BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20055_g1_i3 len=715 path=[1:0-336 338:337-714]

Length=715
                                                                      Score     E

ref|XP_009760926.1|  PREDICTED: uncharacterized protein LOC104213182    127   7e-33   
ref|XP_002269159.1|  PREDICTED: uncharacterized protein LOC100249439    126   1e-32   Vitis vinifera
gb|KHG14662.1|  Chaperone DnaJ                                          126   2e-32   
emb|CDP06588.1|  unnamed protein product                                125   3e-32   
gb|AFK38973.1|  unknown                                                 124   5e-32   
ref|XP_007026970.1|  Uncharacterized protein TCM_021901                 124   1e-31   
ref|XP_011077637.1|  PREDICTED: uncharacterized protein LOC105161598    122   6e-31   
ref|XP_010107323.1|  hypothetical protein L484_009457                   121   1e-30   
ref|XP_011094891.1|  PREDICTED: uncharacterized protein LOC105174...    120   1e-30   
ref|XP_010037819.1|  PREDICTED: uncharacterized protein LOC104426453    120   4e-30   
ref|XP_009611238.1|  PREDICTED: uncharacterized protein LOC104104784    119   6e-30   
ref|XP_006429128.1|  hypothetical protein CICLE_v10013090mg             119   1e-29   
ref|NP_001237980.1|  uncharacterized protein LOC100306383               119   1e-29   
ref|NP_001240085.1|  uncharacterized protein LOC100798036               118   1e-29   
gb|EYU26608.1|  hypothetical protein MIMGU_mgv1a016247mg                117   3e-29   
ref|XP_006349494.1|  PREDICTED: uncharacterized protein LOC102596768    117   5e-29   
gb|EYU41748.1|  hypothetical protein MIMGU_mgv1a015868mg                117   7e-29   
ref|XP_010262556.1|  PREDICTED: uncharacterized protein LOC104601062    116   1e-28   
ref|XP_002309071.1|  hypothetical protein POPTR_0006s08800g             115   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008442527.1|  PREDICTED: uncharacterized protein LOC103486375    115   2e-28   
ref|XP_007140510.1|  hypothetical protein PHAVU_008G118700g             115   3e-28   
gb|EMS54426.1|  hypothetical protein TRIUR3_00731                       113   3e-28   
dbj|BAJ99506.1|  predicted protein                                      115   3e-28   
ref|XP_004514394.1|  PREDICTED: uncharacterized protein LOC101510131    114   4e-28   
ref|XP_008369924.1|  PREDICTED: uncharacterized protein LOC103433437    114   7e-28   
ref|XP_004302780.1|  PREDICTED: uncharacterized protein LOC101305773    113   1e-27   
ref|XP_008801593.1|  PREDICTED: uncharacterized protein LOC103715662    113   1e-27   
gb|AFK49459.1|  unknown                                                 113   2e-27   
ref|XP_006846283.1|  hypothetical protein AMTR_s00012p00250250          112   2e-27   
ref|XP_004137792.1|  PREDICTED: uncharacterized protein LOC101209846    112   3e-27   
ref|XP_010543281.1|  PREDICTED: uncharacterized protein LOC104816258    112   3e-27   
ref|XP_011019836.1|  PREDICTED: uncharacterized protein LOC105122436    112   3e-27   
ref|XP_004173015.1|  PREDICTED: uncharacterized protein LOC101228756    112   3e-27   
ref|XP_009338592.1|  PREDICTED: uncharacterized protein LOC103930917    111   4e-27   
ref|XP_010920535.1|  PREDICTED: uncharacterized protein LOC105044368    111   5e-27   
ref|XP_008240695.1|  PREDICTED: uncharacterized protein LOC103339189    111   7e-27   
ref|XP_007206840.1|  hypothetical protein PRUPE_ppa027046mg             110   9e-27   
gb|KFK24599.1|  hypothetical protein AALP_AA8G000200                    111   1e-26   
ref|XP_006288886.1|  hypothetical protein CARUB_v10002245mg             110   1e-26   
ref|NP_001144296.1|  hypothetical protein                               110   1e-26   Zea mays [maize]
ref|XP_004960532.1|  PREDICTED: uncharacterized protein LOC101776841    110   2e-26   
ref|XP_008387784.1|  PREDICTED: uncharacterized protein LOC103450243    110   2e-26   
ref|XP_010678087.1|  PREDICTED: uncharacterized protein LOC104893654    109   3e-26   
ref|XP_002531558.1|  conserved hypothetical protein                     108   6e-26   Ricinus communis
ref|XP_002439132.1|  hypothetical protein SORBIDRAFT_09g001120          107   2e-25   Sorghum bicolor [broomcorn]
ref|NP_195836.5|  uncharacterized protein                               107   2e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40335.1|  BnaA10g27330D                                          107   3e-25   
emb|CDY10464.1|  BnaCnng03650D                                          107   3e-25   
ref|XP_002870957.1|  AT5g02160                                          107   3e-25   
gb|EPS57497.1|  hypothetical protein M569_17319                         104   7e-25   
gb|EAY96259.1|  hypothetical protein OsI_18157                          105   9e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_009122802.1|  PREDICTED: uncharacterized protein LOC103847473    105   9e-25   
ref|XP_010490631.1|  PREDICTED: uncharacterized protein LOC104768381    105   1e-24   
ref|NP_001054438.2|  Os05g0110100                                       105   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569101.1|  PREDICTED: uncharacterized protein LOC100825298    104   2e-24   
ref|XP_010452047.1|  PREDICTED: uncharacterized protein LOC104734220    104   2e-24   
ref|XP_006398681.1|  hypothetical protein EUTSA_v10014990mg             104   3e-24   
gb|AAK73148.1|AC079022_21  unknown protein                              103   9e-24   Oryza sativa [red rice]
ref|XP_002976319.1|  hypothetical protein SELMODRAFT_28797              101   1e-23   
gb|KDP35663.1|  hypothetical protein JCGZ_09101                         103   1e-23   
gb|ABK25712.1|  unknown                                                 103   1e-23   Picea sitchensis
ref|XP_010423894.1|  PREDICTED: uncharacterized protein LOC104708932    102   3e-23   
ref|XP_002987325.1|  hypothetical protein SELMODRAFT_28809            99.8    5e-23   
ref|XP_001762106.1|  predicted protein                                99.4    9e-23   
ref|XP_001751642.1|  predicted protein                                98.2    2e-22   
gb|ACD63517.1|  hypothetical protein                                  89.7    1e-19   Helianthus annuus
ref|XP_009387534.1|  PREDICTED: uncharacterized protein LOC103974427  91.7    2e-19   
gb|ACD63567.1|  hypothetical protein                                  87.4    9e-19   Helianthus petiolaris
gb|EMT20037.1|  hypothetical protein F775_17601                       87.0    1e-18   
gb|ACD63575.1|  hypothetical protein                                  85.9    3e-18   Helianthus petiolaris
gb|ACD63573.1|  hypothetical protein                                  85.9    3e-18   Helianthus petiolaris
gb|ACD63578.1|  hypothetical protein                                  85.9    4e-18   Helianthus petiolaris
ref|NP_001234311.1|  uncharacterized protein LOC778362                86.7    1e-17   
gb|ACD63601.1|  hypothetical protein                                  81.6    9e-17   Bahiopsis reticulata
gb|ACD63576.1|  hypothetical protein                                  79.7    6e-16   Helianthus petiolaris
gb|ACD63518.1|  hypothetical protein                                  53.9    1e-06   Helianthus annuus



>ref|XP_009760926.1| PREDICTED: uncharacterized protein LOC104213182 [Nicotiana sylvestris]
Length=134

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 102/135 (76%), Gaps = 6/135 (4%)
 Frame = -2

