BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20035_g1_i1 len=1304 path=[5118:0-26 5315:27-27 5146:28-56
3315:57-1303]

Length=1304
                                                                      Score     E

ref|XP_004236393.1|  PREDICTED: uncharacterized protein At1g51745...    311   2e-94   
ref|XP_006343014.1|  PREDICTED: uncharacterized protein At1g51745...    301   6e-91   
ref|XP_009614718.1|  PREDICTED: uncharacterized protein At1g51745...    294   9e-88   
ref|XP_009614713.1|  PREDICTED: uncharacterized protein At1g51745...    293   2e-87   
ref|XP_009782512.1|  PREDICTED: uncharacterized protein At1g51745       291   5e-87   
ref|XP_011080298.1|  PREDICTED: uncharacterized protein At1g51745       237   1e-66   
emb|CDO97945.1|  unnamed protein product                                223   3e-61   
ref|XP_011072468.1|  PREDICTED: uncharacterized protein At1g51745       207   6e-56   
ref|XP_010654562.1|  PREDICTED: uncharacterized protein At1g51745...    165   5e-41   
ref|XP_008228332.1|  PREDICTED: uncharacterized protein At1g51745...    164   6e-41   
ref|XP_008228331.1|  PREDICTED: uncharacterized protein At1g51745...    164   8e-41   
ref|XP_007217004.1|  hypothetical protein PRUPE_ppa002212mg             162   2e-40   
gb|EYU45844.1|  hypothetical protein MIMGU_mgv1a004135mg                162   2e-40   
emb|CAN84040.1|  hypothetical protein VITISV_024170                     161   1e-39   Vitis vinifera
ref|XP_007135591.1|  hypothetical protein PHAVU_010G142200g             160   3e-39   
ref|XP_008380820.1|  PREDICTED: uncharacterized protein At1g51745...    157   2e-38   
ref|XP_008380818.1|  PREDICTED: uncharacterized protein At1g51745...    157   2e-38   
ref|XP_002515884.1|  conserved hypothetical protein                     154   4e-37   Ricinus communis
gb|KDP40807.1|  hypothetical protein JCGZ_24806                         154   5e-37   
ref|XP_009367515.1|  PREDICTED: uncharacterized protein At1g51745...    152   1e-36   
gb|KHN11311.1|  Hypothetical protein glysoja_023375                     153   1e-36   
ref|XP_010062582.1|  PREDICTED: uncharacterized protein At1g51745       152   1e-36   
ref|XP_009367513.1|  PREDICTED: uncharacterized protein At1g51745...    152   1e-36   
ref|XP_010088115.1|  hypothetical protein L484_001821                   151   4e-36   
gb|KHG23152.1|  hypothetical protein F383_01193                         150   1e-35   
gb|KEH18280.1|  tudor/PWWP/MBT superfamily protein                      149   3e-35   
ref|XP_011013035.1|  PREDICTED: uncharacterized protein At1g51745...    147   9e-35   
ref|XP_011013034.1|  PREDICTED: uncharacterized protein At1g51745...    146   1e-34   
ref|XP_006369225.1|  hypothetical protein POPTR_0001s19480g             145   2e-34   
gb|EYU21406.1|  hypothetical protein MIMGU_mgv1a002564mg                144   4e-34   
ref|XP_006369226.1|  hypothetical protein POPTR_0001s19480g             144   5e-34   
ref|XP_003529739.1|  PREDICTED: uncharacterized protein At1g51745...    145   6e-34   
gb|KHN39281.1|  Hypothetical protein glysoja_018053                     144   7e-34   
ref|XP_004510340.1|  PREDICTED: uncharacterized protein At1g51745...    144   1e-33   
ref|XP_011011986.1|  PREDICTED: uncharacterized protein At1g51745...    144   2e-33   
ref|XP_011015418.1|  PREDICTED: uncharacterized protein At1g51745...    143   2e-33   
ref|XP_006426470.1|  hypothetical protein CICLE_v10027499mg             142   5e-33   
ref|XP_004297615.1|  PREDICTED: uncharacterized protein At1g51745...    140   1e-32   
ref|XP_008462373.1|  PREDICTED: uncharacterized protein At1g51745...    139   5e-32   
ref|XP_007024422.1|  Tudor/PWWP/MBT superfamily protein, putative...    139   6e-32   
gb|KDO58662.1|  hypothetical protein CISIN_1g004313mg                   138   1e-31   
ref|XP_006466093.1|  PREDICTED: uncharacterized protein At1g51745...    138   1e-31   
gb|KDO58660.1|  hypothetical protein CISIN_1g004313mg                   138   1e-31   
ref|XP_006466092.1|  PREDICTED: uncharacterized protein At1g51745...    138   1e-31   
gb|KGN45541.1|  hypothetical protein Csa_7G451960                       138   1e-31   
gb|KDO58661.1|  hypothetical protein CISIN_1g004313mg                   137   2e-31   
ref|XP_006466095.1|  PREDICTED: uncharacterized protein At1g51745...    137   2e-31   
ref|XP_006466094.1|  PREDICTED: uncharacterized protein At1g51745...    137   2e-31   
ref|XP_010690078.1|  PREDICTED: uncharacterized protein At1g51745       129   6e-29   
gb|KHG19697.1|  hypothetical protein F383_24275                         128   3e-28   
ref|XP_002304109.2|  hypothetical protein POPTR_0003s03970g             121   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_004154875.1|  PREDICTED: uncharacterized protein At1g51745...    120   8e-26   
gb|KGN59837.1|  hypothetical protein Csa_3G849930                       118   4e-25   
ref|XP_004146857.1|  PREDICTED: uncharacterized protein At1g51745...    118   5e-25   
ref|XP_008447587.1|  PREDICTED: uncharacterized protein At1g51745...    114   5e-24   
ref|XP_010267045.1|  PREDICTED: uncharacterized protein At1g51745...    114   6e-24   
ref|XP_004155975.1|  PREDICTED: uncharacterized protein At1g51745...    110   9e-23   
ref|XP_004141802.1|  PREDICTED: uncharacterized protein At1g51745...    110   1e-22   
gb|KHG25774.1|  hypothetical protein F383_10403                         106   3e-21   
ref|XP_010545639.1|  PREDICTED: uncharacterized protein At1g51745...    103   2e-20   
ref|XP_010924938.1|  PREDICTED: uncharacterized protein At1g51745...    102   5e-20   
ref|XP_010911968.1|  PREDICTED: uncharacterized protein At1g51745...    102   7e-20   
ref|XP_007043473.1|  Tudor/PWWP/MBT superfamily protein               97.8    1e-19   
ref|XP_008809885.1|  PREDICTED: uncharacterized protein At1g51745...    100   3e-19   
ref|XP_006406288.1|  hypothetical protein EUTSA_v10020246mg           97.8    2e-18   
ref|XP_010535212.1|  PREDICTED: uncharacterized protein At1g51745     97.4    2e-18   
ref|NP_001078195.1|  uncharacterized protein                          96.7    4e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EPS60051.1|  hypothetical protein M569_14754                       95.5    8e-18   
ref|XP_010510070.1|  PREDICTED: uncharacterized protein At1g51745     95.9    8e-18   
