDELEGV*AMLY  914
            VVVRYPD   G        G    E    LHPVPED E  YHD  D    E  GV A   
Sbjct  189  VVVRYPDDKDGVAADDANEGSVKKETDGVLHPVPED-EPIYHDAEDKAAGEFYGVVACDQ  247

Query  915  M  917
            M
Sbjct  248  M  248



>ref|XP_009629257.1| PREDICTED: uncharacterized protein LOC104119448 isoform X1 [Nicotiana 
tomentosiformis]
Length=280

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 160/235 (68%), Gaps = 19/235 (8%)
 Frame = +3

Query  231  PLAIA-PPLLPRVFTPVLSPTQR--RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLH  401
            P AI   P  PR   P  +PT R  R++AIAVDLSDESA+AV+WAV++YLRPGDGV+LLH
Sbjct  15   PTAIMHQPASPRF--PSGTPTSRANRKIAIAVDLSDESAYAVKWAVQNYLRPGDGVILLH  72

Query  402  VQPTAVLYGADWG-ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFT  578
            V+PT+VLYGADWG I    D       Q     ED  D+ T+ KA  LA+PLV  N+PF 
Sbjct  73   VRPTSVLYGADWGAIDVSVDTTNEESQQKL---EDDFDNFTTTKANDLAQPLVEGNIPFK  129

Query  579  IHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpv  758
            IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R  K  RLGSVSDYCVHHC+CPV
Sbjct  130  IHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRSIKGGRLGSVSDYCVHHCVCPV  188

Query  759  vvvRYPDGDGG--------GGAATEVVVDLHPVPEDKEYEYHDNADDEVDELEGV  899
            VVVRYPD   G        G    E    LHPVPED E  YHD  D    E  GV
Sbjct  189  VVVRYPDDKDGVAADDANEGSVKKETDGVLHPVPED-EPIYHDAEDKAAGEFYGV  242



>ref|XP_004159196.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein C167.05-like 
[Cucumis sativus]
Length=264

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPT  413
            + I P       +P  S   +RR+AIAVDLSDESA+AVRWAV++YLRPGD  V LHVQPT
Sbjct  24   VQIQPSSPGSFLSPRHSLDSQRRIAIAVDLSDESAYAVRWAVQNYLRPGDLXVFLHVQPT  83

Query  414  AVLYGADWGISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFT  578
            +VLYGADWG S           + +AEE     ED  D+ T+ KA  LA+PLV AN+PF 
Sbjct  84   SVLYGADWG-SVDLHQRNSSSDEVSAEETQRKMEDDFDNFTTTKAADLAQPLVEANIPFK  142

Query  579  IHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpv  758
            IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR +K  RLGSVSDYCVHHC+CPV
Sbjct  143  IHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRITK-GRLGSVSDYCVHHCVCPV  200

Query  759  vvvRYPDGDGG--------GGAATEVV---VDLHPVPEDKEYEYHDNADDEVDE  887
            VVVRYPD   G        GG+   ++   V+L PVPED E EYHD  D+EV E
Sbjct  201  VVVRYPDDKDGSRHGDAEAGGSVKSIIREEVELDPVPED-EQEYHD-GDEEVKE  252



>emb|CAN75054.1| hypothetical protein VITISV_039450 [Vitis vinifera]
Length=280

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 139/246 (57%), Positives = 168/246 (68%), Gaps = 16/246 (7%)
 Frame = +3

Query  180  KSVHFEPGYRRPVRNVTPLAIAP--PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRW  353
            K    EP     +  V  + + P  P  P   +   +    RR+AIAVDLSDESA+AV+W
Sbjct  4    KQSQMEPDRPSTLPPVKAIHVQPSSPRFPLSSSNTPTAGANRRIAIAVDLSDESAYAVKW  63

Query  354  AVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKA  533
            AV+HYLRPGD V+LLHV+PT+VLYGADWG    +        ++  + ED  D  T  KA
Sbjct  64   AVQHYLRPGDAVILLHVRPTSVLYGADWGSIDLAVDTDNSTEESQQKLEDDFDTFTXTKA  123

Query  534  EHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERL  713
              LA+PLV A +PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR SK  RL
Sbjct  124  SDLAQPLVEAQIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRTSK-GRL  181

Query  714  GSVSDYcvhhcicpvvvvRYPD-GDGGGGAAT------EVV----VDLHPVPEDKEYEYH  860
            GSVSDYCVHHC+CPVVVVRYPD  DGG GA +      + V    V+LHPVPE+ E EYH
Sbjct  182  GSVSDYCVHHCVCPVVVVRYPDEKDGGAGAESPGGVXGKAVLGEEVELHPVPEE-EQEYH  240

Query  861  DNADDE  878
            D +D++
Sbjct  241  DASDEQ  246



>ref|XP_011095276.1| PREDICTED: uncharacterized protein LOC105174785 [Sesamum indicum]
Length=237

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 159/224 (71%), Gaps = 6/224 (3%)
 Frame = +3

Query  216  VRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVL  395
            VR+ +P    PP  P + T   +   +R++ IAVDLSDESAFAV+W+VRHYLRPGD V+L
Sbjct  18   VRSSSP-RFPPPTTP-LSTETPTANAQRKIGIAVDLSDESAFAVKWSVRHYLRPGDAVIL  75

Query  396  LHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPF  575
            LHV+PT+VLYGADWG S           ++  + ED  D  T+ KA  LA+PLV+A +PF
Sbjct  76   LHVRPTSVLYGADWG-SVDLSIVDAENEESQQKLEDDFDTFTTTKASDLAQPLVDAQIPF  134

Query  576  TIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicp  755
             IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ +KRGS   RLGSVSDYCV HC+CP
Sbjct  135  KIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-TKRGSD-GRLGSVSDYCVRHCVCP  192

Query  756  vvvvRYPDGDGGGGAATEVVVDLHPVPEDK-EYEYHDNADDEVD  884
            VVVVRYPD     G   E VV +    ED+ E EYHD +DD  D
Sbjct  193  VVVVRYPDEKDSAGGTGEPVVSVASAAEDEDEPEYHDASDDRKD  236



>ref|XP_008455372.1| PREDICTED: uncharacterized protein C167.05 isoform X3 [Cucumis 
melo]
Length=253

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 163/232 (70%), Gaps = 21/232 (9%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPT  413
            + I P       +P  S   +RR+AIAVDLSDESA+AVRWAV++YLRPGD V  LHVQPT
Sbjct  24   VQIQPSSPGSFLSPRHSLDSQRRIAIAVDLSDESAYAVRWAVQNYLRPGDLVFFLHVQPT  83

Query  414  AVLYGADWGISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFT  578
            +VLYGADWG S           + +AEE     ED  D+ T+ KA  LA+PLV AN+PF 
Sbjct  84   SVLYGADWG-SVDLHQRNSSSDEVSAEETQRKMEDDFDNFTTTKAADLAQPLVEANIPFK  142

Query  579  IHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpv  758
            IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR +K  RLGSVSDYCVHHC+CPV
Sbjct  143  IHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRITK-GRLGSVSDYCVHHCVCPV  200

Query  759  vvvRYPDGDGG--------GGAATEVV---VDLHPVPEDKEYEYHDNADDEV  881
            VVVRYPD   G        GG+   ++   V+L PVPED E EYHD  D+EV
Sbjct  201  VVVRYPDDKDGSRDGDAETGGSVKSIIREEVELDPVPED-EQEYHD-GDEEV  250



>ref|XP_009350375.1| PREDICTED: uncharacterized protein C167.05-like [Pyrus x bretschneideri]
Length=231

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 154/199 (77%), Gaps = 5/199 (3%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppp  476
            R+VAIAVDLS+ESAFAVRWAV++YLRPGD V+LLHV+PT+VLYGADWG   P+D      
Sbjct  31   RKVAIAVDLSEESAFAVRWAVQNYLRPGDTVILLHVRPTSVLYGADWGSVDPNDAVSSSE  90

Query  477  pQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMI  656
             Q   E++   D  T+ KA  LA+PLV A  PF IHIVKDHD+KERLCLEVERL LS +I
Sbjct  91   SQQKLEDD--FDAFTTTKAADLAQPLVEAQFPFKIHIVKDHDMKERLCLEVERLRLSVVI  148

Query  657  MGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP-DGDG-GGGAATEVVVDLHP  830
            MGSRGFG+ +KR SKV RLGSV+DYCVHHC+CPVVVVRYP D DG G G   +  V+LHP
Sbjct  149  MGSRGFGA-AKRASKVGRLGSVTDYCVHHCVCPVVVVRYPDDSDGLGPGGEPDTPVELHP  207

Query  831  VPEDKEYEYHDNADDEVDE  887
            VPE+ + ++++ + D+ D+
Sbjct  208  VPEEDQEDFNEGSSDDNDD  226



>ref|XP_009629260.1| PREDICTED: uncharacterized protein LOC104119448 isoform X4 [Nicotiana 
tomentosiformis]
Length=245

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 160/226 (71%), Gaps = 19/226 (8%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQR--RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P  PR   P  +PT R  R++AIAVDLSDESA+AV+WAV++YLRPGDGV+LLHV+PT+VL
Sbjct  22   PASPRF--PSGTPTSRANRKIAIAVDLSDESAYAVKWAVQNYLRPGDGVILLHVRPTSVL  79

Query  423  YGADWG-ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDH  599
            YGADWG I    D       Q     ED  D+ T+ KA  LA+PLV  N+PF IHIVKDH
Sbjct  80   YGADWGAIDVSVDTTNEESQQKL---EDDFDNFTTTKANDLAQPLVEGNIPFKIHIVKDH  136

Query  600  DLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD  779
            D+KERLCLEVERLGLSA+IMGSRGFG+ S+R  K  RLGSVSDYCVHHC+CPVVVVRYPD
Sbjct  137  DMKERLCLEVERLGLSAVIMGSRGFGA-SRRSIKGGRLGSVSDYCVHHCVCPVVVVRYPD  195

Query  780  GDGG--------GGAATEVVVDLHPVPEDKEYEYHDNADDEVDELE  893
               G        G    E    LHPVPED E  YHD A+D+  +LE
Sbjct  196  DKDGVAADDANEGSVKKETDGVLHPVPED-EPIYHD-AEDKAADLE  239



>gb|AFS65005.1| universal stress protein [Salvia miltiorrhiza]
Length=236

 Score =   213 bits (543),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 169/238 (71%), Gaps = 12/238 (5%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIA-PPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLR  374
            PG  R   +  P AI   P  PR  +   +   +R+VAIAVDLSDESA+AV+WAV++YLR
Sbjct  4    PGKPRKENDRPPAAILHQPASPRFPSGTPTAGAQRKVAIAVDLSDESAYAVKWAVQNYLR  63

Query  375  PGDGVVLLHVQPTAVLYGADWG-ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            PGD V+LLHV+PT+VLYGADWG +    D A     Q     ED  D+ T++KA  LA+P
Sbjct  64   PGDAVILLHVRPTSVLYGADWGAVDVSVDTADEKSQQKL---EDDFDNFTTSKANDLAQP  120

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV A++PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R SK  RLGSVSDY
Sbjct  121  LVEASIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRSSK-GRLGSVSDY  178

Query  732  cvhhcicpvvvvRYPD--GDGGGGAATEVVVD---LHPVPEDKEYEYHDNADDEVDEL  890
            CVHHC+CPVVVVR+PD   D  GG+A  +  D   LHPVPE++E  + D +D    E+
Sbjct  179  CVHHCVCPVVVVRFPDEKDDVSGGSAKPLDKDTSALHPVPEEEEPLFLDASDQNAGEV  236



>ref|XP_009608133.1| PREDICTED: uncharacterized protein LOC104102188 [Nicotiana tomentosiformis]
Length=222

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 159/215 (74%), Gaps = 16/215 (7%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYG  428
            P+ PR      S    R VAIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT+VLYG
Sbjct  16   PVSPRFPLSATSSAAHRHVAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPTSVLYG  75

Query  429  ADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLK  608
            ADWG S P++       Q    E+D  D+LT+ KA  LA PLV ANVP+ IHIVKD D+K
Sbjct  76   ADWGFS-PTN-------QQLKIEQD-YDNLTNTKATQLALPLVEANVPYKIHIVKDRDMK  126

Query  609  ERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVE--RLGSVSDYcvhhcicpvvvvRYPDG  782
            ERLCLEVERLGLSAMIMGSRGFG+ S  G  +   +LGSVSDYCVHHCICPVVVVRYP  
Sbjct  127  ERLCLEVERLGLSAMIMGSRGFGATSS-GFIISKGKLGSVSDYCVHHCICPVVVVRYPQE  185

Query  783  DGGGGAATEVVV--DLHPVPEDKEYEYHDNADDEV  881
            DG GG   + VV  +L PVPE+ E EYHD ADDE+
Sbjct  186  DGDGGVEKKAVVEAELPPVPEE-EVEYHD-ADDEL  218



>ref|XP_009629259.1| PREDICTED: uncharacterized protein LOC104119448 isoform X3 [Nicotiana 
tomentosiformis]
Length=246

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 154/219 (70%), Gaps = 18/219 (8%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQR--RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P  PR   P  +PT R  R++AIAVDLSDESA+AV+WAV++YLRPGDGV+LLHV+PT+VL
Sbjct  22   PASPRF--PSGTPTSRANRKIAIAVDLSDESAYAVKWAVQNYLRPGDGVILLHVRPTSVL  79

Query  423  YGADWG-ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDH  599
            YGADWG I    D       Q     ED  D+ T+ KA  LA+PLV  N+PF IHIVKDH
Sbjct  80   YGADWGAIDVSVDTTNEESQQKL---EDDFDNFTTTKANDLAQPLVEGNIPFKIHIVKDH  136

Query  600  DLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD  779
            D+KERLCLEVERLGLSA+IMGSRGFG+ S+R  K  RLGSVSDYCVHHC+CPVVVVRYPD
Sbjct  137  DMKERLCLEVERLGLSAVIMGSRGFGA-SRRSIKGGRLGSVSDYCVHHCVCPVVVVRYPD  195

Query  780  GDGG--------GGAATEVVVDLHPVPEDKEYEYHDNAD  872
               G        G    E    LHPVPED E  YHD  D
Sbjct  196  DKDGVAADDANEGSVKKETDGVLHPVPED-EPIYHDAED  233



>ref|XP_009768401.1| PREDICTED: uncharacterized protein LOC104219407 [Nicotiana sylvestris]
Length=242

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 158/224 (71%), Gaps = 15/224 (7%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYG  428
            P  PR  + + +    R++AIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT+VLYG
Sbjct  22   PASPRFPSGIPTSRANRKIAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPTSVLYG  81

Query  429  ADWG-ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDL  605
            ADWG I    D       Q     ED  D+ T+ KA  LA+PLV  N+PF IHIVKDHD+
Sbjct  82   ADWGAIDVSVDTTNEESQQKL---EDDFDNFTTTKANDLAQPLVEGNIPFKIHIVKDHDM  138

Query  606  KERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD  785
            KERLCLEVERLGLSA+IMGSRGFG+ S+R  K  RLGSVSDYCVHHC+CPVVVVRYPD  
Sbjct  139  KERLCLEVERLGLSAVIMGSRGFGA-SRRSIKGGRLGSVSDYCVHHCVCPVVVVRYPDDK  197

Query  786  GGGGAA--------TEVVVDLHPVPEDKEYEYHDNADDEVDELE  893
             G  AA         E    LHPVPED E  YHD A+D+  +LE
Sbjct  198  DGVAAADANEGSVIKETDGVLHPVPED-EPIYHD-AEDKAADLE  239



>ref|XP_011096180.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=242

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 164/228 (72%), Gaps = 27/228 (12%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P  PR   P  +PT   +R++AIAVDLSDESAFAV+WAV++YLRPGD V+LLHV+PT+VL
Sbjct  21   PASPRF--PCGTPTSGAQRKIAIAVDLSDESAFAVKWAVQNYLRPGDAVILLHVRPTSVL  78

Query  423  YGADWG-----ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHI  587
            YGADWG     + TP +       ++  + ED  D+ TS+KA  LA+PLV AN+PF IHI
Sbjct  79   YGADWGAIDLSVDTPDE-------KSQQKLEDDFDNFTSSKANDLAQPLVEANIPFKIHI  131

Query  588  VKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvv  767
            VKDHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R SK  RLGSVSDYCVHHC+CPVVVV
Sbjct  132  VKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRSSK-GRLGSVSDYCVHHCVCPVVVV  189

Query  768  RYPDGDGGG------GAATEV---VVDLHPVPEDKEYEYHDNADDEVD  884
            R+PD   G       G+A  V   V  LH VPE++E  + D +D   D
Sbjct  190  RFPDEKDGAVANVIRGSAKAVDKDVSGLHTVPEEEEPVFLDASDKNAD  237



>dbj|BAJ94495.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02503.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06584.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01108.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=265

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 157/230 (68%), Gaps = 26/230 (11%)
 Frame = +3

Query  249  PLLPRVFTPVLS----PTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            P  PR F   L+     +  RR+AIAVDLSDESAFAVRWAV++YLRPGD VVLLHV+PT+
Sbjct  35   PSSPRYFFSSLAGKDASSHHRRIAIAVDLSDESAFAVRWAVQNYLRPGDAVVLLHVRPTS  94

Query  417  VLYGADWGISTP----------------SDHApppppQTAAEEEDIIDDLTSAKAEHLAE  548
            VLYGADWG S P                SD A     +   + E+  D  TS K++ LA+
Sbjct  95   VLYGADWG-SIPVSVADDDAEDAAAAEGSDSASASAEELQKKREEDFDAFTSTKSQDLAQ  153

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV A +PF IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ S++G K  RLGSVSD
Sbjct  154  PLVAAQIPFKIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-SRKGGK-GRLGSVSD  211

Query  729  YcvhhcicpvvvvRYPDGDGG--GGAATEVVVDLHPVPEDKEYEYHDNAD  872
            YCVHHC+CPVVVVRYPD   G  G AA     +LH VPED E  YHD  D
Sbjct  212  YCVHHCVCPVVVVRYPDDAAGIPGEAAAAATDELHTVPED-EPVYHDAPD  260



>ref|XP_004232777.1| PREDICTED: uncharacterized protein LOC101247579 [Solanum lycopersicum]
Length=234

 Score =   211 bits (537),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 151/217 (70%), Gaps = 14/217 (6%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYG  428
            P  PR      +    R+VAIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT+VLYG
Sbjct  22   PASPRFHLGTPNSGANRKVAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPTSVLYG  81

Query  429  ADWGISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVK  593
            ADWG       A      TA EE     ED  D+ T+ K+  LA+PLV AN+PF IHIVK
Sbjct  82   ADWG-------AIDVSVDTANEESQRKLEDDFDNFTTTKSNDLAQPLVEANIPFKIHIVK  134

Query  594  DHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRY  773
            DHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R  K   LGSVSDYCVHHC+CPVVVVRY
Sbjct  135  DHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRSPKGGMLGSVSDYCVHHCVCPVVVVRY  193

Query  774  PDGDGGGGAATEVVVDLHPVPEDKEYEYHDNADDEVD  884
            PD          V   LHPVPE+ E  YHD +D   D
Sbjct  194  PDDKDATTGNDSVTDVLHPVPEE-EPIYHDASDKTAD  229



>ref|XP_008341946.1| PREDICTED: uncharacterized protein C167.05-like [Malus domestica]
Length=232

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppp  476
            R+VAIAVDLS+ESAFAVRWAV++YLRPGD V+LLHV+PT+VLYGADWG   P+D A    
Sbjct  31   RKVAIAVDLSEESAFAVRWAVQNYLRPGDTVILLHVRPTSVLYGADWGSVDPND-AVSSF  89

Query  477  pQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMI  656
             ++  + ED  D  T+ KA  LA+PLV A  PF IHIVKDHD+KERLCLEVERL LS +I
Sbjct  90   SESQQKLEDDFDAFTTTKAADLAQPLVEAQFPFKIHIVKDHDMKERLCLEVERLRLSVVI  149

Query  657  MGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP-DGDG-GGGAATEVVVDLHP  830
            MGSRGFG+ +KR  KV RLGSV+DYCVHHC+CPVVVVRYP D DG G G   +  VDLHP
Sbjct  150  MGSRGFGA-AKRAPKVGRLGSVTDYCVHHCVCPVVVVRYPDDSDGLGPGGEPDTPVDLHP  208

Query  831  VPEDKEYEYHDNADDEVDE  887
            VPE+   ++++ +  + D+
Sbjct  209  VPEEDPEDFNEGSSSDNDD  227



>ref|XP_010247876.1| PREDICTED: uncharacterized protein LOC104590820 isoform X1 [Nelumbo 
nucifera]
Length=242

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 167/246 (68%), Gaps = 27/246 (11%)
 Frame = +3

Query  195  EPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHY  368
            +P   RP   + P   + P  P  F+   +PT    R++AIAVDLSDESAFAV+WAV++Y
Sbjct  7    QPESDRPATTIQP---SSPRFP--FSASGTPTSGAHRKIAIAVDLSDESAFAVKWAVQNY  61

Query  369  LRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAE  548
            LRPGD V+LLHV+PT+VLYGADWG     D +     ++  + ED  D  T+ KA  LA+
Sbjct  62   LRPGDAVILLHVRPTSVLYGADWG---SIDLSVETDEESQQKLEDDFDAFTTTKATDLAQ  118

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV A +PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR SK  RLGSVSD
Sbjct  119  PLVEAQIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRTSK-GRLGSVSD  176

Query  729  YcvhhcicpvvvvRYPDGDGG--------------GGAATEVVVDLHPVPEDKEYEYHDN  866
            YCVHHC+CPVVVVRYPD   G                AA +   +LHPVPE+ E EYHD 
Sbjct  177  YCVHHCVCPVVVVRYPDEKDGASAAADAADSEAAAKAAAVDKEAELHPVPEE-EQEYHDA  235

Query  867  ADDEVD  884
            +D+  D
Sbjct  236  SDEHKD  241



>gb|EYU27879.1| hypothetical protein MIMGU_mgv1a012682mg [Erythranthe guttata]
Length=243

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 163/240 (68%), Gaps = 16/240 (7%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIA-PPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLR  374
            P   RP  +  P AI   P  PR  +   +    R++AIAVDLSDESAFAV+WAV++YLR
Sbjct  4    PNKPRPGNDRAPAAILHQPASPRFPSGTPTSGANRKIAIAVDLSDESAFAVKWAVQNYLR  63

Query  375  PGDGVVLLHVQPTAVLYGADWG-ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            PGD V+LLHV+PT+VLYGADWG I    D       Q   + ED  D+ T+ KA  LA+P
Sbjct  64   PGDAVILLHVRPTSVLYGADWGAIDLSVDTTDEKSQQ---KLEDDFDNFTTTKANDLAQP  120

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV A++PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R SK  RLGSVSDY
Sbjct  121  LVEASIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRTSK-GRLGSVSDY  178

Query  732  cvhhcicpvvvvRYPD----GDGGGGAATEVVVD-----LHPVPEDKEYEYHDNADDEVD  884
            CVHHC+CPVVVVR+PD    GD      +   VD     LH VPE++E  + D +D   D
Sbjct  179  CVHHCVCPVVVVRFPDEKDEGDASTAGGSSKAVDKDALGLHTVPEEEEPLFLDASDKNAD  238



>ref|XP_009419600.1| PREDICTED: uncharacterized protein LOC103999547 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=248

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 162/240 (68%), Gaps = 22/240 (9%)
 Frame = +3

Query  219  RNVTPLAIAPPLLPRVF---TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGV  389
            R   P AI P   PR F       SP   RR+AIAVDLSDESA+AV+WAV++YLRPGD V
Sbjct  12   RQGRPPAIEPSS-PRFFLSAAAAASPGSHRRIAIAVDLSDESAYAVKWAVQNYLRPGDAV  70

Query  390  VLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANV  569
            +LLHV+ T++LYGADWG    S  A P    +  + E+  D  TS KA+ LA+PLV A +
Sbjct  71   ILLHVRSTSILYGADWGAIDLSVSADPDSELSQQKLEEDFDAFTSTKAQDLAQPLVEAQI  130

Query  570  PFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhci  749
            PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R SK  RLGSVSDYCVHHC+
Sbjct  131  PFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRSSK-SRLGSVSDYCVHHCV  188

Query  750  cpvvvvRYPDG---------------DGGGGAATEVVVDLHPVPEDKEYEYHDNADDEVD  884
            CPVVVVR+PD                D G     E  V+LHPVPE+ E EYHD  D+  D
Sbjct  189  CPVVVVRFPDDGTGVGLGPGGSSAPLDNGATLPLEKDVELHPVPEE-EQEYHDATDEHKD  247



>ref|XP_010247877.1| PREDICTED: uncharacterized protein LOC104590820 isoform X2 [Nelumbo 
nucifera]
Length=242

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 166/243 (68%), Gaps = 27/243 (11%)
 Frame = +3

Query  195  EPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHY  368
            +P   RP   + P   + P  P  F+   +PT    R++AIAVDLSDESAFAV+WAV++Y
Sbjct  7    QPESDRPATTIQP---SSPRFP--FSASGTPTSGAHRKIAIAVDLSDESAFAVKWAVQNY  61

Query  369  LRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAE  548
            LRPGD V+LLHV+PT+VLYGADWG     D +     ++  + ED  D  T+ KA  LA+
Sbjct  62   LRPGDAVILLHVRPTSVLYGADWG---SIDLSVETDEESQQKLEDDFDAFTTTKATDLAQ  118

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV A +PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR SK  RLGSVSD
Sbjct  119  PLVEAQIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRTSK-GRLGSVSD  176

Query  729  YcvhhcicpvvvvRYPDGDGG--------------GGAATEVVVDLHPVPEDKEYEYHDN  866
            YCVHHC+CPVVVVRYPD   G                AA +   +LHPVPE+ E EYHD 
Sbjct  177  YCVHHCVCPVVVVRYPDEKDGASAAADAADSEAAAKAAAVDKEAELHPVPEE-EQEYHDA  235

Query  867  ADD  875
            +D+
Sbjct  236  SDE  238



>ref|XP_009419601.1| PREDICTED: uncharacterized protein LOC103999547 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=247

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 161/237 (68%), Gaps = 22/237 (9%)
 Frame = +3

Query  219  RNVTPLAIAPPLLPRVF---TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGV  389
            R   P AI P   PR F       SP   RR+AIAVDLSDESA+AV+WAV++YLRPGD V
Sbjct  12   RQGRPPAIEPSS-PRFFLSAAAAASPGSHRRIAIAVDLSDESAYAVKWAVQNYLRPGDAV  70

Query  390  VLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANV  569
            +LLHV+ T++LYGADWG    S  A P    +  + E+  D  TS KA+ LA+PLV A +
Sbjct  71   ILLHVRSTSILYGADWGAIDLSVSADPDSELSQQKLEEDFDAFTSTKAQDLAQPLVEAQI  130

Query  570  PFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhci  749
            PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R SK  RLGSVSDYCVHHC+
Sbjct  131  PFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRSSK-SRLGSVSDYCVHHCV  188

Query  750  cpvvvvRYPDG---------------DGGGGAATEVVVDLHPVPEDKEYEYHDNADD  875
            CPVVVVR+PD                D G     E  V+LHPVPE+ E EYHD  D+
Sbjct  189  CPVVVVRFPDDGTGVGLGPGGSSAPLDNGATLPLEKDVELHPVPEE-EQEYHDATDE  244



>gb|AID16047.1| putative universal stress protein [Catharanthus roseus]
Length=277

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 143/250 (57%), Positives = 175/250 (70%), Gaps = 27/250 (11%)
 Frame = +3

Query  177  QKSVHFEPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPT--QRRRVAIAVDLSDESAFAVR  350
            Q+     P    PVR++ P+ + PP  PR+     +PT    RR+AIAVDLSDESAFAV+
Sbjct  5    QQKNQNRPKPESPVRHLHPVQVKPPPSPRLSVSPSTPTFAANRRIAIAVDLSDESAFAVK  64

Query  351  WAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSD---------HApppppQTAAEE--  497
            W++++YLRPGD V+LLHV+PT+VLYGADWG STP +         +A P    T   E  
Sbjct  65   WSIQNYLRPGDAVILLHVRPTSVLYGADWGSSTPPNTIPPPTSPFNATPTTISTPEREQL  124

Query  498  EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFG  677
            ED  D+ T+ KA +LA+PL  A +PF IHIVKDHDLKERLCLEVERLGLSA+IMGSRGFG
Sbjct  125  EDDFDNFTNTKATNLAQPLAEAQIPFKIHIVKDHDLKERLCLEVERLGLSAVIMGSRGFG  184

Query  678  SPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAAT-----EVV------VDL  824
            + SKR SK  RLGSVSDYCVHHC+CPVVVVRYP+  G GG+ +     E+V       +L
Sbjct  185  A-SKRNSK-GRLGSVSDYCVHHCVCPVVVVRYPEDGGSGGSGSGGNRLEIVKRAQSEAEL  242

Query  825  HPVP-EDKEY  851
            HPVP ED+EY
Sbjct  243  HPVPEEDQEY  252



>ref|XP_007149923.1| hypothetical protein PHAVU_005G110500g [Phaseolus vulgaris]
 gb|ESW21917.1| hypothetical protein PHAVU_005G110500g [Phaseolus vulgaris]
Length=225

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 162/220 (74%), Gaps = 11/220 (5%)
 Frame = +3

Query  249  PLLPRVFTP--VLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P +P  F+P   L+   +R++AIAVDLSDESA AVRWAV++YLRPGD V+LLHV+PT+VL
Sbjct  8    PSVP-TFSPRFALTTGSQRKIAIAVDLSDESAHAVRWAVQNYLRPGDAVILLHVRPTSVL  66

Query  423  YGADWG---ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVK  593
            YGADWG   +S   +       ++  + ED  D+ T+ KA  +A+PLV A +PF IHIVK
Sbjct  67   YGADWGSVDLSVAEEGGAGGDEESQRKLEDYFDNFTTTKASDVAQPLVEAQIPFKIHIVK  126

Query  594  DHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRY  773
            DHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR +K  RLGSVSDYCVHHC+CPVVVVRY
Sbjct  127  DHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRAAK-GRLGSVSDYCVHHCVCPVVVVRY  184

Query  774  P-DGDGGGGAATEV--VVDLHPVPEDKEYEYHDNADDEVD  884
            P + D G G    V   V+L PVPE++   YHD +D+  D
Sbjct  185  PEENDNGNGRGVLVGEQVELPPVPEEENEVYHDASDEHRD  224



>ref|XP_006347162.1| PREDICTED: uncharacterized protein C167.05-like [Solanum tuberosum]
Length=231

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 149/208 (72%), Gaps = 4/208 (2%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYG  428
            P  PR      +    R+VAIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT+VLYG
Sbjct  23   PASPRFHLGTPTSGANRKVAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPTSVLYG  82

Query  429  ADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLK  608
            ADWG    S        ++  + ED  D+ T+ K+  LA+PLV AN+PF IHIVKDHD+K
Sbjct  83   ADWGAIDVS--VDTENEESQRKLEDDFDNFTTTKSNDLAQPLVEANIPFKIHIVKDHDMK  140

Query  609  ERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDG  788
            ERLCLEVERLGLSA+IMGSRGFG+ S+R  K   LGSVSDYCVHHC+CPVVVVRYPD   
Sbjct  141  ERLCLEVERLGLSAVIMGSRGFGA-SRRSPKGGMLGSVSDYCVHHCVCPVVVVRYPDDKD  199

Query  789  GGGAATEVVVDLHPVPEDKEYEYHDNAD  872
                   V   LHPVPE+ E  YHD +D
Sbjct  200  ATSGNDSVTDVLHPVPEE-EPIYHDASD  226



>ref|XP_006833097.1| hypothetical protein AMTR_s00072p00034700 [Amborella trichopoda]
 gb|ERM98375.1| hypothetical protein AMTR_s00072p00034700 [Amborella trichopoda]
Length=241

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 156/208 (75%), Gaps = 20/208 (10%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            +R++AIAVDLSDESAFAV+WAV++YLRPGD V+LLHV+PT+VLYGADWG     D +   
Sbjct  15   QRKIAIAVDLSDESAFAVKWAVQNYLRPGDNVILLHVRPTSVLYGADWG---SIDLSVDT  71

Query  474  ppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAM  653
              ++  + ED  D  T+ KA  LA+PLV A +PF IHIVKDHD+KERLCLEVERLGLSA+
Sbjct  72   DEESQQKLEDDFDTFTTTKATDLAQPLVEAQIPFKIHIVKDHDMKERLCLEVERLGLSAV  131

Query  654  IMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD-GDGGGGAATEVVV----  818
            IMGSRGFG+ SKR SK  RLGSVSDYCVHHC+CPVVVVR+PD  DG GGA    V     
Sbjct  132  IMGSRGFGA-SKRNSK-GRLGSVSDYCVHHCVCPVVVVRFPDEKDGQGGAQVSGVGGGEV  189

Query  819  --------DLHPVPEDKEYEYHDNADDE  878
                    +LHPVPE+ E EYH +AD++
Sbjct  190  VKKVEKDPELHPVPEE-EQEYH-SADEQ  215



>emb|CDO99659.1| unnamed protein product [Coffea canephora]
Length=240

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 154/221 (70%), Gaps = 16/221 (7%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYG  428
            P  PR  +   +    R++AIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT+VLYG
Sbjct  22   PASPRFPSGTPTSGANRKIAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPTSVLYG  81

Query  429  ADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLK  608
            ADWG    S        ++  + ED  D+LT+ KA  LA+PLV AN+PF IHIVKDHD+K
Sbjct  82   ADWG----SVDLSVTDEESQQKMEDDFDNLTTTKANDLAQPLVEANIPFKIHIVKDHDMK  137

Query  609  ERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDG  788
            ERLCLEVERLGLSA+IMGSRGFG  + R S   RLGSVSDYCVHHC+CPVVVVRYPD   
Sbjct  138  ERLCLEVERLGLSAVIMGSRGFG--AARRSTKGRLGSVSDYCVHHCVCPVVVVRYPDEKD  195

Query  789  GGGAATEVVVD---------LHPVPEDKEYEYHDNADDEVD  884
            G     E +           LHPVPE+ E  YHD++D   D
Sbjct  196  GASDVGEGLKKSGELKNLEGLHPVPEE-EPIYHDSSDKATD  235



>ref|XP_009773853.1| PREDICTED: uncharacterized protein LOC104224003 isoform X1 [Nicotiana 
sylvestris]
Length=254

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 159/220 (72%), Gaps = 9/220 (4%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLH  401
            +  + P  P   TP  + T     +R++ IAVDLSDESAFAV+WAV HYLRPGD V+LLH
Sbjct  21   VKCSSPRFPPPTTPSAAETPTAGAQRKIGIAVDLSDESAFAVKWAVHHYLRPGDAVILLH  80

Query  402  VQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTI  581
            V+PT+VLYGADWG S       P   ++  + ED  D+ T+ K+  LA+PLV+A +P+ I
Sbjct  81   VRPTSVLYGADWG-SVDLSIIDPDNVESHRKLEDDFDNFTATKSSALAQPLVDAQIPYKI  139

Query  582  HIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvv  761
            HIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ +KRG+   RLGSVSDYCV HC+CPVV
Sbjct  140  HIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-TKRGND-GRLGSVSDYCVRHCVCPVV  197

Query  762  vvRYPDGDGGGGAATEVVVDLHPVPE--DKEYEYHDNADD  875
            VVRYPD   GG AA + VV +    +  ++E EYHD +DD
Sbjct  198  VVRYPDEKDGGNAARKPVVSVASAAKENEEETEYHDASDD  237



>ref|XP_009773854.1| PREDICTED: uncharacterized protein LOC104224003 isoform X2 [Nicotiana 
sylvestris]
Length=253

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 159/220 (72%), Gaps = 9/220 (4%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLH  401
            +  + P  P   TP  + T     +R++ IAVDLSDESAFAV+WAV HYLRPGD V+LLH
Sbjct  21   VKCSSPRFPPPTTPSAAETPTAGAQRKIGIAVDLSDESAFAVKWAVHHYLRPGDAVILLH  80

Query  402  VQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTI  581
            V+PT+VLYGADWG S       P   ++  + ED  D+ T+ K+  LA+PLV+A +P+ I
Sbjct  81   VRPTSVLYGADWG-SVDLSIIDPDNVESHRKLEDDFDNFTATKSSALAQPLVDAQIPYKI  139

Query  582  HIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvv  761
            HIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ +KRG+   RLGSVSDYCV HC+CPVV
Sbjct  140  HIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-TKRGND-GRLGSVSDYCVRHCVCPVV  197

Query  762  vvRYPDGDGGGGAATEVVVDLHPVPE--DKEYEYHDNADD  875
            VVRYPD   GG AA + VV +    +  ++E EYHD +DD
Sbjct  198  VVRYPDEKDGGNAARKPVVSVASAAKENEEETEYHDASDD  237



>emb|CDP11872.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 167/247 (68%), Gaps = 35/247 (14%)
 Frame = +3

Query  159  HHHQQHQKSVHFEPGYRRPVRNVT---PLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSD  329
            HHH      V  +P    P  ++T   P +++P          L+PT RR +AIAVDLSD
Sbjct  9    HHHPNLLPPVQVKPPPTSPAFSITFSTPTSVSP----------LTPTHRR-IAIAVDLSD  57

Query  330  ESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAE-----  494
            ESAFAV+WA+ +YLRPGD V+LLHV+PT++LYGADWG STP+    PP     A      
Sbjct  58   ESAFAVKWAIENYLRPGDAVILLHVRPTSILYGADWGSSTPTSTVTPPSSPFQAHATSHD  117

Query  495  ---EEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGS  665
               EED  D+LT++KA  LA+PLV A+VPF IHIVKDHDLKERLCLEVERLGLSA+IMGS
Sbjct  118  QKLEEDF-DNLTNSKATGLAQPLVEAHVPFKIHIVKDHDLKERLCLEVERLGLSAVIMGS  176

Query  666  RGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP-DGDGGGGAATEVVVD-------  821
            RGFG+ S++ SK  RLGSVSDYCVHHC+CPVVVVRYP D + G     EVV         
Sbjct  177  RGFGA-SRKNSK-GRLGSVSDYCVHHCVCPVVVVRYPGDNNEGRNGGVEVVKKTAAVINE  234

Query  822  --LHPVP  836
              LHP+P
Sbjct  235  AVLHPLP  241



>ref|XP_004248282.1| PREDICTED: uncharacterized protein LOC101247371 [Solanum lycopersicum]
Length=253

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 154/219 (70%), Gaps = 9/219 (4%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLH  401
            +  + P  P   TP  + T     +R++ IAVDLSDESAFAV+WAV HYLRPGD V+L+H
Sbjct  21   IKCSSPRFPPPTTPSATDTPTAGAQRKIGIAVDLSDESAFAVKWAVHHYLRPGDAVILVH  80