Query  597  AAMASLHTIMFTNSGKKPASLPCSKFLGT---PRNVVTPSPKIAKTARPFTvvaavgdvs  427
            +++A+   I+  N  KK  ++P S FLGT   P N+ T      K  R   VVAAVGDVS
Sbjct  3    SSIANCMQIISANPAKKSIAIP-SNFLGTKILPLNISTAHKN--KKHRSLKVVAAVGDVS  59

Query  426  daGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIV  247
              GTTYLIAGAAAVAL+GTAFPI FSRKDTCPECDGAGFVR+ GATLRANAARKDQ QIV
Sbjct  60   SEGTTYLIAGAAAVALLGTAFPILFSRKDTCPECDGAGFVRKGGATLRANAARKDQVQIV  119

Query  246  CARCNGLGKLNQIDK  202
            CA CNGLGKLNQ+DK
Sbjct  120  CANCNGLGKLNQVDK  134



>ref|XP_002269159.1| PREDICTED: uncharacterized protein LOC100249439 [Vitis vinifera]
 emb|CAN82963.1| hypothetical protein VITISV_000344 [Vitis vinifera]
 emb|CBI30525.3| unnamed protein product [Vitis vinifera]
Length=129

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 98/133 (74%), Gaps = 4/133 (3%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPASLPCSKFLGTPRNVVTPSPKIAKTARPFTvvaavgdvsda  421
            M ++A LHT+   NS K+ +SLP      TP   V  +    K  R  TVVAAVG+VS  
Sbjct  1    MVSLAPLHTLFPGNSLKQ-SSLPGFYARPTP---VGSAVSWKKKNRSLTVVAAVGEVSTD  56

Query  420  GTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCA  241
            GT YLIAGA AV ++GTAFPIFFSRKD CPECDGAGFVRQ+G  LRANAARKDQ QIVCA
Sbjct  57   GTIYLIAGAVAVTVLGTAFPIFFSRKDVCPECDGAGFVRQSGVALRANAARKDQAQIVCA  116

Query  240  RCNGLGKLNQIDK  202
            RCNGLGKLNQ+DK
Sbjct  117  RCNGLGKLNQVDK  129



>gb|KHG14662.1| Chaperone DnaJ [Gossypium arboreum]
Length=138

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 98/138 (71%), Gaps = 8/138 (6%)
 Frame = -2

Query  591  MASLHTIMFTNSGKKPAS--LPCSKFLGTPRNVVTPSPKIAKTA------RPFTvvaavg  436
            MASL  +  TN  + P    LP S        + + +    KT       R  TVVAAVG
Sbjct  1    MASLQALYATNLKQSPLQGFLPLSSRYAVAAPMRSTALTRTKTKGQNNQKRSLTVVAAVG  60

Query  435  dvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQT  256
            DVS  GT YLIAGAA VALVGTAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQ 
Sbjct  61   DVSADGTNYLIAGAAVVALVGTAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQA  120

Query  255  QIVCARCNGLGKLNQIDK  202
            QIVCARCNGLGKLNQIDK
Sbjct  121  QIVCARCNGLGKLNQIDK  138



>emb|CDP06588.1| unnamed protein product [Coffea canephora]
Length=141

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 100/143 (70%), Gaps = 12/143 (8%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPASLPCSKFLGTPRNVVTPSPKI----------AKTARPFTv  451
            MA+ ASL T+  +   K+P +      L   R+      K+           K  R  TV
Sbjct  1    MASTASLQTLFSSLGVKQPRAGASGTSL--RRSTTAVGSKVWSLNAGVRENKKKGRSLTV  58

Query  450  vaavgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAA  271
            VAAVGDVS  GTTYLIAGAAAVAL+GTAFPIFFSRKD CPECDGAGFVRQ+GA LRANAA
Sbjct  59   VAAVGDVSSEGTTYLIAGAAAVALIGTAFPIFFSRKDLCPECDGAGFVRQSGAALRANAA  118

Query  270  RKDQTQIVCARCNGLGKLNQIDK  202
            RKDQ QIVCARCNGLGKLNQIDK
Sbjct  119  RKDQAQIVCARCNGLGKLNQIDK  141



>gb|AFK38973.1| unknown [Lotus japonicus]
Length=128

 Score =   124 bits (312),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 97/133 (73%), Gaps = 5/133 (4%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPASLPCSKFLGTPRNVVTPSPKIAKTARPFTvvaavgdvsda  421
            MA++  LHTI+  N+      L  +   G P + +  +       R  TVV+AVGDVS  
Sbjct  1    MASLIPLHTIIPRNTTVSKTGLSSAGLTGVPCSRIQKNKN-----RTLTVVSAVGDVSAD  55

Query  420  GTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCA  241
            G TYLIAGA AVALVGTAFPI FSRKDTCPECDGAGFVR++G TLRANAARKDQTQIVCA
Sbjct  56   GNTYLIAGAIAVALVGTAFPILFSRKDTCPECDGAGFVRKSGKTLRANAARKDQTQIVCA  115

Query  240  RCNGLGKLNQIDK  202
             CNGLGKLNQIDK
Sbjct  116  NCNGLGKLNQIDK  128



>ref|XP_007026970.1| Uncharacterized protein TCM_021901 [Theobroma cacao]
 gb|EOY07472.1| Uncharacterized protein TCM_021901 [Theobroma cacao]
Length=140

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 103/143 (72%), Gaps = 13/143 (9%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPASLPCSKFLGTPRNVVTPSPK----IAKTA------RPFTv  451
            MA++ASL T+  T+  + P S    +   + R+ V P+P     +++T       R  TV
Sbjct  1    MASVASLQTLYATSLKQSPVS---GRHSLSSRHAVAPAPWRSTVLSRTKSRNNQKRSLTV  57

Query  450  vaavgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAA  271
            VAA+GDVS   T YLIAGAA VALVGTAFPI FSRKDTCPECDGAGFVR++G  LRANAA
Sbjct  58   VAAIGDVSADSTNYLIAGAAVVALVGTAFPILFSRKDTCPECDGAGFVRKSGVPLRANAA  117

Query  270  RKDQTQIVCARCNGLGKLNQIDK  202
            RKD+ QIVCARCNGLGKLNQIDK
Sbjct  118  RKDEAQIVCARCNGLGKLNQIDK  140



>ref|XP_011077637.1| PREDICTED: uncharacterized protein LOC105161598 [Sesamum indicum]
Length=136

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 104/140 (74%), Gaps = 11/140 (8%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKP----ASLPCSKFLGTPRNVVTPSP---KIAKTARPFTvvaa  442
            MA++A    +   NS K+P    +S   + FLG+      PS    +  K  RP TVVAA
Sbjct  1    MASIAYGQAVFSPNSIKRPIPSLSSNTINSFLGSK----LPSQCTIRKTKDTRPLTVVAA  56

Query  441  vgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKD  262
            VGDVS  GTTYLIAGAAAVAL+GTAFP+ FSRKD CPECDGAGFVR++G+TLRANAARKD
Sbjct  57   VGDVSAEGTTYLIAGAAAVALLGTAFPVLFSRKDLCPECDGAGFVRKSGSTLRANAARKD  116

Query  261  QTQIVCARCNGLGKLNQIDK  202
            + QIVCARCNGLGKLNQIDK
Sbjct  117  EVQIVCARCNGLGKLNQIDK  136



>ref|XP_010107323.1| hypothetical protein L484_009457 [Morus notabilis]
 gb|EXC14803.1| hypothetical protein L484_009457 [Morus notabilis]
Length=132

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 101/136 (74%), Gaps = 7/136 (5%)
 Frame = -2

Query  600  MAAMA-SLHTIMFTNSGKKPASL--PCSKFLGTPRNVVTPSPKIAKTARPFTvvaavgdv  430
            MA+M+ SL TI+  NS K+ A +  P S  L    N    + K     RP TVVAAVGDV
Sbjct  1    MASMSTSLQTILSANSVKQSALVVKPSSSTLLITWNKREKNEK----KRPLTVVAAVGDV  56