ref|XP_008797875.1|  PREDICTED: uncharacterized protein At1g51745...  92.8    1e-16   
ref|XP_009410801.1|  PREDICTED: uncharacterized protein At1g51745...  92.4    1e-16   
ref|XP_006297135.1|  hypothetical protein CARUB_v10013137mg           91.7    2e-16   
ref|XP_006392999.1|  hypothetical protein EUTSA_v10011307mg           90.9    3e-16   
ref|XP_010500760.1|  PREDICTED: uncharacterized protein At1g51745...  90.1    5e-16   
ref|XP_010500759.1|  PREDICTED: uncharacterized protein At1g51745...  90.1    5e-16   
ref|XP_006304889.1|  hypothetical protein CARUB_v10012660mg           90.1    5e-16   
ref|XP_009145492.1|  PREDICTED: uncharacterized protein At1g51745     89.4    9e-16   
emb|CDY51454.1|  BnaA05g36710D                                        89.4    1e-15   
emb|CDY56919.1|  BnaCnng31400D                                        87.8    4e-15   
emb|CBI35984.3|  unnamed protein product                              84.0    6e-15   
gb|KFK39439.1|  hypothetical protein AALP_AA3G245000                  86.7    8e-15   
ref|XP_010479675.1|  PREDICTED: uncharacterized protein At1g51745...  85.9    1e-14   
ref|XP_010479677.1|  PREDICTED: uncharacterized protein At1g51745...  85.9    1e-14   
ref|XP_010462016.1|  PREDICTED: uncharacterized protein At1g51745...  84.7    3e-14   
ref|XP_010462014.1|  PREDICTED: uncharacterized protein At1g51745...  84.7    3e-14   
dbj|BAJ91774.1|  predicted protein                                    84.0    7e-14   
ref|XP_010488139.1|  PREDICTED: uncharacterized protein At1g51745...  83.6    8e-14   
pir||D96556  hypothetical protein F19C24.5 [imported] - Arabidops...  82.8    2e-13
gb|AFW83010.1|  hypothetical protein ZEAMMB73_581703                  82.4    2e-13   
ref|XP_008657775.1|  PREDICTED: uncharacterized protein At1g51745...  82.0    3e-13   
ref|XP_009144882.1|  PREDICTED: uncharacterized protein At1g51745     78.2    3e-12   
dbj|BAB01723.1|  unnamed protein product                              77.8    7e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EEE54805.1|  hypothetical protein OsJ_02221                        77.4    9e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EMT19851.1|  hypothetical protein F775_09638                       77.4    9e-12   
ref|NP_001043335.1|  Os01g0558500                                     77.4    9e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002455796.1|  hypothetical protein SORBIDRAFT_03g025340        77.0    1e-11   Sorghum bicolor [broomcorn]
emb|CDY33863.1|  BnaC06g04900D                                        77.4    1e-11   
ref|XP_006646000.1|  PREDICTED: uncharacterized protein At1g51745...  76.6    1e-11   
emb|CDY43925.1|  BnaA05g15350D                                        74.7    5e-11   
emb|CDM83021.1|  unnamed protein product                              74.3    8e-11   
ref|XP_003569211.1|  PREDICTED: uncharacterized protein LOC100833692  74.3    9e-11   
ref|XP_009147732.1|  PREDICTED: uncharacterized protein At1g51745...  73.6    1e-10   
emb|CDY22868.1|  BnaA06g02090D                                        73.6    2e-10   
ref|XP_006853959.1|  hypothetical protein AMTR_s00036p00215850        73.2    2e-10   
ref|XP_009395771.1|  PREDICTED: uncharacterized protein At1g51745...  66.6    3e-08   
ref|XP_006854154.1|  hypothetical protein AMTR_s00048p00187700        66.2    3e-08   
ref|XP_004235289.1|  PREDICTED: uncharacterized protein At1g51745     66.2    3e-08   
ref|XP_003565804.1|  PREDICTED: uncharacterized protein LOC100844359  65.1    6e-08   
ref|XP_006347560.1|  PREDICTED: uncharacterized protein At1g51745...  63.2    3e-07   
tpg|DAA59003.1|  TPA: hypothetical protein ZEAMMB73_224631            62.8    4e-07   
ref|XP_008676390.1|  PREDICTED: uncharacterized protein At1g51745     62.8    4e-07   
emb|CBI26559.3|  unnamed protein product                              62.0    5e-07   
ref|XP_009402955.1|  PREDICTED: uncharacterized protein At1g51745...  61.6    8e-07   
ref|XP_009402956.1|  PREDICTED: uncharacterized protein At1g51745...  61.6    9e-07   
ref|XP_008234588.1|  PREDICTED: uncharacterized protein At1g51745...  61.6    9e-07   
ref|XP_008234587.1|  PREDICTED: uncharacterized protein At1g51745...  61.2    1e-06   
ref|XP_008811047.1|  PREDICTED: uncharacterized protein LOC103722315  58.2    1e-06   
ref|XP_008234589.1|  PREDICTED: uncharacterized protein LOC103333...  60.8    1e-06   
gb|KHN46442.1|  Hypothetical protein glysoja_035118                   60.8    2e-06   
ref|XP_006592019.1|  PREDICTED: uncharacterized protein At1g51745...  60.8    2e-06   
emb|CDP04947.1|  unnamed protein product                              60.5    2e-06   
ref|XP_008800030.1|  PREDICTED: uncharacterized protein At1g51745...  60.5    2e-06   
ref|XP_009402985.1|  PREDICTED: uncharacterized protein At1g51745...  60.1    3e-06   
gb|KHN05521.1|  Hypothetical protein glysoja_020486                   60.1    3e-06   
ref|XP_009402986.1|  PREDICTED: uncharacterized protein At1g51745...  60.1    3e-06   
ref|XP_006590768.1|  PREDICTED: uncharacterized protein At1g51745...  60.1    3e-06   
ref|XP_004953538.1|  PREDICTED: uncharacterized protein At1g51745...  59.7    3e-06   
ref|XP_010943463.1|  PREDICTED: uncharacterized protein At1g51745     59.7    4e-06   
ref|XP_008785043.1|  PREDICTED: uncharacterized protein At1g51745     59.3    5e-06   
ref|XP_004137270.1|  PREDICTED: uncharacterized protein LOC101221045  59.3    5e-06   
gb|KGN53739.1|  hypothetical protein Csa_4G114200                     58.9    5e-06   
ref|XP_010278764.1|  PREDICTED: uncharacterized protein At1g51745     59.3    5e-06   
ref|XP_007220250.1|  hypothetical protein PRUPE_ppa001649mg           58.9    5e-06   
ref|XP_004968966.1|  PREDICTED: uncharacterized protein At1g51745...  58.9    6e-06   
ref|XP_010227249.1|  PREDICTED: uncharacterized protein At1g51745...  58.9    6e-06   
ref|XP_008451676.1|  PREDICTED: uncharacterized protein At1g51745...  58.5    7e-06   
ref|XP_004171220.1|  PREDICTED: uncharacterized protein LOC101227164  58.5    7e-06   
ref|XP_004307887.1|  PREDICTED: uncharacterized protein LOC101303560  58.5    7e-06   
ref|XP_008451680.1|  PREDICTED: uncharacterized protein At1g51745...  58.5    7e-06   
ref|XP_010549813.1|  PREDICTED: uncharacterized protein At1g51745...  58.2    9e-06   