Query  402  VQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTI  581
            V+PT+VLYGADWG S     A     +T  + ED  D  TSAK+  LA+PLV A +P+ I
Sbjct  81   VRPTSVLYGADWG-SVDVSIADTDNIETQKKLEDDFDAFTSAKSSDLAQPLVEAQIPYKI  139

Query  582  HIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvv  761
            HIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ +KRG+   RLGSVSDYCV HC+CPVV
Sbjct  140  HIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-TKRGND-GRLGSVSDYCVRHCVCPVV  197

Query  762  vvRYPDGDGGGGAATE--VVVDLHPVPEDKEYEYHDNAD  872
            VVRYPD   GG AA +  V V       ++E EYHD  D
Sbjct  198  VVRYPDEKDGGNAARKGGVPVASASKENEEEGEYHDACD  236



>ref|XP_009597385.1| PREDICTED: uncharacterized protein LOC104093361 isoform X2 [Nicotiana 
tomentosiformis]
Length=253

 Score =   206 bits (525),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 158/220 (72%), Gaps = 9/220 (4%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLH  401
            +  + P  P   TP  + T     +R++ IAVDLSDESAFAV+WAV HYLRPGD V+LLH
Sbjct  21   VKCSSPRFPPPTTPSATETPTAGAQRKIGIAVDLSDESAFAVKWAVHHYLRPGDAVILLH  80

Query  402  VQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTI  581
            V+PT+VLYGADWG S       P   ++  + ED  D+ T+ K+  LA+PLV+A +P+ I
Sbjct  81   VRPTSVLYGADWG-SVDLSIIDPDNEESHRKLEDDFDNFTATKSSALAQPLVDAQIPYKI  139

Query  582  HIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvv  761
            HIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ +KRG+   RLGSVSDYCV HC+CPVV
Sbjct  140  HIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-TKRGND-GRLGSVSDYCVRHCVCPVV  197

Query  762  vvRYPDGDGGGGAATEVVVDLHPV--PEDKEYEYHDNADD  875
            VVRYPD   GG AA + +V +       ++E EYHD +DD
Sbjct  198  VVRYPDEKDGGNAARKQLVSVASAVKENEEETEYHDASDD  237



>ref|XP_009597384.1| PREDICTED: uncharacterized protein LOC104093361 isoform X1 [Nicotiana 
tomentosiformis]
Length=254

 Score =   206 bits (525),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 158/220 (72%), Gaps = 9/220 (4%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLH  401
            +  + P  P   TP  + T     +R++ IAVDLSDESAFAV+WAV HYLRPGD V+LLH
Sbjct  21   VKCSSPRFPPPTTPSATETPTAGAQRKIGIAVDLSDESAFAVKWAVHHYLRPGDAVILLH  80

Query  402  VQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTI  581
            V+PT+VLYGADWG S       P   ++  + ED  D+ T+ K+  LA+PLV+A +P+ I
Sbjct  81   VRPTSVLYGADWG-SVDLSIIDPDNEESHRKLEDDFDNFTATKSSALAQPLVDAQIPYKI  139

Query  582  HIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvv  761
            HIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ +KRG+   RLGSVSDYCV HC+CPVV
Sbjct  140  HIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-TKRGND-GRLGSVSDYCVRHCVCPVV  197

Query  762  vvRYPDGDGGGGAATEVVVDLHPV--PEDKEYEYHDNADD  875
            VVRYPD   GG AA + +V +       ++E EYHD +DD
Sbjct  198  VVRYPDEKDGGNAARKQLVSVASAVKENEEETEYHDASDD  237



>ref|XP_006362927.1| PREDICTED: uncharacterized protein C167.05-like isoform X2 [Solanum 
tuberosum]
Length=251

 Score =   206 bits (525),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 155/223 (70%), Gaps = 9/223 (4%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLH  401
            +  + P  P   TP  + T     +R++ IAVDLSDESAFAV+WAV HYLRPGD V+LLH
Sbjct  21   IKCSSPRFPPPTTPSATDTPTAGAQRKIGIAVDLSDESAFAVKWAVHHYLRPGDAVILLH  80

Query  402  VQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTI  581
            V+PT+VLYGADWG S           ++  + ED  D  TSAK+  LA+PLV   +P+ I
Sbjct  81   VRPTSVLYGADWG-SVDLSIVDTDNIESQKKLEDDFDAFTSAKSADLAQPLVEVQIPYKI  139

Query  582  HIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvv  761
            HIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ +KRG+   RLGSVSDYCV HC+CPVV
Sbjct  140  HIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-TKRGND-GRLGSVSDYCVRHCVCPVV  197

Query  762  vvRYPDGDGGGGAATEVVVDLHPVPE--DKEYEYHDNADDEVD  884
            VVRYPD   GG AA +  V +    +  ++E EYHD  DD  D
Sbjct  198  VVRYPDEKDGGNAARKRGVSVASASKEHEEEGEYHDACDDRQD  240



>gb|KHG28425.1| Uncharacterized protein F383_15197 [Gossypium arboreum]
 gb|KHG28426.1| Uncharacterized protein F383_15197 [Gossypium arboreum]
Length=255

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 159/230 (69%), Gaps = 32/230 (14%)
 Frame = +3

Query  249  PLLPRV-FTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLY  425
            P  PR  F+  ++ +QRR +AIAVDLSDESA+AVRWAV++YLRPGD VVLLHV+PT+VLY
Sbjct  25   PSSPRFPFSTPIAGSQRR-IAIAVDLSDESAYAVRWAVQNYLRPGDAVVLLHVRPTSVLY  83

Query  426  GADWG-----------------ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPL  554
            GADWG                  +   DH+     Q     E+  D  T+ KA  LA+PL
Sbjct  84   GADWGSIKLQITPNSTNNHENATAISGDHSDEESQQKL---ENDFDVFTTTKANTLAQPL  140

Query  555  VNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYc  734
            V+A +PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R  K  RLGSVSDYC
Sbjct  141  VDAQIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRTCK-GRLGSVSDYC  198

Query  735  vhhcicpvvvvRYPDGDGGGGAATEVV-------VDLHPVPEDKEYEYHD  863
            VHHCICPVVVVRYPD + G G A +V        V+L PVPE+ E E HD
Sbjct  199  VHHCICPVVVVRYPDEENGNGGAEKVTKKNIVEDVELQPVPEE-EQECHD  247



>ref|XP_004243417.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=216

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 156/224 (70%), Gaps = 21/224 (9%)
 Frame = +3

Query  240  IAPPLLPRVFTPVLSPT-----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHV  404
            +  PLL    + ++SP        RRVAIAVDLSDESAFAV+WAV++YLRPGD V+LLHV
Sbjct  1    MTQPLLKLTNSLLISPNFSLSAAHRRVAIAVDLSDESAFAVKWAVQNYLRPGDAVILLHV  60

Query  405  QPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIH  584
            +PT+VLYGADWG ++ S          A + E   +  T+ KA  LA PLV ANVPF IH
Sbjct  61   RPTSVLYGADWGSTSTS---------PAHKIERDYEIFTNNKATELAVPLVEANVPFKIH  111

Query  585  IVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVE-RLGSVSDYcvhhcicpvv  761
            IVKD D+KERLCLEVERL LSAMIMGSRGFG    RG   + +LGSVSDYCV +CICPVV
Sbjct  112  IVKDRDMKERLCLEVERLRLSAMIMGSRGFGENESRGIVSKGKLGSVSDYCVKNCICPVV  171

Query  762  vvRYPDGDGGGGAATE----VVVDLHPVPEDKEYEYHDNADDEV  881
            VVRYP  D  G  A E    +  +L PVPE+ E+EYHD ADDE+
Sbjct  172  VVRYPQQDEYGDGAVEKKAAIEAELPPVPEE-EHEYHD-ADDEL  213



>ref|XP_008813303.1| PREDICTED: uncharacterized protein LOC103723977 [Phoenix dactylifera]
Length=270

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 154/218 (71%), Gaps = 25/218 (11%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHAp  467
            RR+AIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT+VLYGADWG   +S  ++ A 
Sbjct  55   RRIAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPTSVLYGADWGSIDLSVSANAAA  114

Query  468  ppppQTAAEE---EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERL  638
                 +   +   ED  D  T+ KA+ LA+PLV A +PF IHIVKDHD+KERLCLEVERL
Sbjct  115  AEEVDSEESQRKLEDDFDAFTTTKAQDLAQPLVEAQIPFKIHIVKDHDMKERLCLEVERL  174

Query  639  GLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDG----------  788
            GLSA+IMGSRGFG+ S+R SK  RLGSVSDYCVHHC+CPVVVVRYPD             
Sbjct  175  GLSAVIMGSRGFGA-SRRTSK-GRLGSVSDYCVHHCVCPVVVVRYPDEGSGAGAGAGCIA  232

Query  789  ------GGGAATEVVVDLHPVPEDKEYEYHDNADDEVD  884
                        E   +LHPVPE+ E EYHD +D++ D
Sbjct  233  DGGEAVAAKGILEKEAELHPVPEE-EQEYHDASDEQKD  269



>gb|KDP44611.1| hypothetical protein JCGZ_19753 [Jatropha curcas]
Length=248

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 159/227 (70%), Gaps = 20/227 (9%)
 Frame = +3

Query  243  APPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            +PP LP   T   +  QRR VAIAVDLSDESA AV+WAV +YLRPGD V+LLHV+PT+VL
Sbjct  23   SPPRLPISITTSTAGAQRR-VAIAVDLSDESAHAVKWAVNNYLRPGDAVILLHVRPTSVL  81

Query  423  YGADWG-----ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHI  587
            YGADWG     I+  +D A          E+D  D+ T+ K   LA+PLV A +PF I I
Sbjct  82   YGADWGSIKLQINDNNDSASLDESDEQKLEDDF-DNFTTIKTNSLAQPLVEAEIPFKIRI  140

Query  588  VKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvv  767
            VKDHD+KERLCLEVERLGLSA+IMGSRGFG+ ++R SK  RLGSVSDYCVHHCICPVVVV
Sbjct  141  VKDHDMKERLCLEVERLGLSAVIMGSRGFGA-ARRNSK-GRLGSVSDYCVHHCICPVVVV  198

Query  768  RYPD---GDGGGGAATEVV-------VDLHPVPEDKEYEYHDNADDE  878
            RYPD    DG  G    V         +LHPVPE+ + EYHD +D++
Sbjct  199  RYPDDGGSDGNSGKEGRVKKGIVGKEAELHPVPEEDQ-EYHDASDEQ  244



>ref|XP_010924024.1| PREDICTED: uncharacterized protein LOC105046969 [Elaeis guineensis]
Length=261

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 160/234 (68%), Gaps = 28/234 (12%)
 Frame = +3

Query  258  PRVF---TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYG  428
            PR F   T   SP   RR+AIAVDLSDESA+AVRWAV++YLRPGD V+LLHV+ T+VLYG
Sbjct  30   PRFFFSATAAASPGSHRRIAIAVDLSDESAYAVRWAVQNYLRPGDAVILLHVRSTSVLYG  89

Query  429  ADWG------ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIV  590
            ADWG       +  +        ++  + ED +D  T+ KA+ LA+PLV A +PF IHIV
Sbjct  90   ADWGSIDLSVSAAAAVAEEADSEESQQKLEDDLDAFTTTKAQDLAQPLVEAQIPFKIHIV  149

Query  591  KDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvR  770
            KDHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R SK  RLGSVSDYCVHHC+CPVVVVR
Sbjct  150  KDHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRTSK-GRLGSVSDYCVHHCVCPVVVVR  207

Query  771  YPD----------------GDGGGGAATEVVVDLHPVPEDKEYEYHDNADDEVD  884
            YPD                G  G     E   +LHPVPE+ E EYHD +D++ D
Sbjct  208  YPDEGSGAGAGAGSVADGGGVVGVRGTLEKEAELHPVPEE-EQEYHDASDEQKD  260



>ref|NP_001044454.1| Os01g0783500 [Oryza sativa Japonica Group]
 dbj|BAD53290.1| universal stress protein-like [Oryza sativa Japonica Group]
 dbj|BAF06368.1| Os01g0783500 [Oryza sativa Japonica Group]
 dbj|BAG92905.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 156/220 (71%), Gaps = 15/220 (7%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ---RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAV  419
            P  PR F   L+ T     RR+AIAVDLSDESA+AVRWAV++YLRPGD VVLLHV+PT+V
Sbjct  41   PTSPRYFFSSLAGTNASPHRRIAIAVDLSDESAYAVRWAVQNYLRPGDAVVLLHVRPTSV  100

Query  420  LYGADWG---ISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPF  575
            LYGADWG   +S   D      P  +AEE     E+  D  TS KAE LA+PLV+A +PF
Sbjct  101  LYGADWGSIPVSVSDDADGEVAPAASAEELQKKREEDFDAFTSTKAEDLAQPLVDAQIPF  160

Query  576  TIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicp  755
             IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ S++G K  RLGSVSDYCVHHC+CP
Sbjct  161  KIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-SRKGGK-GRLGSVSDYCVHHCVCP  218

Query  756  vvvvRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYHDNAD  872
            VVVVRYPD   G         D LH VPED E  YHD  D
Sbjct  219  VVVVRYPDDAAGADGEAAGPTDELHTVPED-EPVYHDAPD  257



>gb|EYU19169.1| hypothetical protein MIMGU_mgv1a011259mg [Erythranthe guttata]
 gb|EYU19170.1| hypothetical protein MIMGU_mgv1a011259mg [Erythranthe guttata]
Length=287

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 156/217 (72%), Gaps = 8/217 (4%)
 Frame = +3

Query  249  PLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            P  P   TP+ + T     +R++ IAVDLSDESA AV+W+V HYLRPGD V+L+HV+PT+
Sbjct  73   PRFPPPTTPLSTETPTAGAQRKIGIAVDLSDESAVAVKWSVHHYLRPGDAVILVHVRPTS  132

Query  417  VLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
            VLYGADWG S           ++  + ED  D  T+AK+  LA+PLV+A +PF IHIVKD
Sbjct  133  VLYGADWG-SVDLSIVDTDNEESQRKLEDDFDAFTTAKSADLAQPLVDAQIPFKIHIVKD  191

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD++ERLCLEVERLGLSA+IMGSRGFG+ +KRGS   RLGSVSDYCV HC+CPVVVVRYP
Sbjct  192  HDMRERLCLEVERLGLSALIMGSRGFGA-TKRGSD-GRLGSVSDYCVRHCVCPVVVVRYP  249

Query  777  DGDGGGGAATEVVVDLHPVPE-DKEYEYHDNADDEVD  884
            D     GAA + +V +    E D+E E+HD +DD  D
Sbjct  250  DEKDTAGAAVQPIVSVASAAEDDEEPEFHDASDDRKD  286



>gb|EEC71603.1| hypothetical protein OsI_04001 [Oryza sativa Indica Group]
Length=329

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 156/220 (71%), Gaps = 15/220 (7%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ---RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAV  419
            P  PR F   L+ T     RR+AIAVDLSDESA+AVRWAV++YLRPGD VVLLHV+PT+V
Sbjct  41   PTSPRYFFSSLAGTNASPHRRIAIAVDLSDESAYAVRWAVQNYLRPGDAVVLLHVRPTSV  100

Query  420  LYGADWG---ISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPF  575
            LYGADWG   +S   D      P  +AEE     E+  D  TS KAE LA+PLV+A +PF
Sbjct  101  LYGADWGSIPVSVSDDADGEVAPAASAEELQKKREEDFDAFTSTKAEDLAQPLVDAQIPF  160

Query  576  TIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicp  755
             IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ S++G K  RLGSVSDYCVHHC+CP
Sbjct  161  KIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-SRKGGK-GRLGSVSDYCVHHCVCP  218

Query  756  vvvvRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYHDNAD  872
            VVVVRYPD   G         D LH VPED E  YHD  D
Sbjct  219  VVVVRYPDDAAGADGEAAGPTDELHTVPED-EPVYHDAPD  257



>ref|XP_010268920.1| PREDICTED: uncharacterized protein LOC104605731 [Nelumbo nucifera]
 ref|XP_010268921.1| PREDICTED: uncharacterized protein LOC104605731 [Nelumbo nucifera]
Length=241

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 163/243 (67%), Gaps = 22/243 (9%)
 Frame = +3

Query  195  EPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLR  374
            +P   RP   + P +   PL P V TP  +    R++AIAVDLSDESAFAV+WAV++YLR
Sbjct  7    KPESDRPALIIQPSSPRFPL-PSVGTP--TSGAHRKIAIAVDLSDESAFAVKWAVQNYLR  63

Query  375  PGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPL  554
            PGD V+LLHV+ T VLYGADWG     D +     ++  + ED  D  T+ K  +LA+PL
Sbjct  64   PGDAVILLHVRTTGVLYGADWG---SIDLSVDTNDESQQKLEDDFDAFTTTKVTNLAQPL  120

Query  555  VNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYc  734
            V A +PF +HIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR SK  RLGSVSDYC
Sbjct  121  VEARIPFKLHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRTSK-GRLGSVSDYC  178

Query  735  vhhcicpvvvvRYPDGDGGGGA-------------ATEVVVDLHPVPEDKEYEYHDNADD  875
            VHHCICPVVVVRYPD   G  +               +  V+LH VPE+ E EYHD +D 
Sbjct  179  VHHCICPVVVVRYPDEKDGASSVAVAADPEAAAKAVADTEVELHLVPEE-EQEYHDASDK  237

Query  876  EVD  884
              D
Sbjct  238  HKD  240



>ref|XP_008348125.1| PREDICTED: uncharacterized protein LOC103411258 [Malus domestica]
Length=230

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 158/218 (72%), Gaps = 8/218 (4%)
 Frame = +3

Query  249  PLLPRVFTPVLSPT---QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAV  419
            P  PR+ T  ++PT     R+VAIAVDLS+ESAFAVRWAV++YLRPGD VVLL V+PT+V
Sbjct  11   PSXPRLTT-TITPTPDGTHRKVAIAVDLSEESAFAVRWAVQNYLRPGDSVVLLXVRPTSV  69

Query  420  LYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDH  599
            LYGADWG   P+D A     ++  + ED  D   + KA  LA+PLV A  PF IHIVKDH
Sbjct  70   LYGADWGSVDPND-AVCSSSESQQKLEDDFDAFITTKAADLAQPLVEAQFPFKIHIVKDH  128

Query  600  DLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD  779
            D+KERLCLEVERL LS +IMGSRGFG+ +KR +KV RLGSV+DYCV HC+ PVVVVRYPD
Sbjct  129  DMKERLCLEVERLWLSVVIMGSRGFGA-AKRAAKVGRLGSVTDYCVQHCVRPVVVVRYPD  187

Query  780  GDGGGGAATEV--VVDLHPVPEDKEYEYHDNADDEVDE  887
               G GA  E    V+LHPVPE+   E++D +  + +E
Sbjct  188  DSVGSGAGGEPDGPVELHPVPEEDPEEFNDGSSSDNNE  225



>ref|XP_010931886.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
 ref|XP_010931887.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=255

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 152/218 (70%), Gaps = 24/218 (11%)
 Frame = +3

Query  258  PRVF---TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYG  428
            PR F   T   SP   RR+AIAVDLSDESA+AVRWAV++YLRPGD V+LLHV+PT+VLYG
Sbjct  30   PRFFFSATAAASPGSHRRIAIAVDLSDESAYAVRWAVQNYLRPGDAVILLHVRPTSVLYG  89

Query  429  ADWG-------ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHI  587
            ADWG           +    P   ++  + ED  D  T+ KA+ LA+PLV A +PF IHI
Sbjct  90   ADWGSIDQSVSAVAAAPAKDPDSDESQQKMEDDFDAFTTTKAQDLAQPLVEAQIPFKIHI  149

Query  588  VKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvv  767
            VKDHD+KERLCLEVERLGLSA+IMGSRGFG+ S+R SK  RLGSVSDYCVHHC+CPVVVV
Sbjct  150  VKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SRRSSK-SRLGSVSDYCVHHCVCPVVVV  207

Query  768  RYP-DGDGGGGAATEVVVD-----------LHPVPEDK  845
            RYP DG G G      +VD           L PVPE++
Sbjct  208  RYPDDGTGAGSRTRRSLVDCGNGTTGKDSELQPVPEEE  245



>ref|XP_003597072.1| hypothetical protein MTR_2g089350 [Medicago truncatula]
 gb|AES67323.1| universal stress family protein [Medicago truncatula]
Length=226

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 158/215 (73%), Gaps = 9/215 (4%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYG  428
            P  P  F+  L     R+VAIAVDLSDESA+AVRWAV++YLRPGD V+LLHV+PT VLYG
Sbjct  11   PDQPARFS--LPSGSNRKVAIAVDLSDESAYAVRWAVQNYLRPGDTVILLHVRPTYVLYG  68

Query  429  ADWG-ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDL  605
            ADWG +++P+        ++  + ED  D+ TS KA  LA+PLV +  PF IHIVKDHD+
Sbjct  69   ADWGSVTSPTADGGDASEESRQKMEDEFDNFTSTKATDLAQPLVESETPFKIHIVKDHDM  128

Query  606  KERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD  785
            KERLCLEVERLGLSA+IMGSRGFG+ +KR S   +LGSVSDYCV HC+CPVVVVRYP+  
Sbjct  129  KERLCLEVERLGLSAVIMGSRGFGA-TKRSSN-GKLGSVSDYCVRHCVCPVVVVRYPEES  186

Query  786  GGGGAATE----VVVDLHPVPEDKEYEYHDNADDE  878
             GGGA  E      V+LHPV E++  + + +ADD+
Sbjct  187  NGGGAGVEGNDGEKVELHPVIEEEHEDEYHDADDD  221



>emb|CDM84442.1| unnamed protein product [Triticum aestivum]
 emb|CDM84505.1| unnamed protein product [Triticum aestivum]
Length=278

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 155/231 (67%), Gaps = 28/231 (12%)
 Frame = +3

Query  249  PLLPRVFTPVLS---PTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAV  419
            P  PR F   L+    +  RR+AIAVDLSDESAFAVRWAV++YLRPGD VVLLHV+PT+V
Sbjct  34   PSSPRYFFSSLAGKDASSHRRIAIAVDLSDESAFAVRWAVQNYLRPGDAVVLLHVRPTSV  93

Query  420  LYGADWGISTP-------------------SDHApppppQTAAEEEDIIDDLTSAKAEHL  542
            LYGADWG S P                   SD A          EED  D  TS K++ L
Sbjct  94   LYGADWG-SIPVSVSDDDADDAAVAVAAEGSDPAASAEELQKKREEDF-DAFTSTKSQDL  151

Query  543  AEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSV  722
            A+PLV A +PF IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ S++G K  RLGSV
Sbjct  152  AQPLVAAQIPFKIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-SRKGGK-GRLGSV  209

Query  723  SDYcvhhcicpvvvvRYPDGDGG-GGAATEVVVDLHPVPEDKEYEYHDNAD  872
            SDYCVHHC+CPVVVVRYPD   G  G A     +LH VPED E  YHD  D
Sbjct  210  SDYCVHHCVCPVVVVRYPDDAAGIPGEAAAATDELHTVPED-EPVYHDAPD  259



>ref|XP_006362926.1| PREDICTED: uncharacterized protein C167.05-like isoform X1 [Solanum 
tuberosum]
Length=253

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 154/220 (70%), Gaps = 9/220 (4%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLH  401
            +  + P  P   TP  + T     +R++ IAVDLSDESAFAV+WAV HYLRPGD V+LLH
Sbjct  21   IKCSSPRFPPPTTPSATDTPTAGAQRKIGIAVDLSDESAFAVKWAVHHYLRPGDAVILLH  80

Query  402  VQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTI  581
            V+PT+VLYGADWG S           ++  + ED  D  TSAK+  LA+PLV   +P+ I
Sbjct  81   VRPTSVLYGADWG-SVDLSIVDTDNIESQKKLEDDFDAFTSAKSADLAQPLVEVQIPYKI  139

Query  582  HIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvv  761
            HIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ +KRG+   RLGSVSDYCV HC+CPVV
Sbjct  140  HIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-TKRGND-GRLGSVSDYCVRHCVCPVV  197

Query  762  vvRYPDGDGGGGAATEVVVDLHPVPE--DKEYEYHDNADD  875
            VVRYPD   GG AA +  V +    +  ++E EYHD  DD
Sbjct  198  VVRYPDEKDGGNAARKRGVSVASASKEHEEEGEYHDACDD  237



>ref|XP_009385068.1| PREDICTED: uncharacterized protein LOC103972450 [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 159/236 (67%), Gaps = 25/236 (11%)
 Frame = +3

Query  243  APPLL----PRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQP  410
            APPL     P  F    S   +RR+AIAVDLSDESA+AVRWAV++YLRPGD V+LLHV+P
Sbjct  15   APPLRTQPSPPRFITYASAGSQRRIAIAVDLSDESAYAVRWAVQNYLRPGDAVILLHVRP  74

Query  411  TAVLYGADWGI----------STPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVN  560
            T+VLYGADWG              + +  P   ++  + E+  D  T+ KA+ LA+PLV 
Sbjct  75   TSVLYGADWGAVDLTVSVAADDDDAANGRPDSHESQRKMEEDFDAFTTTKAQDLAQPLVE  134

Query  561  ANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvh  740
            A +PF IHIVKDHD+KERLCLEVERLG SA+IMGSRGFG  + R     RLGSVSDYCVH
Sbjct  135  AQIPFKIHIVKDHDMKERLCLEVERLGPSAVIMGSRGFG--AARSISKSRLGSVSDYCVH  192

Query  741  hcicpvvvvRYPD--------GDGGGGAATEVVVDLHPVPEDKEYEYHDNADDEVD  884
            HC+CPVVVVRYPD         D G G  ++ VV+ H VPED E E+HD A++  D
Sbjct  193  HCVCPVVVVRYPDDGAAAGPATDNGEGPKSDEVVEKHVVPED-EQEFHDAAEEHKD  247



>gb|EAZ13771.1| hypothetical protein OsJ_03696 [Oryza sativa Japonica Group]
Length=272

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 156/220 (71%), Gaps = 15/220 (7%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ---RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAV  419
            P  PR F   L+ T     RR+AIAVDLSDESA+AVRWAV++YLRPGD VVLLHV+PT+V
Sbjct  41   PTSPRYFFSSLAGTNASPHRRIAIAVDLSDESAYAVRWAVQNYLRPGDAVVLLHVRPTSV  100

Query  420  LYGADWG---ISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPF  575
            LYGADWG   +S   D      P  +AEE     E+  D  TS KAE LA+PLV+A +PF
Sbjct  101  LYGADWGSIPVSVSDDADGEVAPAASAEELQKKREEDFDAFTSTKAEDLAQPLVDAQIPF  160

Query  576  TIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicp  755
             IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ S++G K  RLGSVSDYCVHHC+CP
Sbjct  161  KIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-SRKGGK-GRLGSVSDYCVHHCVCP  218

Query  756  vvvvRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYHDNAD  872
            VVVVRYPD   G         D LH VPED E  YHD  D
Sbjct  219  VVVVRYPDDAAGADGEAAGPTDELHTVPED-EPVYHDAPD  257



>ref|XP_004487352.1| PREDICTED: uncharacterized protein C167.05-like [Cicer arietinum]
Length=226

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 153/203 (75%), Gaps = 9/203 (4%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGI--STPSDHApp  470
            R+VAIAVDLSDESA+AVRWAV++YLRPGD V+LLHV+PT+VLYGADWG    T +D    
Sbjct  25   RKVAIAVDLSDESAYAVRWAVQNYLRPGDTVILLHVRPTSVLYGADWGSVDQTLNDENET  84

Query  471  pppQTAAEE-EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLS  647
               + +  + ED  D+ T+ KA  LA+PLV +  PF IHIVKDHD+KERLCLEVERLGLS
Sbjct  85   ESSENSRRKMEDEFDNFTATKASDLAQPLVESQTPFKIHIVKDHDMKERLCLEVERLGLS  144

Query  648  AMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATE----VV  815
            A+IMGSRGFG+  KR S   RLGSVSDYCV HC+CPVVVVR+P+ + G G   +      
Sbjct  145  AVIMGSRGFGA-LKRAS-TGRLGSVSDYCVRHCVCPVVVVRFPEENNGDGVQGKDSVGEK  202

Query  816  VDLHPVPEDKEYEYHDNADDEVD  884
            V+LHPVPE++  EYHD +D++ D
Sbjct  203  VELHPVPEEEHEEYHDASDEQKD  225



>ref|XP_010927720.1| PREDICTED: uncharacterized protein LOC105049674 isoform X2 [Elaeis 
guineensis]
Length=264

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 158/218 (72%), Gaps = 25/218 (11%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHAp  467
            RR+AIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT+VLYGADWG   +S  +  A 
Sbjct  49   RRIAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPTSVLYGADWGSIDLSVSAAAAA  108

Query  468  ppppQTAAEEEDIIDDL---TSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERL  638
                 +   ++ + DD    T+ KA+ LA+PLV A +PF IHIVKDHD+KERLCLEVERL
Sbjct  109  SEEADSEESQQKLEDDFDAFTTTKAQDLAQPLVEAQIPFKIHIVKDHDMKERLCLEVERL  168

Query  639  GLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG------------  782
            GLSA+IMGSRGFG+ S+R SK  RLGSVSDYCVHHC+CPVVVVRYPD             
Sbjct  169  GLSAVIMGSRGFGA-SRRTSK-GRLGSVSDYCVHHCVCPVVVVRYPDEGGGAGAGAGSVV  226

Query  783  DGGGGAATEVVV----DLHPVPEDKEYEYHDNADDEVD  884
            DGG     +  V    +LHPVPE+ E EYHD +D++ D
Sbjct  227  DGGDALVAKGFVEKEAELHPVPEE-EQEYHDASDEQKD  263



>ref|XP_010095865.1| hypothetical protein L484_022222 [Morus notabilis]
 gb|EXB62333.1| hypothetical protein L484_022222 [Morus notabilis]
Length=294

 Score =   205 bits (522),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 168/253 (66%), Gaps = 26/253 (10%)
 Frame = +3

Query  255  LPRV-FTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGA  431
            LP +   P  S + +RR+AIAVDLS+ESA+AVRWAV++YLRPGD V+LL+V+PT+VLYGA
Sbjct  17   LPTIHIQPSSSTSSQRRIAIAVDLSNESAYAVRWAVQNYLRPGDAVILLYVRPTSVLYGA  76

Query  432  DWG-----ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
            DWG     +   +D           + ED  D  T+ KA+ LA+PLV A +PF IHIVKD
Sbjct  77   DWGSIDLNLGGGNDDVVSSEESQRKKLEDDFDAFTTTKAQDLAQPLVEAQIPFRIHIVKD  136

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD+KERLCLEVERLGLSA+IMGSRGFG+ SKR +K  RLGSVSDYCVHHC+CPVVVVR+P
Sbjct  137  HDMKERLCLEVERLGLSAVIMGSRGFGA-SKRTAK-GRLGSVSDYCVHHCVCPVVVVRFP  194

Query  777  DGDGGGGAATEVV-----------VDLHPVPEDKEYEYHDNADDEVDELEGV*AMLYMSF  923
            +                       V+LHPVPE+ + EYHD +D+  D      + +Y++ 
Sbjct  195  NEKDEACGGDVDGGVAGCAAAGQHVELHPVPEEDQ-EYHDASDEPKD------SEMYINQ  247

Query  924  IPLSQTQVVYCVQ  962
            +    T  +Y VQ
Sbjct  248  VTQRLTICLYIVQ  260



>ref|XP_006417363.1| hypothetical protein EUTSA_v10008352mg [Eutrema salsugineum]
 gb|ESQ35716.1| hypothetical protein EUTSA_v10008352mg [Eutrema salsugineum]
Length=292

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 159/233 (68%), Gaps = 14/233 (6%)
 Frame = +3

Query  210  RPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGD  383
            R  R    +    P  PR   P+ +PT   +R++ IAVDLSDESA+AV+WAV++YLR GD
Sbjct  64   RSDRKSPTVVTVQPSSPRF--PIGTPTAGAQRKIGIAVDLSDESAYAVQWAVQNYLRSGD  121

Query  384  GVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
             VVLLHV+PT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+PLV A
Sbjct  122  AVVLLHVRPTSVLYGADWGAIDLSPQWDPENEESQKKLEDDFDIFTNKKASDVAQPLVEA  181

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
            ++PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY VHH
Sbjct  182  DIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRTSK-GRLGSVSDYSVHH  239

Query  744  cicpvvvvRYPDGDGG-----GGAATEVVVD---LHPVPEDKEYEYHDNADDE  878
            C CPVVVVR+PD   G     G    E +VD   LH VPE  E EYHD +D +
Sbjct  240  CACPVVVVRFPDEKDGEDEKSGENGAENLVDSDKLHTVPEVAEEEYHDASDKQ  292



>ref|XP_009148466.1| PREDICTED: uncharacterized protein C167.05 isoform X1 [Brassica 
rapa]
Length=253

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 163/243 (67%), Gaps = 22/243 (9%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAP--PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYL  371
            PG + P ++ T + + P  P  P   TP      +R++ IAVDLSDESA+AV+WAV++YL
Sbjct  4    PG-KSPRKSPTVVTVQPSSPRFPITTTPTTGA--QRKIGIAVDLSDESAYAVQWAVQNYL  60

Query  372  RPGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            R GD VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+P
Sbjct  61   RSGDAVVLLHVQPTSVLYGADWGAIDLSPQWDPENEESQKKLEDDFDIFTNKKASDVAQP  120

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV A +PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY
Sbjct  121  LVEAEIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDY  178

Query  732  cvhhcicpvvvvRYPD-------GDGGGGAATEVVVD-LHPVPE------DKEYEYHDNA  869
             VHHC CPVVVVR+PD        +G  GA   V  D LH VPE      DKE EYHD +
Sbjct  179  SVHHCACPVVVVRFPDDKDGEDEKNGENGAENLVESDKLHTVPEVAEEEGDKE-EYHDAS  237

Query  870  DDE  878
            D +
Sbjct  238  DKQ  240



>ref|XP_009402599.1| PREDICTED: uncharacterized protein LOC103986344 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=235

 Score =   203 bits (517),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 156/232 (67%), Gaps = 19/232 (8%)
 Frame = +3

Query  237  AIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            A+  P  P    P  S   RRR+AIAVDLSDESA AV WAVR+YLRPGD VVLLHV+PT+
Sbjct  6    ALPDPDRPARLLPSASAGSRRRIAIAVDLSDESAHAVSWAVRNYLRPGDAVVLLHVRPTS  65

Query  417  VLYGADWG---ISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVP  572
            VLYGADWG   +S P+          A+EE     E+  D  T++KA+ LA+PLV A +P
Sbjct  66   VLYGADWGAVDLSLPAGDDDAENGLPASEESQRKMEEDFDAFTTSKAQDLAQPLVEAQIP  125

Query  573  FTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcic  752
            F IHIVKDHD+KERLCLEVERL  SA+IMGSRGFG  + R     RLGSVSDYCVHHC C
Sbjct  126  FKIHIVKDHDMKERLCLEVERLRPSAVIMGSRGFG--AARSVSKSRLGSVSDYCVHHCAC  183

Query  753  pvvvvRYPDGDGGGGAATEV--------VVDLHPVPEDKEYEYHDNADDEVD  884
            PVVVVRYPD   G G+  +          ++LH  PE+ E EYHD A+++ D
Sbjct  184  PVVVVRYPDDGAGAGSGLDNGEAKKLDEGIELHLAPEE-EQEYHDAAEEQKD  234



>emb|CDX97953.1| BnaA06g07040D [Brassica napus]
Length=253

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 163/243 (67%), Gaps = 22/243 (9%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAP--PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYL  371
            PG + P ++ T + + P  P  P   TP      +R++ IAVDLSDESA+AV+WAV++YL
Sbjct  4    PG-KSPRKSPTVVTVQPSSPRFPITTTPTAGA--QRKIGIAVDLSDESAYAVQWAVQNYL  60

Query  372  RPGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            R GD VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+P
Sbjct  61   RSGDAVVLLHVQPTSVLYGADWGAIDLSPQWDPENEESQKKLEDDFDIFTNKKASDVAQP  120

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV A +PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY
Sbjct  121  LVEAEIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDY  178

Query  732  cvhhcicpvvvvRYPD-------GDGGGGAATEVVVD-LHPVPE------DKEYEYHDNA  869
             VHHC CPVVVVR+PD        +G  GA   V  D LH VPE      DKE EYHD +
Sbjct  179  SVHHCACPVVVVRFPDDKDGEDEKNGENGAENLVESDKLHTVPEVAEEEGDKE-EYHDAS  237

Query  870  DDE  878
            D +
Sbjct  238  DKQ  240



>ref|XP_009148467.1| PREDICTED: uncharacterized protein C167.05 isoform X2 [Brassica 
rapa]
Length=251

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 162/241 (67%), Gaps = 22/241 (9%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAP--PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYL  371
            PG + P ++ T + + P  P  P   TP      +R++ IAVDLSDESA+AV+WAV++YL
Sbjct  4    PG-KSPRKSPTVVTVQPSSPRFPITTTPTTG--AQRKIGIAVDLSDESAYAVQWAVQNYL  60

Query  372  RPGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            R GD VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+P
Sbjct  61   RSGDAVVLLHVQPTSVLYGADWGAIDLSPQWDPENEESQKKLEDDFDIFTNKKASDVAQP  120

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV A +PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY
Sbjct  121  LVEAEIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDY  178

Query  732  cvhhcicpvvvvRYPD-------GDGGGGAATEVVVD-LHPVPE------DKEYEYHDNA  869
             VHHC CPVVVVR+PD        +G  GA   V  D LH VPE      DKE EYHD +
Sbjct  179  SVHHCACPVVVVRFPDDKDGEDEKNGENGAENLVESDKLHTVPEVAEEEGDKE-EYHDAS  237

Query  870  D  872
            D
Sbjct  238  D  238



>ref|XP_010035643.1| PREDICTED: uncharacterized protein LOC104424833 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010035644.1| PREDICTED: uncharacterized protein LOC104424833 isoform X2 [Eucalyptus 
grandis]
Length=239

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 162/221 (73%), Gaps = 14/221 (6%)
 Frame = +3

Query  243  APPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            A P  P V TP    +  R++AIAVDLS+ESAFAVRWAV++YLRPGD VVLLHV+PT+VL
Sbjct  25   AAPRTPLVATPTAGAS--RKIAIAVDLSEESAFAVRWAVQNYLRPGDAVVLLHVRPTSVL  82

Query  423  YGADWGI--STPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
            YGADWG   S P+ H      + + + E   D LT+ K   LA+PLV A+ PF IHIVKD
Sbjct  83   YGADWGAVSSQPAGHVSG---EESEKLESDFDSLTTTKVGDLAQPLVEADFPFKIHIVKD  139