Query  429  sdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQI  250
            S  GT YLIAGAAAVAL+GTAFPI F+RKDTCP+CDGAGF+R+AG TLRANAARKDQ QI
Sbjct  57   SADGTNYLIAGAAAVALLGTAFPILFTRKDTCPDCDGAGFIRKAGVTLRANAARKDQAQI  116

Query  249  VCARCNGLGKLNQIDK  202
            VC  CNGLGKLNQIDK
Sbjct  117  VCPNCNGLGKLNQIDK  132



>ref|XP_011094891.1| PREDICTED: uncharacterized protein LOC105174470 isoform X1 [Sesamum 
indicum]
Length=131

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPASLPCSK--FLGTPRNVVTPSPKIAKTARPFTvvaavgdvs  427
            MA++  +  +  TNS KKPA   CS   FLG+  +      +     +  TVVAA GDVS
Sbjct  1    MASIVQMQALFSTNSIKKPAPSLCSATTFLGSKFS----QRQKTNDRKQLTVVAAAGDVS  56

Query  426  daGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIV  247
              GTTYL+ GA  VAL+GTAFP  FSRKD CPECDGAGFVR++G+TLRANAARKD+ QIV
Sbjct  57   ADGTTYLLVGACTVALLGTAFPALFSRKDLCPECDGAGFVRKSGSTLRANAARKDELQIV  116

Query  246  CARCNGLGKLNQIDK  202
            CARCNGLGKLNQIDK
Sbjct  117  CARCNGLGKLNQIDK  131



>ref|XP_010037819.1| PREDICTED: uncharacterized protein LOC104426453 [Eucalyptus grandis]
 gb|KCW49583.1| hypothetical protein EUGRSUZ_K03108 [Eucalyptus grandis]
Length=133

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPASLPCSKFLGTPRNVVTPSPKIAKTARPFTvvaavgdvsda  421
            MA+ A   T++ +N   +PA   C     +    +       K  R   VVAAVGDVS  
Sbjct  1    MASPAPPPTVLRSNPLIQPARTACISLSSSVGRSLANQMLAKKKRRSLAVVAAVGDVSAD  60

Query  420  GTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCA  241
            GTTYLIAGAA VALVGTAFPI FSRKDTCPECDGAGFVRQ+ ATLRANAARKDQ+QIVC 
Sbjct  61   GTTYLIAGAAVVALVGTAFPILFSRKDTCPECDGAGFVRQSAATLRANAARKDQSQIVCQ  120

Query  240  RCNGLGKLNQIDK  202
            RCNGLGKLNQIDK
Sbjct  121  RCNGLGKLNQIDK  133



>ref|XP_009611238.1| PREDICTED: uncharacterized protein LOC104104784 [Nicotiana tomentosiformis]
Length=131

 Score =   119 bits (298),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 96/132 (73%), Gaps = 6/132 (5%)
 Frame = -2

Query  588  ASLHTIMFTNSGKKPASLPCSKFLGT---PRNVVTPSPKIAKTARPFTvvaavgdvsdaG  418
            +S+   M      K  ++P S FLGT   P N+ T      K  R   VVAAVGDVS  G
Sbjct  3    SSIANCMQITVNPKSTAIP-SNFLGTKISPLNISTAHKN--KKHRSLEVVAAVGDVSSEG  59

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            TTYLIAGAAAVAL+GTAFPI FSRKD CPECDGAGFVR+ GATLRANAARKDQ QIVCA 
Sbjct  60   TTYLIAGAAAVALLGTAFPILFSRKDLCPECDGAGFVRKGGATLRANAARKDQVQIVCAN  119

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQ+DK
Sbjct  120  CNGLGKLNQVDK  131



>ref|XP_006429128.1| hypothetical protein CICLE_v10013090mg [Citrus clementina]
 ref|XP_006480870.1| PREDICTED: uncharacterized protein LOC102609873 [Citrus sinensis]
 gb|ESR42368.1| hypothetical protein CICLE_v10013090mg [Citrus clementina]
 gb|KDO52346.1| hypothetical protein CISIN_1g032793mg [Citrus sinensis]
Length=133

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 98/137 (72%), Gaps = 8/137 (6%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKK---PASLPCSKFLGTPRNVVTPSPKIAKTA-RPFTvvaavgd  433
            MA++  L ++  +++ K      S   S F   PR    P  +  K   R  TVVAA GD
Sbjct  1    MASIVPLQSVYASSTTKNLDVARSPSVSSFFAVPR----PINRTQKNKKRSLTVVAAAGD  56

Query  432  vsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQ  253
            VS  GTTYLIAGAAAVAL+GT FPI FSRKD CPECDGAGFVR++GATLRANAARKD+ Q
Sbjct  57   VSADGTTYLIAGAAAVALLGTGFPILFSRKDMCPECDGAGFVRKSGATLRANAARKDEVQ  116

Query  252  IVCARCNGLGKLNQIDK  202
            IVCARCNGLGKLNQIDK
Sbjct  117  IVCARCNGLGKLNQIDK  133



>ref|NP_001237980.1| uncharacterized protein LOC100306383 [Glycine max]
 gb|ACU14527.1| unknown [Glycine max]
 gb|KHN14006.1| hypothetical protein glysoja_025023 [Glycine soja]
Length=139

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            TTYL+AGA AVAL+GTAFPIFFSRKDTCPECDGAGFVR+A  TLRANAARKDQTQIVCAR
Sbjct  68   TTYLVAGAIAVALIGTAFPIFFSRKDTCPECDGAGFVRKADVTLRANAARKDQTQIVCAR  127

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQIDK
Sbjct  128  CNGLGKLNQIDK  139



>ref|NP_001240085.1| uncharacterized protein LOC100798036 [Glycine max]
 gb|ACU20493.1| unknown [Glycine max]
 gb|KHN40287.1| hypothetical protein glysoja_000785 [Glycine soja]
Length=140

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 98/140 (70%), Gaps = 7/140 (5%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPASLPCSK-------FLGTPRNVVTPSPKIAKTARPFTvvaa  442
            MA+M  L T++  N+   P  +  S        F G+ R + T   +         VVAA
Sbjct  1    MASMTMLQTMIPKNAPNLPPRVGASSNNTTKISFGGSGRVLWTGIQRNRNNRSSSIVVAA  60

Query  441  vgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKD  262
            VGDVS  GT YL+AGA AVALVGTAFPIFFSRKDTCPECDGAGFVR+A  TLRANAARKD
Sbjct  61   VGDVSSDGTAYLVAGAIAVALVGTAFPIFFSRKDTCPECDGAGFVRKANVTLRANAARKD  120

Query  261  QTQIVCARCNGLGKLNQIDK  202
            QTQIVCARCNGLGKLNQIDK
Sbjct  121  QTQIVCARCNGLGKLNQIDK  140



>gb|EYU26608.1| hypothetical protein MIMGU_mgv1a016247mg [Erythranthe guttata]
Length=129

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -2

Query  465  RPFTvvaavgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATL  286
            +P TVVAAVGDVS  GTTYLIAGAAAVAL+GTAFPI FSRKD CPECDGAGFVR++G+TL
Sbjct  42   KPLTVVAAVGDVSANGTTYLIAGAAAVALIGTAFPILFSRKDLCPECDGAGFVRKSGSTL  101

Query  285  RANAARKDQTQIVCARCNGLGKLNQIDK  202
            RANAARKD  QIVCARCNGLGKLNQIDK
Sbjct  102  RANAARKDSAQIVCARCNGLGKLNQIDK  129



>ref|XP_006349494.1| PREDICTED: uncharacterized protein LOC102596768 [Solanum tuberosum]
Length=128

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = -2

Query  594  AMASLHTIMFTNSGKKPASLPCSKFLGTPRNVVTPSPKIAKTARPFTvvaavgdvsdaGT  415
            A +S+  + F  S KK   +P S FLGT  +  T + K  K  R   VVAA+GDVS  GT
Sbjct  2    ASSSIACVQF--SAKKSPVIP-SNFLGTKVSSSTTTQK-NKKQRSLKVVAAIGDVSSDGT  57