gb|EAY87184.1|  hypothetical protein OsI_08586                        58.2    1e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001047836.1|  Os02g0700000                                     58.2    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010549814.1|  PREDICTED: uncharacterized protein LOC104820...  58.2    1e-05   
ref|XP_008451679.1|  PREDICTED: uncharacterized protein At1g51745...  58.2    1e-05   
ref|XP_011075809.1|  PREDICTED: uncharacterized protein LOC105160226  58.2    1e-05   
ref|XP_008451678.1|  PREDICTED: uncharacterized protein At1g51745...  58.2    1e-05   
gb|EEC77915.1|  hypothetical protein OsI_17245                        57.8    1e-05   Oryza sativa Indica Group [Indian rice]
emb|CAE03465.2|  OSJNBa0083N12.2                                      57.8    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002274927.1|  PREDICTED: uncharacterized protein At1g51745...  57.8    2e-05   Vitis vinifera
emb|CAI44650.1|  OSJNba0093F12.23                                     57.8    2e-05   Oryza sativa [red rice]
ref|NP_001031172.1|  Tudor/PWWP/MBT superfamily protein               57.0    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010662138.1|  PREDICTED: uncharacterized protein LOC100254...  57.4    2e-05   
ref|XP_009776963.1|  PREDICTED: uncharacterized protein LOC104226632  57.0    2e-05   
gb|AFW72945.1|  hypothetical protein ZEAMMB73_974607                  57.0    2e-05   
emb|CDY48880.1|  BnaA03g36190D                                        53.9    2e-05   
emb|CAN77845.1|  hypothetical protein VITISV_020829                   57.4    2e-05   Vitis vinifera
sp|P59278.2|Y1745_ARATH  RecName: Full=Uncharacterized protein At...  57.0    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAO22798.1|  unknown protein                                       57.0    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564598.2|  Tudor/PWWP/MBT superfamily protein                  57.0    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010918108.1|  PREDICTED: uncharacterized protein LOC105042543  57.0    2e-05   
ref|XP_009783633.1|  PREDICTED: uncharacterized protein At1g51745...  57.0    2e-05   
ref|XP_008646117.1|  PREDICTED: uncharacterized protein At1g51745...  57.0    2e-05   
ref|XP_008646118.1|  PREDICTED: uncharacterized protein At1g51745...  57.0    3e-05   
ref|XP_006647738.1|  PREDICTED: uncharacterized protein LOC102704308  57.0    3e-05   
ref|XP_003570168.1|  PREDICTED: uncharacterized protein LOC100840926  57.0    3e-05   
gb|EYU45368.1|  hypothetical protein MIMGU_mgv1a018253mg              56.6    3e-05   
ref|XP_010243122.1|  PREDICTED: uncharacterized protein At1g51745...  56.2    4e-05   
ref|XP_002452698.1|  hypothetical protein SORBIDRAFT_04g030860        56.2    4e-05   Sorghum bicolor [broomcorn]
ref|XP_003607394.1|  hypothetical protein MTR_4g077550                55.8    5e-05   
gb|AES89591.2|  tudor/PWWP/MBT superfamily protein                    55.8    5e-05   
ref|XP_008376887.1|  PREDICTED: uncharacterized protein At1g51745...  55.5    7e-05   
ref|XP_002891656.1|  hypothetical protein ARALYDRAFT_474292           55.5    7e-05   
ref|XP_008376888.1|  PREDICTED: uncharacterized protein LOC103439...  55.5    7e-05   
ref|XP_004505617.1|  PREDICTED: uncharacterized protein At1g51745...  55.5    7e-05   
ref|XP_002520007.1|  conserved hypothetical protein                   55.5    8e-05   Ricinus communis
ref|XP_009119103.1|  PREDICTED: uncharacterized protein At1g51745...  55.5    8e-05   
ref|XP_009626996.1|  PREDICTED: uncharacterized protein At1g51745     54.7    1e-04   
ref|XP_002325377.2|  hypothetical protein POPTR_0019s07270g           54.7    1e-04   Populus trichocarpa [western balsam poplar]
emb|CDY23461.1|  BnaC04g49890D                                        54.7    1e-04   
ref|XP_009351866.1|  PREDICTED: uncharacterized protein At1g51745...  54.7    1e-04   
ref|XP_009351865.1|  PREDICTED: uncharacterized protein At1g51745...  54.7    1e-04   
ref|XP_010087499.1|  hypothetical protein L484_019705                 54.7    1e-04   
ref|XP_006590455.1|  PREDICTED: uncharacterized protein At1g51745...  54.3    1e-04   
ref|XP_006590454.1|  PREDICTED: uncharacterized protein At1g51745...  54.3    1e-04   
gb|KHN35122.1|  Hypothetical protein glysoja_004888                   54.3    2e-04   
ref|XP_009361204.1|  PREDICTED: uncharacterized protein At1g51745...  54.3    2e-04   
gb|EMS66663.1|  hypothetical protein TRIUR3_34844                     54.3    2e-04   
ref|NP_186964.1|  PWWP domain-containing protein                      53.9    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EMT25308.1|  hypothetical protein F775_01904                       53.9    2e-04   
ref|XP_010671152.1|  PREDICTED: uncharacterized protein LOC104888033  53.9    2e-04   
ref|XP_010506908.1|  PREDICTED: uncharacterized protein At1g51745     53.9    2e-04   
ref|XP_007131537.1|  hypothetical protein PHAVU_011G021400g           53.5    3e-04   
ref|XP_006652748.1|  PREDICTED: uncharacterized protein At1g51745...  53.5    3e-04   
ref|XP_010463763.1|  PREDICTED: uncharacterized protein At1g51745...  53.5    3e-04   
emb|CDY49929.1|  BnaCnng18390D                                        53.5    3e-04   
ref|XP_010485649.1|  PREDICTED: uncharacterized protein At1g51745...  53.5    3e-04   
gb|KDP21792.1|  hypothetical protein JCGZ_00579                       53.5    3e-04   
gb|AFW63510.1|  hypothetical protein ZEAMMB73_379388                  53.1    3e-04   
ref|XP_006352937.1|  PREDICTED: uncharacterized protein At1g51745...  52.8    4e-04   
ref|XP_008678998.1|  PREDICTED: uncharacterized protein At1g51745...  53.1    4e-04   
ref|XP_002319249.2|  hypothetical protein POPTR_0013s08000g           53.1    4e-04   Populus trichocarpa [western balsam poplar]
dbj|BAF01144.1|  hypothetical protein                                 53.1    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004245942.1|  PREDICTED: uncharacterized protein LOC101257099  52.8    4e-04   
ref|XP_011010169.1|  PREDICTED: uncharacterized protein At1g51745...  53.1    4e-04   
emb|CDP11755.1|  unnamed protein product                              52.8    5e-04   
gb|KHG23776.1|  hypothetical protein F383_28480                       52.0    9e-04   