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD+KERLCLEVERL LSAMIMGSRGFG+ ++R SK  RLGSVSDYCVHHCICPVVVVR+P
Sbjct  140  HDMKERLCLEVERLRLSAMIMGSRGFGA-ARRASKA-RLGSVSDYCVHHCICPVVVVRFP  197

Query  777  DGDGG-GGAA----TEVVVDLHPVPEDKEYEYHDNADDEVD  884
            + +GG  G A     E  ++LHPVPE+++ E  D +D+  D
Sbjct  198  EEEGGRKGVAEEEGEEGELELHPVPEEEDLEDTDASDEHKD  238



>ref|XP_009402598.1| PREDICTED: uncharacterized protein LOC103986344 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=237

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 155/230 (67%), Gaps = 19/230 (8%)
 Frame = +3

Query  237  AIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            A+  P  P    P  S   RRR+AIAVDLSDESA AV WAVR+YLRPGD VVLLHV+PT+
Sbjct  6    ALPDPDRPARLLPSASAGSRRRIAIAVDLSDESAHAVSWAVRNYLRPGDAVVLLHVRPTS  65

Query  417  VLYGADWG---ISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVP  572
            VLYGADWG   +S P+          A+EE     E+  D  T++KA+ LA+PLV A +P
Sbjct  66   VLYGADWGAVDLSLPAGDDDAENGLPASEESQRKMEEDFDAFTTSKAQDLAQPLVEAQIP  125

Query  573  FTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcic  752
            F IHIVKDHD+KERLCLEVERL  SA+IMGSRGFG  + R     RLGSVSDYCVHHC C
Sbjct  126  FKIHIVKDHDMKERLCLEVERLRPSAVIMGSRGFG--AARSVSKSRLGSVSDYCVHHCAC  183

Query  753  pvvvvRYPDGDGGGGAATEV--------VVDLHPVPEDKEYEYHDNADDE  878
            PVVVVRYPD   G G+  +          ++LH  PE+ E EYHD A+++
Sbjct  184  PVVVVRYPDDGAGAGSGLDNGEAKKLDEGIELHLAPEE-EQEYHDAAEEQ  232



>ref|XP_009402600.1| PREDICTED: uncharacterized protein LOC103986344 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=235

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 155/230 (67%), Gaps = 19/230 (8%)
 Frame = +3

Query  237  AIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            A+  P  P    P  S   RRR+AIAVDLSDESA AV WAVR+YLRPGD VVLLHV+PT+
Sbjct  6    ALPDPDRPARLLPSASAGSRRRIAIAVDLSDESAHAVSWAVRNYLRPGDAVVLLHVRPTS  65

Query  417  VLYGADWG---ISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVP  572
            VLYGADWG   +S P+          A+EE     E+  D  T++KA+ LA+PLV A +P
Sbjct  66   VLYGADWGAVDLSLPAGDDDAENGLPASEESQRKMEEDFDAFTTSKAQDLAQPLVEAQIP  125

Query  573  FTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcic  752
            F IHIVKDHD+KERLCLEVERL  SA+IMGSRGFG  + R     RLGSVSDYCVHHC C
Sbjct  126  FKIHIVKDHDMKERLCLEVERLRPSAVIMGSRGFG--AARSVSKSRLGSVSDYCVHHCAC  183

Query  753  pvvvvRYPDGDGGGGAATEV--------VVDLHPVPEDKEYEYHDNADDE  878
            PVVVVRYPD   G G+  +          ++LH  PE+ E EYHD A+++
Sbjct  184  PVVVVRYPDDGAGAGSGLDNGEAKKLDEGIELHLAPEE-EQEYHDAAEEQ  232



>ref|XP_010927714.1| PREDICTED: uncharacterized protein LOC105049674 isoform X1 [Elaeis 
guineensis]
Length=287

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 157/216 (73%), Gaps = 25/216 (12%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHAp  467
            RR+AIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT+VLYGADWG   +S  +  A 
Sbjct  49   RRIAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPTSVLYGADWGSIDLSVSAAAAA  108

Query  468  ppppQTAAEEEDIIDDL---TSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERL  638
                 +   ++ + DD    T+ KA+ LA+PLV A +PF IHIVKDHD+KERLCLEVERL
Sbjct  109  SEEADSEESQQKLEDDFDAFTTTKAQDLAQPLVEAQIPFKIHIVKDHDMKERLCLEVERL  168

Query  639  GLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG------------  782
            GLSA+IMGSRGFG+ S+R SK  RLGSVSDYCVHHC+CPVVVVRYPD             
Sbjct  169  GLSAVIMGSRGFGA-SRRTSK-GRLGSVSDYCVHHCVCPVVVVRYPDEGGGAGAGAGSVV  226

Query  783  DGGGGAATEVVV----DLHPVPEDKEYEYHDNADDE  878
            DGG     +  V    +LHPVPE+ E EYHD +D++
Sbjct  227  DGGDALVAKGFVEKEAELHPVPEE-EQEYHDASDEQ  261



>ref|XP_008371242.1| PREDICTED: uncharacterized protein C167.05-like [Malus domestica]
 ref|XP_008355974.1| PREDICTED: uncharacterized protein C167.05-like [Malus domestica]
 ref|XP_008364122.1| PREDICTED: uncharacterized protein C167.05-like [Malus domestica]
Length=235

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 166/243 (68%), Gaps = 20/243 (8%)
 Frame = +3

Query  177  QKSVHFEPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVR  350
            +KS   EPG R+    +    +  P  PR + P  +PT   +RR+ IAVDLSDESAFAV+
Sbjct  5    RKSPLSEPGDRQSAAAI----VVQPSSPR-YPPSGTPTSGAQRRIGIAVDLSDESAFAVK  59

Query  351  WAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHApppppQTAAEEEDIIDDLT  521
            WAV++YLRPGD V+LLHV+PT+VLYGADWG   +S P D       ++  + ED  D+ T
Sbjct  60   WAVQNYLRPGDAVILLHVRPTSVLYGADWGATDVSIPEDQ------ESQQKLEDDFDNFT  113

Query  522  SAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSK  701
              KA  LA+PL  A +P+ IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ SKR SK
Sbjct  114  VTKANDLAKPLEEAKMPYKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SKRTSK  172

Query  702  VERLGSVSDYcvhhcicpvvvvRYP-DGDGGGGAATEVVVDLHPVPEDKEYEYHDNADDE  878
              RLGSVSDYCV HC+CPV+VVR+  D D    A  +   D   VPE+ E E+HD  D +
Sbjct  173  A-RLGSVSDYCVQHCVCPVIVVRFSDDKDDEXDAVKQGNFDCPVVPEE-EPEFHDALDKD  230

Query  879  VDE  887
             D+
Sbjct  231  ADK  233



>ref|XP_009372543.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=235

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 165/243 (68%), Gaps = 20/243 (8%)
 Frame = +3

Query  177  QKSVHFEPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVR  350
            +KS   EPG R+    +    +  P  PR +TP  +PT   +RR+ IAVDLSDESAFAV+
Sbjct  5    RKSPLSEPGDRQSAAAI----VVQPSSPR-YTPSGTPTSGAQRRIGIAVDLSDESAFAVK  59

Query  351  WAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHApppppQTAAEEEDIIDDLT  521
            WAV++YLRPGD V+LLHV+PT+VLYGADWG   +S P D       ++  + ED  D+ T
Sbjct  60   WAVQNYLRPGDAVILLHVRPTSVLYGADWGATDVSIPEDQ------ESQQKLEDDFDNFT  113

Query  522  SAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSK  701
              KA  LA+PL  A  P+ IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ SKR SK
Sbjct  114  VTKANDLAKPLEEAKTPYKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SKRTSK  172

Query  702  VERLGSVSDYcvhhcicpvvvvRYP-DGDGGGGAATEVVVDLHPVPEDKEYEYHDNADDE  878
              RLGSVSDYCV HC+CPV+VVR+  D D    A  +   D   VPE+ E E+HD    +
Sbjct  173  A-RLGSVSDYCVQHCVCPVIVVRFSDDKDDENDAVKQGNFDCPVVPEE-EPEFHDALHKD  230

Query  879  VDE  887
             D+
Sbjct  231  ADK  233



>ref|XP_006360529.1| PREDICTED: universal stress protein A-like protein-like [Solanum 
tuberosum]
Length=216

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 148/200 (74%), Gaps = 16/200 (8%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppp  476
            RRVAIAVDLSDESAFAV+WA+++YLRPGD V+LLHV+PT+VLYGADWG ++ S       
Sbjct  25   RRVAIAVDLSDESAFAVKWAIQNYLRPGDAVILLHVRPTSVLYGADWGSTSTS-------  77

Query  477  pQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMI  656
               A + E   +  T+ KA  LA PLV ANVPF IHIVKD D+KERLCLEVERL LSAMI
Sbjct  78   --PAHKIERDYEIFTNNKATELALPLVEANVPFKIHIVKDRDMKERLCLEVERLRLSAMI  135

Query  657  MGSRGFGSPSKRGSKVE-RLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATE----VVVD  821
            MGSRGFG+   RG   + +LGSVSDYCV +CICPVVVVRYP  D  G  A E    V  +
Sbjct  136  MGSRGFGANDIRGIISKGKLGSVSDYCVKNCICPVVVVRYPQEDEYGDGAVEKKAAVEAE  195

Query  822  LHPVPEDKEYEYHDNADDEV  881
            L PVPE+ E+EYHD ADDE+
Sbjct  196  LPPVPEE-EHEYHD-ADDEL  213



>ref|XP_010547129.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
Length=248

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 158/227 (70%), Gaps = 20/227 (9%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P  PR FTPV +PT   +R++ IAVDLSDESA+AVRWAV++YLR GD VVLLHV+PT+VL
Sbjct  22   PSSPR-FTPVSTPTAGAQRKIGIAVDLSDESAYAVRWAVQNYLRSGDAVVLLHVRPTSVL  80

Query  423  YGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHD  602
            YGADWG    S    P   ++  + ED  D  T+AKA  +A PLV A +PF IHIVKDHD
Sbjct  81   YGADWGAIDLSPQWDPENEESQRKVEDDFDVFTNAKANDMAGPLVEAEIPFKIHIVKDHD  140

Query  603  LKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG  782
            +KERLCLEVERLGLS +IMGSRGFG+ +KR  K  RLGSVSDYCVHHC+CPVVVVR+   
Sbjct  141  MKERLCLEVERLGLSTLIMGSRGFGAVAKRSGK-GRLGSVSDYCVHHCVCPVVVVRFSYD  199

Query  783  DGG------GGAATEV---VVDLHPVP------EDKEYEYHDNADDE  878
            +GG      GG   +     V LH V       EDKEY +HD +D +
Sbjct  200  NGGGEDEKRGGNGAKFPSDSVKLHTVAEAEGEGEDKEY-HHDASDKQ  245



>ref|XP_010035642.1| PREDICTED: uncharacterized protein LOC104424833 isoform X1 [Eucalyptus 
grandis]
Length=241

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 161/218 (74%), Gaps = 14/218 (6%)
 Frame = +3

Query  243  APPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            A P  P V TP    +  R++AIAVDLS+ESAFAVRWAV++YLRPGD VVLLHV+PT+VL
Sbjct  25   AAPRTPLVATPTAGAS--RKIAIAVDLSEESAFAVRWAVQNYLRPGDAVVLLHVRPTSVL  82

Query  423  YGADWGI--STPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
            YGADWG   S P+ H      + + + E   D LT+ K   LA+PLV A+ PF IHIVKD
Sbjct  83   YGADWGAVSSQPAGHVSG---EESEKLESDFDSLTTTKVGDLAQPLVEADFPFKIHIVKD  139

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD+KERLCLEVERL LSAMIMGSRGFG+ ++R SK  RLGSVSDYCVHHCICPVVVVR+P
Sbjct  140  HDMKERLCLEVERLRLSAMIMGSRGFGA-ARRASKA-RLGSVSDYCVHHCICPVVVVRFP  197

Query  777  DGDGG-GGAA----TEVVVDLHPVPEDKEYEYHDNADD  875
            + +GG  G A     E  ++LHPVPE+++ E  D +D+
Sbjct  198  EEEGGRKGVAEEEGEEGELELHPVPEEEDLEDTDASDE  235



>ref|NP_563888.2| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 ref|NP_849638.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 ref|NP_001154325.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 ref|NP_001184963.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 dbj|BAH56920.1| AT1G11360 [Arabidopsis thaliana]
 gb|AEE28722.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 gb|AEE28723.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 gb|AEE28724.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 gb|AEE28725.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
Length=242

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 163/239 (68%), Gaps = 21/239 (9%)
 Frame = +3

Query  210  RPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGD  383
            R  R    +    P  PR   P+ +PT   +R++ IAVDLSDESA+AV+WAV++YLR GD
Sbjct  9    RSDRKSPTVVTVQPSSPRF--PISTPTAGAQRKIGIAVDLSDESAYAVQWAVQNYLRSGD  66

Query  384  GVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
             VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D +T+ KA  +A+PLV A
Sbjct  67   AVVLLHVQPTSVLYGADWGAMDLSPQWDPNNEESQRKLEDDFDIVTNKKASDVAQPLVEA  126

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
            ++PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY VHH
Sbjct  127  DIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDYSVHH  184

Query  744  cicpvvvvRYPDGDGG-----GGAATEVVVD---LHPVPE------DKEYEYHDNADDE  878
            C CPVVVVR+PD   G     G +  E ++D   LH VPE      DK+ EYHD +D +
Sbjct  185  CACPVVVVRFPDDKDGEDEKSGDSGGENLMDSDKLHTVPEVAEEEGDKD-EYHDASDKQ  242



>ref|XP_008383973.1| PREDICTED: uncharacterized protein C167.05-like [Malus domestica]
Length=235

 Score =   201 bits (511),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 166/243 (68%), Gaps = 20/243 (8%)
 Frame = +3

Query  177  QKSVHFEPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVR  350
            +KS   EPG R+    +    +  P  PR + P  +PT   +RR+ IAVDLSDESAFAV+
Sbjct  5    RKSPLSEPGDRQSAAAI----VVQPSSPR-YPPSGTPTSGAQRRIGIAVDLSDESAFAVK  59

Query  351  WAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHApppppQTAAEEEDIIDDLT  521
            WAV++YLRPGD V+LLHV+PT+VLYGADWG   +S P D       ++  + ED  D+ T
Sbjct  60   WAVQNYLRPGDAVILLHVRPTSVLYGADWGATDVSIPEDQ------ESQQKLEDDFDNFT  113

Query  522  SAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSK  701
              KA  LA PL  A  P+ IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ SKR SK
Sbjct  114  VTKANDLARPLEEAXTPYKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SKRTSK  172

Query  702  VERLGSVSDYcvhhcicpvvvvRYP-DGDGGGGAATEVVVDLHPVPEDKEYEYHDNADDE  878
              RLGSVSDYCVHHC+CPV+VVR+  D D    A  +  +D   VPE+ E E+HD  D +
Sbjct  173  A-RLGSVSDYCVHHCVCPVIVVRFSDDKDDENDAXKQGKLDCPVVPEE-EPEFHDALDKD  230

Query  879  VDE  887
             D+
Sbjct  231  ADK  233



>ref|XP_004244178.1| PREDICTED: uncharacterized protein LOC101265561 [Solanum lycopersicum]
Length=242

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 154/218 (71%), Gaps = 9/218 (4%)
 Frame = +3

Query  249  PLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            P  P   TP ++ T     +RR+ IAVDLSDESAFAV+WAV  YLRPGD V+L+HV+PT+
Sbjct  27   PRFPPPTTPSITDTPTAGAQRRIGIAVDLSDESAFAVKWAVNQYLRPGDAVILVHVRPTS  86

Query  417  VLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
            VLYGADWG S           ++  + ED  D  T+ KA  LA+PLV+A +PF IHIVKD
Sbjct  87   VLYGADWG-SVELSIVDTENEESQRKLEDDFDTFTTTKASDLAQPLVDAQIPFKIHIVKD  145

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD++ERLCLEVERLGLSA+IMGSRGFG+ +KRGS   RLGSVSDYCV HC+CPVVVVRYP
Sbjct  146  HDMRERLCLEVERLGLSAVIMGSRGFGA-TKRGSD-GRLGSVSDYCVRHCVCPVVVVRYP  203

Query  777  DGDGGGGAATEVVVDL--HPVPEDKEYEYHDNADDEVD  884
            D    G A  E VV +      +++E EYHD ++D  D
Sbjct  204  DDKDAGNAVVEPVVSVASAAEEDEEEAEYHDASEDRKD  241



>ref|XP_010533858.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
Length=249

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 156/227 (69%), Gaps = 19/227 (8%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P  PR F P  +PT   +R++ IAVDLSDESA+AVRWAV++YLR GD VVLLHV+PT+VL
Sbjct  22   PSSPR-FPPTSTPTAGAQRKIGIAVDLSDESAYAVRWAVQNYLRSGDAVVLLHVRPTSVL  80

Query  423  YGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHD  602
            YGADWG    S    P   ++  + ED  D  T+AKA  ++EPLV A +PF IHIVKDHD
Sbjct  81   YGADWGAIDLSPQWDPENEESQRKLEDDFDVFTNAKANDISEPLVEAEIPFKIHIVKDHD  140

Query  603  LKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD-  779
            +KERLCLEVERLGLSA+IMGSRGFG+ +KR  K  RLGSVSDYCVHHC+CPVVVVR+ D 
Sbjct  141  MKERLCLEVERLGLSALIMGSRGFGAAAKRSGKG-RLGSVSDYCVHHCVCPVVVVRFSDE  199

Query  780  ---------GDGGGGAATE-----VVVDLHPVPEDKEYEYHDNADDE  878
                     G+ G    ++      V ++    EDKE  YHD +D +
Sbjct  200  KEDGEDEKHGENGAKFPSDSDKLHTVAEVEGEGEDKEEHYHDASDKQ  246



>ref|XP_004295362.1| PREDICTED: uncharacterized protein LOC101303312 [Fragaria vesca 
subsp. vesca]
Length=247

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 164/240 (68%), Gaps = 17/240 (7%)
 Frame = +3

Query  225  VTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHV  404
             +P  ++ P  PR     LSPT  R+VAIAVDLSDESA+AVRWA  HYLRPGD VVLLHV
Sbjct  2    TSPAVLSQPSSPRF---SLSPTPHRKVAIAVDLSDESAYAVRWAADHYLRPGDSVVLLHV  58

Query  405  QPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIH  584
            +PT  LYGADWG   P D+  P      +E++   D LT++KA  LA+PLV A + F IH
Sbjct  59   RPTTGLYGADWGW-VPVDYTLPVAGDKKSEDD--FDALTTSKATELAQPLVEAGIEFKIH  115

Query  585  IVKDHDLKERLCLEVERLGLSAMIMGSRGFG--SPSKRGSKVERLGSVSDYcvhhcicpv  758
            IVKD D+KERLCLEVERLGLSA+IMGSRGFG  + SKR  K+ RLGSVSDYCV HC+CPV
Sbjct  116  IVKDRDMKERLCLEVERLGLSAVIMGSRGFGAAAASKRSLKMARLGSVSDYCVQHCVCPV  175

Query  759  vvvRYP-DGDGGGGAATEVVVD-LHPVPEDKEYEYHDNADDEVDELEGV*AMLYMSFIPL  932
            VVVR P DGD   G    V  D L PVPE+ + EY+D+     DE +G    L +S I L
Sbjct  176  VVVRCPDDGDRKFGGVEAVEEDVLLPVPEEDQ-EYNDD-----DEHQGF-GSLSLSLIAL  228



>ref|XP_003540330.1| PREDICTED: uncharacterized protein C167.05-like [Glycine max]
Length=234

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 156/219 (71%), Gaps = 14/219 (6%)
 Frame = +3

Query  264  VFTP--VLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADW  437
             F+P   L+ + +R++AIAVDLSDESA+AVRWAV++YLRPGD V+LLHV+PT+VLYGADW
Sbjct  17   TFSPRFALTSSSQRKIAIAVDLSDESAYAVRWAVQNYLRPGDAVILLHVRPTSVLYGADW  76

Query  438  GISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERL  617
            G    S        ++  + ED  D+ T+ KA  LA+PLV A +PF I+IVKDHD+KERL
Sbjct  77   GSVDLSAAEDGGDEESRRKLEDDFDNFTATKASDLAQPLVEAQIPFKIYIVKDHDMKERL  136

Query  618  CLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGG  797
            CLEVERLGLS +IMGSRGFG+ SKR +K  RLGSVSDYCVHHC+CPVVVVRYP+ +  G 
Sbjct  137  CLEVERLGLSTVIMGSRGFGA-SKRAAK-GRLGSVSDYCVHHCVCPVVVVRYPEENDNGN  194

Query  798  AATEVV----------VDLHPVPEDKEYEYHDNADDEVD  884
                            V+L PVPE++   YHD +D+  D
Sbjct  195  GNGTGAGGLVVQVGEPVELPPVPEEEHEVYHDASDEHRD  233



>ref|XP_008788982.1| PREDICTED: uncharacterized protein LOC103706610, partial [Phoenix 
dactylifera]
Length=278

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 154/216 (71%), Gaps = 25/216 (12%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG------ISTPSD  458
            RR+AIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT+VLYGADWG       +  ++
Sbjct  48   RRIAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPTSVLYGADWGSIDLSVSAVAAE  107

Query  459  HApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERL  638
                   ++  + ED  D  T+ KA+ LA+PLV A +PF IHIVKDHD+KERLCLEVERL
Sbjct  108  AEEADSEESQQKLEDDFDAFTTTKAQDLAQPLVEAQIPFKIHIVKDHDMKERLCLEVERL  167

Query  639  GLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG---------  791
            GLSA+IMGSRGFG+ S+R SK  RLGSVSDYCVHHC+CPVVVVRYPD   G         
Sbjct  168  GLSAVIMGSRGFGA-SRRTSK-GRLGSVSDYCVHHCVCPVVVVRYPDEGAGAGAGAGSVG  225

Query  792  -------GGAATEVVVDLHPVPEDKEYEYHDNADDE  878
                        E  V+LHPVPE+ E EYHD AD++
Sbjct  226  DGGNAVVAKGLVEKEVELHPVPEE-EQEYHDAADEQ  260



>ref|XP_006360120.1| PREDICTED: uncharacterized protein C167.05-like [Solanum tuberosum]
Length=242

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 148/199 (74%), Gaps = 5/199 (3%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            +RR+ IAVDLSDESAFAV+WAV  YLRPGD V+L+HV+PT+VLYGADWG S         
Sbjct  46   QRRIGIAVDLSDESAFAVKWAVNQYLRPGDAVILVHVRPTSVLYGADWG-SVDLSIVDTE  104

Query  474  ppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAM  653
              ++  + ED  D  T+ KA  LA+PLV+A +PF IHIVKDHD++ERLCLEVERLGLSA+
Sbjct  105  NEESQRKLEDEFDTFTTTKAADLAQPLVDAQIPFKIHIVKDHDMRERLCLEVERLGLSAV  164

Query  654  IMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEVVVDL--H  827
            IMGSRGFG+ +KRGS   RLGSVSDYCV HC+CPVVVVRYPD   GG A  E VV +   
Sbjct  165  IMGSRGFGA-TKRGSD-GRLGSVSDYCVRHCVCPVVVVRYPDDKDGGNAVVEPVVSVASA  222

Query  828  PVPEDKEYEYHDNADDEVD  884
               +++E EYHD ++D  D
Sbjct  223  AEEDEEEAEYHDASEDRKD  241



>gb|AID16046.1| putative universal stress protein, partial [Catharanthus roseus]
Length=277

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 155/227 (68%), Gaps = 8/227 (4%)
 Frame = +3

Query  153  VMHHHQQHQKSV---HFEPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDL  323
             M +  QH  S       P  +  VR+ +P    PP  P   T   +   +R++ IAVDL
Sbjct  54   TMQNQNQHHHSAPESDLPPLAKIKVRSSSP-RFPPPTTP-CATDTPTAGAQRKIGIAVDL  111

Query  324  SDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEED  503
            SDESAFAV+WAV HYLRPGD V+L+HV+PT+VLYGADWG S           ++  + ED
Sbjct  112  SDESAFAVKWAVHHYLRPGDAVILVHVRPTSVLYGADWG-SVDLSIVDAENEESQQKLED  170

Query  504  IIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSP  683
              D  T+ KA  LA+PLV+A++PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ 
Sbjct  171  DFDTFTTTKASDLAQPLVDAHIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-  229

Query  684  SKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEVVVDL  824
            +++G+   RLGSVSDYCV HC+CPVVVVRYPD   GG A  E VV +
Sbjct  230  TRKGND-GRLGSVSDYCVRHCVCPVVVVRYPDEKEGGNATGEPVVSV  275



>ref|NP_001159067.1| USP family protein [Zea mays]
 gb|ACG44724.1| USP family protein [Zea mays]
Length=279

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 162/239 (68%), Gaps = 25/239 (10%)
 Frame = +3

Query  249  PLLPRVFTPVLSP--TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P  P VF    +P  T  RR+AIAVDLSDESAFAVRWAV +YLR GD V+LLHV+PT+VL
Sbjct  36   PESPGVFFSATAPLGTSHRRIAIAVDLSDESAFAVRWAVANYLRSGDAVILLHVRPTSVL  95

Query  423  YGADWG-----ISTPSDHA--------pppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
            YGADWG     +  PS ++               A   ED  D  T++KA+ +A PL  A
Sbjct  96   YGADWGAVDVSLPIPSAYSEDGFGGGDADSEAAAARRMEDDYDAFTASKADDIARPLKGA  155

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
             +P+ IHIV+DHD+KERLCLEVERL LSA+IMGS+GFGS ++R SK  RLGSVSDYCVHH
Sbjct  156  GIPYKIHIVRDHDMKERLCLEVERLSLSAVIMGSKGFGS-TRRTSK-GRLGSVSDYCVHH  213

Query  744  cicpvvvvRYPD------GDGGGGAATEVVVD-LHPVPEDKEYEYHDNADDEVDELEGV  899
            C+CPVVVVR+PD      G+ GG  A     D LHPVPE++E EYHD A +E  E +G 
Sbjct  214  CVCPVVVVRFPDDGSAECGEAGGLFAAVGAEDVLHPVPEEEEAEYHDAA-EEHKECKGC  271



>ref|XP_008793627.1| PREDICTED: uncharacterized protein LOC103709881 [Phoenix dactylifera]
Length=257

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 151/207 (73%), Gaps = 23/207 (11%)
 Frame = +3

Query  285  PTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGI-------  443
            P   RR+AIAVDLSDESA+AVRWAV++YLRPGD V+LLHV+ T+VLYGADWG        
Sbjct  44   PGSHRRIAIAVDLSDESAYAVRWAVQNYLRPGDAVILLHVRTTSVLYGADWGSIDLSVSP  103

Query  444  STPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCL  623
            S P+    P   ++  + E+ +D  T+ KA+ LA+PLV+A +PF IHIVKDHD+KERLCL
Sbjct  104  SAPAAAEGPDSEESQQKLENDLDAFTTTKAQDLAQPLVDAQIPFKIHIVKDHDMKERLCL  163

Query  624  EVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD--------  779
            EVERLGLSA+IMGSRGFG+ S+R SK  RLGSVSDYCVHHC+CPVVVVRYPD        
Sbjct  164  EVERLGLSAVIMGSRGFGA-SRRSSK-SRLGSVSDYCVHHCVCPVVVVRYPDDGTGAGSR  221

Query  780  -----GDGGGGAATEVVVDLHPVPEDK  845
                  DGG GA  +   +L PVPE++
Sbjct  222  TRRSSADGGDGAVGK-DSELQPVPEEE  247



>ref|XP_003562944.1| PREDICTED: uncharacterized protein LOC100824886 [Brachypodium 
distachyon]
Length=257

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 151/207 (73%), Gaps = 12/207 (6%)
 Frame = +3

Query  288  TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAp  467
            +  RR+AIAVDLSDESAFAV WAV +YLRPGD V+LLHV+ T VLYGADWG  TP+    
Sbjct  54   SAHRRIAIAVDLSDESAFAVSWAVANYLRPGDAVILLHVRSTNVLYGADWGSVTPTSPED  113

Query  468  ppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLS  647
                     EED  D LT++KAE LA+PL  A +P+ IHIVKDHD+KERLCLEVERLGLS
Sbjct  114  DAEVAARKMEEDF-DALTASKAEDLAKPLQEAEIPYKIHIVKDHDMKERLCLEVERLGLS  172

Query  648  AMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP-DGDGGGGAATEVVVD-  821
            A+IMGS+GFG+ ++R SK  RLGSVSDYCVHHCICPVVVVR P DG   GG AT V+   
Sbjct  173  AVIMGSKGFGA-ARRASK-GRLGSVSDYCVHHCICPVVVVRTPDDGVAEGGEATTVLEAA  230

Query  822  ------LHPVPEDKEYEYHDNADDEVD  884
                  LHPVPE+ + EYHD  ++  D
Sbjct  231  VGAEDVLHPVPEE-DAEYHDATEEHKD  256



>ref|XP_007043417.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOX99248.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2 [Theobroma cacao]
Length=258

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/249 (54%), Positives = 171/249 (69%), Gaps = 30/249 (12%)
 Frame = +3

Query  213  PVRNVTPLAIAP--PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDG  386
            P+ ++  L I P  P +P   TP      +RR+AIAVDLSDESA+AVRWAV++YLRPGD 
Sbjct  14   PLPHLASLRIQPTSPRVPSNATPTAG--SQRRIAIAVDLSDESAYAVRWAVQNYLRPGDA  71

Query  387  VVLLHVQPTAVLYGADWG---------ISTPSDHAppppp-----QTAAEEEDIIDDLTS  524
            V+LLHV+PT+VLYGADWG          +T  ++A          ++  + E+  D  T+
Sbjct  72   VILLHVRPTSVLYGADWGSIQLQITPNATTNHENATAITSGHPDGESQQKLENDFDIFTT  131

Query  525  AKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKV  704
             KA  LA+PLV+A +PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ ++R SK 
Sbjct  132  TKANTLAQPLVDAQIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-ARRTSK-  189

Query  705  ERLGSVSDYcvhhcicpvvvvRYPDGDGGG-GAATEVV--------VDLHPVPEDKEYEY  857
             RLGSVSDYCVHHCICPVVVVR+P+ +    G A +V+        V+L PVPE+ E EY
Sbjct  190  GRLGSVSDYCVHHCICPVVVVRFPEEEESEIGGAEKVMKKKMVGEDVELQPVPEE-ELEY  248

Query  858  HDNADDEVD  884
            HD  ++  D
Sbjct  249  HDAEEEHRD  257



>ref|XP_006657818.1| PREDICTED: uncharacterized protein C167.05-like, partial [Oryza 
brachyantha]
Length=209

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 158/211 (75%), Gaps = 19/211 (9%)
 Frame = +3

Query  300  RVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSD----  458
            R+AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYGADWG   +S P++    
Sbjct  1    RIAIAVDLSDESAYAVRWAVANYLRPGDAVILLHVRPTSVLYGADWGSVDLSLPANPNPS  60

Query  459  ---HApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEV  629
                A       A + ED  D  T++KA+ LA+PL +A +P+ IHIVKDHD+KERLCLEV
Sbjct  61   DPPSAEDDAEAAARKMEDDFDAFTASKADDLAKPLKDAGIPYKIHIVKDHDMKERLCLEV  120

Query  630  ERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD---GDGGGGA  800
            ERLGLSA+IMGS+GFG+ S+R SK  RLGSVSDYCVHHC+CPVVVVR+PD    +GG G 
Sbjct  121  ERLGLSAVIMGSKGFGA-SRRTSK-GRLGSVSDYCVHHCVCPVVVVRFPDDGVAEGGDGG  178

Query  801  ATEVVVD---LHPVPEDKEYEYHDNADDEVD  884
            A E+ V    LHPVPE ++ EYHD  ++  D
Sbjct  179  AAELAVGEEMLHPVPE-EDAEYHDATEEHKD  208



>ref|NP_001151050.1| LOC100284683 [Zea mays]
 gb|ACG41424.1| USP family protein [Zea mays]
Length=268

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 156/217 (72%), Gaps = 21/217 (10%)
 Frame = +3

Query  288  TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSD  458
            T  RR+AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYGADWG   +S P+ 
Sbjct  54   TAHRRIAIAVDLSDESAYAVRWAVANYLRPGDAVILLHVRPTSVLYGADWGAVDVSLPNP  113

Query  459  HApppp-----pQTAAEE---EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKER  614
             A          +TAA     ED  D  T+ KA+H A PL +A +P+ IHIV+DHD+KER
Sbjct  114  SAAASEDGDGDCETAAAARRMEDDYDAFTATKADHFASPLKDAGIPYKIHIVRDHDMKER  173

Query  615  LCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD---GD  785
            LCLEVERL LSA+IMGS+GFG+ ++R SK  RLGSVSDYCVHHC+CPVVVVR+PD    +
Sbjct  174  LCLEVERLSLSAVIMGSKGFGA-ARRTSK-GRLGSVSDYCVHHCVCPVVVVRFPDDGSAE  231

Query  786  GGGGAATEVVVD----LHPVPEDKEYEYHDNADDEVD  884
            GG  A     V     LHPVPE+ E EYHD A++  D
Sbjct  232  GGEAAGLSAAVGAEDVLHPVPEE-EGEYHDAAEEHKD  267



>ref|XP_011043331.1| PREDICTED: uncharacterized protein LOC105138810 isoform X1 [Populus 
euphratica]
Length=241

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRP  377
            P    P  +   + + PP  PR+     +   +RR+ IAVDLSDESAFAV+WAV++YLR 
Sbjct  7    PKKNPPTESAVVVQVQPPS-PRLHVTTPTTCAQRRIGIAVDLSDESAFAVKWAVQNYLRA  65

Query  378  GDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDL---TSAKAEHLAE  548
            GD V+L+HV PT VLYGADWG S P         Q    ++ I +D    TS KA  +A+
Sbjct  66   GDAVILVHVSPTNVLYGADWG-SLPIKENYNLDDQNEENQQKIEEDFNLFTSTKANDIAQ  124

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV+AN+PF IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ S++ SK  RLGSVSD
Sbjct  125  PLVDANIPFKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SRKSSK-GRLGSVSD  182

Query  729  YcvhhcicpvvvvRYPD-GDGGGGAATE  809
            YCVHHC+CPV+VVR+PD  DGG G  +E
Sbjct  183  YCVHHCVCPVIVVRFPDEKDGGAGEESE  210



>ref|XP_011043334.1| PREDICTED: uncharacterized protein LOC105138810 isoform X4 [Populus 
euphratica]
Length=237

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRP  377
            P    P  +   + + PP  PR+     +   +RR+ IAVDLSDESAFAV+WAV++YLR 
Sbjct  7    PKKNPPTESAVVVQVQPPS-PRLHVTTPTTCAQRRIGIAVDLSDESAFAVKWAVQNYLRA  65

Query  378  GDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDL---TSAKAEHLAE  548
            GD V+L+HV PT VLYGADWG S P         Q    ++ I +D    TS KA  +A+
Sbjct  66   GDAVILVHVSPTNVLYGADWG-SLPIKENYNLDDQNEENQQKIEEDFNLFTSTKANDIAQ  124

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV+AN+PF IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ S++ SK  RLGSVSD
Sbjct  125  PLVDANIPFKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SRKSSK-GRLGSVSD  182

Query  729  YcvhhcicpvvvvRYPD-GDGGGGAATE  809
            YCVHHC+CPV+VVR+PD  DGG G  +E
Sbjct  183  YCVHHCVCPVIVVRFPDEKDGGAGEESE  210



>ref|XP_011043333.1| PREDICTED: uncharacterized protein LOC105138810 isoform X3 [Populus 
euphratica]
Length=237

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRP  377
            P    P  +   + + PP  PR+     +   +RR+ IAVDLSDESAFAV+WAV++YLR 
Sbjct  7    PKKNPPTESAVVVQVQPPS-PRLHVTTPTTCAQRRIGIAVDLSDESAFAVKWAVQNYLRA  65

Query  378  GDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDL---TSAKAEHLAE  548
            GD V+L+HV PT VLYGADWG S P         Q    ++ I +D    TS KA  +A+
Sbjct  66   GDAVILVHVSPTNVLYGADWG-SLPIKENYNLDDQNEENQQKIEEDFNLFTSTKANDIAQ  124

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV+AN+PF IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ S++ SK  RLGSVSD
Sbjct  125  PLVDANIPFKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SRKSSK-GRLGSVSD  182

Query  729  YcvhhcicpvvvvRYPD-GDGGGGAATE  809
            YCVHHC+CPV+VVR+PD  DGG G  +E
Sbjct  183  YCVHHCVCPVIVVRFPDEKDGGAGEESE  210



>gb|AFW84883.1| USP family protein [Zea mays]
Length=261

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 155/225 (69%), Gaps = 24/225 (11%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ----RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            P  PR F   L+ T      RR+AIAVDLSDESAFAV+WAV++YLRPGD VVLLHV+PT+
Sbjct  33   PSSPRFFFSSLAGTNPASPHRRIAIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRPTS  92

Query  417  VLYGADWGISTP---------------SDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            VLYGADWG S P               +    P   +   + E+  D  TS KA+ LA+P
Sbjct  93   VLYGADWG-SIPVSVADEDDAAEDAAAAAEGGPSEEELQKKREEDYDAFTSTKAQDLAQP  151

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV+A +PF IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ S++GSK  RLGSVSDY
Sbjct  152  LVDAQIPFKIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-SRKGSK-GRLGSVSDY  209

Query  732  cvhhcicpvvvvRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYHD  863
            CVHHC+CPVVVVRYPD     G     V D LH VPED E  YHD
Sbjct  210  CVHHCVCPVVVVRYPDDAADAGGDASGVTDELHTVPED-EPVYHD  253



>ref|XP_011013955.1| PREDICTED: uncharacterized protein LOC105117870 isoform X4 [Populus 
euphratica]
Length=237

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRP  377
            P    P  +   + + PP  PR+     +   +RR+ IAVDLSDESAFAV+WAV++YLR 
Sbjct  7    PKKNPPTESAVVVQVQPPS-PRLHVTTPTTCAQRRIGIAVDLSDESAFAVKWAVQNYLRA  65

Query  378  GDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDL---TSAKAEHLAE  548
            GD V+L+HV PT VLYGADWG S P         Q    ++ I +D    TS KA  +A+
Sbjct  66   GDAVILVHVSPTNVLYGADWG-SLPIKENYNLDDQNEENQQKIEEDFNLFTSTKANDIAQ  124

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV+AN+PF IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ S++ SK  RLGSVSD
Sbjct  125  PLVDANIPFKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SRKSSK-GRLGSVSD  182

Query  729  YcvhhcicpvvvvRYPD-GDGGGGAATE  809
            YCVHHC+CPV+VVR+PD  DGG G  +E
Sbjct  183  YCVHHCVCPVIVVRFPDEKDGGAGEESE  210