Query  414  TYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARC  235
             YLIAGAAAVAL+GTAFPI FSRKD CPECDGAGFVR+ GA L+ANAARKDQ QIVCA C
Sbjct  58   VYLIAGAAAVALLGTAFPILFSRKDLCPECDGAGFVRKGGAALKANAARKDQVQIVCANC  117

Query  234  NGLGKLNQIDK  202
            NGLGKLNQ+DK
Sbjct  118  NGLGKLNQVDK  128



>gb|EYU41748.1| hypothetical protein MIMGU_mgv1a015868mg [Erythranthe guttata]
Length=142

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 97/140 (69%), Gaps = 7/140 (5%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPA-SLPCSK------FLGTPRNVVTPSPKIAKTARPFTvvaa  442
            MA++  L  +  TNS  KP  S  CS       F G   +      K  +  +  TVVAA
Sbjct  1    MASVTQLQAVFSTNSITKPTPSSLCSNSNGRSIFFGPTLSSTATLQKKTRERKQLTVVAA  60

Query  441  vgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKD  262
            VGDVS  GT YLIAGAAAVAL+GTAFPIFFSRKD CPECDGAGFVR++G+ LRANAARKD
Sbjct  61   VGDVSSDGTVYLIAGAAAVALLGTAFPIFFSRKDLCPECDGAGFVRKSGSALRANAARKD  120

Query  261  QTQIVCARCNGLGKLNQIDK  202
            Q QIVC  CNGLGKLNQIDK
Sbjct  121  QLQIVCVTCNGLGKLNQIDK  140



>ref|XP_010262556.1| PREDICTED: uncharacterized protein LOC104601062 [Nelumbo nucifera]
Length=145

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  414  TYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARC  235
            TYLIAGA AVAL+GTAFPI FSRKD CPECDGAGFVRQAG TLRANAARKDQTQIVCARC
Sbjct  75   TYLIAGAVAVALLGTAFPILFSRKDICPECDGAGFVRQAGVTLRANAARKDQTQIVCARC  134

Query  234  NGLGKLNQIDK  202
            NGLGKL QIDK
Sbjct  135  NGLGKLGQIDK  145



>ref|XP_002309071.1| hypothetical protein POPTR_0006s08800g [Populus trichocarpa]
 gb|EEE92594.1| hypothetical protein POPTR_0006s08800g [Populus trichocarpa]
Length=137

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 93/115 (81%), Gaps = 6/115 (5%)
 Frame = -2

Query  543  ASLPC-SKFLGTPRNVVTPSPKIAKTARPFTvvaavgdvsdaGTTYLIagaaavalvgtA  367
            A++P  SKFL    N+   S K  K  R  TVVAAVGDVS  GTTYLIAGAAAVAL+GTA
Sbjct  28   AAMPAGSKFLSW--NI---SQKKNKNKRSLTVVAAVGDVSADGTTYLIAGAAAVALLGTA  82

Query  366  FPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            FPI FSRKD CPECDGAGF+R++GATLRANAARKDQ QIVC RCNGLGKLNQIDK
Sbjct  83   FPILFSRKDLCPECDGAGFIRKSGATLRANAARKDQAQIVCPRCNGLGKLNQIDK  137



>ref|XP_008442527.1| PREDICTED: uncharacterized protein LOC103486375 [Cucumis melo]
Length=135

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            TTYLIAGA AVALVGTAFPIFFSRKD CPEC+GAGFVR++G+ LRANAARKDQTQIVCAR
Sbjct  64   TTYLIAGAIAVALVGTAFPIFFSRKDLCPECEGAGFVRRSGSALRANAARKDQTQIVCAR  123

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQ+DK
Sbjct  124  CNGLGKLNQVDK  135



>ref|XP_007140510.1| hypothetical protein PHAVU_008G118700g [Phaseolus vulgaris]
 gb|ESW12504.1| hypothetical protein PHAVU_008G118700g [Phaseolus vulgaris]
Length=136

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 97/140 (69%), Gaps = 11/140 (8%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPASLPCSKFLGTPRNVVTPSPKIAKTA-------RPFTvvaa  442
            MA++  LHT M  N+  K   LP S  +   +    PSP +  TA           VV+A
Sbjct  1    MASITPLHT-MLPNAAPK---LPASVAVSNTKVSFGPSPGLPCTAIQRNKSRSSRVVVSA  56

Query  441  vgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKD  262
            VGDVS   T YL+AGA AVALVGT FPI FSRKDTCPECDGAGFVR+A  TLRANAARKD
Sbjct  57   VGDVSADSTVYLVAGAVAVALVGTGFPILFSRKDTCPECDGAGFVRKANVTLRANAARKD  116

Query  261  QTQIVCARCNGLGKLNQIDK  202
            QTQIVCARCNGLGKLNQIDK
Sbjct  117  QTQIVCARCNGLGKLNQIDK  136



>gb|EMS54426.1| hypothetical protein TRIUR3_00731 [Triticum urartu]
Length=87

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  414  TYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARC  235
            TYLIAGA AVALVGTAFPIFFSRKDTCPECDGAGFVR++G+TLRANAARKDQ QIVCA C
Sbjct  17   TYLIAGAVAVALVGTAFPIFFSRKDTCPECDGAGFVRKSGSTLRANAARKDQAQIVCANC  76

Query  234  NGLGKLNQIDK  202
            NGLGKL QIDK
Sbjct  77   NGLGKLGQIDK  87



>dbj|BAJ99506.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96455.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=130

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 89/124 (72%), Gaps = 8/124 (6%)
 Frame = -2

Query  564  TNSGKKPASLPCSKFLGTP---RNVVTPSPKIAKTARPFTvvaavgdvsdaGTTYLIaga  394
            ++S   P  LP  + +  P   R V  P  ++A T        AVGDV   G T+LIAGA
Sbjct  12   SSSAPSPGLLPARRGVPLPSTRRAVAAPGGRMAATV-----ARAVGDVGAEGNTFLIAGA  66

Query  393  aavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLN  214
             AVALVGTAFPIFFSRKDTCPECDGAGFVR++GATLRANAARKDQ QIVCA CNGLGKL 
Sbjct  67   VAVALVGTAFPIFFSRKDTCPECDGAGFVRKSGATLRANAARKDQAQIVCANCNGLGKLG  126

Query  213  QIDK  202
            QIDK
Sbjct  127  QIDK  130



>ref|XP_004514394.1| PREDICTED: uncharacterized protein LOC101510131 [Cicer arietinum]
Length=132

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T YL+AGA  VAL+GTAFPI FSRKDTCPECDGAGFVR++G TLRANAARKDQTQIVCAR
Sbjct  61   TIYLVAGAIGVALIGTAFPIIFSRKDTCPECDGAGFVRKSGVTLRANAARKDQTQIVCAR  120

Query  237  CNGLGKLNQIDK  202
            C+GLGKLNQIDK
Sbjct  121  CDGLGKLNQIDK  132



>ref|XP_008369924.1| PREDICTED: uncharacterized protein LOC103433437 [Malus domestica]
Length=126

 Score =   114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  465  RPFTvvaavgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATL  286
            +P TVVAA+GDVS  GT YLIAGAA VAL+GTAFPI FSRKD CPECDGAGFVR+ GATL
Sbjct  38   KPSTVVAAIGDVSANGTPYLIAGAAXVALLGTAFPILFSRKDLCPECDGAGFVRKGGATL  97

Query  285  RANAARKDQTQIVCARCNGLGKLNQIDK  202
            RANAARKD+ QIVCARCNGLGKLNQ+DK
Sbjct  98   RANAARKDEAQIVCARCNGLGKLNQVDK  125



>ref|XP_004302780.1| PREDICTED: uncharacterized protein LOC101305773 [Fragaria vesca 
subsp. vesca]
Length=130