>ref|XP_004236393.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum lycopersicum]
 ref|XP_010318513.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum lycopersicum]
Length=703

 Score =   311 bits (796),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 225/332 (68%), Gaps = 38/332 (11%)
 Frame = +3

Query  63   SPIVPCASQKGEFSAGAPSSESGQVETMSCGSGEHNESGCTNLGNADI-LDSGPRMGKET  239
            SPIV C SQK + + GA SS+  QVE MS GS E N+SG T+ G+ D    S  RM K T
Sbjct  372  SPIVSCTSQKAQGAVGAQSSQGSQVEAMSFGSEELNDSGSTSSGSEDFHCFSQQRMVKGT  431

Query  240  SKWQSKGKRNFR-----TGNF-----------ID----WSRNSPHKESQMKGPTADLPIP  359
            SKWQ KGKRN R       N+           +D    WSRN   +E+QMKGPTADL  P
Sbjct  432  SKWQLKGKRNSRHTCRKVDNYPLKSRPVTEIQVDELRGWSRNVSLREAQMKGPTADLLTP  491

Query  360  RRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLN  539
            +R LPYR SRF VNPKYES DFSLRHH  ADSSL DV +EVK+ YR +H+PYISLMSKLN
Sbjct  492  QRLLPYRQSRFTVNPKYESSDFSLRHHT-ADSSLYDVNLEVKASYRPQHVPYISLMSKLN  550

Query  540  GQPITGHRLAVEVLDDGFCDQLLVSA----SNCHDLDDD-----SAPKGVDMVNKTKLSF  692
            GQPI GH L VEVLDDGFCD LL+S     S+ +DLD+D     S     ++V ++K S 
Sbjct  551  GQPIIGHPLTVEVLDDGFCDNLLLSGSEHYSSSYDLDEDHGENSSVLHSANIVYESKPSS  610

Query  693  GGR-------LQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPT  851
             GR       L+PR+S  KS K++K  +LSKK+R+LSSLTG  +QNREK P V++L+GP 
Sbjct  611  AGRISTKHRMLKPRSSPAKSPKTRKNGLLSKKIRKLSSLTGSHQQNREKKPVVEKLKGPA  670

Query  852  IACVPLKVVFSRIKAALNSSIRPAHRLIAPSI  947
            +ACVPLK+VFSRI  ALN+SIRPAHR + PSI
Sbjct  671  VACVPLKIVFSRISEALNNSIRPAHRSLVPSI  702



>ref|XP_006343014.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum tuberosum]
Length=700

 Score =   301 bits (771),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 190/357 (53%), Positives = 235/357 (66%), Gaps = 43/357 (12%)
 Frame = +3

Query  3    SVSG--RSGTPVKLLGL----KDTCSSPIVPCASQKGEFSAGAPSSESGQVETMSCGSGE  164
            S+SG   SG+  +L  +    ++  S+ + P  SQK +   GA SS+S QVE MS GS E
Sbjct  344  SISGLPESGSSDRLFDVPLVAEEKQSAGLSPIVSQKAQGGVGAQSSQSSQVEAMSFGSEE  403

Query  165  HNESGCTNLGNADILDSGPRMGKETSKWQSKGKRNFR-----TGNF-----------ID-  293
             N+SG T+ G+ D       M K TSKWQ KGKRN R       N+           +D 
Sbjct  404  LNDSGSTSSGSEDFHCFSQGMVKGTSKWQLKGKRNLRHTCRKVDNYRSKSRPVTEIQVDE  463

Query  294  ---WSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLT  464
               WSRN   +E+QMKGPTADL  P+R LPYR SRF VNPKYES DFSLRHH IADSSL 
Sbjct  464  LRGWSRNVSLREAQMKGPTADLLTPQRLLPYRQSRFTVNPKYESSDFSLRHH-IADSSLY  522

Query  465  DVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLV----SASNCHD  632
            DV +EVK+ YR +H+PYISLMSKLNGQPI GH L VEVLDDGFCD LLV      S+ +D
Sbjct  523  DVNLEVKASYRPQHVPYISLMSKLNGQPIIGHPLTVEVLDDGFCDNLLVSGSEYYSSSYD  582

Query  633  LDDD-----SAPKGVDMVNKTKLSFGGR-------LQPRAsstksskskkesmlskkVRR  776
            LD+D     S     D+V ++K S  GR       ++PR+S TKS K++K  +LSKK+R+
Sbjct  583  LDEDHGENSSVLHSADIVYESKPSSAGRTSTKHRMVKPRSSPTKSPKTRKNGLLSKKIRK  642

Query  777  LSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPSI  947
            LSSLTG  +QNREK P V++++GP +ACVPLK+VFSRI  ALN+SIRPAHR + PSI
Sbjct  643  LSSLTGSHQQNREKKPVVEKVKGPAVACVPLKIVFSRISEALNNSIRPAHRSLVPSI  699



>ref|XP_009614718.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Nicotiana tomentosiformis]
Length=726

 Score =   294 bits (752),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 186/351 (53%), Positives = 223/351 (64%), Gaps = 57/351 (16%)
 Frame = +3

Query  63   SPIVPCASQKGEFSAGAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKETS  242
            SPI+ C SQK +   GA SS+  QVE +S GS E ++S  T+ G+ D      RM K TS
Sbjct  376  SPIMSCTSQKAQGGVGAQSSQGSQVEAISFGSEELDDSDSTSSGSDDFQCFSQRMEKGTS  435

Query  243  KWQSKGKRNFR------------------------------------TGNFID----WSR  302
            KWQ KGKRN R                                    T + +D    WSR
Sbjct  436  KWQLKGKRNSRQTSRKAGCYNTGGSHASESLTYSLKSRPATTMPQSQTRSIVDELRGWSR  495

Query  303  NSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEV  482
            N   +E+ MKGPTA+L  P+R LPYR SR+ VNPKYES DFSLRHH IADSSL DV +EV
Sbjct  496  NVSLREACMKGPTAELLAPQRLLPYRQSRYTVNPKYESSDFSLRHH-IADSSLYDVNLEV  554

Query  483  KSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNC----HDLDDD--  644
            K+ YR +H+PYISLMSKLNGQPI GH L VEVLDDGFCD LLVS S C    +DLD+D  
Sbjct  555  KASYRPQHVPYISLMSKLNGQPIIGHPLTVEVLDDGFCDNLLVSGSECYSSSYDLDEDHS  614

Query  645  ---SAPKGVDMVNKTKLSFGGRL-------QPRAsstksskskkesmlskkVRRLSSLTG  794
               SA +G DM  ++K S   R+       QPR S TKS K++K  +LSKK+R+LSSLTG
Sbjct  615  ENISALQGADMDYESKPSLAARMSTRHRMVQPRDSPTKSPKTRKNGLLSKKIRKLSSLTG  674

Query  795  PRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPSI  947
              +QN+EK P V++LRGP +ACVPLK+VFSRI  ALNSS+RPAHR I PSI
Sbjct  675  SHQQNKEKKPVVEKLRGPAVACVPLKIVFSRINEALNSSVRPAHRSIIPSI  725



>ref|XP_009614713.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009614714.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009614715.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009614716.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
Length=741

 Score =   293 bits (751),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 186/351 (53%), Positives = 223/351 (64%), Gaps = 57/351 (16%)
 Frame = +3

Query  63   SPIVPCASQKGEFSAGAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKETS  242
            SPI+ C SQK +   GA SS+  QVE +S GS E ++S  T+ G+ D      RM K TS
Sbjct  391  SPIMSCTSQKAQGGVGAQSSQGSQVEAISFGSEELDDSDSTSSGSDDFQCFSQRMEKGTS  450

Query  243  KWQSKGKRNFR------------------------------------TGNFID----WSR  302
            KWQ KGKRN R                                    T + +D    WSR
Sbjct  451  KWQLKGKRNSRQTSRKAGCYNTGGSHASESLTYSLKSRPATTMPQSQTRSIVDELRGWSR  510

Query  303  NSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEV  482
            N   +E+ MKGPTA+L  P+R LPYR SR+ VNPKYES DFSLRHH IADSSL DV +EV
Sbjct  511  NVSLREACMKGPTAELLAPQRLLPYRQSRYTVNPKYESSDFSLRHH-IADSSLYDVNLEV  569

Query  483  KSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNC----HDLDDD--  644
            K+ YR +H+PYISLMSKLNGQPI GH L VEVLDDGFCD LLVS S C    +DLD+D  
Sbjct  570  KASYRPQHVPYISLMSKLNGQPIIGHPLTVEVLDDGFCDNLLVSGSECYSSSYDLDEDHS  629

Query  645  ---SAPKGVDMVNKTKLSFGGRL-------QPRAsstksskskkesmlskkVRRLSSLTG  794
               SA +G DM  ++K S   R+       QPR S TKS K++K  +LSKK+R+LSSLTG
Sbjct  630  ENISALQGADMDYESKPSLAARMSTRHRMVQPRDSPTKSPKTRKNGLLSKKIRKLSSLTG  689

Query  795  PRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPSI  947
              +QN+EK P V++LRGP +ACVPLK+VFSRI  ALNSS+RPAHR I PSI
Sbjct  690  SHQQNKEKKPVVEKLRGPAVACVPLKIVFSRINEALNSSVRPAHRSIIPSI  740



>ref|XP_009782512.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
 ref|XP_009782513.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
 ref|XP_009782514.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
 ref|XP_009782515.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
Length=726

 Score =   291 bits (746),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 222/351 (63%), Gaps = 57/351 (16%)
 Frame = +3

Query  63   SPIVPCASQKGEFSAGAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKETS  242
            SPI+ C SQK +   GA  S+  QVE MS GS E ++S  T+ G+ D      RM K TS
Sbjct  376  SPIMSCTSQKAKGGVGAQPSQGSQVEAMSFGSEELDDSDSTSSGSDDFQCFSQRMEKGTS  435

Query  243  KWQSKGKRNFR------------------------------------TGNFID----WSR  302
            KWQ KGKRN R                                    T + +D    W R
Sbjct  436  KWQLKGKRNSRQTSRKVGCYNTGGSHASESLTYRLKSKSATTTPQSETRSIVDELRGWGR  495

Query  303  NSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEV  482
            N   +E++MKGPTA+L  P+R LPYR SR+ VNPKYES DFSLRHH IADSSL DV +EV
Sbjct  496  NVSLREARMKGPTAELLAPQRLLPYRQSRYTVNPKYESSDFSLRHH-IADSSLYDVNLEV  554

Query  483  KSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNC----HDLDDD--  644
            K+ YR +H+PYISLMSKLNGQPI GH L VEVLDDGFCD LLVS S C    +DLD+D  
Sbjct  555  KASYRPQHVPYISLMSKLNGQPIIGHPLTVEVLDDGFCDNLLVSGSECYSSSYDLDEDHS  614

Query  645  ---SAPKGVDMVNKTKLSFGGRL-------QPRAsstksskskkesmlskkVRRLSSLTG  794
               SA +G DM  ++K S   R+       QPR S TKS K++K  +LSKK+R+LSSLTG
Sbjct  615  ENNSALQGADMDYESKPSLAARISTRHHMVQPRGSPTKSPKTRKNGLLSKKIRKLSSLTG  674

Query  795  PRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPSI  947
              +QN+EK P V++L+GP +ACVPLK+VFSRI  ALNSS+RPAHR I PSI
Sbjct  675  SHQQNKEKKPVVEKLKGPAVACVPLKIVFSRINEALNSSVRPAHRSIIPSI  725



>ref|XP_011080298.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
 ref|XP_011080306.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
Length=709

 Score =   237 bits (605),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 155/337 (46%), Positives = 198/337 (59%), Gaps = 46/337 (14%)
 Frame = +3

Query  69   IVPCASQKGEFSAGAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKETSKW  248
            +VP ASQ+G   A A SS+S  VET+S G+ EHNESG T    A+I     R+ K T++W
Sbjct  372  VVPDASQRGTAGARAQSSQSSHVETISPGNEEHNESGSTGSATANIHHISQRIEKSTTEW  431

Query  249  QSKGKRNFRT-----------------------------------------GNFIDWSRN  305
            Q KGKRN R+                                           F  WS N
Sbjct  432  QLKGKRNSRSRKVDVDDDAETYVASNDVNRSLVSDGGGHHVKSRPITETQVEEFRGWSWN  491

Query  306  SPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVK  485
            +P KES+ +GPT +L +P+R LPYR SRF VNPKY+S DFSLRHH IA S+L DV V+VK
Sbjct  492  APPKESRGRGPTPELLVPQRLLPYRQSRFTVNPKYDSSDFSLRHH-IAGSALYDVTVKVK  550

Query  486  SCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSA---SNCHDLDDDSAPK  656
            S Y+ + +PYISL+SKLNGQPI GH + VE LDDGFC+ L V +   S+  +LDD+    
Sbjct  551  SSYQPQRVPYISLVSKLNGQPIIGHPITVEALDDGFCNNLFVVSECRSSSSELDDEKHVG  610

Query  657  GVDMVNKTKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTV-Q  833
             V      +          +   K  +SK+ S+LSKK+R+LSSLTG  + +RE+   V  
Sbjct  611  TVYQQRPHRRPHSKHRSAYSLPAKPPRSKRNSILSKKIRKLSSLTGSHRLSREEKKRVPD  670

Query  834  QLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            +L+GP+IACVPL VVFSRI AAL SS+R   RLIA S
Sbjct  671  KLKGPSIACVPLNVVFSRINAALTSSVRYPPRLIATS  707



>emb|CDO97945.1| unnamed protein product [Coffea canephora]
Length=739

 Score =   223 bits (567),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 141/283 (50%), Positives = 187/283 (66%), Gaps = 28/283 (10%)
 Frame = +3

Query  138  ETMSCGSGEHNESGCTNLGNADILDSGPRMGKETSKWQSKGKRNFRTGNFIDWSRNSPHK  317
            + +S GSG   ++ C+++G    L+S  R+       +S+   + +   F  WS  S H 
Sbjct  469  DVLSLGSGR--KADCSSIGGCLALNSTYRL-------KSRTVTDIQLDEFGGWS--SSHN  517

Query  318  ESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYR  497
            E  ++  TA+LP  +RSLP+RLSRFV+NPKY   DFSLRHH I DSSL DV VEVK+ YR
Sbjct  518  ECHVRDLTAELP--QRSLPFRLSRFVLNPKYNQSDFSLRHH-ITDSSLYDVNVEVKASYR  574