>ref|XP_003564362.1| PREDICTED: uncharacterized protein LOC100824166 [Brachypodium 
distachyon]
Length=267

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 136/244 (56%), Positives = 157/244 (64%), Gaps = 27/244 (11%)
 Frame = +3

Query  213  PVR-NVTPLAIAPPLLPRVFTPVLS---PTQRRRVAIAVDLSDESAFAVRWAVRHYLRPG  380
            PVR +    A   P  PR F   L+    +  RR+AIAVDLSDESAFAVRWAV++YLRPG
Sbjct  22   PVRLSAAQAATIQPSSPRYFFSSLAGGNASSHRRIAIAVDLSDESAFAVRWAVQNYLRPG  81

Query  381  DGVVLLHVQPTAVLYGADWG---ISTPSDHApppppQTAA----------------EEED  503
            D VVLLHV+PT+VLYGADWG   +S   D          A                + E+
Sbjct  82   DAVVLLHVRPTSVLYGADWGSIPVSVSDDDGSADGEDAPAATAEGAEAASAEELQKKREE  141

Query  504  IIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSP  683
              D  TS K++ LA+PLV A +PF IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ 
Sbjct  142  DFDTFTSTKSQDLAQPLVAAQIPFKIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-  200

Query  684  SKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYH  860
            S++G K  RLGSVSDYCVHHC+CPVVVVRYPD   G         D LH VPED E  YH
Sbjct  201  SRKGGK-GRLGSVSDYCVHHCVCPVVVVRYPDDAAGIAGEAAGATDELHTVPED-EPVYH  258

Query  861  DNAD  872
            D  D
Sbjct  259  DAPD  262



>ref|XP_011013952.1| PREDICTED: uncharacterized protein LOC105117870 isoform X1 [Populus 
euphratica]
Length=241

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRP  377
            P    P  +   + + PP  PR+     +   +RR+ IAVDLSDESAFAV+WAV++YLR 
Sbjct  7    PKKNPPTESAVVVQVQPPS-PRLHVTTPTTCAQRRIGIAVDLSDESAFAVKWAVQNYLRA  65

Query  378  GDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDL---TSAKAEHLAE  548
            GD V+L+HV PT VLYGADWG S P         Q    ++ I +D    TS KA  +A+
Sbjct  66   GDAVILVHVSPTNVLYGADWG-SLPIKENYNLDDQNEENQQKIEEDFNLFTSTKANDIAQ  124

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV+AN+PF IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ S++ SK  RLGSVSD
Sbjct  125  PLVDANIPFKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SRKSSK-GRLGSVSD  182

Query  729  YcvhhcicpvvvvRYPD-GDGGGGAATE  809
            YCVHHC+CPV+VVR+PD  DGG G  +E
Sbjct  183  YCVHHCVCPVIVVRFPDEKDGGAGEESE  210



>ref|XP_011043332.1| PREDICTED: uncharacterized protein LOC105138810 isoform X2 [Populus 
euphratica]
Length=241

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRP  377
            P    P  +   + + PP  PR+     +   +RR+ IAVDLSDESAFAV+WAV++YLR 
Sbjct  7    PKKNPPTESAVVVQVQPPS-PRLHVTTPTTCAQRRIGIAVDLSDESAFAVKWAVQNYLRA  65

Query  378  GDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDL---TSAKAEHLAE  548
            GD V+L+HV PT VLYGADWG S P         Q    ++ I +D    TS KA  +A+
Sbjct  66   GDAVILVHVSPTNVLYGADWG-SLPIKENYNLDDQNEENQQKIEEDFNLFTSTKANDIAQ  124

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV+AN+PF IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ S++ SK  RLGSVSD
Sbjct  125  PLVDANIPFKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SRKSSK-GRLGSVSD  182

Query  729  YcvhhcicpvvvvRYPD-GDGGGGAATE  809
            YCVHHC+CPV+VVR+PD  DGG G  +E
Sbjct  183  YCVHHCVCPVIVVRFPDEKDGGAGEESE  210



>ref|XP_007043418.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 3 [Theobroma cacao]
 gb|EOX99249.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 3 [Theobroma cacao]
Length=261

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 170/246 (69%), Gaps = 30/246 (12%)
 Frame = +3

Query  213  PVRNVTPLAIAP--PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDG  386
            P+ ++  L I P  P +P   TP      +RR+AIAVDLSDESA+AVRWAV++YLRPGD 
Sbjct  14   PLPHLASLRIQPTSPRVPSNATPTAG--SQRRIAIAVDLSDESAYAVRWAVQNYLRPGDA  71

Query  387  VVLLHVQPTAVLYGADWG---------ISTPSDHAppppp-----QTAAEEEDIIDDLTS  524
            V+LLHV+PT+VLYGADWG          +T  ++A          ++  + E+  D  T+
Sbjct  72   VILLHVRPTSVLYGADWGSIQLQITPNATTNHENATAITSGHPDGESQQKLENDFDIFTT  131

Query  525  AKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKV  704
             KA  LA+PLV+A +PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ ++R SK 
Sbjct  132  TKANTLAQPLVDAQIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-ARRTSK-  189

Query  705  ERLGSVSDYcvhhcicpvvvvRYPDGDGGG-GAATEVV--------VDLHPVPEDKEYEY  857
             RLGSVSDYCVHHCICPVVVVR+P+ +    G A +V+        V+L PVPE+ E EY
Sbjct  190  GRLGSVSDYCVHHCICPVVVVRFPEEEESEIGGAEKVMKKKMVGEDVELQPVPEE-ELEY  248

Query  858  HDNADD  875
            HD  ++
Sbjct  249  HDAEEE  254



>ref|XP_011013953.1| PREDICTED: uncharacterized protein LOC105117870 isoform X2 [Populus 
euphratica]
Length=241

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRP  377
            P    P  +   + + PP  PR+     +   +RR+ IAVDLSDESAFAV+WAV++YLR 
Sbjct  7    PKKNPPTESAVVVQVQPPS-PRLHVTTPTTCAQRRIGIAVDLSDESAFAVKWAVQNYLRA  65

Query  378  GDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDL---TSAKAEHLAE  548
            GD V+L+HV PT VLYGADWG S P         Q    ++ I +D    TS KA  +A+
Sbjct  66   GDAVILVHVSPTNVLYGADWG-SLPIKENYNLDDQNEENQQKIEEDFNLFTSTKANDIAQ  124

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV+AN+PF IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ S++ SK  RLGSVSD
Sbjct  125  PLVDANIPFKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SRKSSK-GRLGSVSD  182

Query  729  YcvhhcicpvvvvRYPD-GDGGGGAATE  809
            YCVHHC+CPV+VVR+PD  DGG G  +E
Sbjct  183  YCVHHCVCPVIVVRFPDEKDGGAGEESE  210



>ref|XP_004957966.1| PREDICTED: uncharacterized protein C167.05-like [Setaria italica]
Length=266

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 157/214 (73%), Gaps = 18/214 (8%)
 Frame = +3

Query  282  SPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTP  452
            S +  RR+AIAVDLSDESA+AVRWAV +YLRPGD VVLLHV+PT+VLYGADWG   +S P
Sbjct  52   SGSSHRRIAIAVDLSDESAYAVRWAVANYLRPGDAVVLLHVRPTSVLYGADWGAVDVSLP  111

Query  453  SDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERL  617
            +  A        +E      ED  D  T++KA+ LA PL +A +P+ IHIVKDHD+KERL
Sbjct  112  NPSAGAADDDGDSEAAARRMEDDYDAFTASKADDLARPLKDAGIPYKIHIVKDHDMKERL  171

Query  618  CLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG----D  785
            CLEVERLGLSA+IMGS+GFG+ ++R SK  RLGSVSDYCVHHC+CPVVVVR+PD     D
Sbjct  172  CLEVERLGLSAVIMGSKGFGA-ARRTSK-GRLGSVSDYCVHHCVCPVVVVRFPDDGLAED  229

Query  786  GGGGAATEVVVD---LHPVPEDKEYEYHDNADDE  878
            G  G  + VV     LHPVPE ++ EYHD  +++
Sbjct  230  GEAGGLSSVVGAEDVLHPVPE-EDAEYHDATEEQ  262



>ref|XP_006655460.1| PREDICTED: uncharacterized protein C167.05-like, partial [Oryza 
brachyantha]
Length=222

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 146/209 (70%), Gaps = 27/209 (13%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG------------  440
            RR+AIAVDLSDESAFAV+WAV++YLRPGD VVLLHV+PT+VLYGADWG            
Sbjct  13   RRIAIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRPTSVLYGADWGSIPVSVDDDDAA  72

Query  441  --------ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
                     + P D       +   + E+  D  TS KA+ LA+PLV A +PF IHIVKD
Sbjct  73   DADAHQANAAAPRDEPE----EAKKKREEDFDAFTSTKAQDLAQPLVAAQIPFKIHIVKD  128

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD+KERLCLE ERLGLSAMIMGSRGFG+ S+RG+K  RLGSVSDYCVHHC+CPVVVVRYP
Sbjct  129  HDMKERLCLEAERLGLSAMIMGSRGFGA-SRRGNK-GRLGSVSDYCVHHCVCPVVVVRYP  186

Query  777  DGDGGGGAATEVVVDLHPVPEDKEYEYHD  863
            D     G+   V  +L  VPED E  YH+
Sbjct  187  DDGAAAGSGEAVGDELRTVPED-EPVYHE  214



>ref|XP_002892640.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68899.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=273

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 162/239 (68%), Gaps = 21/239 (9%)
 Frame = +3

Query  210  RPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGD  383
            R  R    +    P  PR   P+ +PT   +R++ IAVDLSDESA+AV+WAV++YLR GD
Sbjct  9    RSDRKSPTVVTVQPSSPRF--PIGTPTAGAQRKIGIAVDLSDESAYAVQWAVQNYLRSGD  66

Query  384  GVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
             VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+PLV A
Sbjct  67   AVVLLHVQPTSVLYGADWGAIDLSPQWDPENEESQRKLEDDFDIFTNKKASDVAQPLVEA  126

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
            ++PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY VHH
Sbjct  127  DIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDYSVHH  184

Query  744  cicpvvvvRYPDGDGG-----GGAATEVVVD---LHPVPE------DKEYEYHDNADDE  878
            C CPVVVVR+PD   G     G +  E +V+   LH VPE      DK+ EYHD +D +
Sbjct  185  CACPVVVVRFPDDKDGEDEKSGESGGENLVESDKLHTVPELAEEEGDKD-EYHDASDKQ  242



>ref|XP_011013956.1| PREDICTED: uncharacterized protein LOC105117870 isoform X5 [Populus 
euphratica]
Length=237

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRP  377
            P    P  +   + + PP  PR+     +   +RR+ IAVDLSDESAFAV+WAV++YLR 
Sbjct  7    PKKNPPTESAVVVQVQPPS-PRLHVTTPTTCAQRRIGIAVDLSDESAFAVKWAVQNYLRA  65

Query  378  GDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDL---TSAKAEHLAE  548
            GD V+L+HV PT VLYGADWG S P         Q    ++ I +D    TS KA  +A+
Sbjct  66   GDAVILVHVSPTNVLYGADWG-SLPIKENYNLDDQNEENQQKIEEDFNLFTSTKANDIAQ  124

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV+AN+PF IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ S++ SK  RLGSVSD
Sbjct  125  PLVDANIPFKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SRKSSK-GRLGSVSD  182

Query  729  YcvhhcicpvvvvRYPD-GDGGGGAATE  809
            YCVHHC+CPV+VVR+PD  DGG G  +E
Sbjct  183  YCVHHCVCPVIVVRFPDEKDGGAGEESE  210



>ref|XP_011013954.1| PREDICTED: uncharacterized protein LOC105117870 isoform X3 [Populus 
euphratica]
Length=240

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRP  377
            P    P  +   + + PP  PR+     +   +RR+ IAVDLSDESAFAV+WAV++YLR 
Sbjct  7    PKKNPPTESAVVVQVQPPS-PRLHVTTPTTCAQRRIGIAVDLSDESAFAVKWAVQNYLRA  65

Query  378  GDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDL---TSAKAEHLAE  548
            GD V+L+HV PT VLYGADWG S P         Q    ++ I +D    TS KA  +A+
Sbjct  66   GDAVILVHVSPTNVLYGADWG-SLPIKENYNLDDQNEENQQKIEEDFNLFTSTKANDIAQ  124

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV+AN+PF IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ S++ SK  RLGSVSD
Sbjct  125  PLVDANIPFKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SRKSSK-GRLGSVSD  182

Query  729  YcvhhcicpvvvvRYPD-GDGGGGAATE  809
            YCVHHC+CPV+VVR+PD  DGG G  +E
Sbjct  183  YCVHHCVCPVIVVRFPDEKDGGAGEESE  210



>ref|XP_003543370.1| PREDICTED: uncharacterized protein C167.05 [Glycine max]
Length=239

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 134/241 (56%), Positives = 159/241 (66%), Gaps = 21/241 (9%)
 Frame = +3

Query  207  RRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDG  386
            + PVR   P    P   PR     L+   +R++AIAVDLSDESA+AVRWAV++YLRPGD 
Sbjct  4    QSPVR-AEPEPPVPTFSPRF---ALTSGSQRKIAIAVDLSDESAYAVRWAVQNYLRPGDA  59

Query  387  VVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEP  551
            V+LLHV+PT+VLYGADWG    S            EE     ED  D+ TS KA  LA P
Sbjct  60   VILLHVRPTSVLYGADWGSVDLSAAEDADDGGGGDEESRRKLEDDFDNFTSTKASDLAHP  119

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV A +PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR +K  RLGSVSDY
Sbjct  120  LVEAQIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRAAK-GRLGSVSDY  177

Query  732  cvhhcicpvvvvRYPDGDGGGGAATEVV----------VDLHPVPEDKEYEYHDNADDEV  881
            CVHHC+CPVVVVRYP+ +  G                 V+L PVPE++   YHD +D+  
Sbjct  178  CVHHCVCPVVVVRYPEENDNGKGDGNGAGGLVVQVGEPVELPPVPEEEHEVYHDASDEHR  237

Query  882  D  884
            D
Sbjct  238  D  238



>ref|XP_010907383.1| PREDICTED: uncharacterized protein LOC105034060 [Elaeis guineensis]
Length=262

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 155/220 (70%), Gaps = 24/220 (11%)
 Frame = +3

Query  285  PTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGIS--TPSD  458
            P   RR+AIAVDLSDESA+AVRWAV++YLRPGD V+LLHV+PT+VLYGADWG    + S 
Sbjct  46   PGSHRRIAIAVDLSDESAYAVRWAVQNYLRPGDAVILLHVRPTSVLYGADWGSIDLSVSA  105

Query  459  HApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCL  623
                   +  +EE     ED  D  T+ KA+ LA+PLV A +PF IHIV DHD+KERLCL
Sbjct  106  ATAAAAEEPDSEESQQKLEDDFDTFTTTKAQDLAQPLVEAQIPFKIHIVNDHDMKERLCL  165

Query  624  EVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG-------  782
            EVERLGLSA+IMGSRGFG+ SKR SK  RLGSVSDYCVHHC+CPVVVVRYPD        
Sbjct  166  EVERLGLSAVIMGSRGFGA-SKRSSK-SRLGSVSDYCVHHCVCPVVVVRYPDDGIGARSG  223

Query  783  ------DGGGGAATEVVVDLHPVPEDKEYEYHDNADDEVD  884
                  DGG GA  +  ++L PVPE+ E+E  D  + + D
Sbjct  224  ARRSSVDGGDGAVGK-GLELQPVPEE-EHERPDATEGKKD  261



>ref|XP_007043416.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOX99247.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
Length=273

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 170/246 (69%), Gaps = 30/246 (12%)
 Frame = +3

Query  213  PVRNVTPLAIAP--PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDG  386
            P+ ++  L I P  P +P   TP      +RR+AIAVDLSDESA+AVRWAV++YLRPGD 
Sbjct  14   PLPHLASLRIQPTSPRVPSNATPTAG--SQRRIAIAVDLSDESAYAVRWAVQNYLRPGDA  71

Query  387  VVLLHVQPTAVLYGADWG---------ISTPSDHAppppp-----QTAAEEEDIIDDLTS  524
            V+LLHV+PT+VLYGADWG          +T  ++A          ++  + E+  D  T+
Sbjct  72   VILLHVRPTSVLYGADWGSIQLQITPNATTNHENATAITSGHPDGESQQKLENDFDIFTT  131

Query  525  AKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKV  704
             KA  LA+PLV+A +PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ ++R SK 
Sbjct  132  TKANTLAQPLVDAQIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-ARRTSK-  189

Query  705  ERLGSVSDYcvhhcicpvvvvRYPDGDGGG-GAATEVV--------VDLHPVPEDKEYEY  857
             RLGSVSDYCVHHCICPVVVVR+P+ +    G A +V+        V+L PVPE+ E EY
Sbjct  190  GRLGSVSDYCVHHCICPVVVVRFPEEEESEIGGAEKVMKKKMVGEDVELQPVPEE-ELEY  248

Query  858  HDNADD  875
            HD  ++
Sbjct  249  HDAEEE  254



>ref|XP_009420770.1| PREDICTED: uncharacterized protein LOC104000446 [Musa acuminata 
subsp. malaccensis]
Length=268

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 159/240 (66%), Gaps = 33/240 (14%)
 Frame = +3

Query  249  PLLPRVFTPVL-----SPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPT  413
            P  PR F   +     SP   RR+AIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT
Sbjct  34   PSSPRFFLSSVAAACPSPGSHRRIAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPT  93

Query  414  AVLYGADWG---ISTPSDHApppppQTAAEEEDIIDD----LTSAKAEHLAEPLVNANVP  572
            +VLYGADWG   +S  +  A       + E +  ++D    L +AKA+ LA+PLV A +P
Sbjct  94   SVLYGADWGAIDVSVSAADAAKAEDAGSEESQRKLEDDFHALAAAKAQDLAQPLVQAQIP  153

Query  573  FTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcic  752
            F IHIVKDHDLKERLCLEVERLGLSA+IMGSRGFG  + R +   RLGSVSDYC HHC+C
Sbjct  154  FKIHIVKDHDLKERLCLEVERLGLSAVIMGSRGFG--AARRTNKGRLGSVSDYCAHHCVC  211

Query  753  pvvvvRYPDGDGGGGAATEVVVD----------------LHPVPEDKEYEYHDNADDEVD  884
            PVVVVRYPD +G   AA    +D                L PVPE  E E+HD + ++ D
Sbjct  212  PVVVVRYPD-EGTSDAAEAGSIDGGNAVPALGTAGKDPELQPVPE--EDEFHDASSEQKD  268



>ref|XP_006646395.1| PREDICTED: uncharacterized protein LOC102711036 [Oryza brachyantha]
Length=274

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 154/214 (72%), Gaps = 15/214 (7%)
 Frame = +3

Query  258  PRVFTPVLSPTQ---RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYG  428
            PR F   L+ T     RR+AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYG
Sbjct  56   PRYFFSSLAGTNASPHRRIAIAVDLSDESAYAVRWAVANYLRPGDAVILLHVRPTSVLYG  115

Query  429  ADWG---ISTPSDHApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFTIH  584
            ADWG   +S   D      P  +AEE     E+  D  TS K++ LA+PLV+A +PF IH
Sbjct  116  ADWGSIAVSVSDDADGEVAPAASAEELQKKREEDFDAFTSTKSQDLAQPLVDAQIPFKIH  175

Query  585  IVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvv  764
            +VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ S++G K  RLGSVSDYCVHHC+CPVVV
Sbjct  176  VVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-SRKGGK-GRLGSVSDYCVHHCVCPVVV  233

Query  765  vRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYHD  863
            VRYPD   G  A      D LH VPED E  YHD
Sbjct  234  VRYPDDAAGADAEASGPTDELHTVPED-EPVYHD  266



>emb|CDY19360.1| BnaC05g08690D [Brassica napus]
Length=342

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 164/243 (67%), Gaps = 22/243 (9%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAP--PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYL  371
            PG + P ++ T + + P  P  P   TP  +   +R++ IAVDLSDESA+AV+WAV++YL
Sbjct  9    PG-KSPRKSPTVVTVQPSSPRFPITTTP--TAGAQRKIGIAVDLSDESAYAVQWAVQNYL  65

Query  372  RPGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            R GD VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+P
Sbjct  66   RSGDAVVLLHVQPTSVLYGADWGAIDLSPQWDPENEESQKKLEDDFDIFTNKKASDVAQP  125

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV A +PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY
Sbjct  126  LVEAEIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDY  183

Query  732  cvhhcicpvvvvRYPD-------GDGGGGAATEVVVD-LHPVPE------DKEYEYHDNA  869
             VHHC CPVVVVR+PD        +G  GA + V  D LH V E      DKE EYHD +
Sbjct  184  SVHHCACPVVVVRFPDDKDGEDEKNGENGAESLVESDKLHTVLEVAEEEGDKE-EYHDAS  242

Query  870  DDE  878
            D +
Sbjct  243  DKQ  245



>ref|NP_001149193.1| USP family protein [Zea mays]
 gb|ACG34507.1| USP family protein [Zea mays]
Length=261

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 155/225 (69%), Gaps = 24/225 (11%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ----RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            P  PR F   L+ T      RR+AIAVDLSDESAFAV+WAV++Y+RPGD VVLLHV+PT+
Sbjct  33   PSSPRFFFSSLAGTNPASPHRRIAIAVDLSDESAFAVKWAVQNYVRPGDAVVLLHVRPTS  92

Query  417  VLYGADWGISTP---------------SDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            VLYGADWG S P               +    P   +   + E+  D  TS KA+ LA+P
Sbjct  93   VLYGADWG-SIPVSVADEDDAAEDAAAAAEGDPSEEELQKKREEDYDAFTSTKAQDLAQP  151

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV+A +PF IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ S++GSK  RLGSVSDY
Sbjct  152  LVDAQIPFKIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-SRKGSK-GRLGSVSDY  209

Query  732  cvhhcicpvvvvRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYHD  863
            CVHHC+CPVVVVRYPD     G     V D LH VPED E  YHD
Sbjct  210  CVHHCVCPVVVVRYPDDAADAGGDASGVTDELHTVPED-EPVYHD  253



>ref|XP_007043419.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 4 [Theobroma cacao]
 gb|EOX99250.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 4 [Theobroma cacao]
Length=305

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 171/246 (70%), Gaps = 30/246 (12%)
 Frame = +3

Query  213  PVRNVTPLAIAP--PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDG  386
            P+ ++  L I P  P +P   TP  +   +RR+AIAVDLSDESA+AVRWAV++YLRPGD 
Sbjct  14   PLPHLASLRIQPTSPRVPSNATP--TAGSQRRIAIAVDLSDESAYAVRWAVQNYLRPGDA  71

Query  387  VVLLHVQPTAVLYGADWG---------ISTPSDHAppppp-----QTAAEEEDIIDDLTS  524
            V+LLHV+PT+VLYGADWG          +T  ++A          ++  + E+  D  T+
Sbjct  72   VILLHVRPTSVLYGADWGSIQLQITPNATTNHENATAITSGHPDGESQQKLENDFDIFTT  131

Query  525  AKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKV  704
             KA  LA+PLV+A +PF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ ++R SK 
Sbjct  132  TKANTLAQPLVDAQIPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-ARRTSK-  189

Query  705  ERLGSVSDYcvhhcicpvvvvRYPDGDGGG-GAATEVV--------VDLHPVPEDKEYEY  857
             RLGSVSDYCVHHCICPVVVVR+P+ +    G A +V+        V+L PVPE+ E EY
Sbjct  190  GRLGSVSDYCVHHCICPVVVVRFPEEEESEIGGAEKVMKKKMVGEDVELQPVPEE-ELEY  248

Query  858  HDNADD  875
            HD  ++
Sbjct  249  HDAEEE  254



>ref|XP_010458526.1| PREDICTED: uncharacterized protein C167.05-like [Camelina sativa]
 ref|XP_010458527.1| PREDICTED: uncharacterized protein C167.05-like [Camelina sativa]
Length=242

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 158/238 (66%), Gaps = 19/238 (8%)
 Frame = +3

Query  210  RPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGD  383
            R  R    +    P  PR   P+ +PT   +R++ IAVDLSDESA+AV+WAV++YLR GD
Sbjct  9    RSDRKSPTVMTVQPSSPRF--PIGTPTAGAQRKIGIAVDLSDESAYAVQWAVQNYLRSGD  66

Query  384  GVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
             VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+PLV A
Sbjct  67   AVVLLHVQPTSVLYGADWGAIDLSPQWDPENVESQKKLEDDFDIFTNKKASDVAQPLVEA  126

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
            ++ F+IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY VHH
Sbjct  127  DISFSIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDYSVHH  184

Query  744  cicpvvvvRYPDGDGG-------GGAATEVVVD-LHPVPEDKEY-----EYHDNADDE  878
            C CPVVVVR+PD   G        GA   V  D LH VPE  E      EYHD +D +
Sbjct  185  CACPVVVVRFPDDKDGEDERFSEDGAGNLVESDKLHTVPEVAEEEGEKDEYHDASDKQ  242



>gb|EPS70507.1| hypothetical protein M569_04246, partial [Genlisea aurea]
Length=229

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 147/213 (69%), Gaps = 13/213 (6%)
 Frame = +3

Query  249  PLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            P  P   TP+ S T     +R++ IAVDLSDESAFAV+WAVRHYLRPGD VVL+HV+PT+
Sbjct  23   PRFPPPTTPLSSETPTANAQRKIGIAVDLSDESAFAVKWAVRHYLRPGDAVVLVHVRPTS  82

Query  417  VLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
            VLYGADWG S           ++  + ED  D  TS KA  +A+PLV A  PF IHIVKD
Sbjct  83   VLYGADWG-SVDLSIVEAGNEESQRKLEDDFDTFTSTKASDVAQPLVEAQFPFKIHIVKD  141

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD++ERLCLEVERLGLSA+IMGSRGFG+ SKRG    RLGSVSDYCV HC+CPVVVVRYP
Sbjct  142  HDMRERLCLEVERLGLSALIMGSRGFGA-SKRGGD-GRLGSVSDYCVRHCVCPVVVVRYP  199

Query  777  DGDGGGGAATEVVVDLHPVPEDKEYEYHDNADD  875
            D        +    D      ++E EYHD +++
Sbjct  200  DEKESSATVSVSAED------EEEPEYHDASEE  226



>ref|XP_006343271.1| PREDICTED: uncharacterized protein C167.05-like isoform X2 [Solanum 
tuberosum]
Length=246

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 155/230 (67%), Gaps = 23/230 (10%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P  PR   P  +PT    R++AIAVDLSDESA+AV+WAV +YLRPGD V+LLHV+PT+VL
Sbjct  22   PASPRF--PPGTPTSGANRKIAIAVDLSDESAYAVKWAVENYLRPGDAVILLHVRPTSVL  79

Query  423  YGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHD  602
            YGADWG    S        +   EE+   D+ TS K+  LA+PLV+AN+PF I IVKDHD
Sbjct  80   YGADWGAIDVSIDTTDEKSKQKLEED--FDNFTSTKSNDLAQPLVDANIPFKIRIVKDHD  137

Query  603  LKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG  782
            +KERLCLE+ERLGLSA+IMGSRGFG  + R S   RLGSVSDYCV HC+CPV+VVRYPD 
Sbjct  138  MKERLCLEIERLGLSAVIMGSRGFG--ASRRSTEGRLGSVSDYCVRHCVCPVIVVRYPDD  195

Query  783  D----------GGGGAATEVVVD---LHPVPEDKEYEYHDNADDEVDELE  893
                       G  G+A +V      LHPVPE+    YHD A D+  E E
Sbjct  196  KDGVPDDDDSLGNDGSAKKVAKANEVLHPVPEEDSL-YHD-ASDKATETE  243



>ref|XP_004970198.1| PREDICTED: uncharacterized protein LOC101764207 isoform X2 [Setaria 
italica]
Length=259

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 152/225 (68%), Gaps = 24/225 (11%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ----RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            P  PR F   L+ T      RR+AIAVDLSDESAFAVRWAV++YLRPGD VVLLHV+PT+
Sbjct  31   PSSPRFFFSSLAGTNPASPHRRIAIAVDLSDESAFAVRWAVQNYLRPGDAVVLLHVRPTS  90

Query  417  VLYGADWGISTP---------------SDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            VLYGADWG S P               +    P   +   + E+  D  TS KA+ LA+P
Sbjct  91   VLYGADWG-SIPVSVTDEADAAEDAAAAAQGGPTEEELQKKREEDYDAFTSTKAQDLAQP  149

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV+A +PF IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+  K G    RLGSVSDY
Sbjct  150  LVDAQIPFKIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGAHRKGGKG--RLGSVSDY  207

Query  732  cvhhcicpvvvvRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYHD  863
            CVHHC+CPVVVVRYPD   G G      +D LH VPED E  YHD
Sbjct  208  CVHHCVCPVVVVRYPDDAAGAGGDAAGAIDELHTVPED-EPVYHD  251



>dbj|BAK02323.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05389.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 152/207 (73%), Gaps = 12/207 (6%)
 Frame = +3

Query  288  TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAp  467
            +  RR+AIAVDLSDESA+AV WAV +YLRPGD V+LLHV+ T VLYGADWG  TP+    
Sbjct  54   SAHRRIAIAVDLSDESAYAVSWAVANYLRPGDAVILLHVRSTNVLYGADWGSVTPTSPED  113

Query  468  ppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLS  647
                     EED  D LT++KA+ LA+PL  A +P+ IHIVKDHD+KERLCLEVERLGLS
Sbjct  114  DAEVAARKMEEDF-DALTASKADDLAKPLEEAKIPYKIHIVKDHDMKERLCLEVERLGLS  172

Query  648  AMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD---GDGGGGA-ATEVV  815
            A+IMGS+GFG+ ++R SK  RLGSVSDYCVHHCICPVVVVR PD    +GG  A A E  
Sbjct  173  AVIMGSKGFGA-ARRASK-GRLGSVSDYCVHHCICPVVVVRTPDDAVAEGGESATAMEAA  230

Query  816  VD----LHPVPEDKEYEYHDNADDEVD  884
            V     LHPVPE+ + EYHD A++  D
Sbjct  231  VGAEDVLHPVPEE-DAEYHDAAEEHKD  256



>ref|XP_002316672.2| hypothetical protein POPTR_0011s03970g [Populus trichocarpa]
 gb|EEE97284.2| hypothetical protein POPTR_0011s03970g [Populus trichocarpa]
Length=249

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 147/208 (71%), Gaps = 8/208 (4%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRP  377
            P    P  +   + + PP  PR+     +   +RR+ IAVDLSDESAFAV+WAV++YLR 
Sbjct  7    PKKNPPTESAVVVQVQPPS-PRLHVTTPTTGAQRRIGIAVDLSDESAFAVKWAVQNYLRA  65

Query  378  GDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDL---TSAKAEHLAE  548
            GD V+L+HV PT VLYGADWG S P         Q    ++ I +D    TS KA  +A+
Sbjct  66   GDAVILVHVSPTNVLYGADWG-SLPIKENYNLDDQNEENQQKIEEDFNLFTSTKANDIAQ  124

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV+AN+PF IHIVKDHD+KERLCLEVERLG SA++MGSRGFG+ S++ SK  RLGSVSD
Sbjct  125  PLVDANIPFKIHIVKDHDMKERLCLEVERLGFSAVVMGSRGFGA-SRKSSK-GRLGSVSD  182

Query  729  YcvhhcicpvvvvRYPD-GDGGGGAATE  809
            YCVHHC+CPV+VVR+PD  DGG G  +E
Sbjct  183  YCVHHCVCPVIVVRFPDEKDGGAGEESE  210



>ref|XP_004970197.1| PREDICTED: uncharacterized protein LOC101764207 isoform X1 [Setaria 
italica]
Length=260

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 152/225 (68%), Gaps = 24/225 (11%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ----RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            P  PR F   L+ T      RR+AIAVDLSDESAFAVRWAV++YLRPGD VVLLHV+PT+
Sbjct  31   PSSPRFFFSSLAGTNPASPHRRIAIAVDLSDESAFAVRWAVQNYLRPGDAVVLLHVRPTS  90

Query  417  VLYGADWGISTP---------------SDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            VLYGADWG S P               +    P   +   + E+  D  TS KA+ LA+P
Sbjct  91   VLYGADWG-SIPVSVTDEADAAEDAAAAAQGGPTEEELQKKREEDYDAFTSTKAQDLAQP  149

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV+A +PF IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+  K G    RLGSVSDY
Sbjct  150  LVDAQIPFKIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGAHRKGGKG--RLGSVSDY  207

Query  732  cvhhcicpvvvvRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYHD  863
            CVHHC+CPVVVVRYPD   G G      +D LH VPED E  YHD
Sbjct  208  CVHHCVCPVVVVRYPDDAAGAGGDAAGAIDELHTVPED-EPVYHD  251



>ref|XP_008803866.1| PREDICTED: uncharacterized protein C167.05-like [Phoenix dactylifera]
Length=262

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 149/207 (72%), Gaps = 23/207 (11%)
 Frame = +3

Query  285  PTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG-------I  443
            P   RR+AIAVDLS+ESA+AVRWAV++YLRPGD V+LLHV+PT+VLYGADWG        
Sbjct  46   PGSHRRIAIAVDLSNESAYAVRWAVQNYLRPGDAVILLHVRPTSVLYGADWGSIDLSVSA  105

Query  444  STPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCL  623
            +  +    P   ++  + ED  D  T+ KA+ LA+PLV A +PF IHIVKDHD+KERLCL
Sbjct  106  AAAASAEEPDSEESQQKLEDDFDTFTTTKAQDLAQPLVEAQIPFKIHIVKDHDMKERLCL  165

Query  624  EVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG-------  782
            EVERLGLSA+IMGSRGFG+ SKR SK  RLGSVSDYCVHHC+CPVVVVRYPD        
Sbjct  166  EVERLGLSAVIMGSRGFGA-SKRSSK-SRLGSVSDYCVHHCVCPVVVVRYPDDVTGAGTG  223

Query  783  ------DGGGGAATEVVVDLHPVPEDK  845
                  DGG GA  +  + L PVPE++
Sbjct  224  ARRSSVDGGDGAVGK-DLGLQPVPEEE  249



>ref|NP_001131438.1| uncharacterized protein LOC100192770 [Zea mays]
 gb|ACF79843.1| unknown [Zea mays]
 gb|ACF88029.1| unknown [Zea mays]
 gb|ACG31901.1| USP family protein [Zea mays]
 gb|ACG34291.1| USP family protein [Zea mays]
 tpg|DAA57346.1| TPA: putative USP family protein [Zea mays]
Length=256

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 152/225 (68%), Gaps = 24/225 (11%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ----RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            P  PR F   L+ T      RR+AIAVDLSDESAFAV+WAV++YLRPGD VVLLHV+PT+
Sbjct  28   PSSPRFFFSSLAGTNPASPHRRIAIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRPTS  87

Query  417  VLYGADWGISTP---------------SDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            VLYGADWG S P               +    P   +   + E+  D  TS KA+ LA+P
Sbjct  88   VLYGADWG-SIPVSVADEADAAEDAAAAAEGGPSEEELQKKREEEYDAFTSTKAQDLAQP  146

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV+A +PF IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ S++G K  RLGSVSDY
Sbjct  147  LVDAQIPFKIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-SRKGGK-GRLGSVSDY  204

Query  732  cvhhcicpvvvvRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYHD  863
            CVHHC+CPVVVVRYPD             D LH VPED E  YHD
Sbjct  205  CVHHCVCPVVVVRYPDDAADASGDASGATDELHTVPED-EPVYHD  248



>gb|AID16052.1| putative universal stress protein, partial [Catharanthus roseus]
Length=177

 Score =   194 bits (492),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 126/161 (78%), Gaps = 6/161 (4%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYG  428
            P  PR  +   +   +R++AIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT+VLYG
Sbjct  22   PASPRFPSGTPTSGAQRKIAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPTSVLYG  81

Query  429  ADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLK  608
            ADWG     DH+     ++  + ED  D+ T+ KA  LA+PLV+AN+PF IHIVKDHD+K
Sbjct  82   ADWGAV---DHSVTDE-ESQQKLEDDFDNFTTTKANDLAQPLVDANIPFKIHIVKDHDMK  137

Query  609  ERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            ERLCLEVERLGLSA+IMGSRGFG+ S+R +K  RLGSVSDY
Sbjct  138  ERLCLEVERLGLSAVIMGSRGFGA-SRRSTK-GRLGSVSDY  176



>tpg|DAA63063.1| TPA: USP family protein isoform 1 [Zea mays]
 tpg|DAA63064.1| TPA: USP family protein isoform 2 [Zea mays]
Length=269

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 155/218 (71%), Gaps = 22/218 (10%)
 Frame = +3

Query  288  TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSD  458
            T  RR+AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYGADWG   +S P+ 
Sbjct  54   TAHRRIAIAVDLSDESAYAVRWAVANYLRPGDAVILLHVRPTSVLYGADWGAVDVSLPNP  113

Query  459  HApppp------pQTAAEE---EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKE  611
             A           +TAA     ED  D  T+ KA+  A PL +A +P+ IHIV+DHD+KE
Sbjct  114  SATAASEDGDGDCETAAAARRMEDDYDAFTATKADDFASPLKDAGIPYKIHIVRDHDMKE  173

Query  612  RLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD---G  782
            RLCLEVERL LSA+IMGS+GFG+ ++R SK  RLGSVSDYCVHHC+CPVVVVR+PD    
Sbjct  174  RLCLEVERLSLSAVIMGSKGFGA-ARRTSK-GRLGSVSDYCVHHCVCPVVVVRFPDDGSA  231

Query  783  DGGGGAATEVVVD----LHPVPEDKEYEYHDNADDEVD  884
            +GG  A     V     LHPVPE+ E EYHD A++  D
Sbjct  232  EGGEAAGLSAAVGAEDVLHPVPEE-EGEYHDAAEEHKD  268



>ref|XP_006343270.1| PREDICTED: uncharacterized protein C167.05-like isoform X1 [Solanum 
tuberosum]
Length=258

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 152/223 (68%), Gaps = 22/223 (10%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P  PR   P  +PT    R++AIAVDLSDESA+AV+WAV +YLRPGD V+LLHV+PT+VL
Sbjct  22   PASPRF--PPGTPTSGANRKIAIAVDLSDESAYAVKWAVENYLRPGDAVILLHVRPTSVL  79

Query  423  YGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHD  602
            YGADWG    S        +   EE+   D+ TS K+  LA+PLV+AN+PF I IVKDHD
Sbjct  80   YGADWGAIDVSIDTTDEKSKQKLEED--FDNFTSTKSNDLAQPLVDANIPFKIRIVKDHD  137

Query  603  LKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG  782
            +KERLCLE+ERLGLSA+IMGSRGFG  + R S   RLGSVSDYCV HC+CPV+VVRYPD 
Sbjct  138  MKERLCLEIERLGLSAVIMGSRGFG--ASRRSTEGRLGSVSDYCVRHCVCPVIVVRYPDD  195