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 90/133 (68%), Gaps = 4/133 (3%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPASLPCSKFLGTPRNVVTPSPKIAKTARPFTvvaavgdvsda  421
            MA+M+S    M +    K  +L  S F G+     T   K     R  TVVA VGDVS  
Sbjct  1    MASMSSSPLTMLSAETLKQPTLVGSPFAGSRSWKRTEKNK----KRALTVVAVVGDVSAD  56

Query  420  GTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCA  241
             T YLI GAA VALVGTAFPI FSRKD CPECDGAGFVR++G TLRANAARKD+ QIVCA
Sbjct  57   STPYLIGGAALVALVGTAFPILFSRKDICPECDGAGFVRKSGVTLRANAARKDEAQIVCA  116

Query  240  RCNGLGKLNQIDK  202
             C GLGKLNQIDK
Sbjct  117  NCQGLGKLNQIDK  129



>ref|XP_008801593.1| PREDICTED: uncharacterized protein LOC103715662 [Phoenix dactylifera]
Length=129

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  414  TYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARC  235
            TYLIAGA AVAL+GTAFPI FSR+D CPECDGAGF+RQ+GATLRANAARKDQ+QIVCARC
Sbjct  59   TYLIAGAVAVALLGTAFPILFSRRDICPECDGAGFIRQSGATLRANAARKDQSQIVCARC  118

Query  234  NGLGKLNQIDK  202
            NGLGKL Q DK
Sbjct  119  NGLGKLGQTDK  129



>gb|AFK49459.1| unknown [Medicago truncatula]
 gb|KEH22925.1| transmembrane protein, putative [Medicago truncatula]
Length=131

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T YL+AGA  +ALVGTAFPI FSRKDTCPECDGAGFVR+ G TLRANAARKDQTQIVCAR
Sbjct  60   TIYLVAGAIGIALVGTAFPIIFSRKDTCPECDGAGFVRKGGVTLRANAARKDQTQIVCAR  119

Query  237  CNGLGKLNQIDK  202
            C+GLGKLNQ+DK
Sbjct  120  CDGLGKLNQVDK  131



>ref|XP_006846283.1| hypothetical protein AMTR_s00012p00250250 [Amborella trichopoda]
 gb|ERN07958.1| hypothetical protein AMTR_s00012p00250250 [Amborella trichopoda]
Length=135

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -2

Query  513  TPRNVVTPSPKIAKTARPFTvvaavgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTC  334
             P  +   +PK     +P TVV AVGDVS +GT+YLIAGA AVALVGTAFPI FSRKD C
Sbjct  32   VPNRITGFAPKQRMVKKPLTVVCAVGDVSSSGTSYLIAGAVAVALVGTAFPILFSRKDLC  91

Query  333  PECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            PECDGAGF+R++GATLRANAARKDQ+QIVC RC+GLGKL QIDK
Sbjct  92   PECDGAGFIRKSGATLRANAARKDQSQIVCPRCSGLGKLGQIDK  135



>ref|XP_004137792.1| PREDICTED: uncharacterized protein LOC101209846 [Cucumis sativus]
 gb|KGN58857.1| hypothetical protein Csa_3G734100 [Cucumis sativus]
Length=135

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            TTYLIAGA AVALVGTAFPI FSRKD CPECDGAGFVR++ + LRANAARKDQTQIVCAR
Sbjct  64   TTYLIAGAIAVALVGTAFPILFSRKDLCPECDGAGFVRRSESALRANAARKDQTQIVCAR  123

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQ+DK
Sbjct  124  CNGLGKLNQVDK  135



>ref|XP_010543281.1| PREDICTED: uncharacterized protein LOC104816258 [Tarenaya hassleriana]
Length=124

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            TTYLIAGA AVAL+GTAFPI F R DTCPECDGAGFVR++G++LRANAARKDQ QIVCA 
Sbjct  53   TTYLIAGAVAVALIGTAFPIIFKRSDTCPECDGAGFVRKSGSSLRANAARKDQAQIVCAN  112

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQIDK
Sbjct  113  CNGLGKLNQIDK  124



>ref|XP_011019836.1| PREDICTED: uncharacterized protein LOC105122436 [Populus euphratica]
Length=137

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  489  SPKIAKTARPFTvvaavgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGF  310
            S K  K  R  TVVAAVGDVS  GTTYLIAGAAAVAL+GTAFPI FSRKD CPECDGAGF
Sbjct  42   SQKRNKNKRSLTVVAAVGDVSADGTTYLIAGAAAVALLGTAFPILFSRKDLCPECDGAGF  101

Query  309  VRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            +R++GA LRANAARKDQ QIVC RCNGLGKLNQIDK
Sbjct  102  IRKSGAALRANAARKDQAQIVCPRCNGLGKLNQIDK  137



>ref|XP_004173015.1| PREDICTED: uncharacterized protein LOC101228756 [Cucumis sativus]
Length=135

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            TTYLIAGA AVALVGTAFPI FSRKD CPECDGAGFVR++ + LRANAARKDQTQIVCAR
Sbjct  64   TTYLIAGAIAVALVGTAFPILFSRKDLCPECDGAGFVRRSESALRANAARKDQTQIVCAR  123

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQ+DK
Sbjct  124  CNGLGKLNQVDK  135



>ref|XP_009338592.1| PREDICTED: uncharacterized protein LOC103930917 [Pyrus x bretschneideri]
 ref|XP_009338605.1| PREDICTED: uncharacterized protein LOC103930931 [Pyrus x bretschneideri]
Length=126

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -2

Query  465  RPFTvvaavgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATL  286
            +P TVVAA+GDVS  GT YLIAGAAAVAL+GTAFPI FSRKD CPECDGAGFVR+ GATL
Sbjct  38   KPSTVVAAIGDVSANGTPYLIAGAAAVALLGTAFPILFSRKDLCPECDGAGFVRKGGATL  97

Query  285  RANAARKDQTQIVCARCNGLGKLNQIDK  202
            RANAARKD+ QIVCARCNGLGKLNQ+DK
Sbjct  98   RANAARKDEAQIVCARCNGLGKLNQVDK  125



>ref|XP_010920535.1| PREDICTED: uncharacterized protein LOC105044368 [Elaeis guineensis]
Length=129

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  414  TYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARC  235
            TYLIAGA AVAL+GTAFPI FSR+D CPECDGAGF+RQ+G TLRANAARKDQ QIVCARC
Sbjct  59   TYLIAGAVAVALLGTAFPILFSRRDICPECDGAGFIRQSGVTLRANAARKDQPQIVCARC  118

Query  234  NGLGKLNQIDK  202
            NGLGKL QIDK
Sbjct  119  NGLGKLGQIDK  129



>ref|XP_008240695.1| PREDICTED: uncharacterized protein LOC103339189 [Prunus mume]
Length=137

 Score =   111 bits (278),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T YLIAGAAAVAL+GTAFPI FSRKD CPECDGAGFVR++G TLRANAARKD+ QIVCAR
Sbjct  65   TPYLIAGAAAVALLGTAFPIIFSRKDLCPECDGAGFVRKSGVTLRANAARKDEAQIVCAR  124

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQIDK
Sbjct  125  CNGLGKLNQIDK  136



>ref|XP_007206840.1| hypothetical protein PRUPE_ppa027046mg, partial [Prunus persica]
 gb|EMJ08039.1| hypothetical protein PRUPE_ppa027046mg, partial [Prunus persica]
Length=104

 Score =   110 bits (274),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  465  RPFTvvaavgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATL  286
            R  TVVAA+GDVS  GT YLIAGAAAVAL+GTAFPI FSRKD CPECDGAGFVR++G TL
Sbjct  16   RALTVVAAIGDVSADGTPYLIAGAAAVALLGTAFPIIFSRKDLCPECDGAGFVRKSGVTL  75