Query  498  TRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL---VSASNCHDLDDDSAP-----  653
              H+PYISLMSKLNG+PI GH L V+VL+DG CDQL+      S+ ++LDDD A      
Sbjct  575  PHHVPYISLMSKLNGRPIIGHPLTVDVLEDGSCDQLVSSSECHSSSYELDDDPAEDTYPL  634

Query  654  KGVDMVNKTKLSFGGR------LQPRAsstksskskkesmlskkVRRLSSLTGPRKQNRE  815
            +  DMV + + + GGR      LQPR S  KS K+KK  +L KK+R+LSSLTG +  + +
Sbjct  635  RSFDMVYERRPNSGGRTNKHQALQPRVSPAKSPKAKKNGLLLKKIRKLSSLTGHKHCDVD  694

Query  816  KNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            K P +++L+GP +ACVPLKVVFSRI AALNSS+R  HRL+ PS
Sbjct  695  KKPVMEKLKGPAVACVPLKVVFSRINAALNSSMRSTHRLLPPS  737


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  63   SPIVPCASQKGEFSAGAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKETS  242
            S ++ CASQK +  AGA SS+  QVET+S G+ E NESG T+ G  D+      + K  S
Sbjct  370  SAVISCASQKPQIGAGAQSSQCSQVETLSLGNDELNESGSTSSGTGDMNTLNQMIEKGAS  429

Query  243  KWQSKGKRNFR  275
            +WQ KGKRN R
Sbjct  430  EWQLKGKRNSR  440



>ref|XP_011072468.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
 ref|XP_011072469.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
Length=735

 Score =   207 bits (528),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 155/364 (43%), Positives = 200/364 (55%), Gaps = 75/364 (21%)
 Frame = +3

Query  63   SPIVPCASQKGEFSAGAPSSESGQV-----------ETMSCGSGE---HNESGCTNLGNA  200
            S IVP ASQK +  AGA SS+S  V           E+ S  SG    HN S     G +
Sbjct  371  STIVPGASQKAQVGAGAQSSQSSHVENISLGNEEHNESGSTSSGTADVHNISQRIEKGTS  430

Query  201  DILDSGPR-----------------MGKETSKWQSKGKRNF---RTG-------------  281
            +    G R                  G +   + +   RN    R G             
Sbjct  431  EWQLKGKRNSRSRKMDVDDESETYAAGMDRDSFLASSSRNADSNRVGGSLVSDGGGFHVK  490

Query  282  ----------NFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSL  431
                       F  WS N+P +ES  +   +++  P+R LPYR SRF VNPKYES DFSL
Sbjct  491  SRPITETQVEEFRGWSWNAPQRESHTRRSASEMAGPQRLLPYRQSRFTVNPKYESYDFSL  550

Query  432  RHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL-  608
            RHH  A S+L DV VEVKS YR +H+PYISLMSKL+GQPI GH LAVEVL+ G CD LL 
Sbjct  551  RHHT-AGSALYDVTVEVKSTYRPQHVPYISLMSKLHGQPIIGHPLAVEVLEAGSCDGLLG  609

Query  609  ------VSASNCHDLDDDSAPKGVDMVNKTKLSFGGR-------LQPRAsstksskskke  749
                   S+   H+L+  SA +G++MV + +    GR       LQ  ++  K+ KS++ 
Sbjct  610  LTECYSSSSELDHNLNSVSALQGLNMVYERRPR--GRPPSKHRSLQAHSTRRKTPKSRRN  667

Query  750  smlskkVRRLSSLTGPRKQNRE-KNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  926
             +LSKK+R+LSSLTG  KQ++E K P V++L+GP+IAC+PL VVFSRI AALNSS+RP  
Sbjct  668  GLLSKKIRKLSSLTGSHKQSQEDKKPVVEKLKGPSIACIPLNVVFSRINAALNSSMRPPP  727

Query  927  RLIA  938
            R+ A
Sbjct  728  RMAA  731



>ref|XP_010654562.1| PREDICTED: uncharacterized protein At1g51745-like [Vitis vinifera]
Length=755

 Score =   165 bits (417),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 139/341 (41%), Positives = 189/341 (55%), Gaps = 51/341 (15%)
 Frame = +3

Query  63   SPI-VPCASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTN----------------  188
            SPI V C+S K +    G  SS+S Q ET+S  +   NESG T+                
Sbjct  417  SPIFVSCSSGKPQVGGLGRQSSQSSQAETVSLRNEGLNESGSTSSEAVHTSNCNQRIEKG  476

Query  189  --------LGNADILDSGPRMGKETS-----KWQSKGKRNFRTGNFIDWSRNSPHKESQM  329
                    LG+   +D  P  G   S     + +SK   + +     +WSR+  H+E  +
Sbjct  477  IEHQDGFSLGSDQKVDCNPVGGSVISDSCTLQGKSKPVIDDQESGHRNWSRHISHREPHL  536

Query  330  KGPTAD---LP----IPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKS  488
            +GPT++   LP     P+RSLPYR SRF VNP+Y+ PD   R+   ++S L DV +EVK+
Sbjct  537  RGPTSEVKRLPDCSLTPQRSLPYRHSRFTVNPRYQMPDLPFRN-FYSNSCLYDVNLEVKA  595

Query  489  CYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDM  668
             YR +H+P +SLMSKLNG+ I GH L VEVLDD     L  S    +D    S  +G +M
Sbjct  596  NYRPQHVPLVSLMSKLNGKAIVGHPLTVEVLDDLSDLLLSDSE---YDPTTMSVSEGDEM  652

Query  669  VNKTKLSFGGR--------LQPRAsstksskskkesmlskkVRRLSSLTGP-RKQNREKN  821
                K +   R        LQ R S +KS K KK  +LSKK+R+LSSLTG  +K++ E+ 
Sbjct  653  GYAVKRNSETRRLPTKHSTLQLRVSPSKSPKMKKGGLLSKKIRKLSSLTGSHKKRDEERK  712

Query  822  PTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            P V +L+GP IAC+PLK+VFSR+  A+NSS RPAH  + PS
Sbjct  713  PVVDKLKGPAIACIPLKLVFSRLNEAVNSSARPAHHALTPS  753



>ref|XP_008228332.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Prunus mume]
Length=716

 Score =   164 bits (416),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 186/347 (54%), Gaps = 65/347 (19%)
 Frame = +3

Query  63   SPIVP-CASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKE  236
            SPI+  C+S K +  A G  SS+S Q E +S      NESG T+  +A + D G  + K 
Sbjct  380  SPIIAVCSSGKPQIGALGRQSSQSSQAEALSLRDERINESGSTS--SAALHDIGQSIEKG  437

Query  237  TSKWQSKGKRNFRTGN---------FID-----------------WSRNSPHK-------  317
            +SKWQSKGKRN R  +         ++D                  S++S  K       
Sbjct  438  SSKWQSKGKRNSRQTSKDRKHDSRRYMDVDEESNAYSVGIEHSDGLSQDSDQKVNCKGIS  497

Query  318  -----------ESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLT  464
                       +S+     AD PI +RSLPYR SRF V  +Y++ D + R+ + +D SL 
Sbjct  498  GSGAYNCTLQAKSKQVTELADGPI-QRSLPYRQSRFTVPARYQTSDSTARN-LCSDGSLY  555