Query  783  D----------GGGGAATEVVVD---LHPVPEDKEYEYHDNAD  872
                       G  G+A +V      LHPVPE+    YHD +D
Sbjct  196  KDGVPDDDDSLGNDGSAKKVAKANEVLHPVPEEDSL-YHDASD  237



>ref|XP_002316938.2| hypothetical protein POPTR_0011s12800g [Populus trichocarpa]
 gb|EEE97550.2| hypothetical protein POPTR_0011s12800g [Populus trichocarpa]
Length=271

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 143/205 (70%), Gaps = 25/205 (12%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPS---  455
            RR++ +AVDLSDESA+AV WAV HY+RPGD V+LLHV PT+VL+GADWG   +STP+   
Sbjct  48   RRKIGVAVDLSDESAYAVSWAVDHYIRPGDAVILLHVSPTSVLFGADWGPLPLSTPTQSQ  107

Query  456  --------------DHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVK  593
                          D       +   + ED  D  T++KA  LA PL  A +P+ IHIVK
Sbjct  108  LDLLNNTSKFNNEIDSKNESSEKPQQQNEDDEDAFTASKAADLARPLKEAQIPYKIHIVK  167

Query  594  DHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRY  773
            DHD+KERLCLEVERLGLSA+IMGSRGFG+  KRGS  ERLGSVSDYCVHHC+CPVVVVRY
Sbjct  168  DHDMKERLCLEVERLGLSAVIMGSRGFGA-EKRGSD-ERLGSVSDYCVHHCVCPVVVVRY  225

Query  774  PDGDGGGGAATEVVVDLHPVPEDKE  848
            P+   GG A  E VV+   VPED E
Sbjct  226  PEDKDGGVADLEAVVN---VPEDVE  247



>ref|XP_004234137.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=267

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 150/227 (66%), Gaps = 22/227 (10%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P  PR   P  +PT    R++AIAVDLSDESA+AV+WAV +YLRPGD V+LLHV+PT+VL
Sbjct  43   PASPRF--PPGTPTSGANRKIAIAVDLSDESAYAVKWAVENYLRPGDAVILLHVRPTSVL  100

Query  423  YGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHD  602
            YGADWG    S        +   EE+   D+ TS K+  LA+PLV+AN+PF I IVKDHD
Sbjct  101  YGADWGAIDVSIDTTDEKSKQKLEED--FDNFTSTKSNDLAQPLVDANIPFKIRIVKDHD  158

Query  603  LKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD-  779
            +KERLCLE+ERLGLSA+IMGSRGFG  + R S   RLGSVSDYCV HC+CPV+VVRYPD 
Sbjct  159  MKERLCLEIERLGLSAVIMGSRGFG--ASRRSTEGRLGSVSDYCVRHCVCPVIVVRYPDD  216

Query  780  ------------GDGGGGAATEVVVDLHPVPEDKEYEYHDNADDEVD  884
                         DG    A +    LH VPE+    YHD +D   D
Sbjct  217  KDAVPDDDDSLGNDGSAKKAAKANEVLHLVPEEDSL-YHDASDKATD  262



>tpg|DAA57347.1| TPA: hypothetical protein ZEAMMB73_028214 [Zea mays]
Length=261

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 152/225 (68%), Gaps = 24/225 (11%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ----RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            P  PR F   L+ T      RR+AIAVDLSDESAFAV+WAV++YLRPGD VVLLHV+PT+
Sbjct  28   PSSPRFFFSSLAGTNPASPHRRIAIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRPTS  87

Query  417  VLYGADWGISTP---------------SDHApppppQTAAEEEDIIDDLTSAKAEHLAEP  551
            VLYGADWG S P               +    P   +   + E+  D  TS KA+ LA+P
Sbjct  88   VLYGADWG-SIPVSVADEADAAEDAAAAAEGGPSEEELQKKREEEYDAFTSTKAQDLAQP  146

Query  552  LVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            LV+A +PF IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ S++G K  RLGSVSDY
Sbjct  147  LVDAQIPFKIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-SRKGGK-GRLGSVSDY  204

Query  732  cvhhcicpvvvvRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYHD  863
            CVHHC+CPVVVVRYPD             D LH VPED E  YHD
Sbjct  205  CVHHCVCPVVVVRYPDDAADASGDASGATDELHTVPED-EPVYHD  248



>ref|XP_008224913.1| PREDICTED: uncharacterized protein C167.05 [Prunus mume]
Length=233

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 163/242 (67%), Gaps = 20/242 (8%)
 Frame = +3

Query  177  QKSVHFEPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVR  350
            +KS   EPG R+     +   +  P  PR + P  +PT   +RR+ IAVDLSDESAFAV+
Sbjct  5    RKSPLKEPGDRQ-----SAAIVVQPSSPR-YPPSGTPTSGAQRRIGIAVDLSDESAFAVK  58

Query  351  WAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHApppppQTAAEEEDIIDDLT  521
            WAV++YLRPGD V+LLHV+PT+VLYGADWG   +S P D       ++  + ED  D+ T
Sbjct  59   WAVQNYLRPGDAVILLHVRPTSVLYGADWGATDVSIPEDQ------ESQQKLEDDFDNFT  112

Query  522  SAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSK  701
              KA  LA+PL  A  P+ IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ SK  SK
Sbjct  113  VTKANDLAKPLEEAKTPYKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SKTTSK  171

Query  702  VERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEVVVDLHPVPEDKEYEYHDNADDEV  881
              RLGSVSDYCVHHC+CPV+VVR+ D       A +      PV  ++E E+HD  + + 
Sbjct  172  A-RLGSVSDYCVHHCVCPVIVVRFSDEKDENDVAKQGKFGC-PVVREEEPEFHDALEKDS  229

Query  882  DE  887
            D+
Sbjct  230  DK  231



>ref|XP_002458609.1| hypothetical protein SORBIDRAFT_03g036580 [Sorghum bicolor]
 gb|EES03729.1| hypothetical protein SORBIDRAFT_03g036580 [Sorghum bicolor]
Length=260

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 154/226 (68%), Gaps = 25/226 (11%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ----RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            P  PR F   L+ T      RR+AIAVDLSDESAFAV+WAV++YLRPGD VVLLHV+PT+
Sbjct  31   PSSPRFFFSSLAGTNPASPHRRIAIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRPTS  90

Query  417  VLYGADWGISTP----------------SDHApppppQTAAEEEDIIDDLTSAKAEHLAE  548
            VLYGADWG S P                +    P   +   + E+  D  TS KA+ LA+
Sbjct  91   VLYGADWG-SIPVSVADEADAAEDAAAAAVEGGPSEEELQKKREEDYDAFTSTKAQDLAQ  149

Query  549  PLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSD  728
            PLV+A +PF IH+VKDHD+KERLCLE ERLGLSAMIMGSRGFG+ S++G K  RLGSVSD
Sbjct  150  PLVDAQIPFKIHVVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-SRKGGK-GRLGSVSD  207

Query  729  YcvhhcicpvvvvRYPDGDGGGGAATEVVVD-LHPVPEDKEYEYHD  863
            YCVHHC+CPVVVVRYPD   G G       D LH VPED E  YHD
Sbjct  208  YCVHHCVCPVVVVRYPDDAAGAGGDAAGATDELHTVPED-EPVYHD  252



>gb|EMS67287.1| hypothetical protein TRIUR3_25325 [Triticum urartu]
Length=313

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 150/201 (75%), Gaps = 12/201 (6%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppp  476
            RR+AIAVDLSDESA+AV WAV +YLRPGD V+LLHV+ T VLYGADWG  TP+       
Sbjct  103  RRIAIAVDLSDESAYAVSWAVANYLRPGDAVILLHVRSTNVLYGADWGSVTPTSPEDDAE  162

Query  477  pQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMI  656
                  EED  D LT++KA+ LA+PL  A +P+ IHIVKDHD+KERLCLEVERLGLSA+I
Sbjct  163  VAARKMEEDF-DALTASKADDLAKPLEEAKIPYKIHIVKDHDMKERLCLEVERLGLSAVI  221

Query  657  MGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD---GDGGGGAAT-EVVVD-  821
            MGS+GFG+ ++R SK  RLGSVSDYCVHHCICPVVVVR PD    +GG  A T E  V  
Sbjct  222  MGSKGFGA-ARRASK-GRLGSVSDYCVHHCICPVVVVRSPDDAVAEGGESATTMEAAVGA  279

Query  822  ---LHPVPEDKEYEYHDNADD  875
               LHPVPE+ + EYHD A++
Sbjct  280  DDVLHPVPEE-DAEYHDAAEE  299



>ref|XP_011029385.1| PREDICTED: uncharacterized protein LOC105129141 [Populus euphratica]
Length=256

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 143/205 (70%), Gaps = 25/205 (12%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPS---  455
            RR++ +AVDLSDESA+AV WAV HY+RPGD V+LLHV PT+VL+GADWG   +STP+   
Sbjct  48   RRKIGVAVDLSDESAYAVSWAVDHYIRPGDAVILLHVSPTSVLFGADWGPLPLSTPTQSQ  107

Query  456  --------------DHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVK  593
                          D       +   + ED  D  T++KA  LA PL  A +P+ IHIVK
Sbjct  108  LDLLNNTSKFNNEIDSKNDSSEKPQQQNEDDEDAFTASKAADLARPLKEAQIPYKIHIVK  167

Query  594  DHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRY  773
            DHD+KERLCLEVERLGLSA+IMGSRGFG+  KRGS  ERLGSVSDYCVHHC+CPVVVVRY
Sbjct  168  DHDMKERLCLEVERLGLSAVIMGSRGFGA-EKRGSD-ERLGSVSDYCVHHCVCPVVVVRY  225

Query  774  PDGDGGGGAATEVVVDLHPVPEDKE  848
            P+   GG A  E VV+   VPED E
Sbjct  226  PEDKDGGVADLEAVVN---VPEDVE  247



>ref|XP_009616176.1| PREDICTED: uncharacterized protein LOC104108761 [Nicotiana tomentosiformis]
Length=243

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 148/202 (73%), Gaps = 6/202 (3%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            +R++ IAVDLSDESAFAV+WAV  YLRPGD V+LLHV+PT+VLYGADWG S         
Sbjct  45   QRKIGIAVDLSDESAFAVKWAVHQYLRPGDAVILLHVRPTSVLYGADWG-SVDLSIVDTE  103

Query  474  ppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAM  653
              ++  + ED  D  T+ K   +++PLV+A +PF IHIVKDHD++ERLCLEVERLGLSA+
Sbjct  104  NEESQRKLEDDFDTFTTTKVSDISQPLVDAQIPFKIHIVKDHDMRERLCLEVERLGLSAV  163

Query  654  IMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP-DGDGGGGAATEVVVDL--  824
            IMGSRGFG+ +KRGS   RLGSVSDYCV HC+CPVVVVRYP D D G  A +E VV +  
Sbjct  164  IMGSRGFGA-TKRGSD-GRLGSVSDYCVRHCVCPVVVVRYPDDKDSGANAVSEPVVSVAS  221

Query  825  HPVPEDKEYEYHDNADDEVDEL  890
                +++E EYHD +D   D L
Sbjct  222  AAEEDEEEAEYHDASDHRKDSL  243



>ref|XP_008651511.1| PREDICTED: LOC100284683 isoform X1 [Zea mays]
Length=280

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 154/215 (72%), Gaps = 22/215 (10%)
 Frame = +3

Query  288  TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSD  458
            T  RR+AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYGADWG   +S P+ 
Sbjct  54   TAHRRIAIAVDLSDESAYAVRWAVANYLRPGDAVILLHVRPTSVLYGADWGAVDVSLPNP  113

Query  459  HApppp------pQTAAEE---EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKE  611
             A           +TAA     ED  D  T+ KA+  A PL +A +P+ IHIV+DHD+KE
Sbjct  114  SATAASEDGDGDCETAAAARRMEDDYDAFTATKADDFASPLKDAGIPYKIHIVRDHDMKE  173

Query  612  RLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD---G  782
            RLCLEVERL LSA+IMGS+GFG+ ++R SK  RLGSVSDYCVHHC+CPVVVVR+PD    
Sbjct  174  RLCLEVERLSLSAVIMGSKGFGA-ARRTSK-GRLGSVSDYCVHHCVCPVVVVRFPDDGSA  231

Query  783  DGGGGAATEVVVD----LHPVPEDKEYEYHDNADD  875
            +GG  A     V     LHPVPE+ E EYHD A++
Sbjct  232  EGGEAAGLSAAVGAEDVLHPVPEE-EGEYHDAAEE  265



>ref|XP_007211971.1| hypothetical protein PRUPE_ppa010857mg [Prunus persica]
 gb|EMJ13170.1| hypothetical protein PRUPE_ppa010857mg [Prunus persica]
Length=233

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 162/241 (67%), Gaps = 20/241 (8%)
 Frame = +3

Query  180  KSVHFEPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRW  353
            KS   EPG R+     +   +  P  PR + P  +PT   +RR+ IAVDLSDESAFAV+W
Sbjct  6    KSPLKEPGDRQ-----SAAIVVQPSSPR-YPPSGTPTSGAQRRIGIAVDLSDESAFAVKW  59

Query  354  AVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHApppppQTAAEEEDIIDDLTS  524
            AV++YLRPGD V+LLHV+PT+VLYGADWG   +S P D       ++  + ED  D+ T 
Sbjct  60   AVQNYLRPGDAVILLHVRPTSVLYGADWGATDVSIPEDQ------ESQQKLEDDFDNFTV  113

Query  525  AKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKV  704
             KA  LA+PL  A  P+ IHIVKDHD+KERLCLEVERLGLSA++MGSRGFG+ SK  SK 
Sbjct  114  TKANDLAKPLEEAKTPYKIHIVKDHDMKERLCLEVERLGLSAVVMGSRGFGA-SKTTSKA  172

Query  705  ERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEVVVDLHPVPEDKEYEYHDNADDEVD  884
             RLGSVSDYCVHHC+CPV+VVR+ D       A +      PV  ++E E+HD  + + D
Sbjct  173  -RLGSVSDYCVHHCVCPVIVVRFSDEKDENDVAKQGKFGC-PVVREEEPEFHDALEKDSD  230

Query  885  E  887
            +
Sbjct  231  K  231



>ref|XP_006303262.1| hypothetical protein CARUB_v10009983mg, partial [Capsella rubella]
 gb|EOA36160.1| hypothetical protein CARUB_v10009983mg, partial [Capsella rubella]
Length=263

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 159/240 (66%), Gaps = 23/240 (10%)
 Frame = +3

Query  210  RPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGD  383
            R  R    +    P  PR   P+ +PT   +R++ IAVDLSDESA+AV+WAV++YLR GD
Sbjct  26   RSDRKSPTVVTVQPSSPRF--PIGTPTAGAQRKIGIAVDLSDESAYAVQWAVQNYLRSGD  83

Query  384  GVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
             VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+PLV A
Sbjct  84   AVVLLHVQPTSVLYGADWGAIDLSPQWDPDNEESQKKLEDDFDIFTNKKASDVAQPLVEA  143

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
            ++PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY VHH
Sbjct  144  DIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDYSVHH  201

Query  744  cicpvvvvRYPD---------GDGGGGAATEVVVDLHPVPE------DKEYEYHDNADDE  878
            C CPVVVVR+PD         G+ G G   E    LH VPE      DK+ EYHD  D +
Sbjct  202  CACPVVVVRFPDDKDVQDVKSGEFGPGNLVE-GDKLHTVPELAEEEGDKD-EYHDAPDKQ  259



>ref|XP_006303261.1| hypothetical protein CARUB_v10009983mg, partial [Capsella rubella]
 gb|EOA36159.1| hypothetical protein CARUB_v10009983mg, partial [Capsella rubella]
Length=276

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 159/240 (66%), Gaps = 23/240 (10%)
 Frame = +3

Query  210  RPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGD  383
            R  R    +    P  PR   P+ +PT   +R++ IAVDLSDESA+AV+WAV++YLR GD
Sbjct  26   RSDRKSPTVVTVQPSSPRF--PIGTPTAGAQRKIGIAVDLSDESAYAVQWAVQNYLRSGD  83

Query  384  GVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
             VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+PLV A
Sbjct  84   AVVLLHVQPTSVLYGADWGAIDLSPQWDPDNEESQKKLEDDFDIFTNKKASDVAQPLVEA  143

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
            ++PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY VHH
Sbjct  144  DIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDYSVHH  201

Query  744  cicpvvvvRYPD---------GDGGGGAATEVVVDLHPVPE------DKEYEYHDNADDE  878
            C CPVVVVR+PD         G+ G G   E    LH VPE      DK+ EYHD  D +
Sbjct  202  CACPVVVVRFPDDKDVQDVKSGEFGPGNLVE-GDKLHTVPELAEEEGDKD-EYHDAPDKQ  259



>ref|XP_010694460.1| PREDICTED: uncharacterized protein LOC104907253 [Beta vulgaris 
subsp. vulgaris]
Length=268

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 138/178 (78%), Gaps = 7/178 (4%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGI-----STPSDH  461
            R++AIAVDLSDESAFAV+WAV HY+RPGD VVLLHV+PT+VLYGADWG      +  S++
Sbjct  65   RKIAIAVDLSDESAFAVKWAVDHYIRPGDAVVLLHVRPTSVLYGADWGCVDFDAANSSNN  124

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
            +     ++  + ED  D  T++KA  LA+PL+ A VP+ IHIVKDHD+KERLCLEVERLG
Sbjct  125  SNKNEQESQQKLEDDFDAFTTSKAADLAQPLLQAQVPYKIHIVKDHDMKERLCLEVERLG  184

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEVV  815
             +A+IMGSRGFG+ SKRGS   RLGSVSDYCV HC+CPVVVVRYPD   G G   E++
Sbjct  185  FNAVIMGSRGFGA-SKRGSN-GRLGSVSDYCVRHCVCPVVVVRYPDEKDGNGGDDEMI  240



>ref|XP_010646368.1| PREDICTED: uncharacterized protein LOC100855106 [Vitis vinifera]
Length=232

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 147/216 (68%), Gaps = 18/216 (8%)
 Frame = +3

Query  198  PGYRRPVRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRP  377
            P   RP   +    +  P  PR   P+      R++ IAVDLSDESAFAV+WAV++YLRP
Sbjct  8    PESERPATAI----LVQPSSPRF--PITPTGAHRKIGIAVDLSDESAFAVKWAVQNYLRP  61

Query  378  GDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLV  557
            GD V+LLHV+PT+VLYGADWG     D +     ++  + ED  D  T+AKA  LA+PLV
Sbjct  62   GDVVILLHVRPTSVLYGADWG---SIDLSMETDEESQQKLEDDFDAFTTAKANDLAQPLV  118

Query  558  NANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcv  737
             A +P  IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+ SKR SK  RLGSVSDYCV
Sbjct  119  EAQIPVKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-SKRNSK-GRLGSVSDYCV  176

Query  738  hhcicpvvvvRYPDGDGGGGAATEVVVDLHPVPEDK  845
            HHC+CPVVVVR+PD   G  +           PEDK
Sbjct  177  HHCVCPVVVVRFPDDKDGNDSG-------DATPEDK  205



>ref|XP_006303263.1| hypothetical protein CARUB_v10009983mg, partial [Capsella rubella]
 gb|EOA36161.1| hypothetical protein CARUB_v10009983mg, partial [Capsella rubella]
Length=270

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 159/240 (66%), Gaps = 23/240 (10%)
 Frame = +3

Query  210  RPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGD  383
            R  R    +    P  PR   P+ +PT   +R++ IAVDLSDESA+AV+WAV++YLR GD
Sbjct  26   RSDRKSPTVVTVQPSSPRF--PIGTPTAGAQRKIGIAVDLSDESAYAVQWAVQNYLRSGD  83

Query  384  GVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
             VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+PLV A
Sbjct  84   AVVLLHVQPTSVLYGADWGAIDLSPQWDPDNEESQKKLEDDFDIFTNKKASDVAQPLVEA  143

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
            ++PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY VHH
Sbjct  144  DIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDYSVHH  201

Query  744  cicpvvvvRYPD---------GDGGGGAATEVVVDLHPVPE------DKEYEYHDNADDE  878
            C CPVVVVR+PD         G+ G G   E    LH VPE      DK+ EYHD  D +
Sbjct  202  CACPVVVVRFPDDKDVQDVKSGEFGPGNLVE-GDKLHTVPELAEEEGDKD-EYHDAPDKQ  259



>gb|AAF16649.1|AC011661_27 T23J18.3 [Arabidopsis thaliana]
Length=875

 Score =   206 bits (523),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 163/239 (68%), Gaps = 21/239 (9%)
 Frame = +3

Query  210  RPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGD  383
            R  R    +    P  PR   P+ +PT   +R++ IAVDLSDESA+AV+WAV++YLR GD
Sbjct  642  RSDRKSPTVVTVQPSSPRF--PISTPTAGAQRKIGIAVDLSDESAYAVQWAVQNYLRSGD  699

Query  384  GVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
             VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D +T+ KA  +A+PLV A
Sbjct  700  AVVLLHVQPTSVLYGADWGAMDLSPQWDPNNEESQRKLEDDFDIVTNKKASDVAQPLVEA  759

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
            ++PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY VHH
Sbjct  760  DIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDYSVHH  817

Query  744  cicpvvvvRYPDGDGG-----GGAATEVVVD---LHPVPE------DKEYEYHDNADDE  878
            C CPVVVVR+PD   G     G +  E ++D   LH VPE      DK+ EYHD +D +
Sbjct  818  CACPVVVVRFPDDKDGEDEKSGDSGGENLMDSDKLHTVPEVAEEEGDKD-EYHDASDKQ  875



>gb|EMT17863.1| hypothetical protein F775_30320 [Aegilops tauschii]
Length=333

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 151/204 (74%), Gaps = 12/204 (6%)
 Frame = +3

Query  288  TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAp  467
            +  RR+AIAVDLSDESA+AV WAV +YLRPGD V+LLHV+ T VLYGADWG  TP+    
Sbjct  120  SAHRRIAIAVDLSDESAYAVSWAVANYLRPGDAVILLHVRSTNVLYGADWGSVTPTSPED  179

Query  468  ppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLS  647
                     EED  D LT++KA+ LA+PL  A +P+ IHIVKDHD+KERLCLEVERLGLS
Sbjct  180  DAEVAARKMEEDF-DALTASKADDLAKPLEEAKIPYKIHIVKDHDMKERLCLEVERLGLS  238

Query  648  AMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD---GDGGGGA-ATEVV  815
            A+IMGS+GFG+ ++R SK  RLGSVSDYCVHHCICPVVVVR PD    +GG  A A E  
Sbjct  239  AVIMGSKGFGA-ARRASK-GRLGSVSDYCVHHCICPVVVVRSPDDAVAEGGESATAMEAA  296

Query  816  VD----LHPVPEDKEYEYHDNADD  875
            V     LHPVPE+ + EYHD A++
Sbjct  297  VGAEDVLHPVPEE-DAEYHDAAEE  319



>emb|CDP05842.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   193 bits (491),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 148/198 (75%), Gaps = 6/198 (3%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            +R++ IAVDLSDESAFAV+WAV HYLRPGD V+L+HV+PT+VLYGADWG S         
Sbjct  49   QRKIGIAVDLSDESAFAVKWAVHHYLRPGDAVILVHVRPTSVLYGADWG-SVDLSIVDAE  107

Query  474  ppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAM  653
               +  + ED  D  T+ KA  LA+PLV A +PF IHIVKDHD+KERLCLEVERLGLSA+
Sbjct  108  NEVSQQKLEDDFDTFTTTKASDLAQPLVEAQIPFKIHIVKDHDMKERLCLEVERLGLSAV  167

Query  654  IMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG-DGGGGAATEVVVDLHP  830
            IMGSRGFG+ ++RGS   RLGSVSDYCV HC+CPVVVVRY D  +GGG AA   VV +  
Sbjct  168  IMGSRGFGA-TRRGSD-GRLGSVSDYCVRHCVCPVVVVRYADDHEGGGNAAPGPVVSVGS  225

Query  831  VP--EDKEYEYHDNADDE  878
            V   +++E EYHD + ++
Sbjct  226  VAEEDEEEQEYHDASTED  243



>ref|XP_010476057.1| PREDICTED: uncharacterized protein C167.05-like [Camelina sativa]
Length=242

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 144/207 (70%), Gaps = 16/207 (8%)
 Frame = +3

Query  210  RPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGD  383
            R  R    +    P  PR   P+ +PT   +R++ IAVDLSDESA+AV+WAV++YLR GD
Sbjct  9    RSDRKSPTVMTVQPSSPRF--PISTPTAGAQRKIGIAVDLSDESAYAVQWAVQNYLRSGD  66

Query  384  GVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
             VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+PLV A
Sbjct  67   AVVLLHVQPTSVLYGADWGAIDLSPQWDPENVESQKKLEDDFDIFTNKKASDVAQPLVEA  126

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
            ++PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY VHH
Sbjct  127  DIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDYSVHH  184

Query  744  cicpvvvvRYPD----------GDGGG  794
            C CPVVVVR+PD          GDG G
Sbjct  185  CACPVVVVRFPDDKDGEDERSSGDGSG  211



>gb|KHG08960.1| Uncharacterized protein F383_12625 [Gossypium arboreum]
Length=240

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 141/185 (76%), Gaps = 7/185 (4%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG--I  443
            TP  +   RR++ +AVDLSDESAFAVRWAV++YLRPGD V+LLHV PT+VL+GADWG   
Sbjct  31   TPTPTSGARRKIGVAVDLSDESAFAVRWAVQNYLRPGDAVILLHVSPTSVLFGADWGPLS  90

Query  444  STPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCL  623
             TP +   P  PQ+  + ED  D  T++KA  LA+PL  A + F IHIVKDHD++ERLCL
Sbjct  91   QTPQN---PETPQSQKQLEDDFDAFTASKAADLAKPLKEAGIHFKIHIVKDHDMRERLCL  147

Query  624  EVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAA  803
            EVERLGLSA+IMGSRGFG+  KRGS   RLGSVSDYCVHHC+CPV+VVRYP+   GG AA
Sbjct  148  EVERLGLSAVIMGSRGFGA-EKRGSD-GRLGSVSDYCVHHCVCPVIVVRYPEDKDGGDAA  205

Query  804  TEVVV  818
              V V
Sbjct  206  PVVNV  210



>ref|XP_006449181.1| hypothetical protein CICLE_v10016399mg [Citrus clementina]
 gb|ESR62421.1| hypothetical protein CICLE_v10016399mg [Citrus clementina]
Length=247

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 150/229 (66%), Gaps = 19/229 (8%)
 Frame = +3

Query  240  IAPPLLPRVFTPVLSPTQ---RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQP  410
            I  P  PR   P+ SPT     R++ IAVDLSDESAFAV+WAV++YLRPGD VVLLHV+P
Sbjct  19   IVQPSSPRF--PLSSPTTGGAHRKIGIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRP  76

Query  411  TAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIV  590
            T+VLYGADWG +           ++  + ED  D  T+ KA  LA+PLV A +PF IHIV
Sbjct  77   TSVLYGADWG-AIEVSLEMSESEESQRKLEDDFDQFTTTKANDLAQPLVEAQIPFKIHIV  135

Query  591  KDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvR  770
            KDHD+KERLCLEVERLGLSA+IMGSRGFG+ +K+ SK  RLGSVSDYCVHHC+CPV+VVR
Sbjct  136  KDHDMKERLCLEVERLGLSAVIMGSRGFGA-AKKSSK-SRLGSVSDYCVHHCVCPVIVVR  193

Query  771  YP-----------DGDGGGGAATEVVVDLHPVPEDKEYEYHDNADDEVD  884
            +                  G       +L  V E+ E EYHD  D   D
Sbjct  194  FSDDKDAADGDADAASKSDGVKLGRENELCTVAEEDEQEYHDAFDKHSD  242



>ref|XP_010492698.1| PREDICTED: uncharacterized protein C167.05-like [Camelina sativa]
Length=242

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 141/196 (72%), Gaps = 6/196 (3%)
 Frame = +3

Query  210  RPVRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGD  383
            R  R    +    P  PR   P+ +PT   +R++ IAVDLSDESA+AV+WAV++YLR GD
Sbjct  9    RSDRKSPTVMTVQPSSPRF--PIGTPTAGAQRKIGIAVDLSDESAYAVQWAVQNYLRSGD  66

Query  384  GVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
             VVLLHVQPT+VLYGADWG    S    P   ++  + ED  D  T+ KA  +A+PLV A
Sbjct  67   AVVLLHVQPTSVLYGADWGAIDLSPQWDPENVESQKKLEDDFDIFTNKKASDVAQPLVEA  126

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
            ++PF IHIVKDHD+KERLCLEVERLGLS +IMGSRGFG+ +KR SK  RLGSVSDY VHH
Sbjct  127  DIPFKIHIVKDHDMKERLCLEVERLGLSTLIMGSRGFGA-TKRSSK-GRLGSVSDYSVHH  184

Query  744  cicpvvvvRYPDGDGG  791
            C CPVVVVR+PD   G
Sbjct  185  CACPVVVVRFPDDKDG  200



>ref|XP_009767748.1| PREDICTED: uncharacterized protein LOC104218860 [Nicotiana sylvestris]
Length=242

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 147/200 (74%), Gaps = 6/200 (3%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            +R++ IAVDLSDESAFAV+WAV  YLRPGD V+L+HV+PT+VLYGADWG S         
Sbjct  45   QRKIGIAVDLSDESAFAVKWAVHQYLRPGDAVILVHVRPTSVLYGADWG-SVDLSIVDTE  103

Query  474  ppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAM  653
              ++  + E+  D  T+ KA  +++PLV+A +PF IHIVKDHD++ERLCLEVERLGLSA+
Sbjct  104  NEESQRKLENDFDTFTTTKASDISQPLVDAQIPFKIHIVKDHDMRERLCLEVERLGLSAV  163

Query  654  IMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP-DGDGGGGAATEVVVDLHP  830
            IMGSRGFG+ +KRGS   RLGSVSDYCV HC+CPVVVVRYP D D G  A  E VV +  
Sbjct  164  IMGSRGFGA-TKRGSD-GRLGSVSDYCVRHCVCPVVVVRYPDDKDSGANAVAEPVVSVAS  221

Query  831  --VPEDKEYEYHDNADDEVD  884
                ++++ EYHD +D   D
Sbjct  222  AAEEDEEDAEYHDASDHRKD  241



>gb|KDP20859.1| hypothetical protein JCGZ_21330 [Jatropha curcas]
Length=239

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 144/206 (70%), Gaps = 11/206 (5%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPS-DHApp  470
            +RR+ IAVDLS+ESA+AV+WAV++YLR GD V+L+HV+ T +LYGADWG   PS   +  
Sbjct  31   QRRIGIAVDLSNESAYAVKWAVQNYLRHGDAVILVHVRTTNILYGADWGSIDPSITDSEN  90

Query  471  pppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSA  650
               Q+  + ED  D  T+ K   LA+PLV A +PF IHIVKDHD+KERLCLEVERLGLSA
Sbjct  91   QSEQSNKKIEDEFDLFTNTKVNELAQPLVEAQIPFKIHIVKDHDMKERLCLEVERLGLSA  150

Query  651  MIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD--------GDGGGGAAT  806
            +IMGSRGFG  + R S   RLGSVSDYCVHHC+CPV+VVR+PD        G GG     
Sbjct  151  VIMGSRGFG--ALRKSTKGRLGSVSDYCVHHCVCPVIVVRFPDENDGCRAEGSGGRYKRG  208

Query  807  EVVVDLHPVPEDKEYEYHDNADDEVD  884
            E   +L PV E+ E E+H  +D + D
Sbjct  209  EKDGELPPVVEEAEQEHHGASDKQAD  234



>ref|XP_006467927.1| PREDICTED: uncharacterized protein C167.05-like [Citrus sinensis]
Length=247

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 150/229 (66%), Gaps = 19/229 (8%)
 Frame = +3

Query  240  IAPPLLPRVFTPVLSPTQ---RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQP  410
            I  P  PR   P+ SPT     R++ IAVDLSDESAFAV+WAV++YLRPGD VVLLHV+P
Sbjct  19   IVQPSSPRF--PLSSPTTGGAHRKIGIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRP  76

Query  411  TAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIV  590
            T+VLYGADWG +           ++  + ED  D  T+ KA  LA+PLV A +PF IHIV
Sbjct  77   TSVLYGADWG-AIEVSLEMSESEESQRKLEDDFDQFTTTKANDLAQPLVEAQIPFKIHIV  135

Query  591  KDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvR  770
            KDHD+KERLCLEVERLGLSA+IMGSRGFG+ +K+ SK  RLGSVSDYCVHHC+CPV+VVR
Sbjct  136  KDHDMKERLCLEVERLGLSAVIMGSRGFGA-AKKSSK-SRLGSVSDYCVHHCVCPVIVVR  193

Query  771  YP-----------DGDGGGGAATEVVVDLHPVPEDKEYEYHDNADDEVD  884
            +                  G       +L  V E+ E EYHD  D   D
Sbjct  194  FSDDKDAADGDADAASKSDGLKLGRENELCTVAEEDEQEYHDAFDKHSD  242



>ref|XP_006449182.1| hypothetical protein CICLE_v10016399mg [Citrus clementina]
 gb|ESR62422.1| hypothetical protein CICLE_v10016399mg [Citrus clementina]
Length=246

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 149/225 (66%), Gaps = 19/225 (8%)
 Frame = +3

Query  240  IAPPLLPRVFTPVLSPTQ---RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQP  410
            I  P  PR   P+ SPT     R++ IAVDLSDESAFAV+WAV++YLRPGD VVLLHV+P
Sbjct  19   IVQPSSPRF--PLSSPTTGGAHRKIGIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRP  76

Query  411  TAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIV  590
            T+VLYGADWG +           ++  + ED  D  T+ KA  LA+PLV A +PF IHIV
Sbjct  77   TSVLYGADWG-AIEVSLEMSESEESQRKLEDDFDQFTTTKANDLAQPLVEAQIPFKIHIV  135

Query  591  KDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvR  770
            KDHD+KERLCLEVERLGLSA+IMGSRGFG+ +K+ SK  RLGSVSDYCVHHC+CPV+VVR
Sbjct  136  KDHDMKERLCLEVERLGLSAVIMGSRGFGA-AKKSSK-SRLGSVSDYCVHHCVCPVIVVR  193

Query  771  YP-----------DGDGGGGAATEVVVDLHPVPEDKEYEYHDNAD  872
            +                  G       +L  V E+ E EYHD  D
Sbjct  194  FSDDKDAADGDADAASKSDGVKLGRENELCTVAEEDEQEYHDAFD  238



>gb|KDO75672.1| hypothetical protein CISIN_1g0258351mg, partial [Citrus sinensis]
Length=241

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 149/225 (66%), Gaps = 19/225 (8%)
 Frame = +3

Query  240  IAPPLLPRVFTPVLSPTQ---RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQP  410
            I  P  PR   P+ SPT     R++ IAVDLSDESAFAV+WAV++YLRPGD V+LLHV+P
Sbjct  19   IVQPSSPRF--PLSSPTTGGAHRKIGIAVDLSDESAFAVKWAVQNYLRPGDAVILLHVRP  76

Query  411  TAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIV  590
            T+VLYGADWG +           ++  + ED  D  T+ KA  LA+PLV A +PF IHIV
Sbjct  77   TSVLYGADWG-AIEVSLEMSESEESQRKLEDDFDQFTTTKANDLAQPLVEAQIPFKIHIV  135

Query  591  KDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvR  770
            KDHD+KERLCLEVERLGLSA+IMGSRGFG+ +K+ SK  RLGSVSDYCVHHC+CPV+VVR
Sbjct  136  KDHDMKERLCLEVERLGLSAVIMGSRGFGA-AKKSSK-SRLGSVSDYCVHHCVCPVIVVR  193

Query  771  YP-----------DGDGGGGAATEVVVDLHPVPEDKEYEYHDNAD  872
            +                  G       +L  V E+ E EYHD  D
Sbjct  194  FSDDKDAADGDADAASKSDGLKLGRENELCTVAEEDEQEYHDAFD  238



>ref|XP_007025856.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
 gb|EOY28478.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
Length=248

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 155/230 (67%), Gaps = 20/230 (9%)
 Frame = +3

Query  219  RNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLL  398
            R  T + + P   PR   PV S    R++ IAVDLSDESAFAV+WAV +YLR GD V+LL
Sbjct  17   RQATAILVQPSS-PRF--PVTSSGAHRKIGIAVDLSDESAFAVKWAVHNYLRSGDTVILL  73

Query  399  HVQPTAVLYGADWG---ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANV  569
            HV+PT+VLYGADWG   +S P +       Q   EE D+    T+ K   LA PL  +++
Sbjct  74   HVRPTSVLYGADWGAIDVSLPDEDETQETKQKREEEFDL---FTNKKMNDLALPLAESHI  130

Query  570  PFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhci  749
            PF +H+VKDHD+KERLCLEVERLGLSA+I+GS GFG+ +KR +K  RLGSVSDYCVHHC+
Sbjct  131  PFKVHVVKDHDMKERLCLEVERLGLSAVILGSTGFGA-AKRTAK-GRLGSVSDYCVHHCV  188

Query  750  cpvvvvRYP----DGDGGGGAATEVVVD-----LHPVPEDKEYEYHDNAD  872
            CPV+VVR+P    + DG G    ++  D     L P+ E++E E+HD  D
Sbjct  189  CPVIVVRFPQEEKETDGCGKVEGKIGFDKDGEVLCPLVEEEEQEFHDAMD  238



>ref|XP_010057709.1| PREDICTED: uncharacterized protein LOC104445502 [Eucalyptus grandis]
 gb|KCW74928.1| hypothetical protein EUGRSUZ_E03674 [Eucalyptus grandis]
Length=245

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 144/204 (71%), Gaps = 10/204 (5%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHA  464
            +R++ IAVDLS+ESA+AVRWAV++YLRPGD V+L+HV PT VLYGADWG   +S   D  
Sbjct  36   QRKIGIAVDLSEESAYAVRWAVQNYLRPGDAVILVHVSPTDVLYGADWGSIDLSVGDDDG  95

Query  465  pppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGL  644
                       ED     T+AKA  LA+PLV+A VPF IHIVKDHD+KERLCLEVERLGL
Sbjct  96   EAGEECQKRRLEDEYYAFTTAKANDLAQPLVDAQVPFKIHIVKDHDMKERLCLEVERLGL  155

Query  645  SAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGG------AAT  806
            SA+++GSRGFG+ +++ +K  RLGSVSDYCVHHC+CPV+VVR  D +GGGG      A+ 
Sbjct  156  SAVVLGSRGFGAVARKNAK-GRLGSVSDYCVHHCVCPVIVVRDKDKNGGGGSKMGSPASR  214