Query  285  RANAARKDQTQIVCARCNGLGKLNQIDK  202
            RANAARKD+ QIVCARCNGLGKLNQIDK
Sbjct  76   RANAARKDEAQIVCARCNGLGKLNQIDK  103



>gb|KFK24599.1| hypothetical protein AALP_AA8G000200 [Arabis alpina]
Length=133

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T YLI GA AVALVGTAFPI F R DTCPECDGAGFVR+ GATLRANAARKDQ QIVCA 
Sbjct  62   TIYLIGGAIAVALVGTAFPILFKRTDTCPECDGAGFVRKQGATLRANAARKDQAQIVCAN  121

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQIDK
Sbjct  122  CNGLGKLNQIDK  133



>ref|XP_006288886.1| hypothetical protein CARUB_v10002245mg [Capsella rubella]
 gb|EOA21784.1| hypothetical protein CARUB_v10002245mg [Capsella rubella]
Length=132

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 93/133 (70%), Gaps = 2/133 (2%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPASLPCSKFLGTPRNVVTPSPKIAKTARPFTvvaavgdvsda  421
            MA   ++ T   +++     + P S     P NV+ P  K  +++    VVAAVGDVS  
Sbjct  1    MAMAPAMQTTFVSSTSFLKQARPSSSSSWGPNNVILPKNK--RSSSSSVVVAAVGDVSAD  58

Query  420  GTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCA  241
            GT YLI GA AVALVGTAFPI F R+DTCPECDGAGFVR+ GATLRANAARKD  QIVCA
Sbjct  59   GTIYLIGGAIAVALVGTAFPIIFKRQDTCPECDGAGFVRKGGATLRANAARKDLPQIVCA  118

Query  240  RCNGLGKLNQIDK  202
             CNGLGKLNQIDK
Sbjct  119  NCNGLGKLNQIDK  131



>ref|NP_001144296.1| hypothetical protein [Zea mays]
 gb|ACG39383.1| hypothetical protein [Zea mays]
 gb|AFW82880.1| hypothetical protein ZEAMMB73_998797 [Zea mays]
Length=134

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  414  TYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARC  235
            TYLIAGA AVALVGTAFPI FSRKDTCPECDGAGF+R+AGATLRANAARKD+ QIVC  C
Sbjct  64   TYLIAGAVAVALVGTAFPILFSRKDTCPECDGAGFIRKAGATLRANAARKDEAQIVCPNC  123

Query  234  NGLGKLNQIDK  202
            NGLGKL QIDK
Sbjct  124  NGLGKLGQIDK  134



>ref|XP_004960532.1| PREDICTED: uncharacterized protein LOC101776841 [Setaria italica]
Length=118

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
             TYLIAGA AVALVGTAFPI FSRKDTCPECDGAGF+R+AG+TLRANAARKDQ QIVC  
Sbjct  47   NTYLIAGAVAVALVGTAFPILFSRKDTCPECDGAGFIRKAGSTLRANAARKDQAQIVCPN  106

Query  237  CNGLGKLNQIDK  202
            CNGLGKL QIDK
Sbjct  107  CNGLGKLGQIDK  118



>ref|XP_008387784.1| PREDICTED: uncharacterized protein LOC103450243 [Malus domestica]
Length=126

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T YLIAGAAAVAL+GTAFPI FSRKD CPECDGAGFVR+ GA LRANAARKD+ QIVCAR
Sbjct  54   TPYLIAGAAAVALLGTAFPILFSRKDLCPECDGAGFVRKGGAXLRANAARKDEAQIVCAR  113

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQ+DK
Sbjct  114  CNGLGKLNQVDK  125



>ref|XP_010678087.1| PREDICTED: uncharacterized protein LOC104893654 [Beta vulgaris 
subsp. vulgaris]
Length=129

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            TTYLIAGAAAVALVGTAFPI FSRKDTCPECDGAGFVR+AG TLRANAARKDQ QIVCA 
Sbjct  58   TTYLIAGAAAVALVGTAFPILFSRKDTCPECDGAGFVRKAGKTLRANAARKDQNQIVCAN  117

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQ+DK
Sbjct  118  CNGLGKLNQVDK  129



>ref|XP_002531558.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30824.1| conserved hypothetical protein [Ricinus communis]
Length=134

 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 90/134 (67%), Gaps = 2/134 (1%)
 Frame = -2

Query  600  MAAMASLHTIMFTNSGKKPASLPCSKFLGTPRNVVTPSPKIAKTARPFTvvaavgdvsda  421
            MA +ASL T         PA L CS +L           +     R  TVVAA G+VS  
Sbjct  2    MATLASLQTSFAAKMSAVPA-LGCSLYLPARAAASWNCTQKNNKKRSLTVVAAFGEVSAD  60

Query  420  GTTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGA-TLRANAARKDQTQIVC  244
            GT YLIAGAAAVAL+GTAFPI FSRKD CPECDGAGF+R++G   LRANAARKDQ QIVC
Sbjct  61   GTNYLIAGAAAVALIGTAFPILFSRKDLCPECDGAGFIRKSGGGALRANAARKDQAQIVC  120

Query  243  ARCNGLGKLNQIDK  202
              CNGLGKLNQ+DK
Sbjct  121  PNCNGLGKLNQVDK  134



>ref|XP_002439132.1| hypothetical protein SORBIDRAFT_09g001120 [Sorghum bicolor]
 gb|EES17562.1| hypothetical protein SORBIDRAFT_09g001120 [Sorghum bicolor]
Length=136

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  414  TYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARC  235
            TYLIAGA AVALVGTAFPI FSRKDTCPECDGAGF+R+AG  LRANAARKDQ QIVC  C
Sbjct  66   TYLIAGAVAVALVGTAFPILFSRKDTCPECDGAGFIRKAGVRLRANAARKDQAQIVCPNC  125

Query  234  NGLGKLNQIDK  202
            NGLGKL QIDK
Sbjct  126  NGLGKLGQIDK  136



>ref|NP_195836.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG40386.1|AF325034_1 AT5g02160 [Arabidopsis thaliana]
 dbj|BAC43232.1| unknown protein [Arabidopsis thaliana]
 gb|AAX22275.1| At5g02160 [Arabidopsis thaliana]
 gb|AED90438.1| uncharacterized protein AT5G02160 [Arabidopsis thaliana]
Length=129

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T YLI GA AVALVGTAFPI F RKDTCPECDGAGFVR+ G TLRANAARKD  QIVCA 
Sbjct  57   TIYLIGGAIAVALVGTAFPILFKRKDTCPECDGAGFVRKGGVTLRANAARKDLPQIVCAN  116

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQIDK
Sbjct  117  CNGLGKLNQIDK  128



>emb|CDY40335.1| BnaA10g27330D [Brassica napus]
Length=131

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  366  FPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            FPI F R DTCPECDGAGFVR+ GATLRANAARKDQ QIVCA CNGLGKLNQIDK
Sbjct  77   FPILFKRTDTCPECDGAGFVRKGGATLRANAARKDQAQIVCANCNGLGKLNQIDK  131



>emb|CDY10464.1| BnaCnng03650D [Brassica napus]
Length=130

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  366  FPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            FPI F R DTCPECDGAGFVR+ GATLRANAARKDQ QIVCA CNGLGKLNQIDK
Sbjct  76   FPILFKRTDTCPECDGAGFVRKGGATLRANAARKDQAQIVCANCNGLGKLNQIDK  130



>ref|XP_002870957.1| AT5g02160 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47216.1| AT5g02160 [Arabidopsis lyrata subsp. lyrata]
Length=130

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T YLI GA AVALVGTAFPI F RKDTCPECDGAGFVR+ G TLRANAARKD  QIVCA 
Sbjct  58   TIYLIGGAIAVALVGTAFPILFKRKDTCPECDGAGFVRKGGVTLRANAARKDLPQIVCAN  117

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQIDK
Sbjct  118  CNGLGKLNQIDK  129



>gb|EPS57497.1| hypothetical protein M569_17319, partial [Genlisea aurea]
Length=84