Query  465  DVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDD  644
            DVK+EVKS YR +H+P +SLMSKLNG+ I GH L VE L DG CD +++S   C   D +
Sbjct  556  DVKLEVKSNYRPQHVPLVSLMSKLNGKAIVGHPLTVEALGDGCCD-IMLSKLEC---DRE  611

Query  645  SAPKGVDMVNKTKLSFGGR-------LQPRAsstksskskkesmlskkVRRLSSLTGPRK  803
                G  +  K ++   GR       LQP+ S  KS K+KK  +  KK R+LSSLTG  K
Sbjct  612  VGKIGYAIQPKAEI---GRNPGKHLALQPQNSPNKSPKTKKSGLQPKKTRKLSSLTG-HK  667

Query  804  QNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            Q+    P   + +GP IAC+PLK+VFSRI  A+N   RP HR++  S
Sbjct  668  QSEVTKPLAAKPQGPVIACIPLKLVFSRINEAVNGLARPTHRVLKSS  714



>ref|XP_008228331.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Prunus mume]
Length=752

 Score =   164 bits (415),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 186/347 (54%), Gaps = 65/347 (19%)
 Frame = +3

Query  63   SPIVP-CASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKE  236
            SPI+  C+S K +  A G  SS+S Q E +S      NESG T+  +A + D G  + K 
Sbjct  416  SPIIAVCSSGKPQIGALGRQSSQSSQAEALSLRDERINESGSTS--SAALHDIGQSIEKG  473

Query  237  TSKWQSKGKRNFRTGN---------FID-----------------WSRNSPHK-------  317
            +SKWQSKGKRN R  +         ++D                  S++S  K       
Sbjct  474  SSKWQSKGKRNSRQTSKDRKHDSRRYMDVDEESNAYSVGIEHSDGLSQDSDQKVNCKGIS  533

Query  318  -----------ESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLT  464
                       +S+     AD PI +RSLPYR SRF V  +Y++ D + R+ + +D SL 
Sbjct  534  GSGAYNCTLQAKSKQVTELADGPI-QRSLPYRQSRFTVPARYQTSDSTARN-LCSDGSLY  591

Query  465  DVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDD  644
            DVK+EVKS YR +H+P +SLMSKLNG+ I GH L VE L DG CD +++S   C   D +
Sbjct  592  DVKLEVKSNYRPQHVPLVSLMSKLNGKAIVGHPLTVEALGDGCCD-IMLSKLEC---DRE  647

Query  645  SAPKGVDMVNKTKLSFGGR-------LQPRAsstksskskkesmlskkVRRLSSLTGPRK  803
                G  +  K ++   GR       LQP+ S  KS K+KK  +  KK R+LSSLTG  K
Sbjct  648  VGKIGYAIQPKAEI---GRNPGKHLALQPQNSPNKSPKTKKSGLQPKKTRKLSSLTG-HK  703

Query  804  QNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            Q+    P   + +GP IAC+PLK+VFSRI  A+N   RP HR++  S
Sbjct  704  QSEVTKPLAAKPQGPVIACIPLKLVFSRINEAVNGLARPTHRVLKSS  750



>ref|XP_007217004.1| hypothetical protein PRUPE_ppa002212mg [Prunus persica]
 gb|EMJ18203.1| hypothetical protein PRUPE_ppa002212mg [Prunus persica]
Length=700

 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 136/347 (39%), Positives = 184/347 (53%), Gaps = 65/347 (19%)
 Frame = +3

Query  63   SPIVP-CASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKE  236
            SPI+  C+S K +  A G  SS+S Q E +S      NESG T+  +A + D G  + K 
Sbjct  364  SPIIAVCSSGKPQIGALGRQSSQSSQAEAVSLRDERINESGSTS--SAALHDIGQSIEKG  421

Query  237  TSKWQSKGKRNFRTGN---------FID-----------------WSRNSPHK-------  317
            +SKWQSKGKRN R  +         ++D                  S++S  K       
Sbjct  422  SSKWQSKGKRNSRQTSKDRKHDSRRYMDVDEESNAYSAGIEHSDGLSQDSDQKVNCKGIS  481

Query  318  -----------ESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLT  464
                       +S+     AD PI +RSLPYR SRF V  +Y++ D + R+ + +D SL 
Sbjct  482  GSGAYNCTLQAKSKQVTELADGPI-QRSLPYRQSRFTVPARYQTSDSTARN-LCSDGSLY  539

Query  465  DVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDD  644
            DVK+EVKS YR +H+P +SLMSKLNG+ I GH L VE L DG CD +L       + D +
Sbjct  540  DVKLEVKSNYRPQHVPLVSLMSKLNGKAIVGHPLTVEALGDGCCDIMLCKL----ECDRE  595

Query  645  SAPKGVDMVNKTKLSFGGR-------LQPRAsstksskskkesmlskkVRRLSSLTGPRK  803
                G  +  K ++   GR       LQP+ S  KS K+KK  +  KK R+LSSLTG  K
Sbjct  596  VGKIGYAIQPKAEI---GRNPGKHLALQPQNSPNKSPKTKKSGLQPKKTRKLSSLTG-HK  651

Query  804  QNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            Q+    P   + +GP IAC+PLK+VFSRI  A+N   RP HR++  S
Sbjct  652  QSEVMKPLTAKPQGPVIACIPLKLVFSRINEAVNGLARPTHRVLKSS  698



>gb|EYU45844.1| hypothetical protein MIMGU_mgv1a004135mg [Erythranthe guttata]
Length=542

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 139/268 (52%), Gaps = 61/268 (23%)
 Frame = +3

Query  231  KETSKWQSKGKRNFRTG---------------NFIDWSRNSPHKESQMKGPTADLPIPRR  365
            K TSKW+SKGKRN RT                 F  WS N P +       T D  +P R
Sbjct  300  KGTSKWRSKGKRNSRTRKLDEARVKTRPVTEIEFRGWSWNIPPRGGI--DSTVDSSVPHR  357

Query  366  SLPYRLSRFVVNPKYESPDFSLRHHV------IADSSLTDVKVEVKSCYRTRHIPYISLM  527
            S+PYR +R  VNPKY+S DFSL HH       +A S L DV VEVK+  R + +PYISLM
Sbjct  358  SMPYRQTRLTVNPKYDSSDFSLAHHNSNNNNNVAGSGLFDVAVEVKTESRPQRVPYISLM  417

Query  528  SKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQ  707
            S+LN QPI GH LAVEVLDD  CD ++       D   ++  +G       K S  G+L 
Sbjct  418  SRLNRQPIVGHPLAVEVLDDSSCDDVI-------DFYGETKHRGRPTKKSKKNS--GQLS  468

Query  708  PRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLR-----------GPTI  854
             +                   R+LS+L+GP + +RE N    + +           GP I
Sbjct  469  KK------------------TRKLSALSGPHRLSREANKMKTKKKKKKPVMEKVKKGPCI  510

Query  855  ACVPLKVVFSRIKAALNSSIRPAHRLIA  938
            ACVPL VVFSRI A+LN S RPA RL++
Sbjct  511  ACVPLNVVFSRISASLNGSGRPAPRLVS  538