Query  807  EVVVDLHPVPEDKEYEYHDNADDE  878
                   P   +++ EYHD  D +
Sbjct  215  GGRCGAGPAVPEEDLEYHDACDKQ  238



>gb|ABK21186.1| unknown [Picea sitchensis]
Length=208

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppp  476
            R++AIAVDLSDESAFAV+WAV +YLRPGD V+LLHV+PT+VLYGADWG S          
Sbjct  19   RKIAIAVDLSDESAFAVKWAVVNYLRPGDNVILLHVRPTSVLYGADWG-SVDLSVEDNTD  77

Query  477  pQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMI  656
             ++  + ED  D  TS KA  LA+PLV+A++PF IHIVKDHD+KERLCLEVERLGLSA+I
Sbjct  78   EESQQKLEDDFDAFTSTKASDLAQPLVDAHIPFKIHIVKDHDMKERLCLEVERLGLSAVI  137

Query  657  MGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            MGSRGFG+ S+R  K  RLGSVSDYCVHHC+CPVVVVRYP
Sbjct  138  MGSRGFGA-SRRTYK-GRLGSVSDYCVHHCVCPVVVVRYP  175



>ref|XP_007021228.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY12753.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
Length=221

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 141/191 (74%), Gaps = 6/191 (3%)
 Frame = +3

Query  234  LAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQ  407
            + I  P  P   T   +PT   RR++ +AVDLS+ESAFAVRW+V++Y+RPGD V+LLHV 
Sbjct  15   IKIHHPSSPHHPTSTATPTAGARRKIGVAVDLSEESAFAVRWSVQNYIRPGDAVILLHVS  74

Query  408  PTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHI  587
            PT+VL+GADWG   P     P  PQ+  + ED  D  T++KA  LA PL  +  PF IHI
Sbjct  75   PTSVLFGADWG-PLPHTPQTPETPQSQKQLEDDFDAFTASKAADLARPLKESGFPFKIHI  133

Query  588  VKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvv  767
            VKDHD++ERLCLEVERLGLSA+IMGSRGFG+  KRGS   RLGSVSDYCVHHC+CPVVVV
Sbjct  134  VKDHDMRERLCLEVERLGLSAVIMGSRGFGA-EKRGSD-GRLGSVSDYCVHHCVCPVVVV  191

Query  768  RYP-DGDGGGG  797
            RYP D DGG G
Sbjct  192  RYPEDKDGGNG  202



>ref|NP_001055972.1| Os05g0501700 [Oryza sativa Japonica Group]
 gb|AAU90231.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17886.1| Os05g0501700 [Oryza sativa Japonica Group]
 dbj|BAG87399.1| unnamed protein product [Oryza sativa Japonica Group]
Length=268

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 143/207 (69%), Gaps = 22/207 (11%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTP--------  452
            RR+AIAVDLSDESAFAV+W+V++YLRPGD VVLLHV+PT+VLYGADWG S P        
Sbjct  58   RRIAIAVDLSDESAFAVKWSVQNYLRPGDAVVLLHVRPTSVLYGADWG-SIPVSVDDDDS  116

Query  453  ----------SDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHD  602
                             P +   + E+  D  TS KA+ LA+PLV A +PF IHIVKDHD
Sbjct  117  APDAAQHANAHAATRDEPEEAKKKREEDFDAFTSTKAQDLAQPLVAAQIPFKIHIVKDHD  176

Query  603  LKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG  782
            +KERLCLE ERLGLSAMIMGSRGFG+ S+R  K  RLGSVSDYCVHHC+CPVVVVRYPD 
Sbjct  177  MKERLCLEAERLGLSAMIMGSRGFGA-SRRAGK-GRLGSVSDYCVHHCVCPVVVVRYPDD  234

Query  783  DGGGGAATEVVVDLHPVPEDKEYEYHD  863
                G    V  +L  VPED E  YH+
Sbjct  235  GAAAGGGEAVGDELRTVPED-EPVYHE  260



>gb|ABK22111.1| unknown [Picea sitchensis]
Length=240

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 128/162 (79%), Gaps = 6/162 (4%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG-ISTPSDHAppp  473
            R++AIAVDLSDESAFAV+WAV +YLRP D V+LLHV+PT+VLYGADWG I    D +   
Sbjct  6    RKIAIAVDLSDESAFAVKWAVLNYLRPSDNVILLHVRPTSVLYGADWGAIDLSVDTSDEE  65

Query  474  ppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAM  653
              Q     ED  D  TS+KA  LA+PLV  NVPF IHIVKDHD+KER+CLEVERLG++A+
Sbjct  66   SHQKL---EDHFDAFTSSKASDLAQPLVEGNVPFKIHIVKDHDMKERICLEVERLGVNAV  122

Query  654  IMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD  779
            IMGSRGFG+ SKR  K  RLGSVSDYCV HC+CPVVVVR+P+
Sbjct  123  IMGSRGFGA-SKRNCK-SRLGSVSDYCVRHCVCPVVVVRFPE  162



>ref|XP_003568163.1| PREDICTED: uncharacterized protein LOC100823570 [Brachypodium 
distachyon]
Length=254

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 156/226 (69%), Gaps = 13/226 (6%)
 Frame = +3

Query  216  VRNVTPLAIAPPLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGV  389
            VR  T +A   P  PR F   L+ +    RR+ IAVDLSDESAFAV+WAV++YLRPGD V
Sbjct  24   VRLATAVAAIQPSSPRFFFSSLAASSSPHRRIGIAVDLSDESAFAVKWAVQNYLRPGDAV  83

Query  390  VLLHVQPTAVLYGADWG---ISTPSDH-----ApppppQTAAEEEDIIDDLTSAKAEHLA  545
            VLLHV+PT+VLYGADWG   +S   D      A   P     + E+  D  TS K++ LA
Sbjct  84   VLLHVRPTSVLYGADWGSIPVSVDDDDGGEAPAGDEPEDARKKREEDFDTFTSTKSQDLA  143

Query  546  EPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVS  725
            +PLV A +PF IHIVKDHD+KERLCLE ERLGLSAMIMGSRGFG+  +RG K  RLGSVS
Sbjct  144  QPLVAAQIPFKIHIVKDHDMKERLCLEAERLGLSAMIMGSRGFGA-FRRGDK-GRLGSVS  201

Query  726  DYcvhhcicpvvvvRYPDGDGGGGAATEVVVDLHPVPEDKEYEYHD  863
            DYCVHHC+CPVVVVRYPD  G  G A     +L  VPE+ E  +H+
Sbjct  202  DYCVHHCVCPVVVVRYPDDAGAAGGAEAAGDELRTVPEN-EVVFHE  246



>ref|XP_002462993.1| hypothetical protein SORBIDRAFT_02g035950 [Sorghum bicolor]
 gb|EER99514.1| hypothetical protein SORBIDRAFT_02g035950 [Sorghum bicolor]
Length=273

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 154/219 (70%), Gaps = 23/219 (11%)
 Frame = +3

Query  288  TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG-----ISTP  452
            T  RR+AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYGADWG     +  P
Sbjct  57   TSHRRIAIAVDLSDESAYAVRWAVANYLRPGDAVILLHVRPTSVLYGADWGAVDVSLPNP  116

Query  453  SDHApppppQTAAEE--------EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLK  608
            S+ A          E        +D  D  T++KA+  A PL +A +P+ IHIV+DHD+K
Sbjct  117  SNAAAASEDDDDDSEAAAAASRMDDDYDAFTASKADDFARPLKDAGIPYKIHIVRDHDMK  176

Query  609  ERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD---  779
            ERLCLEVERL LSA+IMGS+GFG+ ++R SK  RLGSVSDYCVHHC+CPVVVVR+PD   
Sbjct  177  ERLCLEVERLSLSAVIMGSKGFGA-ARRTSK-GRLGSVSDYCVHHCVCPVVVVRFPDDGS  234

Query  780  ---GDGGGGAATEVVVD-LHPVPEDKEYEYHDNADDEVD  884
               G+ GG +A     D LHPV E +E EYHD A++  D
Sbjct  235  AEAGEAGGFSAAVGAEDVLHPVLE-EEAEYHDAAEEHKD  272



>ref|XP_011048505.1| PREDICTED: uncharacterized protein LOC105142527 isoform X1 [Populus 
euphratica]
Length=259

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 147/223 (66%), Gaps = 27/223 (12%)
 Frame = +3

Query  282  SPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGI------  443
            + T  RRVAIAVDLSDESA+AV+WAV +YLRPGD V+LLHV+PT+VLYGADWG       
Sbjct  31   NSTSNRRVAIAVDLSDESAYAVKWAVENYLRPGDAVILLHVRPTSVLYGADWGSIQLQIN  90

Query  444  --STPSDHApppppQTAAEE--EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKE  611
              +TP + +    P     +  ED  D  T+ K   LAEPL+ ANVPF IH+VKDHD+KE
Sbjct  91   NKNTPFELSGSNSPDNRERQKLEDDFDSFTNNKTNLLAEPLLEANVPFKIHVVKDHDMKE  150

Query  612  RLCLEVERLGLSAMIMGSRGFGSPSKRGSKV------ERLGSVSDYcvhhcicpvvvvRY  773
            RLCLEVERLGLSA+IMGSRGFG+  K+G          RLGSVSDYCV HC+CPVVVVR 
Sbjct  151  RLCLEVERLGLSAVIMGSRGFGATRKKGISKGGSVSGGRLGSVSDYCVQHCVCPVVVVRC  210

Query  774  PDGDGGGGAATEV-------VVDLHPVPEDKEYEYHDNADDEV  881
             D DG    + +           LHPVPE+ + E     DDE+
Sbjct  211  SD-DGKEEESVKTGGVGDGVEEGLHPVPEEDQEEC---VDDEL  249



>gb|EAY98599.1| hypothetical protein OsI_20515 [Oryza sativa Indica Group]
Length=282

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 143/207 (69%), Gaps = 22/207 (11%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTP--------  452
            RR+AIAVDLSDESAFAV+W+V++YLRPGD VVLLHV+PT+VLYGADWG S P        
Sbjct  58   RRIAIAVDLSDESAFAVKWSVQNYLRPGDAVVLLHVRPTSVLYGADWG-SIPVSVDDDDS  116

Query  453  ----------SDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHD  602
                             P +   + E+  D  TS KA+ LA+PLV A +PF IHIVKDHD
Sbjct  117  APDAAQHANAHAATRDEPEEAKKKREEDFDAFTSTKAQDLAQPLVAAQIPFKIHIVKDHD  176

Query  603  LKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG  782
            +KERLCLE ERLGLSAMIMGSRGFG+ S+R  K  RLGSVSDYCVHHC+CPVVVVRYPD 
Sbjct  177  MKERLCLEAERLGLSAMIMGSRGFGA-SRRAGK-GRLGSVSDYCVHHCVCPVVVVRYPDD  234

Query  783  DGGGGAATEVVVDLHPVPEDKEYEYHD  863
                G    V  +L  VPED E  YH+
Sbjct  235  GAAAGGGEAVGDELRTVPED-EPVYHE  260



>ref|NP_001059943.1| Os07g0551400 [Oryza sativa Japonica Group]
 dbj|BAC80026.1| CHP-rich zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF21857.1| Os07g0551400 [Oryza sativa Japonica Group]
Length=268

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 154/218 (71%), Gaps = 22/218 (10%)
 Frame = +3

Query  288  TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSD  458
            +  RR+AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYGADWG   +S P+ 
Sbjct  53   SSHRRIAIAVDLSDESAYAVRWAVANYLRPGDAVILLHVRPTSVLYGADWGSVDLSLPAA  112

Query  459  H---------ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKE  611
            +         A       A + ED  D  T++KA+ LA+PL +A +P+ IHIVKDHD+KE
Sbjct  113  NPNPSGDPPSAEDDAEAAARKMEDDFDAFTASKADDLAKPLKDAGIPYKIHIVKDHDMKE  172

Query  612  RLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            RLCLEVERLGLSA+IMGS+GFG+ S+R SK  RLGSVSDYCVHHC+CPVVVVR+PD    
Sbjct  173  RLCLEVERLGLSAVIMGSKGFGA-SRRTSK-GRLGSVSDYCVHHCVCPVVVVRFPDDGVA  230

Query  792  GGAATEVVVD-------LHPVPEDKEYEYHDNADDEVD  884
             G       +       LHPVPE+ + EYHD  ++  D
Sbjct  231  EGGEAGGASELAVGEEVLHPVPEE-DAEYHDATEEHKD  267



>ref|XP_011048507.1| PREDICTED: uncharacterized protein LOC105142527 isoform X2 [Populus 
euphratica]
Length=252

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 145/218 (67%), Gaps = 24/218 (11%)
 Frame = +3

Query  282  SPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGI------  443
            + T  RRVAIAVDLSDESA+AV+WAV +YLRPGD V+LLHV+PT+VLYGADWG       
Sbjct  31   NSTSNRRVAIAVDLSDESAYAVKWAVENYLRPGDAVILLHVRPTSVLYGADWGSIQLQIN  90

Query  444  --STPSDHApppppQTAAEE--EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKE  611
              +TP + +    P     +  ED  D  T+ K   LAEPL+ ANVPF IH+VKDHD+KE
Sbjct  91   NKNTPFELSGSNSPDNRERQKLEDDFDSFTNNKTNLLAEPLLEANVPFKIHVVKDHDMKE  150

Query  612  RLCLEVERLGLSAMIMGSRGFGSPSKRGSKV------ERLGSVSDYcvhhcicpvvvvRY  773
            RLCLEVERLGLSA+IMGSRGFG+  K+G          RLGSVSDYCV HC+CPVVVVR 
Sbjct  151  RLCLEVERLGLSAVIMGSRGFGATRKKGISKGGSVSGGRLGSVSDYCVQHCVCPVVVVRC  210

Query  774  PDGDGGGGAATEV-------VVDLHPVPEDKEYEYHDN  866
             D DG    + +           LHPVPE+ + E  D+
Sbjct  211  SD-DGKEEESVKTGGVGDGVEEGLHPVPEEDQEECVDD  247



>ref|XP_010106722.1| hypothetical protein L484_004891 [Morus notabilis]
 gb|EXC11590.1| hypothetical protein L484_004891 [Morus notabilis]
Length=217

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 122/177 (69%), Gaps = 13/177 (7%)
 Frame = +3

Query  225  VTPLAIAPPLLPRVFTPVLSPTQ--------RRRVAIAVDLSDESAFAVRWAVRHYLRPG  380
             +P   A P LP     ++ P+         +RR+ IAVDLSDESAFAVRWAV++YLRPG
Sbjct  2    TSPRIRAEPDLPAATAILVQPSSPRFPSGGAQRRIGIAVDLSDESAFAVRWAVQNYLRPG  61

Query  381  DGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVN  560
            D VVL+HV PT+VLYGADWG     D       +T  + ED  D  T+AKA  +A PL  
Sbjct  62   DAVVLVHVSPTSVLYGADWG---AVDATAASDEETQRKLEDDFDAFTTAKANDMAGPLEK  118

Query  561  ANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            A +P+ IHIVKDHD+KERLCLEVERLGL A+IMGSRGFG+ +KR +K  RLGSVSDY
Sbjct  119  AQIPYRIHIVKDHDMKERLCLEVERLGLGAVIMGSRGFGA-AKRTTK-GRLGSVSDY  173



>ref|XP_004961595.1| PREDICTED: uncharacterized protein LOC101784949 [Setaria italica]
Length=272

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 143/210 (68%), Gaps = 25/210 (12%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTP--------  452
            RR+ IAVDLSDESAFAV+WAV++YLRPGD VVLLHV+PT+VLYGADWG S P        
Sbjct  59   RRIGIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRPTSVLYGADWG-SIPVSVDDEPD  117

Query  453  -------------SDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVK  593
                         S      P +   + E+  D  TS KA+ LA+PLV A +PF IHIVK
Sbjct  118  AGIAEGAARAAAASGEEETEPEEAKKKREEDFDAFTSTKAQDLAQPLVVAQIPFKIHIVK  177

Query  594  DHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRY  773
            DHD+KERLCLE ERLGLSA+IMGSRGFG+ S+R  K  RLGSVSDYCVHHC+CPVVVVR+
Sbjct  178  DHDMKERLCLEAERLGLSALIMGSRGFGA-SRRAGK-GRLGSVSDYCVHHCVCPVVVVRF  235

Query  774  PDGDGGGGAATEVVVDLHPVPEDKEYEYHD  863
            PD   G G       +L  VPE+ E  YH+
Sbjct  236  PDDAAGAGCGHAFGDELRTVPEN-EPVYHE  264



>gb|KDP38967.1| hypothetical protein JCGZ_00724 [Jatropha curcas]
Length=258

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 139/202 (69%), Gaps = 29/202 (14%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLSDESA+AVRWAV HY+RPGD V+LLHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSDESAYAVRWAVHHYIRPGDAVILLHVSPTSVLFGADWGPLP  95

Query  441  ----ISTPS------------------DHApppppQTAAEEEDIIDDLTSAKAEHLAEPL  554
                  TP+                  DH+     +    E+D  D  T++KA  LA+PL
Sbjct  96   LPSPTHTPTHAQQSELNKDSGFNSSHDDHSNDNSHKQRKLEDDF-DAFTASKAADLAKPL  154

Query  555  VNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYc  734
              A +P+ IHIVKDHD+KERLCLEVERLGLSAMIMGSRGFG+ +KRGS   RLGSVSDYC
Sbjct  155  KEAQIPYKIHIVKDHDMKERLCLEVERLGLSAMIMGSRGFGA-AKRGSD-GRLGSVSDYC  212

Query  735  vhhcicpvvvvRYP-DGDGGGG  797
            VHHC+CPVVVVRYP D D GG 
Sbjct  213  VHHCVCPVVVVRYPEDKDDGGN  234



>gb|EAZ04279.1| hypothetical protein OsI_26421 [Oryza sativa Indica Group]
Length=268

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 155/217 (71%), Gaps = 26/217 (12%)
 Frame = +3

Query  288  TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSD  458
            +  RR+AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYGADWG   +S P+ 
Sbjct  53   SSHRRIAIAVDLSDESAYAVRWAVANYLRPGDAVILLHVRPTSVLYGADWGSVDLSLPAA  112

Query  459  H---------ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKE  611
            +         A       A + ED  D  T++KA+ LA+PL +A +P+ IHIVKDHD+KE
Sbjct  113  NPNPSGDPPSAEDDAEAAARKMEDDFDAFTASKADDLAKPLKDAGIPYKIHIVKDHDMKE  172

Query  612  RLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            RLCLEVERLGLSA+IMGS+GFG+ S+R SK  RLGSVSDYCVHHC+CPVVVVR+PD    
Sbjct  173  RLCLEVERLGLSAVIMGSKGFGA-SRRTSK-GRLGSVSDYCVHHCVCPVVVVRFPDDGVA  230

Query  792  GG---------AATEVVVDLHPVPEDKEYEYHDNADD  875
             G         A  E V  LHPVPE+ + EYHD  ++
Sbjct  231  EGGEAGGASELAVGEEV--LHPVPEE-DAEYHDATEE  264



>dbj|BAC65369.1| CHP-rich zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAG87550.1| unnamed protein product [Oryza sativa Japonica Group]
Length=268

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 153/215 (71%), Gaps = 22/215 (10%)
 Frame = +3

Query  288  TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSD  458
            +  RR+AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYGADWG   +S P+ 
Sbjct  53   SSHRRIAIAVDLSDESAYAVRWAVANYLRPGDAVILLHVRPTSVLYGADWGSVDLSLPAA  112

Query  459  H---------ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKE  611
            +         A       A + ED  D  T++KA+ LA+PL +A +P+ IHIVKDHD+KE
Sbjct  113  NPNPSGDPPSAEDDAEAAARKMEDDFDAFTASKADDLAKPLKDAGIPYKIHIVKDHDMKE  172

Query  612  RLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            RLCLEVERLGLSA+IMGS+GFG+ S+R SK  RLGSVSDYCVHHC+CPVVVVR+PD    
Sbjct  173  RLCLEVERLGLSAVIMGSKGFGA-SRRTSK-GRLGSVSDYCVHHCVCPVVVVRFPDDGVA  230

Query  792  GGAATEVVVD-------LHPVPEDKEYEYHDNADD  875
             G       +       LHPVPE+ + EYHD  ++
Sbjct  231  EGGEAGGASELAVGEEVLHPVPEE-DAEYHDATEE  264



>ref|XP_002326102.1| hypothetical protein POPTR_0019s14190g [Populus trichocarpa]
 gb|EEF00484.1| hypothetical protein POPTR_0019s14190g [Populus trichocarpa]
Length=252

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 159/245 (65%), Gaps = 26/245 (11%)
 Frame = +3

Query  207  RRPVRNVTPLAIAPPLLPRVFTPVLS--PTQRRRVAIAVDLSDESAFAVRWAVRHYLRPG  380
            ++P ++   L + P    RV +P LS  PT  RRVAIAVDLSDESA+AV+WAV++YLRPG
Sbjct  4    KQPYQSEPDLPVPPLPTLRVRSPSLSTAPTTNRRVAIAVDLSDESAYAVKWAVQNYLRPG  63

Query  381  DGVVLLHVQPTAVLYGADWGI--------STPSDHAp--ppppQTAAEEEDIIDDLTSAK  530
            D V+LLHV+PT+ LYGADWG         +TP D         Q   + ED  D  T+ K
Sbjct  64   DAVILLHVRPTSALYGADWGSIQHQINNNNTPFDQNNPDSSDNQERQKLEDDFDSFTNNK  123

Query  531  AEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSK------R  692
            A  LA+PL+ A+VPF IHIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+  K       
Sbjct  124  ANLLAKPLLEADVPFKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGATRKMGGGKGG  183

Query  693  GSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATE-------VVVDLHPVPEDKEY  851
                 RLGSVSDYCV HC+CPVVVVR  D DG  G + +       +   LHPVPE+ + 
Sbjct  184  IVGGGRLGSVSDYCVQHCVCPVVVVRCND-DGKEGESVKIGGLGEEIEEGLHPVPEEDQE  242

Query  852  EYHDN  866
            E  D+
Sbjct  243  ECVDD  247



>ref|XP_002987442.1| hypothetical protein SELMODRAFT_48206, partial [Selaginella moellendorffii]
 gb|EFJ11529.1| hypothetical protein SELMODRAFT_48206, partial [Selaginella moellendorffii]
Length=163

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 134/170 (79%), Gaps = 11/170 (6%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            +R++AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYGADWG+    DHA   
Sbjct  1    QRKIAIAVDLSDESAYAVRWAVENYLRPGDSVILLHVRPTSVLYGADWGV---VDHAVSF  57

Query  474  ppQTAAEE-EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSA  650
              + + ++ ED  D  TS+K+  LA PL+ + +P  IHIVKDHD+KERLCLEVERLG++A
Sbjct  58   DDEESQQKMEDDFDAFTSSKSLDLARPLLESKLPHKIHIVKDHDMKERLCLEVERLGVNA  117

Query  651  MIMGSRGFGS---PSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            +I+GSRGFG+   P+++G    RLGSVSDYCV HC+CPVVVVRYP+   G
Sbjct  118  LILGSRGFGASKPPARKG----RLGSVSDYCVQHCVCPVVVVRYPEESDG  163



>ref|XP_009418754.1| PREDICTED: uncharacterized protein LOC103998872 [Musa acuminata 
subsp. malaccensis]
Length=264

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 142/214 (66%), Gaps = 36/214 (17%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHAp  467
            RR+AIAVDLSDESA+AV+WAV++YLRPGD V+LLHV+PT+VLYGADWG   +S   + A 
Sbjct  54   RRIAIAVDLSDESAYAVKWAVQNYLRPGDAVILLHVRPTSVLYGADWGSVDLSVSEEAAE  113

Query  468  ppppQTAAEE--EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
                   +++  E+  D  T+ KA+ LA PLV A +PF IHIVKDHD+KERLCLEVERL 
Sbjct  114  EGAGSDVSQQKLEEDFDAFTATKAQDLARPLVEAQIPFKIHIVKDHDMKERLCLEVERLS  173

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvR-----------------  770
            LSA+IMGSRGFG+  + G    RLGSVSDYCVHHC+CPVVVVR                 
Sbjct  174  LSAVIMGSRGFGASRRTGKG--RLGSVSDYCVHHCVCPVVVVRDEGAAAGADAGVVAKGA  231

Query  771  ---YPDGDGGGGAATEVVVDLHPVPEDKEYEYHD  863
                  G   GG       +LHPVPE  E EYHD
Sbjct  232  CPSMAKGSAEGG-------ELHPVPE--EDEYHD  256



>ref|XP_006447353.1| hypothetical protein CICLE_v10016651mg [Citrus clementina]
 ref|XP_006491652.1| PREDICTED: uncharacterized protein LOC102621256 [Citrus sinensis]
 gb|ESR60593.1| hypothetical protein CICLE_v10016651mg [Citrus clementina]
 gb|KDO43655.1| hypothetical protein CISIN_1g027929mg [Citrus sinensis]
Length=217

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 151/209 (72%), Gaps = 3/209 (1%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYG  428
            P+LP    P+++   +R++AIAVDLSDESA+AVRWAV +YLRPGD VVLLHV+ T+VLYG
Sbjct  11   PVLP-TRVPLMTNGAQRKIAIAVDLSDESAYAVRWAVENYLRPGDAVVLLHVRQTSVLYG  69

Query  429  ADWGISTPSDHApppppQTAAEEEDIID-DLTSAKAEHLAEPLVNANVPFTIHIVKDHDL  605
            ADWG    +++           + D  + DLT+  A+++AEPL  A + + IHIVKDHD+
Sbjct  70   ADWGFINNTENRNDDEGGWGGIQLDSTETDLTATNAKNIAEPLEEAGLQYKIHIVKDHDM  129

Query  606  KERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD  785
            KERLCLEVERLGLSAMIMG RG G  + R S V RLGSVSDYCVHHC+CPVVV+RYPD D
Sbjct  130  KERLCLEVERLGLSAMIMGGRGIGIGAVRRSSVGRLGSVSDYCVHHCVCPVVVLRYPD-D  188

Query  786  GGGGAATEVVVDLHPVPEDKEYEYHDNAD  872
                  +    +LHPVPE+ + EYHD +D
Sbjct  189  SRSQHDSRDDAELHPVPEEDDSEYHDFSD  217



>gb|EEE67375.1| hypothetical protein OsJ_24676 [Oryza sativa Japonica Group]
Length=310

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 153/215 (71%), Gaps = 22/215 (10%)
 Frame = +3

Query  288  TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSD  458
            +  RR+AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYGADWG   +S P+ 
Sbjct  53   SSHRRIAIAVDLSDESAYAVRWAVANYLRPGDAVILLHVRPTSVLYGADWGSVDLSLPAA  112

Query  459  H---------ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKE  611
            +         A       A + ED  D  T++KA+ LA+PL +A +P+ IHIVKDHD+KE
Sbjct  113  NPNPSGDPPSAEDDAEAAARKMEDDFDAFTASKADDLAKPLKDAGIPYKIHIVKDHDMKE  172

Query  612  RLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            RLCLEVERLGLSA+IMGS+GFG+ S+R SK  RLGSVSDYCVHHC+CPVVVVR+PD    
Sbjct  173  RLCLEVERLGLSAVIMGSKGFGA-SRRTSK-GRLGSVSDYCVHHCVCPVVVVRFPDDGVA  230

Query  792  GGAATEVVVD-------LHPVPEDKEYEYHDNADD  875
             G       +       LHPVPE+ + EYHD  ++
Sbjct  231  EGGEAGGASELAVGEEVLHPVPEE-DAEYHDATEE  264



>ref|XP_002980050.1| hypothetical protein SELMODRAFT_58286, partial [Selaginella moellendorffii]
 gb|EFJ18920.1| hypothetical protein SELMODRAFT_58286, partial [Selaginella moellendorffii]
Length=163

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 134/170 (79%), Gaps = 11/170 (6%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            +R++AIAVDLSDESA+AVRWAV +YLRPGD V+LLHV+PT+VLYGADWG+    DHA   
Sbjct  1    QRKIAIAVDLSDESAYAVRWAVENYLRPGDSVILLHVRPTSVLYGADWGV---VDHAVSF  57

Query  474  ppQTAAEE-EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSA  650
              + + ++ ED  D  TS+K+  LA PL+ + +P  IHIVKDHD+KERLCLEVERLG++A
Sbjct  58   DDEESQQKMEDDFDAFTSSKSLDLARPLLESKLPHKIHIVKDHDMKERLCLEVERLGVNA  117

Query  651  MIMGSRGFGS---PSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            +I+GSRGFG+   P+++G    RLGSVSDYCV HC+CPVVVVR+P+   G
Sbjct  118  LILGSRGFGASKPPARKG----RLGSVSDYCVQHCVCPVVVVRFPEESDG  163



>ref|XP_002319393.2| hypothetical protein POPTR_0013s14650g [Populus trichocarpa]
 gb|EEE95316.2| hypothetical protein POPTR_0013s14650g [Populus trichocarpa]
Length=252

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 149/223 (67%), Gaps = 27/223 (12%)
 Frame = +3

Query  282  SPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGI------  443
            + T  RRVAIAVDLSDESA+AV+WAV +YLRPGD V+LLHV+PT+VLYGADWG       
Sbjct  31   NSTSNRRVAIAVDLSDESAYAVKWAVENYLRPGDAVILLHVRPTSVLYGADWGSIQLQIN  90

Query  444  --STPSDHApppppQTAAEE--EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKE  611
              +TP + +    P     +  ED  D  T+ K   LA+PL+ ANVPF IH+VKDHD+KE
Sbjct  91   NNNTPFELSGSNSPDNRERQKLEDDFDSFTNNKTNLLAKPLLEANVPFKIHVVKDHDMKE  150

Query  612  RLCLEVERLGLSAMIMGSRGFGSPSKRG-SKVE-----RLGSVSDYcvhhcicpvvvvRY  773
            RLCLEVERLGLSA+IMGSRGFG+  K+G SK       RLGSVSD+CV HC+CPVVVVR 
Sbjct  151  RLCLEVERLGLSAVIMGSRGFGATRKKGISKGRSVGGGRLGSVSDHCVQHCVCPVVVVRC  210

Query  774  PDGDGGGGAATEV-------VVDLHPVPEDKEYEYHDNADDEV  881
             D DG    + +           LHPVPE+ + E     DDE+
Sbjct  211  SD-DGKEEESVKTGGVGDGVEEGLHPVPEEDQEEC---VDDEL  249



>gb|EYU24834.1| hypothetical protein MIMGU_mgv1a021721mg [Erythranthe guttata]
Length=242

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 145/194 (75%), Gaps = 8/194 (4%)
 Frame = +3

Query  216  VRNVTPLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVL  395
            V+  +P     P  P   +  +SP+ RR +AIAVDLSDESA+AV+WAV +YLRPGD V+L
Sbjct  28   VKTSSPRFPPSPATPNSIS-AISPSSRR-IAIAVDLSDESAYAVKWAVENYLRPGDTVIL  85

Query  396  LHVQPTAVLYGADWGISTPSDHApppp---pQTAAEE-EDIIDDLTSAKAEHLAEPLVNA  563
            LHV+ T+VLYGADWG STP+           +T+ ++ E+  D+ T+AKA HLA+PLV A
Sbjct  86   LHVRSTSVLYGADWGSSTPTTATASTNNPFSKTSPQQMEEDYDNFTAAKANHLAQPLVEA  145

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
            +VP  IHIVKDHD+KERLCLEVERLGLSA+IMGSRG G+ S+R SK  RLGSVSDYCV H
Sbjct  146  HVPVKIHIVKDHDMKERLCLEVERLGLSAVIMGSRGIGA-SRRSSK-GRLGSVSDYCVQH  203

Query  744  cicpvvvvRYPDGD  785
            C CPVVVVRY + D
Sbjct  204  CACPVVVVRYNNHD  217



>ref|XP_001774052.1| predicted protein [Physcomitrella patens]
 gb|EDQ61104.1| predicted protein [Physcomitrella patens]
Length=161

 Score =   180 bits (457),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 129/165 (78%), Gaps = 5/165 (3%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppp  476
            RR+A+AVDLSDESA+AV+WAV +YLR GD VV+LHV+PT+VL+GADWG    SD   P  
Sbjct  1    RRIAVAVDLSDESAYAVKWAVENYLRSGDHVVILHVRPTSVLFGADWG---ASDQVIPAD  57

Query  477  pQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMI  656
             ++  + ED  D  T+ K+  LA+ L++A +P+ IHIVKDHD+KER+CLEVERLG+ AMI
Sbjct  58   EESQQKMEDDFDTFTTTKSSDLAKSLLDAKIPYKIHIVKDHDMKERICLEVERLGVHAMI  117

Query  657  MGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            MGSRGFG+ +   ++  RLGSVSDYC+HHC CPVVVVRYP+G  G
Sbjct  118  MGSRGFGASNH--TRKGRLGSVSDYCLHHCDCPVVVVRYPEGKDG  160



>ref|XP_006401570.1| hypothetical protein EUTSA_v10014526mg [Eutrema salsugineum]
 gb|ESQ43023.1| hypothetical protein EUTSA_v10014526mg [Eutrema salsugineum]
Length=242

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 126/166 (76%), Gaps = 2/166 (1%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            RR++ +AVDLSDESAFAVRWAV HY+RPGD VVLLHV PT+VL+GADWG   P      P
Sbjct  46   RRKIGVAVDLSDESAFAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWG-PLPLKTLEDP  104

Query  474  ppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAM  653
              Q+    ++  D  TS+K   LA+PL  +  P+ IHIVKDHD++ERLCLE+ERLGLSA+
Sbjct  105  SAQSQQPSQEDFDAFTSSKVADLAKPLKESGFPYKIHIVKDHDMRERLCLEIERLGLSAV  164

Query  654  IMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            IMGSRGFG+  K GS   +LGSVSDYCVHHC+CPVVVVRYPD   G
Sbjct  165  IMGSRGFGAEKKSGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDG  209



>ref|XP_004509978.1| PREDICTED: uncharacterized protein LOC101498996 [Cicer arietinum]
Length=250

 Score =   183 bits (464),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 146/228 (64%), Gaps = 19/228 (8%)
 Frame = +3

Query  180  KSVHFEPGYRRPVRNVTPLAIAPPLLPR---VFTPVLSPTQRRRVAIAVDLSDESAFAVR  350
            +++H  P        +  + I  P  PR     TP  +   RR++ +AVDLSDESA+AV 
Sbjct  2    QNLHHNPTAHESDPQLPQIRIHHPSSPRHQSAATPTPTAGARRKIGVAVDLSDESAYAVH  61

Query  351  WAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSD-----------HApppppQTA  488
            WAV+HY+RPGD V+LLHV PT VL+GADWG   +S  +D                   + 
Sbjct  62   WAVQHYIRPGDAVILLHVSPTNVLFGADWGSIDLSINTDPNSEEETINVVSTNNNDNNSK  121

Query  489  AEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSR  668
             + ED  D  T++K+  LA+PL  A +P+ IHIVKDHD+KERLCLEVERLGLSA+IMGSR
Sbjct  122  TKLEDDFDAFTASKSADLAKPLREAQIPYKIHIVKDHDMKERLCLEVERLGLSAVIMGSR  181

Query  669  GFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEV  812
            GFG+ ++RGS   +LGSVSDYCVHHC+CPVVVVRYPD      A   V
Sbjct  182  GFGA-ARRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDKDAAEAVIAV  227



>ref|XP_007211814.1| hypothetical protein PRUPE_ppa010002mg [Prunus persica]
 gb|EMJ13013.1| hypothetical protein PRUPE_ppa010002mg [Prunus persica]
Length=268

 Score =   183 bits (465),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 133/184 (72%), Gaps = 14/184 (8%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLSDESA AVRWAV HY+RPGD VVLLHV PT+VL+GADWG   
Sbjct  47   TPTPTAGARRKLGVAVDLSDESAHAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWGSVD  106

Query  441  --ISTPSD------HApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
              I+T  D      HA     +    E D  D  T++KA  LA PL  A +PF IHIVKD
Sbjct  107  LSINTNDDVDFVDNHALNDSVKQKKLEND-FDAFTASKAADLARPLKEAQIPFKIHIVKD  165

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD+KERLCLEVERLGLSA+IMGSRG G+ +KRG+   RLGSVSDYCVHHC+CPVVVVR+P
Sbjct  166  HDMKERLCLEVERLGLSAVIMGSRGVGA-AKRGND-GRLGSVSDYCVHHCVCPVVVVRFP  223

Query  777  DGDG  788
            D D 
Sbjct  224  DDDN  227



>ref|XP_006464880.1| PREDICTED: uncharacterized protein LOC102621041 [Citrus sinensis]
Length=221

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 139/201 (69%), Gaps = 19/201 (9%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG----ISTPSDH  461
            RR++ +AVDLSDESAFAVRWAV HYLRPGD V+L+HV PT+VL+GADWG        S++
Sbjct  30   RRKIGVAVDLSDESAFAVRWAVHHYLRPGDAVILVHVSPTSVLFGADWGPLPQQQINSEN  89

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
            A     Q   + ED  D  T+ KA  LA PL  A  P+ IHIVKDHD++ERLCLE+ERL 
Sbjct  90   ASNIEHQK--QLEDDFDTFTATKAADLARPLKEAGFPYKIHIVKDHDMRERLCLEIERLS  147

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEVVVD  821
            LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD    G         
Sbjct  148  LSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDKDDG---------  196

Query  822  LHPVPEDKEYEYHDNADDEVD  884
              P+ + KE E  D+ DD VD
Sbjct  197  -EPLVKVKEPE-KDDEDDHVD  215



>ref|XP_002979362.1| hypothetical protein SELMODRAFT_177600 [Selaginella moellendorffii]
 ref|XP_002990336.1| hypothetical protein SELMODRAFT_131474 [Selaginella moellendorffii]
 gb|EFJ08605.1| hypothetical protein SELMODRAFT_131474 [Selaginella moellendorffii]
 gb|EFJ19770.1| hypothetical protein SELMODRAFT_177600 [Selaginella moellendorffii]
Length=180

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 128/173 (74%), Gaps = 5/173 (3%)
 Frame = +3

Query  276  VLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPS  455
            +L+    R++AIAVDLS ESA+AV+WAV HYLR GD V++LHVQPT+VLYGADWG   P+
Sbjct  1    MLTTPGERKIAIAVDLSAESAYAVKWAVAHYLRQGDSVIVLHVQPTSVLYGADWG---PA  57

Query  456  DHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVER  635
            D    P      + E+ ++  TSAK+  LA+PL  AN+PF IHIVKDHD+KER+CLEVER
Sbjct  58   DTTAGPDASVQQKMEEDMEAFTSAKSTELAKPLEEANIPFRIHIVKDHDMKERICLEVER  117