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            TTYLIAGAAA AL+GTAFPI F+ KD CPECDGAGFVR++G+TLRANAARKD+ QIVCAR
Sbjct  13   TTYLIAGAAAAALIGTAFPIIFTNKDRCPECDGAGFVRKSGSTLRANAARKDEVQIVCAR  72

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQIDK
Sbjct  73   CNGLGKLNQIDK  84



>gb|EAY96259.1| hypothetical protein OsI_18157 [Oryza sativa Indica Group]
Length=128

 Score =   105 bits (263),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
             TYLIAGA AVALVGTAFPI FSRKDTCPECDGAGFVR+ GATLRANAARKD  QIVC  
Sbjct  57   NTYLIAGAVAVALVGTAFPILFSRKDTCPECDGAGFVRKGGATLRANAARKDLPQIVCPN  116

Query  237  CNGLGKLNQIDK  202
            CNGLGKL QIDK
Sbjct  117  CNGLGKLGQIDK  128



>ref|XP_009122802.1| PREDICTED: uncharacterized protein LOC103847473 [Brassica rapa]
Length=132

 Score =   105 bits (263),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  366  FPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            FPI F R DTCPECDGAGFVR+ GATLRANAARKDQ QIVCA CNGLGKLNQIDK
Sbjct  78   FPILFKRTDTCPECDGAGFVRKGGATLRANAARKDQAQIVCANCNGLGKLNQIDK  132



>ref|XP_010490631.1| PREDICTED: uncharacterized protein LOC104768381 [Camelina sativa]
Length=136

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = -2

Query  510  PRNVVTPSPKIAKTARPFTvvaavgdvsdaGTTYLIagaaavalvgtAFPIFFSRKDTCP  331
            P NV+ P  K + ++    VVAAVGDVS  GT YLI GA AVALVGTAFPI F R+DTCP
Sbjct  32   PNNVIFPRNKRSSSSSSSVVVAAVGDVSSDGTIYLIGGAIAVALVGTAFPILFKRQDTCP  91

Query  330  ECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            ECDGAGFVR+  ATLRANAARKD  QIVCA CNGLGKLNQIDK
Sbjct  92   ECDGAGFVRKGRATLRANAARKDLPQIVCANCNGLGKLNQIDK  134



>ref|NP_001054438.2| Os05g0110100 [Oryza sativa Japonica Group]
 gb|AAU44197.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94292.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00339.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62066.1| hypothetical protein OsJ_16850 [Oryza sativa Japonica Group]
 dbj|BAF16352.2| Os05g0110100 [Oryza sativa Japonica Group]
Length=131

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
             TYLIAGA AVALVGTAFPI FSRKDTCPECDGAGFVR+ GATLRANAARKD  QIVC  
Sbjct  60   NTYLIAGAVAVALVGTAFPILFSRKDTCPECDGAGFVRKGGATLRANAARKDLPQIVCPN  119

Query  237  CNGLGKLNQIDK  202
            CNGLGKL QIDK
Sbjct  120  CNGLGKLGQIDK  131



>ref|XP_003569101.1| PREDICTED: uncharacterized protein LOC100825298 [Brachypodium 
distachyon]
Length=125

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  414  TYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARC  235
            TYLIAGA AVALVGTAFPI FSRKDTCPECDGAGFVR+ GATLR NAARKD  QIVCA C
Sbjct  54   TYLIAGAVAVALVGTAFPILFSRKDTCPECDGAGFVRKTGATLRTNAARKDDRQIVCANC  113

Query  234  NGLGKLNQIDK  202
            NGLGKL Q DK
Sbjct  114  NGLGKLGQTDK  124



>ref|XP_010452047.1| PREDICTED: uncharacterized protein LOC104734220 [Camelina sativa]
Length=134

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T YLI GA AVALVGTAFPI F R+DTCPECDGAGFVR+  ATLRANAARKD  QIVCA 
Sbjct  61   TIYLIGGAIAVALVGTAFPILFKRQDTCPECDGAGFVRKGRATLRANAARKDLPQIVCAN  120

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQIDK
Sbjct  121  CNGLGKLNQIDK  132



>ref|XP_006398681.1| hypothetical protein EUTSA_v10014990mg [Eutrema salsugineum]
 gb|ESQ40134.1| hypothetical protein EUTSA_v10014990mg [Eutrema salsugineum]
Length=135

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  366  FPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            FPI F R DTCPECDGAGFVR+ GATLRANAARKDQ QIVC+ CNGLGKLNQIDK
Sbjct  81   FPILFKRTDTCPECDGAGFVRKQGATLRANAARKDQAQIVCSNCNGLGKLNQIDK  135



>gb|AAK73148.1|AC079022_21 unknown protein [Oryza sativa]
Length=141

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
             TYLIAGA AVALVGTAFPI FSRKDTCPECDGAGFVR+ GATLRANAARKD  QIVC  
Sbjct  64   NTYLIAGAVAVALVGTAFPILFSRKDTCPECDGAGFVRKGGATLRANAARKDLPQIVCPN  123

Query  237  CNGLGKLNQIDK  202
            CNGLGKL QID 
Sbjct  124  CNGLGKLGQIDN  135



>ref|XP_002976319.1| hypothetical protein SELMODRAFT_28797, partial [Selaginella moellendorffii]
 gb|EFJ22579.1| hypothetical protein SELMODRAFT_28797, partial [Selaginella moellendorffii]
Length=88

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T+YLIAGA  +A++GTAFPIFFSRKD CPECDGAGFVR+ G+ L ANAARKD TQIVCAR
Sbjct  19   TSYLIAGAIGIAVIGTAFPIFFSRKDLCPECDGAGFVRKTGSKLTANAARKDNTQIVCAR  78

Query  237  CNGLGKLNQI  208
            CNGLGKL +I
Sbjct  79   CNGLGKLGKI  88



>gb|KDP35663.1| hypothetical protein JCGZ_09101 [Jatropha curcas]
Length=135

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  414  TYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARC  235
            TYL AGAA VAL+GTAFPI F RKD CPECDGAGF+R+AG  LRANAARKDQ QIVC  C
Sbjct  65   TYLFAGAATVALLGTAFPILFFRKDLCPECDGAGFIRKAGGALRANAARKDQAQIVCPNC  124

Query  234  NGLGKLNQIDK  202
            NGLGKLNQIDK
Sbjct  125  NGLGKLNQIDK  135



>gb|ABK25712.1| unknown [Picea sitchensis]
Length=160

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            TTYL+AGA AVAL+GTAFPI FSRKD CPECDGAGF R+   TLRANAARKD+ QIVC R
Sbjct  89   TTYLVAGAVAVALLGTAFPILFSRKDLCPECDGAGFTRKTDRTLRANAARKDEAQIVCPR  148

Query  237  CNGLGKLNQIDK  202
            CNGLGKL Q+DK
Sbjct  149  CNGLGKLGQVDK  160



>ref|XP_010423894.1| PREDICTED: uncharacterized protein LOC104708932 [Camelina sativa]
Length=140

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  411  YLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCN  232
            YLI GA AVALVGTAFPI F R+DTCPECDGAGFVR+  ATLRANAARKD  QIVCA CN
Sbjct  69   YLIGGAIAVALVGTAFPILFKRQDTCPECDGAGFVRKGRATLRANAARKDLPQIVCANCN  128

Query  231  GLGKLNQIDK  202
            GLGKLNQIDK
Sbjct  129  GLGKLNQIDK  138



>ref|XP_002987325.1| hypothetical protein SELMODRAFT_28809, partial [Selaginella moellendorffii]
 gb|EFJ11640.1| hypothetical protein SELMODRAFT_28809, partial [Selaginella moellendorffii]
Length=87

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T+YLIAGA  +A++GTAFPIFFSRKD CPECDGAGFVR+ G+ L ANAARKD TQIVCAR
Sbjct  19   TSYLIAGAIGIAVIGTAFPIFFSRKDLCPECDGAGFVRKTGSKLTANAARKDNTQIVCAR  78

Query  237  CNGLGKLNQ  211
            CNGLGKL +
Sbjct  79   CNGLGKLGK  87



>ref|XP_001762106.1| predicted protein [Physcomitrella patens]
 gb|EDQ73210.1| predicted protein [Physcomitrella patens]
Length=98

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T YLIAGA A+ALVGTAFPIFFSRKD CPECDGAGFVR+  + L ANAARKDQ QIVC  
Sbjct  27   TNYLIAGAVAIALVGTAFPIFFSRKDLCPECDGAGFVRKTDSALNANAARKDQLQIVCKN  86

Query  237  CNGLGKLNQIDK  202
            CNGLGK+ QIDK
Sbjct  87   CNGLGKVGQIDK  98



>ref|XP_001751642.1| predicted protein [Physcomitrella patens]
 gb|EDQ83959.1| predicted protein [Physcomitrella patens]
Length=85

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
            T YL+AGA A+ALVG+AFPI FSRKD CP CDGAGFVR+ G+ L ANAARKDQ QIVC  
Sbjct  14   TNYLVAGAIAIALVGSAFPILFSRKDLCPVCDGAGFVRETGSALNANAARKDQAQIVCKN  73

Query  237  CNGLGKLNQIDK  202
            CNGLGK+ Q+DK
Sbjct  74   CNGLGKVGQVDK  85



>gb|ACD63517.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63519.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63520.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63521.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63522.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63523.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63524.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63525.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63526.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63527.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63528.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63529.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63530.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63531.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63532.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63533.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63534.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63535.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63536.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63537.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63538.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63539.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63540.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63541.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63542.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63543.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63544.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63545.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63546.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63547.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63548.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63549.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63550.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63551.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63552.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63553.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63554.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63555.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63556.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63557.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63558.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63559.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63560.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63561.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63562.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63563.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63564.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63565.1| hypothetical protein, partial [Helianthus annuus]
 gb|ACD63566.1| hypothetical protein, partial [Helianthus annuus]
Length=49

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -2

Query  348  RKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            RKDTCPECDGAGFVR++G  L ANAARKDQ QIVCA CNGLGKLNQ+DK
Sbjct  1    RKDTCPECDGAGFVRKSGGRLNANAARKDQAQIVCANCNGLGKLNQVDK  49



>ref|XP_009387534.1| PREDICTED: uncharacterized protein LOC103974427 [Musa acuminata 
subsp. malaccensis]
Length=134

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -2

Query  417  TTYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCAR  238
             TYLIAGA  VALVGTAFPI FSR+D CPECDGAGFVRQAGA LRANAARKDQ+QIVC R
Sbjct  63   NTYLIAGAIGVALVGTAFPILFSRRDICPECDGAGFVRQAGAALRANAARKDQSQIVCPR  122

Query  237  CNGLGKLNQIDK  202
            CNGLGKL QIDK
Sbjct  123  CNGLGKLGQIDK  134



>gb|ACD63567.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63568.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63569.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63570.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63571.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63572.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63574.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63577.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63579.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63580.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63581.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63582.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63583.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63584.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63585.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63586.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63587.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63588.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63589.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63590.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63591.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63592.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63593.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63594.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63595.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63596.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63597.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63598.1| hypothetical protein, partial [Helianthus petiolaris]
Length=49

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -2

Query  348  RKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            RKDTCPECDGAGFVR++   L ANAARKDQ QIVCA CNGLGKLNQ+DK
Sbjct  1    RKDTCPECDGAGFVRKSSGRLNANAARKDQAQIVCANCNGLGKLNQVDK  49



>gb|EMT20037.1| hypothetical protein F775_17601 [Aegilops tauschii]
Length=59

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -2

Query  345  KDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            K  CPECDGAGFVR++G+TLRANAARKDQ QIVCA CNGLGKL QIDK
Sbjct  12   KHRCPECDGAGFVRKSGSTLRANAARKDQAQIVCANCNGLGKLGQIDK  59



>gb|ACD63575.1| hypothetical protein, partial [Helianthus petiolaris]
Length=49

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  348  RKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            RKDTCPECDGAGFVR++   L ANAARKDQ QIVC  CNGLGKLNQ+DK
Sbjct  1    RKDTCPECDGAGFVRKSSGRLNANAARKDQAQIVCENCNGLGKLNQVDK  49



>gb|ACD63573.1| hypothetical protein, partial [Helianthus petiolaris]
Length=49

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -2

Query  348  RKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            RKDTCP+CDGAGFVR++   L ANAARKDQ QIVCA CNGLGKLNQ+DK
Sbjct  1    RKDTCPDCDGAGFVRKSSGRLNANAARKDQAQIVCANCNGLGKLNQVDK  49



>gb|ACD63578.1| hypothetical protein, partial [Helianthus petiolaris]
Length=49

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  348  RKDTCPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            RKDTCPECDGAG VR++   L ANAARKDQ QIVCA CNGLGKLNQ+DK
Sbjct  1    RKDTCPECDGAGLVRKSSGRLNANAARKDQAQIVCANCNGLGKLNQVDK  49



>ref|NP_001234311.1| uncharacterized protein LOC778362 [Solanum lycopersicum]
 dbj|BAD95796.1| hypothetical protein [Solanum lycopersicum]
Length=126

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 89/132 (67%), Gaps = 8/132 (6%)
 Frame = -2

Query  594  AMASLHTIMFTNSGKKPASLPCSKFLGTPRNVVTPSPKIAKTARPFTvvaavgdvsdaGT  415
            A +S+  + F  S KK   +P S  +GT     +P     K  R   VVAA+GDVS  GT
Sbjct  2    ASSSIACVQF--SVKKSLVIP-STIVGTK----SPVTHKNKKQRSLKVVAAIGDVSSDGT  54

Query  414  TYLIagaaavalvgtAFPIFFSRKDTCPECDGAGFVRQAGATLRANAA-RKDQTQIVCAR  238
             YLIAGAAAVALVGTAFPI FSRKD CPECDGAGFVR+ GA      A RKD+ QIVCA 
Sbjct  55   VYLIAGAAAVALVGTAFPILFSRKDLCPECDGAGFVRKGGAAALKANAARKDEVQIVCAN  114

Query  237  CNGLGKLNQIDK  202
            CNGLGKLNQ+DK
Sbjct  115  CNGLGKLNQVDK  126



>gb|ACD63601.1| hypothetical protein, partial [Bahiopsis reticulata]
 gb|ACD63602.1| hypothetical protein, partial [Bahiopsis reticulata]
Length=45

 Score = 81.6 bits (200),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -2

Query  336  CPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            CPECDGAGFVR++G  L ANAARKDQ QIVCA CNGLGKLNQ+DK
Sbjct  1    CPECDGAGFVRKSGGRLNANAARKDQAQIVCANCNGLGKLNQVDK  45



>gb|ACD63576.1| hypothetical protein, partial [Helianthus petiolaris]
 gb|ACD63599.1| hypothetical protein, partial [Bahiopsis lanata]
 gb|ACD63600.1| hypothetical protein, partial [Bahiopsis lanata]
Length=45

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -2

Query  336  CPECDGAGFVRQAGATLRANAARKDQTQIVCARCNGLGKLNQIDK  202
            CPECDGAGFVR++   L ANAARKDQ QIVCA CNGLGKLNQ+DK
Sbjct  1    CPECDGAGFVRKSSGRLNANAARKDQAQIVCANCNGLGKLNQVDK  45



>gb|ACD63518.1| hypothetical protein, partial [Helianthus annuus]
Length=29

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  348  RKDTCPECDGAGFVRQAGATLRANAARKD  262
            RKDTCPECDGAGFVR++G  L ANAARKD
Sbjct  1    RKDTCPECDGAGFVRKSGGRLNANAARKD  29



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1175877007191