Query  636  LGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGG  794
            LG+  MIMGSRG G  ++R ++  RLGSVSDYCVHHC C VVVVR P+   G 
Sbjct  118  LGVDVMIMGSRGIG--AERRTRRARLGSVSDYCVHHCDCAVVVVRLPENKQGN  168



>ref|XP_010113086.1| hypothetical protein L484_000044 [Morus notabilis]
 gb|EXC63173.1| hypothetical protein L484_000044 [Morus notabilis]
Length=285

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 137/183 (75%), Gaps = 13/183 (7%)
 Frame = +3

Query  264  VFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG-  440
            V TP  +   RRR+ +AVDLSDESA+AVRWAV HY+RPGD V+LLHV PT+VL+GADWG 
Sbjct  44   VATPTPTAGARRRIGVAVDLSDESAYAVRWAVHHYIRPGDAVILLHVSPTSVLFGADWGC  103

Query  441  ----ISTPSD---HApppppQTAAEE---EDIIDDLTSAKAEHLAEPLVNANVPFTIHIV  590
                I+T  D    A   P +  A++   ED  D  T++KA  LA PL  A +P+ IHIV
Sbjct  104  IDLAIATDDDGEAAATATPTKRNAKQKKLEDDFDAFTASKAADLARPLREAQIPYKIHIV  163

Query  591  KDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvR  770
            KDHD+KERLCLEVERLGLSA+IMGSRGFG+  +RG+   +LGSVSDYCVHHC+CPVVVVR
Sbjct  164  KDHDMKERLCLEVERLGLSAVIMGSRGFGA-VRRGND-GKLGSVSDYCVHHCVCPVVVVR  221

Query  771  YPD  779
            YP+
Sbjct  222  YPE  224



>ref|XP_008454617.1| PREDICTED: uncharacterized protein LOC103494984 [Cucumis melo]
Length=259

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 157/236 (67%), Gaps = 27/236 (11%)
 Frame = +3

Query  168  QQHQKSVHFEPGYRRPVRNVTPLAIAPPLLPRVFTPVLSPT----QRRRVAIAVDLSDES  335
            Q + ++   EP  + P  N+     A P  P   TPV +PT     RR++ +AVDLS+ES
Sbjct  4    QSYLRNPTLEPDPQLP--NIKIHHPASPRHPSAATPVATPTPTAGARRKIGVAVDLSEES  61

Query  336  AFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGI---------STPSD----HApppp  476
            A+AV WAV+HY+RPGD V+LLHV PT+VL+GADWG          + P D    ++    
Sbjct  62   AYAVHWAVQHYIRPGDAVILLHVSPTSVLFGADWGSIDITLDTVGNNPDDDDALNSDNGQ  121

Query  477  pQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
             Q   E      ED  D  T++KA  LA+PL +A +P+ IHIVKDHD++ERLCLEVERLG
Sbjct  122  QQNHTERSKRKLEDDFDAFTASKAADLAKPLKDAQIPYKIHIVKDHDMRERLCLEVERLG  181

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD-GDGGGGAAT  806
            L+A+IMGSRGFG+ +KRG+    LGSVSDYCVHHC+CPVVVVR+PD  D G GA++
Sbjct  182  LNALIMGSRGFGA-AKRGND-GGLGSVSDYCVHHCVCPVVVVRFPDEKDVGVGASS  235



>ref|XP_011047501.1| PREDICTED: uncharacterized protein LOC105141830 [Populus euphratica]
Length=253

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 150/236 (64%), Gaps = 25/236 (11%)
 Frame = +3

Query  231  PLAIAPPLLPRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQP  410
            P+   P L  R  +   +P   RRVAIAVDLSDE A+AV+WAV++YLRPGD V+LLHV+P
Sbjct  14   PVPPLPALCIRSPSLSTAPPANRRVAIAVDLSDERAYAVKWAVQNYLRPGDAVILLHVRP  73

Query  411  TAVLYGADWGI--------STPSDHAp--ppppQTAAEEEDIIDDLTSAKAEHLAEPLVN  560
            T+ LYGADWG         +TP D         Q   + ED  D  T+ KA  LA+PL+ 
Sbjct  74   TSALYGADWGSIQHQINNNNTPFDQNDPDSSDNQERQKLEDDFDSFTNNKANLLAKPLLE  133

Query  561  ANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSK------RGSKVERLGSV  722
            A+VPF IHIVKDHD+KERLCLE+ERLGLSA+IMGSRGFG+  K            RLGSV
Sbjct  134  ADVPFKIHIVKDHDMKERLCLEIERLGLSAVIMGSRGFGATRKMGGGQGGIVGGGRLGSV  193

Query  723  SDYcvhhcicpvvvvRYPDGDGG--------GGAATEVVVDLHPVPEDKEYEYHDN  866
            SDYCV HC+CPVVVVR  D DG         GG   EV   LHPVPE+ + E  D+
Sbjct  194  SDYCVQHCVCPVVVVRCND-DGKEEESTVKIGGLGVEVEEGLHPVPEEDQEECIDD  248



>ref|XP_010060483.1| PREDICTED: uncharacterized protein LOC104448384 [Eucalyptus grandis]
Length=272

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 136/195 (70%), Gaps = 23/195 (12%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG-----------I  443
            R++ +AVDLSDESA+AVRWAV HYLRPGD V+LLHV PT+VL+GADWG            
Sbjct  55   RKIGVAVDLSDESAYAVRWAVHHYLRPGDAVILLHVSPTSVLFGADWGPLPHLPSSASSA  114

Query  444  STPSDHAppppp----------QTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVK  593
            S   DH   P P          +   + +D  D  TSAKA  LA+PL +A +P+ IHIVK
Sbjct  115  SASPDHPLNPNPNPNPNNPARPEEVQKSQDDFDAFTSAKAADLAKPLKDAQIPYKIHIVK  174

Query  594  DHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRY  773
            DHD+KERLCLEVERLGLSA+IMGSRGFG+ ++RGS   RLGSVSDYCVHHC+CPVVVVRY
Sbjct  175  DHDMKERLCLEVERLGLSAVIMGSRGFGA-ARRGSD-GRLGSVSDYCVHHCVCPVVVVRY  232

Query  774  PDGDGGGGAATEVVV  818
            PD   GG     +V 
Sbjct  233  PDEKDGGNGGDPIVA  247



>gb|KDO74284.1| hypothetical protein CISIN_1g024982mg [Citrus sinensis]
Length=259

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 143/206 (69%), Gaps = 20/206 (10%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG----ISTPSDH  461
            RR++ +AVDLSDESAFAVRWAV HYLRPGD V+L+HV PT+VL+GADWG        S++
Sbjct  41   RRKIGVAVDLSDESAFAVRWAVHHYLRPGDAVILVHVSPTSVLFGADWGPLPQQQINSEN  100

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
            A     Q   + ED  D  T+ KA  LA PL  A  P+ IHIVKDHD++ERLCLE+ERL 
Sbjct  101  ASNIEHQK--QLEDDFDTFTATKAADLARPLKEAGFPYKIHIVKDHDMRERLCLEIERLS  158

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEVVVD  821
            LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD    G         
Sbjct  159  LSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDKDDG---------  207

Query  822  LHPVPEDKEYEYHDNADDEVD-ELEG  896
              P+ + KE E  D+ DD VD +L+G
Sbjct  208  -EPLVKVKEPE-KDDEDDHVDRKLKG  231



>ref|XP_002440029.1| hypothetical protein SORBIDRAFT_09g024745 [Sorghum bicolor]
 gb|EES18459.1| hypothetical protein SORBIDRAFT_09g024745 [Sorghum bicolor]
Length=260

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 143/205 (70%), Gaps = 27/205 (13%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSD---  458
            RR+ IAVDLSDESAFAV+WAV++YLRPGD VVLLHV+PT+VLYGADWG   +S   D   
Sbjct  59   RRIGIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRPTSVLYGADWGSIPVSVDDDPDA  118

Query  459  ----------HApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLK  608
                       A   P +   + E+  D  TS KA+ LA+PLV A +PF IHIVKDHD+K
Sbjct  119  DIAEGAARAAAAEEEPEEAKKKREEEFDAFTSTKAQDLAQPLVGAQIPFKIHIVKDHDMK  178

Query  609  ERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDG  788
            ERLCLE ERLGLSAMIMGSRGFG+ S+R  K  RLGSVSDYCVHHC+CPVVVVRYPD   
Sbjct  179  ERLCLEAERLGLSAMIMGSRGFGA-SRRAGK-GRLGSVSDYCVHHCVCPVVVVRYPDDAF  236

Query  789  GGGAATEVVVDLHPVPEDKEYEYHD  863
            G         +L  VPE+ E  YH+
Sbjct  237  GD--------ELRTVPEN-EPVYHE  252



>ref|XP_008454618.1| PREDICTED: uncharacterized protein LOC103494986 [Cucumis melo]
Length=257

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 139/193 (72%), Gaps = 20/193 (10%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG-----ISTPSD  458
            RR+V +AVDLS+ESAFAVRWAV+HYLRPGD V+LLHV PT+VL+GADWG     ++T  D
Sbjct  48   RRKVGVAVDLSEESAFAVRWAVQHYLRPGDAVILLHVSPTSVLFGADWGSIDISLNTVDD  107

Query  459  H--------ApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDH  599
            +              Q  AE      ED  D  T++KA  LA+P+ +A +P+ IHIVKDH
Sbjct  108  NPDDEDAADGENNQNQNRAERSKRKLEDDFDAFTASKAADLAKPIKDAQIPYKIHIVKDH  167

Query  600  DLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD  779
            D++ERLCLEVERLGL+A+IMGSRGFG+ +KRG+    LGSVSDYCVHHC+CPVVVVR+PD
Sbjct  168  DMRERLCLEVERLGLNALIMGSRGFGA-AKRGTD-GGLGSVSDYCVHHCVCPVVVVRFPD  225

Query  780  GDGGGGAATEVVV  818
               GG + +  V 
Sbjct  226  EKDGGFSGSAAVA  238



>gb|KHG07616.1| Uncharacterized protein F383_34610 [Gossypium arboreum]
Length=253

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 140/216 (65%), Gaps = 14/216 (6%)
 Frame = +3

Query  267  FTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGIS  446
              P       RR+AIA+DLSDESA+AVRWAV++YLR GD VVLLHV+PT+VLYGADWG  
Sbjct  30   IQPTFPAAAHRRLAIAIDLSDESAYAVRWAVQNYLRAGDAVVLLHVRPTSVLYGADWGSI  89

Query  447  TPSDHApppppQTAAEEEDI---IDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERL  617
            TP+             +++I   +  LT+ KA  LA+PLV+A +PF IH+VKD D+KERL
Sbjct  90   TPNSKNKCENDSNNGSQQEIDKELSILTTRKANTLAQPLVDAKIPFKIHVVKDRDMKERL  149

Query  618  CLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGG  797
            CLEVERLGLSA+IMGSRGFG    R       GSVS YCV+HCICPVVVVRYPD D  G 
Sbjct  150  CLEVERLGLSAVIMGSRGFGGTRGRLGLGL--GSVSYYCVNHCICPVVVVRYPDEDESGI  207

Query  798  AATEVVVDLHPVPED---------KEYEYHDNADDE  878
               E V     V ED         +E EY D  ++E
Sbjct  208  GRAERVTKKKIVDEDIQLLLPVSEEEVEYQDAEEEE  243



>ref|XP_007133081.1| hypothetical protein PHAVU_011G149900g [Phaseolus vulgaris]
 ref|XP_007133082.1| hypothetical protein PHAVU_011G149900g [Phaseolus vulgaris]
 gb|AGV54619.1| CHP-rich zinc finger protein [Phaseolus vulgaris]
 gb|ESW05075.1| hypothetical protein PHAVU_011G149900g [Phaseolus vulgaris]
 gb|ESW05076.1| hypothetical protein PHAVU_011G149900g [Phaseolus vulgaris]
Length=244

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 134/182 (74%), Gaps = 14/182 (8%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLSDESA+AVRWAV HY+RPGD V+LLHV PT VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSDESAYAVRWAVHHYIRPGDAVILLHVSPTNVLFGADWGSID  95

Query  441  ISTPSD--------HApppppQTAAEE-EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVK  593
            +S  +D        +A      T+  + ED  D  T++KA  LA+PL    +PF IHIVK
Sbjct  96   LSINTDPNSDEEAVNAVNNNDHTSKRKLEDDFDAFTASKAADLAKPLREVQIPFKIHIVK  155

Query  594  DHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRY  773
            DHD+KERLCLEVERLGLSA+IMGSRGFG+  +RGS   +LGSVSDYCVHHC+CPVVVVRY
Sbjct  156  DHDMKERLCLEVERLGLSAVIMGSRGFGA-VRRGSD-GKLGSVSDYCVHHCVCPVVVVRY  213

Query  774  PD  779
            PD
Sbjct  214  PD  215



>ref|XP_002524715.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37734.1| conserved hypothetical protein [Ricinus communis]
Length=237

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 134/180 (74%), Gaps = 8/180 (4%)
 Frame = +3

Query  249  PLLPRVFTPVLSPTQ--RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P  PR   PV +PT   +RR+ IAVDLSDESA+AV+WAV++YLR GD V+L+HV+PT+VL
Sbjct  24   PSSPRF--PVSTPTSGAQRRIGIAVDLSDESAYAVKWAVQNYLRHGDAVILVHVRPTSVL  81

Query  423  YGADWGI--STPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
            YGADWG    + +D       Q+  + ED  +  T++K   LAEPLV   +PF  HIVKD
Sbjct  82   YGADWGAIDVSMTDQDSDNNEQSKKKLEDDFELFTTSKINELAEPLVEGLIPFKTHIVKD  141

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD+KERLCLEVERLGLSA+IMGSRGFG  + R +   RLGSVSDYCVHHC+CPV+VVR+P
Sbjct  142  HDMKERLCLEVERLGLSAVIMGSRGFG--ASRKTTKGRLGSVSDYCVHHCVCPVIVVRFP  199



>ref|XP_006452025.1| hypothetical protein CICLE_v10009334mg [Citrus clementina]
 ref|XP_006452026.1| hypothetical protein CICLE_v10009334mg [Citrus clementina]
 gb|ESR65265.1| hypothetical protein CICLE_v10009334mg [Citrus clementina]
 gb|ESR65266.1| hypothetical protein CICLE_v10009334mg [Citrus clementina]
 gb|KDO74282.1| hypothetical protein CISIN_1g024982mg [Citrus sinensis]
 gb|KDO74283.1| hypothetical protein CISIN_1g024982mg [Citrus sinensis]
Length=232

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 139/201 (69%), Gaps = 19/201 (9%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG----ISTPSDH  461
            RR++ +AVDLSDESAFAVRWAV HYLRPGD V+L+HV PT+VL+GADWG        S++
Sbjct  41   RRKIGVAVDLSDESAFAVRWAVHHYLRPGDAVILVHVSPTSVLFGADWGPLPQQQINSEN  100

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
            A     Q   + ED  D  T+ KA  LA PL  A  P+ IHIVKDHD++ERLCLE+ERL 
Sbjct  101  ASNIEHQK--QLEDDFDTFTATKAADLARPLKEAGFPYKIHIVKDHDMRERLCLEIERLS  158

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEVVVD  821
            LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD    G         
Sbjct  159  LSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDKDDG---------  207

Query  822  LHPVPEDKEYEYHDNADDEVD  884
              P+ + KE E  D+ DD VD
Sbjct  208  -EPLVKVKEPE-KDDEDDHVD  226



>ref|XP_006452024.1| hypothetical protein CICLE_v10009334mg [Citrus clementina]
 gb|ESR65264.1| hypothetical protein CICLE_v10009334mg [Citrus clementina]
Length=238

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 139/201 (69%), Gaps = 19/201 (9%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG----ISTPSDH  461
            RR++ +AVDLSDESAFAVRWAV HYLRPGD V+L+HV PT+VL+GADWG        S++
Sbjct  41   RRKIGVAVDLSDESAFAVRWAVHHYLRPGDAVILVHVSPTSVLFGADWGPLPQQQINSEN  100

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
            A     Q   + ED  D  T+ KA  LA PL  A  P+ IHIVKDHD++ERLCLE+ERL 
Sbjct  101  ASNIEHQK--QLEDDFDTFTATKAADLARPLKEAGFPYKIHIVKDHDMRERLCLEIERLS  158

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEVVVD  821
            LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD    G         
Sbjct  159  LSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDKDDG---------  207

Query  822  LHPVPEDKEYEYHDNADDEVD  884
              P+ + KE E  D+ DD VD
Sbjct  208  -EPLVKVKEPE-KDDEDDHVD  226



>ref|XP_008374204.1| PREDICTED: uncharacterized protein C167.05-like isoform X1 [Malus 
domestica]
Length=266

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 138/194 (71%), Gaps = 20/194 (10%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLSDESA AVRWAV HY+RPGD V+LLHV PT+VL+GADWG   
Sbjct  48   TPTPTAGARRKLGVAVDLSDESAHAVRWAVDHYIRPGDAVILLHVSPTSVLFGADWGSVD  107

Query  441  --ISTPSD------HApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
              I+T  D      HA     +    E D  D  T++KA  LA+PL  A +P+ IHIVKD
Sbjct  108  LSINTNDDVDFVDNHALHDSVKQKKLEND-FDAFTASKAADLAKPLREAQIPYKIHIVKD  166

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD+KERLCLEVERLGLSA+IMGSRG G+ +KRG+   RLGSVSDYCVHHC+CPVVVVR+P
Sbjct  167  HDMKERLCLEVERLGLSAVIMGSRGVGA-AKRGND-GRLGSVSDYCVHHCVCPVVVVRFP  224

Query  777  D------GDGGGGA  800
            +       DGG GA
Sbjct  225  EDDNCGVADGGSGA  238



>ref|XP_008374205.1| PREDICTED: uncharacterized protein C167.05-like isoform X2 [Malus 
domestica]
Length=266

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 138/194 (71%), Gaps = 20/194 (10%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLSDESA AVRWAV HY+RPGD V+LLHV PT+VL+GADWG   
Sbjct  48   TPTPTAGARRKLGVAVDLSDESAHAVRWAVDHYIRPGDAVILLHVSPTSVLFGADWGSVD  107

Query  441  --ISTPSD------HApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
              I+T  D      HA     +    E D  D  T++KA  LA+PL  A +P+ IHIVKD
Sbjct  108  LSINTNDDVDFVDNHALHDSVKQKKLEND-FDAFTASKAADLAKPLREAQIPYKIHIVKD  166

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD+KERLCLEVERLGLSA+IMGSRG G+ +KRG+   RLGSVSDYCVHHC+CPVVVVR+P
Sbjct  167  HDMKERLCLEVERLGLSAVIMGSRGVGA-AKRGND-GRLGSVSDYCVHHCVCPVVVVRFP  224

Query  777  D------GDGGGGA  800
            +       DGG GA
Sbjct  225  EDDNCGVADGGSGA  238



>ref|XP_003527284.1| PREDICTED: uncharacterized protein LOC100817735 isoform X1 [Glycine 
max]
Length=255

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 142/220 (65%), Gaps = 31/220 (14%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLSDESA+AVRWAV+HY+RPGD V+LLHV  T VL+GADWG   
Sbjct  39   TPTPTAGARRKIGVAVDLSDESAYAVRWAVQHYIRPGDAVILLHVSATNVLFGADWGSID  98

Query  441  ISTPSDHApppppQTAAEE----------EDIIDDLTSAKAEHLAEPLVNANVPFTIHIV  590
            +S  +D        +A             ED  D  T++KA  LA+PL    +PF IHIV
Sbjct  99   LSINTDPNSDEDAVSAVNNSNDHNSKRKLEDDFDAFTASKAADLAKPLRELQIPFKIHIV  158

Query  591  KDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvR  770
            KDHD+KERLCLEVERLGLSA+IMGSRGFG+  +RGS   +LGSVSDYCVHHC+CPVVVVR
Sbjct  159  KDHDMKERLCLEVERLGLSAVIMGSRGFGA-VRRGSD-GKLGSVSDYCVHHCVCPVVVVR  216

Query  771  YPDGDGGGGAAT--------------EVVVDLHPVPEDKE  848
            YPD      AAT              E VV   PVP  KE
Sbjct  217  YPDDKDAVAAATTAEPVVAVKDGDEGEAVV--QPVPHKKE  254



>ref|XP_004294478.1| PREDICTED: uncharacterized protein LOC101313290 [Fragaria vesca 
subsp. vesca]
Length=253

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 133/182 (73%), Gaps = 10/182 (5%)
 Frame = +3

Query  258  PRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADW  437
            P   TP  +   RR++ +AVDLSDESA+AVRWAV HY+RPGD V+LLHV PT+VL+GADW
Sbjct  31   PAGATPTPTAGARRKLGVAVDLSDESAYAVRWAVDHYIRPGDAVILLHVSPTSVLFGADW  90

Query  438  G-----ISTPSDHApppppQTAAEEEDI---IDDLTSAKAEHLAEPLVNANVPFTIHIVK  593
            G     ++   D          A ++++    D  T+AKA  LA PL  A +P+ IHIVK
Sbjct  91   GSTDLSLAANDDLLLNTSSPNHASKQNLEHDFDAFTAAKAGDLARPLKEAQIPYKIHIVK  150

Query  594  DHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRY  773
            DHD+KERLCLEVERLGLSA+IMGSRGFG+  KRGS   RLGSVSDYCVHHC+CPVVVVRY
Sbjct  151  DHDMKERLCLEVERLGLSAVIMGSRGFGA-VKRGSD-GRLGSVSDYCVHHCVCPVVVVRY  208

Query  774  PD  779
            P+
Sbjct  209  PE  210



>ref|XP_001767941.1| predicted protein [Physcomitrella patens]
 gb|EDQ67216.1| predicted protein [Physcomitrella patens]
Length=213

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 129/169 (76%), Gaps = 12/169 (7%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG----ISTPSDHA  464
            R++AIAVDLSDESA+AV+WAV +YLRPGD VV+LHV+PT+VL+GADWG    +  P D  
Sbjct  11   RKIAIAVDLSDESAYAVKWAVANYLRPGDNVVILHVRPTSVLFGADWGATDQVLEPDDK-  69

Query  465  pppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGL  644
                 ++  + ED  D  T  K+  LA+PL++A +P+ IHIVKDHD+KER+CLEVERLG+
Sbjct  70   -----ESQQKMEDDFDTFTETKSADLAKPLLDAGIPYKIHIVKDHDMKERICLEVERLGV  124

Query  645  SAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            SAMIMGSRG G  + R S+  RLGSVSDYC+HHC CPV+VVR+P+   G
Sbjct  125  SAMIMGSRGVG--ATRRSRKARLGSVSDYCLHHCECPVIVVRFPEDKNG  171



>ref|NP_568808.1| universal stress protein PHOS32 [Arabidopsis thaliana]
 gb|AAL49890.1| unknown protein [Arabidopsis thaliana]
 gb|AAM65217.1| unknown [Arabidopsis thaliana]
 gb|AAM67558.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43129.1| unknown protein [Arabidopsis thaliana]
 gb|AED96495.1| universal stress protein (USP) family protein [Arabidopsis thaliana]
Length=242

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 124/166 (75%), Gaps = 2/166 (1%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            RR++ +AVDLS+ES+FAVRWAV HY+RPGD VVLLHV PT+VL+GADWG          P
Sbjct  47   RRKIGVAVDLSEESSFAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWGPLPLKTQIEDP  106

Query  474  ppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAM  653
              Q    +ED  D  TS K   LA+PL     P+ IHIVKDHD++ERLCLE+ERLGLSA+
Sbjct  107  NAQPQPSQEDF-DAFTSTKVADLAKPLKELGFPYKIHIVKDHDMRERLCLEIERLGLSAV  165

Query  654  IMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD   G
Sbjct  166  IMGSRGFGAEKKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDG  210



>gb|KGN59861.1| hypothetical protein Csa_3G850650 [Cucumis sativus]
Length=258

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 141/201 (70%), Gaps = 24/201 (12%)
 Frame = +3

Query  243  APPLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQP  410
            A P  P   TPV +PT     RR+V +AVDLS+ESA+AV WAV+HY+RPGD V+LLHV P
Sbjct  27   ASPRHPSAATPVATPTPTAGARRKVGVAVDLSEESAYAVHWAVQHYIRPGDAVILLHVSP  86

Query  411  TAVLYGADWG------------------ISTPSDHApppppQTAAEEEDIIDDLTSAKAE  536
            T+VL+GADWG                  +++ +        ++  + ED  D  T++KA 
Sbjct  87   TSVLFGADWGSIDITLDTVGDNPDDDGALNSENGQQQNHTERSKRKLEDDFDAFTASKAA  146

Query  537  HLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLG  716
             LA+PL +A +P+ IHIVKDHD++ERLCLEVERLGL+A+IMGSRGFG+ +KRG+    LG
Sbjct  147  DLAKPLKDAQIPYKIHIVKDHDMRERLCLEVERLGLNALIMGSRGFGA-AKRGND-GGLG  204

Query  717  SVSDYcvhhcicpvvvvRYPD  779
            SVSDYCVHHC+CPVVVVR+PD
Sbjct  205  SVSDYCVHHCVCPVVVVRFPD  225



>ref|NP_001148935.1| LOC100282555 [Zea mays]
 gb|ACG33528.1| ER6 protein [Zea mays]
 gb|AFW78572.1| ER6 protein [Zea mays]
Length=260

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 139/204 (68%), Gaps = 27/204 (13%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG------------  440
            RR+ IAVDLSDESAFAV+WAV++YLRPGD VVLLHV+PT+VLYGADWG            
Sbjct  59   RRIGIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRPTSVLYGADWGSIPVSVDDDPDV  118

Query  441  ----ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLK  608
                 +  +  A   P +   + E+  D  TS KA+ LA+PLV A +PF IHIVKDHD+K
Sbjct  119  DIAEGAVRAAAAEEEPEEAKKKREEEFDSFTSTKAQDLAQPLVGAQIPFKIHIVKDHDMK  178

Query  609  ERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDG  788
            ERLCLE ERLGLSAMIMGSRGFG+  + G    RLGSVSDYCVHHC+CPVVVVRYPD   
Sbjct  179  ERLCLEAERLGLSAMIMGSRGFGASRRVGKG--RLGSVSDYCVHHCVCPVVVVRYPDDAF  236

Query  789  GGGAATEVVVDLHPVPEDKEYEYH  860
            G         +L  VPE+ E  YH
Sbjct  237  GD--------ELRTVPEN-EPVYH  251



>ref|XP_010533511.1| PREDICTED: uncharacterized protein LOC104809279 [Tarenaya hassleriana]
 ref|XP_010533512.1| PREDICTED: uncharacterized protein LOC104809279 [Tarenaya hassleriana]
 ref|XP_010533513.1| PREDICTED: uncharacterized protein LOC104809279 [Tarenaya hassleriana]
 ref|XP_010533514.1| PREDICTED: uncharacterized protein LOC104809279 [Tarenaya hassleriana]
Length=242

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 136/191 (71%), Gaps = 8/191 (4%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG-IS  446
            TP  +   RR++ +AVDLSDESA+AVRWAV  Y+RPGD VVLLHV PT+VL+GADWG + 
Sbjct  30   TPTPTAGARRKIGVAVDLSDESAYAVRWAVHDYIRPGDAVVLLHVSPTSVLFGADWGPLP  89

Query  447  TPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLE  626
              S          +A  ++  D  T++K   LA+PL  A  PF +HIVKDHD++ERLCLE
Sbjct  90   LQSQPPSSAADPNSAPSQEDFDAFTASKVVDLAKPLKEAGFPFKMHIVKDHDMRERLCLE  149

Query  627  VERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP---DGD--GG  791
            +ERLGLSA+IMGSRGFG+  K+GS   +LGSVSDYCVHHC+CPVVVVRYP   DGD  G 
Sbjct  150  IERLGLSAVIMGSRGFGA-EKKGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDGDAPGN  207

Query  792  GGAATEVVVDL  824
             G   E +V +
Sbjct  208  AGGVGEAIVTM  218



>dbj|BAA97516.1| unnamed protein product [Arabidopsis thaliana]
Length=250

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 123/162 (76%), Gaps = 2/162 (1%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            RR++ +AVDLS+ES+FAVRWAV HY+RPGD VVLLHV PT+VL+GADWG          P
Sbjct  47   RRKIGVAVDLSEESSFAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWGPLPLKTQIEDP  106

Query  474  ppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAM  653
              Q    +ED  D  TS K   LA+PL     P+ IHIVKDHD++ERLCLE+ERLGLSA+
Sbjct  107  NAQPQPSQEDF-DAFTSTKVADLAKPLKELGFPYKIHIVKDHDMRERLCLEIERLGLSAV  165

Query  654  IMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD  779
            IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD
Sbjct  166  IMGSRGFGAEKKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPD  206



>ref|XP_004146839.1| PREDICTED: uncharacterized protein LOC101209390 [Cucumis sativus]
Length=259

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 141/201 (70%), Gaps = 24/201 (12%)
 Frame = +3

Query  243  APPLLPRVFTPVLSPT----QRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQP  410
            A P  P   TPV +PT     RR+V +AVDLS+ESA+AV WAV+HY+RPGD V+LLHV P
Sbjct  27   ASPRHPSAATPVATPTPTAGARRKVGVAVDLSEESAYAVHWAVQHYIRPGDAVILLHVSP  86

Query  411  TAVLYGADWG------------------ISTPSDHApppppQTAAEEEDIIDDLTSAKAE  536
            T+VL+GADWG                  +++ +        ++  + ED  D  T++KA 
Sbjct  87   TSVLFGADWGSIDITLDTVGDNPDDDGALNSENGQQQNHTERSKRKLEDDFDAFTASKAA  146

Query  537  HLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLG  716
             LA+PL +A +P+ IHIVKDHD++ERLCLEVERLGL+A+IMGSRGFG+ +KRG+    LG
Sbjct  147  DLAKPLKDAQIPYKIHIVKDHDMRERLCLEVERLGLNALIMGSRGFGA-AKRGND-GGLG  204

Query  717  SVSDYcvhhcicpvvvvRYPD  779
            SVSDYCVHHC+CPVVVVR+PD
Sbjct  205  SVSDYCVHHCVCPVVVVRFPD  225



>ref|NP_001141066.1| hypothetical protein [Zea mays]
 gb|ACF85324.1| unknown [Zea mays]
 tpg|DAA41096.1| TPA: hypothetical protein ZEAMMB73_813119 [Zea mays]
Length=226

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 137/192 (71%), Gaps = 17/192 (9%)
 Frame = +3

Query  249  PLLPRVFTPVLSP--TQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVL  422
            P  P VF    +P  T  RR+AIAVDLSDESAFAVRWAV +YLR GD V+LLHV+PT+VL
Sbjct  36   PESPGVFFSATAPLGTSHRRIAIAVDLSDESAFAVRWAVANYLRSGDAVILLHVRPTSVL  95

Query  423  YGADWG-----ISTPSDHA--------pppppQTAAEEEDIIDDLTSAKAEHLAEPLVNA  563
            YGADWG     +  PS ++               A   ED  D  T++KA+ +A PL  A
Sbjct  96   YGADWGAVDVSLPIPSAYSEDGFGGGDADSEAAAARRMEDDYDAFTASKADDIARPLKEA  155

Query  564  NVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhh  743
             +P+ IHIV+DHD+KERLCLEVERL LSA+IMGS+GFGS ++R SK  RLGSVSDYCVHH
Sbjct  156  GIPYKIHIVRDHDMKERLCLEVERLSLSAVIMGSKGFGS-TRRTSK-GRLGSVSDYCVHH  213

Query  744  cicpvvvvRYPD  779
            CICPVVVVR+PD
Sbjct  214  CICPVVVVRFPD  225



>ref|XP_001758787.1| predicted protein [Physcomitrella patens]
 gb|EDQ76293.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 127/165 (77%), Gaps = 4/165 (2%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppp  476
            R++AIAVDLSDESA+AV+WAV +YLRPGD V++LHV+PT+VL+GADWG +     A    
Sbjct  11   RKIAIAVDLSDESAYAVKWAVANYLRPGDNVIILHVRPTSVLFGADWGATDQVLEADDKE  70

Query  477  pQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMI  656
             Q   E++  I   T  K+  LA+PL++A +P+ IHIVKDHD+KER+CLEVERLG+SAMI
Sbjct  71   SQQKMEDDFAI--FTETKSADLAKPLLDAGIPYKIHIVKDHDMKERICLEVERLGVSAMI  128

Query  657  MGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            MGSRG G  + R S+  RLGSVSDYC++HC CPV+VVR+P+   G
Sbjct  129  MGSRGVG--ATRRSRKSRLGSVSDYCLYHCECPVIVVRFPEDQNG  171



>gb|KEH15227.1| universal stress family protein [Medicago truncatula]
 gb|KEH15278.1| universal stress family protein [Medicago truncatula]
Length=249

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 133/185 (72%), Gaps = 17/185 (9%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLSDESA+AVRWAV+HY+RPGD V+LLHV PT VL+GADWG   
Sbjct  33   TPTPTAGARRKIGVAVDLSDESAYAVRWAVQHYIRPGDAVILLHVSPTNVLFGADWGSID  92

Query  441  --IST-PSDHApppppQTAAEE---------EDIIDDLTSAKAEHLAEPLVNANVPFTIH  584
              I+T P+         T   E         E+  D  T+ K+  LA+PL  A +P+ IH
Sbjct  93   LSINTDPNSEEEAINIATNNTEISSTPKRKLEEDYDAFTATKSADLAKPLKEAQIPYKIH  152

Query  585  IVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvv  764
            IVKDHD+KERLCLEVERLGLSA+IMGSRGFG+  +RGS   +LGSVSDYCVHHC+CPVVV
Sbjct  153  IVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-VRRGSD-GKLGSVSDYCVHHCVCPVVV  210

Query  765  vRYPD  779
            VRYPD
Sbjct  211  VRYPD  215



>ref|XP_001753050.1| predicted protein [Physcomitrella patens]
 gb|EDQ82091.1| predicted protein, partial [Physcomitrella patens]
Length=155

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 126/162 (78%), Gaps = 7/162 (4%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppp  476
            R+VAIAVDLSDESA AV WAV +YLRPGD VV+LHV+PT+VL+GADWG    SD   P  
Sbjct  1    RKVAIAVDLSDESAHAVEWAVENYLRPGDNVVVLHVRPTSVLFGADWG---ASDQVIPFD  57

Query  477  pQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMI  656
             +   EE+   D  T+ K+  LA+PL +A +P+ IHIVKDHD+KER+CLE ERLG+SAMI
Sbjct  58   DEQKMEEQ--FDAFTNTKSCDLAKPLSDAKIPYKIHIVKDHDMKERICLEAERLGVSAMI  115

Query  657  MGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDG  782
            MGSRGFG+ SKR  K  RLGSVSDYC+HHC CPVVVVRYP+ 
Sbjct  116  MGSRGFGA-SKRARK-GRLGSVSDYCLHHCYCPVVVVRYPEN  155



>ref|XP_006284359.1| hypothetical protein CARUB_v10005532mg [Capsella rubella]
 gb|EOA17257.1| hypothetical protein CARUB_v10005532mg [Capsella rubella]
Length=260

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 128/177 (72%), Gaps = 5/177 (3%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  441  ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLC  620
            + TP   A   P       ++  D  TS+K   LA+PL  A  P  IHIVKDHD++ERLC
Sbjct  96   VQTPPPSAAVDPAAQPKPSQEDFDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDMRERLC  155

Query  621  LEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            LE ERL LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD   G
Sbjct  156  LETERLNLSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDG  210



>ref|XP_003540075.1| PREDICTED: uncharacterized protein LOC100805067 [Glycine max]
Length=256

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 134/188 (71%), Gaps = 22/188 (12%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLSDESA+AVRWAV+HY+RPGD V+LLHV PT VL+GADWG   
Sbjct  37   TPTPTAGARRKIGVAVDLSDESAYAVRWAVQHYIRPGDAVILLHVSPTNVLFGADWGSID  96

Query  441  --IST-------------PSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPF  575
              I+T              +DHA     +   E++   D  T++KA  LA+PL  + +P 
Sbjct  97   LSINTDPNSDEDAVSAVNSNDHANAGNSKRKLEDD--FDAFTASKAADLAKPLRESQIPV  154

Query  576  TIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicp  755
              HIVKDHD+KERLCLEVERLGLSA+IMGSRGFG+  +RGS   RLGSVSDYCVHHC+CP
Sbjct  155  QDHIVKDHDMKERLCLEVERLGLSAVIMGSRGFGA-VRRGSD-GRLGSVSDYCVHHCVCP  212

Query  756  vvvvRYPD  779
            VVVVRYPD
Sbjct  213  VVVVRYPD  220



>ref|XP_004169716.1| PREDICTED: uncharacterized protein LOC101225643 [Cucumis sativus]
Length=257

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 139/193 (72%), Gaps = 20/193 (10%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG-----ISTPSD  458
            RR+V +AVDLS+ESAFAVRWAV+HYLRPGD V+LLHV PT+VL+GADWG     ++T  D
Sbjct  48   RRKVGVAVDLSEESAFAVRWAVQHYLRPGDAVILLHVSPTSVLFGADWGSIDISLNTTDD  107

Query  459  H--------ApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDH  599
            +        A   P Q  A+      ED  D  T++KA  LA+P+ +A +P+ IHIVKDH
Sbjct  108  NPDDGDAADAENNPNQNRADRSKRKLEDDFDAFTASKAADLAKPIKDAQIPYKIHIVKDH  167

Query  600  DLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD  779
            D++ERLCLEVERLGL+A+IMGSRGFG+ +KRG     LGSVSDYCVHHC+CPVVVVR+PD
Sbjct  168  DMRERLCLEVERLGLNALIMGSRGFGA-AKRGID-GGLGSVSDYCVHHCVCPVVVVRFPD  225

Query  780  GDGGGGAATEVVV  818
                G + +  V 
Sbjct  226  EKDSGFSGSAAVA  238



>ref|XP_011002470.1| PREDICTED: probable serine/threonine-protein kinase tsuA [Populus 
euphratica]
Length=245

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 130/189 (69%), Gaps = 24/189 (13%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTPSDHA  464
            RR++ +AVDLSDESA+AVRW+V HY+RPGD V+LLHV PT+VL GADWG   +STP+   
Sbjct  57   RRKIGVAVDLSDESAYAVRWSVHHYIRPGDAVILLHVSPTSVLLGADWGPLPLSTPTQSQ  116

Query  465  pppppQTAA-------------------EEEDIIDDLTSAKAEHLAEPLVNANVPFTIHI  587
                   +                     +ED  D  T++KA  +A PL  A +P+ IHI
Sbjct  117  LDLLNNNSKFNSEIDRKTKNENSEKPQPRQEDDFDAFTASKAADIARPLKEAQIPYKIHI  176

Query  588  VKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvv  767
            VKDHD+KERLCLE+ERLGLSA+IMGSRGFG+ + RGS  ERLGSVSDYCVHHC CPVVVV
Sbjct  177  VKDHDMKERLCLEIERLGLSAVIMGSRGFGA-AIRGSD-ERLGSVSDYCVHHCFCPVVVV  234

Query  768  RYPDGDGGG  794
            RYP+    G
Sbjct  235  RYPEDKDCG  243



>ref|XP_009143310.1| PREDICTED: uncharacterized protein LOC103867033 [Brassica rapa]
Length=253

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 132/191 (69%), Gaps = 14/191 (7%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGIST  449
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  37   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  96

Query  450  PSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEV  629
                   PPP     +ED  D  TS+K   LA PL  A  P  I IVKDHD++ERLCLE+
Sbjct  97   ----PQSPPPPNHPSQED-FDAFTSSKVADLARPLKEAGFPHKIQIVKDHDMRERLCLEI  151

Query  630  ERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD--------GD  785
            ERL LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD        G+
Sbjct  152  ERLNLSAVIMGSRGFGAEKKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDGPAAPGE  210

Query  786  GGGGAATEVVV  818
             GGG    +V 
Sbjct  211  EGGGTREAIVT  221



>ref|XP_004146840.1| PREDICTED: uncharacterized protein LOC101209635 [Cucumis sativus]
 gb|KGN59862.1| hypothetical protein Csa_3G850660 [Cucumis sativus]
Length=257

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 135/180 (75%), Gaps = 20/180 (11%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG-----ISTPSD  458
            RR+V +AVDLS+ESAFAVRWAV+HYLRPGD V+LLHV PT+VL+GADWG     ++T  D
Sbjct  48   RRKVGVAVDLSEESAFAVRWAVQHYLRPGDAVILLHVSPTSVLFGADWGSIDISLNTTDD  107

Query  459  H--------ApppppQTAAEE-----EDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDH  599
            +        A   P Q  A+      ED  D  T++KA  LA+P+ +A +P+ IHIVKDH
Sbjct  108  NPDDGDAADAENNPNQNRADRSKRKLEDDFDAFTASKAADLAKPIKDAQIPYKIHIVKDH  167

Query  600  DLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD  779
            D++ERLCLEVERLGL+A+IMGSRGFG+ +KRG     LGSVSDYCVHHC+CPVVVVR+PD
Sbjct  168  DMRERLCLEVERLGLNALIMGSRGFGA-AKRGID-GGLGSVSDYCVHHCVCPVVVVRFPD  225



>ref|XP_010482852.1| PREDICTED: uncharacterized protein LOC104761464 [Camelina sativa]
Length=239

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 128/170 (75%), Gaps = 7/170 (4%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG----ISTPSDH  461
            RR++ +AVDLS+ES+FAVRWAV HY+RPGD VVLLHV PT+VL+GADWG     + PS  
Sbjct  46   RRKIGVAVDLSEESSFAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWGPLPLKTQPSVD  105

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
               P  Q+   +ED  D  TS+K   LA+PL     P  IHIVKDHD++ERLCLE+ERLG
Sbjct  106  VEDPNAQSQPSQED-FDAFTSSKVADLAKPLKELGFPHKIHIVKDHDMRERLCLEIERLG  164

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD   G
Sbjct  165  LSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDG  212



>ref|XP_009377304.1| PREDICTED: uncharacterized protein LOC103965927 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009377322.1| PREDICTED: uncharacterized protein LOC103965944 isoform X1 [Pyrus 
x bretschneideri]
Length=261

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 133/184 (72%), Gaps = 14/184 (8%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESA AVRWAV HY+RPGD V+LLHV PT+VL+GADWG   
Sbjct  41   TPTPTAGARRKLGVAVDLSEESAHAVRWAVDHYIRPGDAVILLHVSPTSVLFGADWGSVD  100

Query  441  --ISTPSD------HApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
              I+T  D      HA     +    E D  D  T++K   LA+PL  A +P+ IHIVKD
Sbjct  101  LSINTNDDIDFVDNHALHDSVKQKKLEND-FDAFTASKVADLAKPLKEAQIPYKIHIVKD  159

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD+KERLCLEVERLGLSA+IMGSRG G+ +KRG+   RLGSVSDYCVHHC+CPVVVVR+P
Sbjct  160  HDMKERLCLEVERLGLSAVIMGSRGVGA-TKRGTD-GRLGSVSDYCVHHCVCPVVVVRFP  217

Query  777  DGDG  788
            + D 
Sbjct  218  EDDN  221



>ref|XP_009377305.1| PREDICTED: uncharacterized protein LOC103965927 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009377323.1| PREDICTED: uncharacterized protein LOC103965944 isoform X2 [Pyrus 
x bretschneideri]
Length=261

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 133/184 (72%), Gaps = 14/184 (8%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESA AVRWAV HY+RPGD V+LLHV PT+VL+GADWG   
Sbjct  41   TPTPTAGARRKLGVAVDLSEESAHAVRWAVDHYIRPGDAVILLHVSPTSVLFGADWGSVD  100

Query  441  --ISTPSD------HApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKD  596
              I+T  D      HA     +    E D  D  T++K   LA+PL  A +P+ IHIVKD
Sbjct  101  LSINTNDDIDFVDNHALHDSVKQKKLEND-FDAFTASKVADLAKPLKEAQIPYKIHIVKD  159

Query  597  HDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYP  776
            HD+KERLCLEVERLGLSA+IMGSRG G+ +KRG+   RLGSVSDYCVHHC+CPVVVVR+P
Sbjct  160  HDMKERLCLEVERLGLSAVIMGSRGVGA-TKRGTD-GRLGSVSDYCVHHCVCPVVVVRFP  217

Query  777  DGDG  788
            + D 
Sbjct  218  EDDN  221



>ref|XP_006413090.1| hypothetical protein EUTSA_v10026025mg [Eutrema salsugineum]
 gb|ESQ54543.1| hypothetical protein EUTSA_v10026025mg [Eutrema salsugineum]
Length=258

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 134/195 (69%), Gaps = 14/195 (7%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  441  --ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKER  614
                 PS   P  P Q     ++  D  TS+K   LA+PL  A  P  IHIVKDHD++ER
Sbjct  96   LQTQPPSVVDPVAPDQKPQPSQEDFDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDMRER  155

Query  615  LCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD-----  779
            LCLE ERL LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVR+PD     
Sbjct  156  LCLETERLNLSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRFPDDRDGP  213

Query  780  --GDGGGGAATEVVV  818
              G+GGG     V V
Sbjct  214  APGNGGGTRGAIVTV  228



>ref|XP_002864334.1| hypothetical protein ARALYDRAFT_918574 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40593.1| hypothetical protein ARALYDRAFT_918574 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 127/170 (75%), Gaps = 9/170 (5%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG----ISTPSDH  461
            RR++ +AVDLS+ES+FAVRWAV HY+RPGD VVLLHV PT+VL+GADWG     + PS  
Sbjct  46   RRKIGVAVDLSEESSFAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWGPLPLKTQPSVE  105

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
             P    Q + E+    D  TS K   LA+PL     P+ IHIVKDHD++ERLCLE+ERLG
Sbjct  106  DPNAQSQPSQED---FDAFTSTKVADLAKPLKELGFPYKIHIVKDHDMRERLCLEIERLG  162

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD   G
Sbjct  163  LSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDG  210



>ref|XP_009109143.1| PREDICTED: uncharacterized protein C167.05-like [Brassica rapa]
Length=229

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 128/174 (74%), Gaps = 12/174 (7%)
 Frame = +3

Query  258  PRVFTPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADW  437
            P   TP  +   RR++ +AVDLS+ES+FAVRWAV HY+RPGD VV+LHV PT+VL+GADW
Sbjct  23   PSAATPTPTAGARRKIGVAVDLSEESSFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADW  82

Query  438  GISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERL  617
            G         P P QT   +ED  D  T++K   L  PL  A  P  +HIVKDHD++ERL
Sbjct  83   G---------PLPLQTQHSQED-FDAFTASKVSDLTRPLTEAGFPHKVHIVKDHDMRERL  132

Query  618  CLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD  779
            CLE+ERLG+SA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVR+PD
Sbjct  133  CLEIERLGVSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRFPD  184



>dbj|BAD43031.1| unknown protein [Arabidopsis thaliana]
Length=260

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 133/194 (69%), Gaps = 14/194 (7%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  441  --ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKER  614
                 P   A  P  Q    +ED  D  TS+K   LA+PL  A  P  IHIVKDHD++ER
Sbjct  96   LQTPPPPSAATDPGAQPKPSQED-FDAFTSSKVADLAKPLKEAEFPHKIHIVKDHDMRER  154

Query  615  LCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD---  785
            LCLE ERL LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD     
Sbjct  155  LCLETERLNLSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDGP  212

Query  786  ---GGGGAATEVVV  818
               G  GA  E +V
Sbjct  213  APPGNVGATREAIV  226



>emb|CAA19726.1| putative protein [Arabidopsis thaliana]
 emb|CAB79587.1| putative protein [Arabidopsis thaliana]
 dbj|BAH56990.1| AT4G27320 [Arabidopsis thaliana]
Length=259

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 133/194 (69%), Gaps = 14/194 (7%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  441  --ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKER  614
                 P   A  P  Q    +ED  D  TS+K   LA+PL  A  P  IHIVKDHD++ER
Sbjct  96   LQTPPPPSAATDPGAQPKPSQED-FDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDMRER  154

Query  615  LCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD---  785
            LCLE ERL LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD     
Sbjct  155  LCLETERLNLSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDGP  212

Query  786  ---GGGGAATEVVV  818
               G  GA  E +V
Sbjct  213  APPGNVGATREAIV  226



>dbj|BAD43646.1| unknown protein [Arabidopsis thaliana]
Length=260

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 133/194 (69%), Gaps = 14/194 (7%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  441  --ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKER  614
                 P   A  P  Q    +ED  D  TS+K   LA+PL  A  P  IHIVKDHD++ER
Sbjct  96   IQTPPPPSAATDPGAQPKPSQED-FDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDMRER  154

Query  615  LCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD---  785
            LCLE ERL LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD     
Sbjct  155  LCLETERLNLSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDGP  212

Query  786  ---GGGGAATEVVV  818
               G  GA  E +V
Sbjct  213  APPGNVGATREAIV  226



>dbj|BAD44118.1| unknown protein [Arabidopsis thaliana]
Length=260

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 133/194 (69%), Gaps = 14/194 (7%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPFP  95

Query  441  --ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKER  614
                 P   A  P  Q    +ED  D  TS+K   LA+PL  A  P  IHIVKDHD++ER
Sbjct  96   LQTPPPPSAATDPGAQPKPSQED-FDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDMRER  154

Query  615  LCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD---  785
            LCLE ERL LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD     
Sbjct  155  LCLETERLNLSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDGP  212

Query  786  ---GGGGAATEVVV  818
               G  GA  E +V
Sbjct  213  APPGNVGATREAIV  226



>ref|NP_567770.1| universal stress protein PHOS34 [Arabidopsis thaliana]
 gb|AAM60894.1| unknown [Arabidopsis thaliana]
 gb|AAM74507.1| AT4g27320/M4I22_130 [Arabidopsis thaliana]
 gb|AAN28779.1| At4g27320/M4I22_130 [Arabidopsis thaliana]
 dbj|BAD42960.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43105.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43174.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43186.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44194.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44293.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44552.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44640.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85324.1| universal stress protein family protein [Arabidopsis thaliana]
Length=260

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 133/194 (69%), Gaps = 14/194 (7%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  441  --ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKER  614
                 P   A  P  Q    +ED  D  TS+K   LA+PL  A  P  IHIVKDHD++ER
Sbjct  96   LQTPPPPSAATDPGAQPKPSQED-FDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDMRER  154

Query  615  LCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD---  785
            LCLE ERL LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD     
Sbjct  155  LCLETERLNLSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDGP  212

Query  786  ---GGGGAATEVVV  818
               G  GA  E +V
Sbjct  213  APPGNVGATREAIV  226



>ref|XP_002867512.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43771.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=264

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 134/196 (68%), Gaps = 14/196 (7%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  441  --ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKER  614
                 P   A  P  Q    +ED  D  TS+K   LA+PL  A  P  IHIVKDHD++ER
Sbjct  96   LQTPPPPSAATDPGAQPKPSQED-FDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDMRER  154

Query  615  LCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD---  785
            LCLE ERL LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD     
Sbjct  155  LCLETERLNLSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDGP  212

Query  786  ---GGGGAATEVVVDL  824
               G  GA  E +V +
Sbjct  213  APPGNVGATREAIVTV  228



>dbj|BAD44623.1| unknown protein [Arabidopsis thaliana]
Length=260

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 133/194 (69%), Gaps = 14/194 (7%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  441  --ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKER  614
                 P   A  P  Q    +ED  D  TS+K   LA+PL  A  P  IHIVKDHD++ER
Sbjct  96   LQTPPPPSAATDPGAQPKPSQED-FDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDMRER  154

Query  615  LCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD---  785
            LCLE ERL LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD     
Sbjct  155  LCLETERLNLSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDGP  212

Query  786  ---GGGGAATEVVV  818
               G  GA  E +V
Sbjct  213  APLGNVGATREAIV  226



>ref|XP_010443018.1| PREDICTED: uncharacterized protein LOC104725962 [Camelina sativa]
Length=240

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 128/170 (75%), Gaps = 9/170 (5%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG----ISTPSDH  461
            RR++ +AVDLS+ES+FAVRWAV HY+RPGD VVLLHV PT+VL+GADWG     + PS  
Sbjct  47   RRKIGVAVDLSEESSFAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWGPLPLKTQPS--  104

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
               P  Q+   +ED  D  TS+K   LA+PL     P  IHIVKDHD++ERLCLE+ERLG
Sbjct  105  VEDPNAQSQPSQED-FDAFTSSKVADLAKPLKELGFPHKIHIVKDHDMRERLCLEIERLG  163

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD   G
Sbjct  164  LSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDG  211



>dbj|BAD44582.1| unknown protein [Arabidopsis thaliana]
Length=260

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 133/194 (69%), Gaps = 14/194 (7%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  441  --ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKER  614
                 P   A  P  Q    +ED  D  TS+K   LA+PL  A  P  IHIVKDHD++ER
Sbjct  96   LQTPPPPSAATDPGAQPKPSQED-FDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDMRER  154

Query  615  LCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD---  785
            LCLE ERL LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD     
Sbjct  155  LCLETERLNLSAVIMGSRGFGA-EKRGSG-GKLGSVSDYCVHHCVCPVVVVRYPDDRDGP  212

Query  786  ---GGGGAATEVVV  818
               G  GA  E +V
Sbjct  213  APPGNVGATREAIV  226



>ref|XP_009127088.1| PREDICTED: uncharacterized protein LOC103851961 [Brassica rapa]
Length=234

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 128/173 (74%), Gaps = 6/173 (3%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            RR++ +A+DLS+ESA+AVRWAV HY+RPGD VVLLHV PT+VL+GADWG   P      P
Sbjct  43   RRKIGVAIDLSEESAYAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWG-PLPLKTQENP  101

Query  474  ppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAM  653
              Q + E+    D  T++K   LA PL  +  P+ IHIVKDHD++ERLCLE+ERLGLSA+
Sbjct  102  SDQPSQED---FDAFTASKVADLARPLKESGFPYKIHIVKDHDMRERLCLEIERLGLSAV  158

Query  654  IMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATEV  812
            IMGSRGFG+  K+GS   +LGSVSDYC+HHC+CPVVVVRYPD   G G    V
Sbjct  159  IMGSRGFGA-EKKGSD-GKLGSVSDYCLHHCVCPVVVVRYPDDRDGPGPVVTV  209



>ref|XP_010433382.1| PREDICTED: uncharacterized protein LOC104717504 [Camelina sativa]
Length=258

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 128/175 (73%), Gaps = 8/175 (5%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  441  --ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKER  614
               + P   A  P  Q    +ED  D  TS+K   LA+PL  A  P  IHIVKDHD++ER
Sbjct  96   LQTTPPPPSAVDPGAQPKPSQED-FDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDMRER  154

Query  615  LCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPD  779
            LCLE ERL LSA+IMGSRGFG+  K+GS   +LGSVSDYCVHHC+CPVVVVRYPD
Sbjct  155  LCLETERLNLSAVIMGSRGFGA-EKKGSD-GKLGSVSDYCVHHCVCPVVVVRYPD  207



>ref|XP_010448153.1| PREDICTED: uncharacterized protein LOC104730647 [Camelina sativa]
Length=237

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 128/170 (75%), Gaps = 9/170 (5%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG----ISTPSDH  461
            RR++ +AVDLS+ES+FAVRWAV HY+RPGD VVLLHV PT+VL+GADWG     + P+  
Sbjct  46   RRKIGVAVDLSEESSFAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWGPLPLKTQPT--  103

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
               P  Q+   +ED  D  TS+K   LA+PL     P  IHIVKDHD++ERLCLE+ERLG
Sbjct  104  VEDPNAQSQPSQED-FDAFTSSKVADLAKPLKELGFPHKIHIVKDHDMRERLCLEIERLG  162

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD   G
Sbjct  163  LSAVIMGSRGFGA-VKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDG  210



>ref|XP_010448151.1| PREDICTED: uncharacterized protein LOC104730649 [Camelina sativa]
Length=257

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 128/177 (72%), Gaps = 6/177 (3%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGIST  449
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  450  PSDHApppp---pQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLC  620
                 PPP     Q    +ED  D  TS+K   LA+PL  A  P  IHIVKDHD++ERLC
Sbjct  96   LQTTPPPPSDPEAQPKPSQED-FDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDMRERLC  154

Query  621  LEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            LE ERL LSA+IMGSRGFG+  K+GS   +LGSVSDYCVHHC+CPVVVVRYPD   G
Sbjct  155  LETERLNLSAVIMGSRGFGA-EKKGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDG  209



>ref|XP_011100324.1| PREDICTED: uncharacterized protein LOC105178530 isoform X2 [Sesamum 
indicum]
Length=293

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 132/189 (70%), Gaps = 11/189 (6%)
 Frame = +3

Query  258  PRVFTPVLSPTQ-------RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            PR   P  +PT         RR+ IAVDLS+ESA+AV+WAV +YLR GD V+LLHV  T+
Sbjct  92   PRFPPPAGTPTSSTASSPFHRRIGIAVDLSEESAYAVKWAVDNYLRLGDAVILLHVLSTS  151

Query  417  VLYGADWGISTPSDHApppppQTAAEE--EDIIDDLTSAKAEHLAEPLVNANVPFTIHIV  590
            VLYGADWG STP+             E  E+  D+ T+A+A  LA+PLV+A++P  IHIV
Sbjct  152  VLYGADWGPSTPTTPTSENSFSVTPPERTEEEYDNFTAAQANILAQPLVDAHMPVKIHIV  211

Query  591  KDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvR  770
            KDHD+KERLCLEVERLGLSA+IMGSRG G+ S+R S   +LGS+SDYCV HC CPVVVVR
Sbjct  212  KDHDMKERLCLEVERLGLSAVIMGSRGIGA-SRRSSN-GKLGSMSDYCVQHCACPVVVVR  269

Query  771  YPDGDGGGG  797
            Y   +   G
Sbjct  270  YNKEEKAAG  278



>ref|XP_011100323.1| PREDICTED: uncharacterized protein LOC105178530 isoform X1 [Sesamum 
indicum]
Length=301

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 132/189 (70%), Gaps = 11/189 (6%)
 Frame = +3

Query  258  PRVFTPVLSPTQ-------RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTA  416
            PR   P  +PT         RR+ IAVDLS+ESA+AV+WAV +YLR GD V+LLHV  T+
Sbjct  92   PRFPPPAGTPTSSTASSPFHRRIGIAVDLSEESAYAVKWAVDNYLRLGDAVILLHVLSTS  151

Query  417  VLYGADWGISTPSDHApppppQTAAEE--EDIIDDLTSAKAEHLAEPLVNANVPFTIHIV  590
            VLYGADWG STP+             E  E+  D+ T+A+A  LA+PLV+A++P  IHIV
Sbjct  152  VLYGADWGPSTPTTPTSENSFSVTPPERTEEEYDNFTAAQANILAQPLVDAHMPVKIHIV  211

Query  591  KDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvR  770
            KDHD+KERLCLEVERLGLSA+IMGSRG G+ S+R S   +LGS+SDYCV HC CPVVVVR
Sbjct  212  KDHDMKERLCLEVERLGLSAVIMGSRGIGA-SRRSSN-GKLGSMSDYCVQHCACPVVVVR  269

Query  771  YPDGDGGGG  797
            Y   +   G
Sbjct  270  YNKEEKAAG  278



>ref|XP_010438630.1| PREDICTED: uncharacterized protein LOC104722194 [Camelina sativa]
Length=260

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 128/182 (70%), Gaps = 11/182 (6%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLS+ESAFAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   
Sbjct  36   TPTPTAGARRKIGVAVDLSEESAFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPLP  95

Query  441  -----ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDL  605
                    P   A  P  Q    +ED  D  TS+K   LA+PL  A  P  IHIVKDHD+
Sbjct  96   LQTSPPPPPPPSAVDPLAQAKPSQED-FDAFTSSKVADLAKPLKEAGFPHKIHIVKDHDM  154

Query  606  KERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGD  785
            +ERLCLE ERL LSA+IMGSRGFG+  K+GS   +LGSVSDYCVHHC+CPVVVVRYPD  
Sbjct  155  RERLCLETERLNLSAVIMGSRGFGA-EKKGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDR  212

Query  786  GG  791
             G
Sbjct  213  DG  214



>ref|XP_010274682.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104609941 
[Nelumbo nucifera]
Length=248

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 116/173 (67%), Gaps = 14/173 (8%)
 Frame = +3

Query  195  EPGYRRPVRNVTPLAIAPPLLPRVFTPVL--SPTQ--RRRVAIAVDLSDESAFAVRWAVR  362
            +P   RP   + P +      PR   P L  +PT    R++AIAVDLSDESAFAV+WAV+
Sbjct  7    QPESDRPALTIQPSS------PRFLLPSLEXAPTSGAHRKIAIAVDLSDESAFAVKWAVQ  60

Query  363  HYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKAEHL  542
            +YLRPGD V+LLHV+ T VLYGADWG     D +     ++  + ED  D  T+ K   L
Sbjct  61   NYLRPGDVVILLHVRTTGVLYGADWG---SIDLSVDTDEESQQKLEDDFDAFTTTKVTDL  117

Query  543  AEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSK  701
            A+PLV   +PF +HIVKDHD+KERLCLEVERLG+ A+IMGSRGFG+ S R SK
Sbjct  118  AQPLVETRIPFKLHIVKDHDMKERLCLEVERLGMGAVIMGSRGFGA-SNRTSK  169



>ref|XP_006281006.1| hypothetical protein CARUB_v10027020mg [Capsella rubella]
 gb|EOA13904.1| hypothetical protein CARUB_v10027020mg [Capsella rubella]
Length=241

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 126/170 (74%), Gaps = 8/170 (5%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG----ISTPSDH  461
            RR++ +AVDLS+ES+ AVRWAV HY+RPGD VVLLHV PT+VL+GADWG     + PS  
Sbjct  46   RRKIGVAVDLSEESSLAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWGPLPLKTQPS--  103

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
               P  Q +   ++  D  TS+K   LA+PL     P  IHIVKDHD++ERLCLE+ERLG
Sbjct  104  VEDPNSQGSQPSQEDFDAFTSSKVADLAKPLKELGFPHKIHIVKDHDMRERLCLEIERLG  163

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG  791
            LSA+IMGSRGFG+  KRGS   +LGSVSDYCVHHC+CPVVVVRYPD   G
Sbjct  164  LSAVIMGSRGFGA-EKRGSD-GKLGSVSDYCVHHCVCPVVVVRYPDDRDG  211



>ref|XP_007216703.1| hypothetical protein PRUPE_ppa026633mg, partial [Prunus persica]
 gb|EMJ17902.1| hypothetical protein PRUPE_ppa026633mg, partial [Prunus persica]
Length=166

 Score =   167 bits (424),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 104/136 (76%), Gaps = 2/136 (1%)
 Frame = +3

Query  327  DESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPS-DHApppppQTAAEEED  503
            +ESAFAV+WAV++YLRPGD VVLLHV+PT+ LYGADWG   P+  +      ++  + ED
Sbjct  1    EESAFAVQWAVQNYLRPGDSVVLLHVRPTSGLYGADWGSVDPNLPNDAVSSSESRQKLED  60

Query  504  IIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSP  683
              D  T+ KA  LA+PLV A +PF IHIVKDHD+KERLCLEVERL L  +IMGSRGFG+ 
Sbjct  61   DFDAFTTTKAADLAQPLVEAQIPFKIHIVKDHDMKERLCLEVERLRLGVVIMGSRGFGA-  119

Query  684  SKRGSKVERLGSVSDY  731
            SKR +KV RLGSV+DY
Sbjct  120  SKRAAKVGRLGSVTDY  135



>ref|XP_009137740.1| PREDICTED: uncharacterized protein LOC103861788 [Brassica rapa]
Length=236

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 125/172 (73%), Gaps = 8/172 (5%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHAppp  473
            RR++ +AVDLS+ES+FAVRWAV HY+RPGD VV+LHV PT+VL+GADWG   PS      
Sbjct  39   RRKIGVAVDLSEESSFAVRWAVDHYIRPGDAVVILHVSPTSVLFGADWGPQPPSS-----  93

Query  474  ppQTAAE-EEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSA  650
              QT  +  ++  D  TSAK   LA PL  A  P  IH+VKDHD++ERL LE+ER+ LSA
Sbjct  94   ADQTPPKPSQEDFDAFTSAKVSDLARPLKEAGFPHKIHVVKDHDMRERLGLEIERVALSA  153

Query  651  MIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAAT  806
            +IMGSRGFG+  KRG +  +LGSVSDYCVHHC+CPVVVVRYPD     G  T
Sbjct  154  VIMGSRGFGA-EKRG-RYGKLGSVSDYCVHHCVCPVVVVRYPDDPAAPGKGT  203



>ref|XP_011079191.1| PREDICTED: uncharacterized protein LOC105162768 [Sesamum indicum]
Length=336

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 118/159 (74%), Gaps = 8/159 (5%)
 Frame = +3

Query  297  RRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppp  476
            RR+AIAVDLS+ESA+AV+WAV +Y+RP D V L+HV  T+VLYGADWG       +    
Sbjct  156  RRIAIAVDLSNESAYAVKWAVENYVRPSDTVTLVHVNSTSVLYGADWGPFA----STTTI  211

Query  477  pQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMI  656
              T +EEE   D+ T+AKA HLA+PL  ANVP+ IHIVKDHD+KERLCLEVERLG SA+I
Sbjct  212  DPTVSEEER--DNFTAAKANHLAQPLAEANVPYKIHIVKDHDMKERLCLEVERLGFSALI  269

Query  657  MGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRY  773
             GSRG G    R S   +LGSVSDYCV HC CPVVVVRY
Sbjct  270  TGSRGAG--VLRKSTKGKLGSVSDYCVQHCSCPVVVVRY  306



>ref|XP_006370361.1| hypothetical protein POPTR_0001s41960g [Populus trichocarpa]
 gb|ERP66930.1| hypothetical protein POPTR_0001s41960g [Populus trichocarpa]
Length=213

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 111/165 (67%), Gaps = 24/165 (15%)
 Frame = +3

Query  294  RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---ISTP----  452
            RR++ +AVDLSDESA+AVRW+V HY+RPGD V+LLHV PT+VL GADWG   +STP    
Sbjct  50   RRKIGVAVDLSDESAYAVRWSVHHYIRPGDSVILLHVSPTSVLLGADWGPLPLSTPTQSQ  109

Query  453  -------SDHApppppQTAAE--------EEDIIDDLTSAKAEHLAEPLVNANVPFTIHI  587
                   S        +T  E        +ED  D  T++KA  +A PL  A +P+ IHI
Sbjct  110  LDLLNNNSKFNSEIDSKTKNENSEKPQPRQEDDFDAFTASKAADIARPLKEAQIPYKIHI  169

Query  588  VKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSV  722
            VKDHD+KERLCLE+ERLGLSA+IMGSRGFG+ + RGS  ERLG  
Sbjct  170  VKDHDMKERLCLEIERLGLSAVIMGSRGFGA-AIRGSD-ERLGKC  212



>ref|XP_008226788.1| PREDICTED: uncharacterized protein LOC103326349, partial [Prunus 
mume]
Length=212

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 119/164 (73%), Gaps = 14/164 (9%)
 Frame = +3

Query  330  ESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG-----ISTPSD------HApppp  476
            ESA AVRWAV HY+RPGD VVLLHV PT+VL+GADWG     I+T  D      HA    
Sbjct  11   ESAHAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWGSVDLSINTNDDVDFVDNHALNDS  70

Query  477  pQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMI  656
             +    E D  D  T++KA  LA PL  A +PF IHIVKDHD+KERLCLEVERLGLSA+I
Sbjct  71   VKQKKLENDF-DAFTASKAADLARPLKEAQIPFKIHIVKDHDMKERLCLEVERLGLSAVI  129

Query  657  MGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDG  788
            MGSRG G+ +KRG+   RLGSVSDYCVHHC+CPVVVVR+PD D 
Sbjct  130  MGSRGVGA-AKRGND-GRLGSVSDYCVHHCVCPVVVVRFPDDDN  171



>gb|ACJ84662.1| unknown [Medicago truncatula]
Length=215

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 110/170 (65%), Gaps = 18/170 (11%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLSDESA+AVRWAV+HY+RPGD V+LLHV PT VL+GADWG   
Sbjct  33   TPTPTAGARRKIGVAVDLSDESAYAVRWAVQHYIRPGDAVILLHVSPTNVLFGADWGSID  92

Query  441  -------------ISTPSDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTI  581
                         I+  +++           EED  D  T+ K+  LA+PL  A +P+ I
Sbjct  93   LSINTDPNSEEEAINIATNNTEISSTPKRKLEED-YDAFTATKSADLAKPLKEAQIPYKI  151

Query  582  HIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDY  731
            HIVKDHD+KERLCLEVERLGLSA+IMG       + RG  + +LGSVSDY
Sbjct  152  HIVKDHDMKERLCLEVERLGLSAVIMGKPWIWRGASRGV-MGKLGSVSDY  200



>ref|XP_007021229.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2, partial [Theobroma cacao]
 gb|EOY12754.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2, partial [Theobroma cacao]
Length=164

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 114/149 (77%), Gaps = 4/149 (3%)
 Frame = +3

Query  354  AVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDHApppppQTAAEEEDIIDDLTSAKA  533
            +V++Y+RPGD V+LLHV PT+VL+GADWG   P     P  PQ+  + ED  D  T++KA
Sbjct  1    SVQNYIRPGDAVILLHVSPTSVLFGADWG-PLPHTPQTPETPQSQKQLEDDFDAFTASKA  59

Query  534  EHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGLSAMIMGSRGFGSPSKRGSKVERL  713
              LA PL  +  PF IHIVKDHD++ERLCLEVERLGLSA+IMGSRGFG+  KRGS   RL
Sbjct  60   ADLARPLKESGFPFKIHIVKDHDMRERLCLEVERLGLSAVIMGSRGFGA-EKRGSD-GRL  117

Query  714  GSVSDYcvhhcicpvvvvRYP-DGDGGGG  797
            GSVSDYCVHHC+CPVVVVRYP D DGG G
Sbjct  118  GSVSDYCVHHCVCPVVVVRYPEDKDGGNG  146



>gb|AFK38246.1| unknown [Medicago truncatula]
Length=189

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 99/146 (68%), Gaps = 15/146 (10%)
 Frame = +3

Query  270  TPVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWG---  440
            TP  +   RR++ +AVDLSDESA+AVRWAV+HY+RPGD V+LLHV PT VL+GADWG   
Sbjct  33   TPTPTAGARRKIGVAVDLSDESAYAVRWAVQHYIRPGDAVILLHVSPTNVLFGADWGSID  92

Query  441  --IST-PSDHApppppQTAAEE---------EDIIDDLTSAKAEHLAEPLVNANVPFTIH  584
              I+T P+         T   E         E+  D  T+ K+  LA+PL  A +P+ IH
Sbjct  93   LSINTDPNSEEEAINIATNNTEISSTPKRKLEEDYDAFTATKSADLAKPLKEAQIPYKIH  152

Query  585  IVKDHDLKERLCLEVERLGLSAMIMG  662
            IVKDHD+KERLCLEVERLGLSA+IMG
Sbjct  153  IVKDHDMKERLCLEVERLGLSAVIMG  178



>ref|XP_008230189.1| PREDICTED: uncharacterized protein LOC103329491 [Prunus mume]
Length=208

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 130/208 (63%), Gaps = 25/208 (12%)
 Frame = +3

Query  273  PVLSPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTP  452
            P  S   +R+VAIAVDLS+ESAFAV+WAV++YLRPGD VVLLHV+PT+VLYGADWG   P
Sbjct  23   PTASGGDQRKVAIAVDLSEESAFAVQWAVQNYLRPGDSVVLLHVRPTSVLYGADWGSVNP  82

Query  453  S-DHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEV  629
            +  +      ++  + ED  D  T+                        +D+K RL LEV
Sbjct  83   NLPNDAVSSSESRRKLEDDFDAFTTT-----------------------NDVKGRLGLEV  119

Query  630  ERLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGGGGAATE  809
            ERL L  +IMGSRGFG+ +KR +KV RLGSV+DYCVHHC+CPVVVVR+PD   G      
Sbjct  120  ERLRLGVVIMGSRGFGA-AKRAAKVGRLGSVTDYCVHHCVCPVVVVRFPDDSDGSEPNGP  178

Query  810  VVVDLHPVPEDKEYEYHDNADDEVDELE  893
              V+LHPVPE+ + E  D    E D  E
Sbjct  179  NPVELHPVPEEDQEELSDADSGEEDPQE  206



>gb|AFW67672.1| hypothetical protein ZEAMMB73_069074 [Zea mays]
Length=183

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 99/157 (63%), Gaps = 19/157 (12%)
 Frame = +3

Query  228  TPLAIAPPLLPRVFTPVLSPTQ----RRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVL  395
            T  A   P  PR F   L  T      RR+AIA DL+DESAFAV+WAV++YLRPGD VVL
Sbjct  26   TQAAAIQPSSPRFFFSSLVGTNPASPHRRIAIAADLNDESAFAVKWAVQNYLRPGDAVVL  85

Query  396  LHVQPTAVLYGADWGISTP--------------SDHApppppQTAAEEEDIIDDLTSAKA  533
            LHV+PT+VLYGADWG S P              +    P   +   + E+  D  TS KA
Sbjct  86   LHVRPTSVLYGADWG-SIPVSVADEDDAAEDAAAAEGGPSEEELQKKWEEDYDAFTSTKA  144

Query  534  EHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLGL  644
            + LA+PL++A +PF IH+VKDH++KER CLE ERLGL
Sbjct  145  QDLAQPLIDAQIPFKIHVVKDHEMKERPCLEAERLGL  181



>gb|EMS64464.1| hypothetical protein TRIUR3_19232 [Triticum urartu]
Length=167

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 100/141 (71%), Gaps = 4/141 (3%)
 Frame = +3

Query  453  SDHApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVE  632
            SD A     +   + E+  D  TS K++ LA+PLV A +PF IH+VKDHD+KERLCLE E
Sbjct  15   SDPAAASAEELQKKREEDFDAFTSTKSQDLAQPLVAAQIPFKIHVVKDHDMKERLCLEAE  74

Query  633  RLGLSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG-GGAATE  809
            RLGLSAMIMGSRGFG+ S++G K  RLGSVSDYCVHHC+CPVVVVRYPD   G  G A  
Sbjct  75   RLGLSAMIMGSRGFGA-SRKGGKG-RLGSVSDYCVHHCVCPVVVVRYPDDAAGVPGEAAA  132

Query  810  VVVDLHPVPEDKEYEYHDNAD  872
               +LH VPED E  YHD  D
Sbjct  133  ATDELHTVPED-EPVYHDAPD  152



>ref|NP_188758.2| zinc ion binding protein [Arabidopsis thaliana]
 gb|AAP04166.1| putative CHP-rich zinc finger protein [Arabidopsis thaliana]
 gb|AAP40346.1| putative CHP-rich zinc finger protein [Arabidopsis thaliana]
 dbj|BAF00490.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76476.1| zinc ion binding protein [Arabidopsis thaliana]
Length=804

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 113/191 (59%), Gaps = 29/191 (15%)
 Frame = +3

Query  282  SPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDH  461
            SP QR+ + IAV+LS+ESAF VRWAV +Y+R GD +++LHV PTA L+GADWG       
Sbjct  11   SPRQRK-IGIAVELSEESAFTVRWAVDNYIRQGDDIIILHVSPTAGLFGADWGY------  63

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
              P   Q       I      +K   L +PL  A  P TIH VKD+D +ERLCLE +RL 
Sbjct  64   -YPLQTQPPYTTASIF-----SKVADLGKPLKEAGFPHTIHTVKDYDKRERLCLETQRLN  117

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG--GGAATEVV  815
            L+A+IM   GFG            GSVSD+CVHHC+C VVVVRYPDG G   G  A  +V
Sbjct  118  LTALIM---GFGD-----------GSVSDFCVHHCVCQVVVVRYPDGPGSVEGTRAAPIV  163

Query  816  VDLHPVPEDKE  848
                   +D+E
Sbjct  164  TFKSRTDDDEE  174



>dbj|BAB01712.1| unnamed protein product [Arabidopsis thaliana]
Length=777

 Score =   125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 113/191 (59%), Gaps = 29/191 (15%)
 Frame = +3

Query  282  SPTQRRRVAIAVDLSDESAFAVRWAVRHYLRPGDGVVLLHVQPTAVLYGADWGISTPSDH  461
            SP QR+ + IAV+LS+ESAF VRWAV +Y+R GD +++LHV PTA L+GADWG       
Sbjct  11   SPRQRK-IGIAVELSEESAFTVRWAVDNYIRQGDDIIILHVSPTAGLFGADWGY------  63

Query  462  ApppppQTAAEEEDIIDDLTSAKAEHLAEPLVNANVPFTIHIVKDHDLKERLCLEVERLG  641
              P   Q       I      +K   L +PL  A  P TIH VKD+D +ERLCLE +RL 
Sbjct  64   -YPLQTQPPYTTASIF-----SKVADLGKPLKEAGFPHTIHTVKDYDKRERLCLETQRLN  117

Query  642  LSAMIMGSRGFGSPSKRGSKVERLGSVSDYcvhhcicpvvvvRYPDGDGG--GGAATEVV  815
            L+A+IM   GFG            GSVSD+CVHHC+C VVVVRYPDG G   G  A  +V
Sbjct  118  LTALIM---GFGD-----------GSVSDFCVHHCVCQVVVVRYPDGPGSVEGTRAAPIV  163

Query  816  VDLHPVPEDKE  848
                   +D+E
Sbjct  164  TFKSRTDDDEE  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2266477593358