>emb|CAN84040.1| hypothetical protein VITISV_024170 [Vitis vinifera]
Length=794

 Score =   161 bits (408),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 123/280 (44%), Positives = 163/280 (58%), Gaps = 30/280 (11%)
 Frame = +3

Query  159  GEHNESGCTNLGNADILDSGPRMGKE--TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMK  332
            G   +  C  +G + I DS    GK       Q  G RN        WSR+  H+E  ++
Sbjct  525  GSDQKVDCNPIGGSVISDSCTLQGKSKPVIDDQESGHRN--------WSRHISHREPHLR  576

Query  333  GPTAD---LP----IPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSC  491
            GPT++   LP     P+RSLPYR SRF VNP+Y+ PD   R+   ++S L DV +EVK+ 
Sbjct  577  GPTSEVKRLPDCSLTPQRSLPYRHSRFTVNPRYQMPDLPFRN-FYSNSCLYDVNLEVKAN  635

Query  492  YRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMV  671
            YR +H+P +SLMSKLNG+ I GH L VEVLDD     L  S    +D    S  +G +M 
Sbjct  636  YRPQHVPLVSLMSKLNGKAIVGHPLTVEVLDDLSDLLLSDSE---YDPTTMSVSEGDEMG  692

Query  672  NKTKLSFGGR--------LQPRAsstksskskkesmlskkVRRLSSLTGP-RKQNREKNP  824
               K +   R        LQ R S +KS K KK  +LSKK+R+LSSLTG  +K++ E+ P
Sbjct  693  YAVKRNSETRRLPTKHSTLQLRVSPSKSPKMKKGGLLSKKIRKLSSLTGSHKKRDEERKP  752

Query  825  TVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
             V +L+GP IAC+PLK+VFSR+  A+NSS RPAH  + PS
Sbjct  753  VVDKLKGPAIACIPLKLVFSRLNEAVNSSARPAHHALTPS  792



>ref|XP_007135591.1| hypothetical protein PHAVU_010G142200g [Phaseolus vulgaris]
 gb|ESW07585.1| hypothetical protein PHAVU_010G142200g [Phaseolus vulgaris]
Length=780

 Score =   160 bits (405),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 180/364 (49%), Gaps = 78/364 (21%)
 Frame = +3

Query  63   SPI-VPCASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKE  236
            SPI V C+  K + SA G  S      E +S      NE GCT+      +  G R  K 
Sbjct  421  SPILVSCSPDKPQVSALGQQSCNLSPCEAVSLRDEIKNEPGCTSSATGHNI-VGHRQDKG  479

Query  237  TSKWQSKGKRNFR------------------------------------TGNFIDWS---  299
            +SKWQSKGKRN R                                     G+ +DW+   
Sbjct  480  SSKWQSKGKRNSRHTSKNIKHVSRKYVDTGHQSSASLPVIGSSDGTYQGAGSKVDWNGMG  539

Query  300  ------------RNSPHKESQM----------KGPTAD---LP----IPRRSLPYRLSRF  392
                        +  P  E Q+          KG T +   LP    IP+R LPYR SRF
Sbjct  540  APYTSYNCNSQVKCKPVAEGQLEGFRDLNKHIKGTTTEAKALPDGSLIPQRLLPYRHSRF  599

Query  393  VVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAV  572
             VN +Y+  DF  R++  +++SL DVK+EVKS YR +H+P +SL+SKLNG+   GH L V
Sbjct  600  TVNSRYQMADFPGRNYC-SEASLYDVKLEVKSSYRPQHVPLVSLVSKLNGKAFIGHPLTV  658

Query  573  EVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskkes  752
            EVL++G CD++L S S C     D     V  + K  L         +   KSSK KK  
Sbjct  659  EVLEEGHCDKML-SGSGC-----DMEAGDVFCMAKPNLVPRRIHSKSSKRLKSSKMKKTG  712

Query  753  mlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRL  932
            +++KK+R+LSSLTG R+   E+ P V +L+GP IAC+PLKVVFSRI  A++   R  HR 
Sbjct  713  LMNKKIRKLSSLTGHRQSEEERKPVVDKLKGPVIACIPLKVVFSRINEAVSGQARSTHRA  772

Query  933  IAPS  944
            +  S
Sbjct  773  VPTS  776



>ref|XP_008380820.1| PREDICTED: uncharacterized protein At1g51745 isoform X3 [Malus 
domestica]
Length=702

 Score =   157 bits (397),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 180/342 (53%), Gaps = 65/342 (19%)
 Frame = +3

Query  60   SSPI-VPCASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGK  233
            SSPI   C+S K +  A G  SS+S Q E +S  +   NESGCT+  +A + D G  + K
Sbjct  377  SSPIRAACSSGKPQIGALGRQSSQSRQPEAVSLKNERINESGCTS--SAALHDIGISIEK  434

Query  234  ETSKWQSKGKRNFRTGN---------FID-------WSRNSPHKESQMKGP---------  338
             +SKWQ KGKRN R  +         F+D       +S    H     +G          
Sbjct  435  GSSKWQLKGKRNSRQTSKDRKHDSRRFMDMDDEYNGYSTGIEHSNGLSQGSYQKVNCNGI  494

Query  339  ----------------TADLPI--PRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLT  464
                              +LP    +RSLPYR SRF V  +Y++ D + R+   +D SL 
Sbjct  495  SGSRAYNGTLRSKSKQVTELPDGPTQRSLPYRQSRFTVPARYQTADSTARNSC-SDGSLY  553

Query  465  DVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDD  644
            DVK+EVKS YR +H+P +SLMSKLNG+ I GH L VEVL DG           C D + D
Sbjct  554  DVKLEVKSNYRPQHVPLVSLMSKLNGKAIVGHPLTVEVLGDG-----------CSDXEVD  602

Query  645  SAPKGVDMVNKTKL--SFGGRLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREK  818
                 V    +     + G  +QPR S ++S K+KK  +  KK+R+LSSLTG  KQ+ E+
Sbjct  603  KTGYAVKPEKEIGRIPAKGLAVQPRNSPSRSPKTKKSGLQPKKIRKLSSLTG-HKQSEER  661

Query  819  NPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
             P V + +GP IAC+PLKVVFSRI  A+    RP+HR++  S
Sbjct  662  KPLVPKQKGPVIACIPLKVVFSRINEAV---ARPSHRVLRSS  700



>ref|XP_008380818.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Malus 
domestica]
 ref|XP_008380819.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Malus 
domestica]
Length=738

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 180/342 (53%), Gaps = 65/342 (19%)
 Frame = +3

Query  60   SSPI-VPCASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGK  233
            SSPI   C+S K +  A G  SS+S Q E +S  +   NESGCT+  +A + D G  + K
Sbjct  413  SSPIRAACSSGKPQIGALGRQSSQSRQPEAVSLKNERINESGCTS--SAALHDIGISIEK  470

Query  234  ETSKWQSKGKRNFRTGN---------FID-------WSRNSPHKESQMKGP---------  338
             +SKWQ KGKRN R  +         F+D       +S    H     +G          
Sbjct  471  GSSKWQLKGKRNSRQTSKDRKHDSRRFMDMDDEYNGYSTGIEHSNGLSQGSYQKVNCNGI  530

Query  339  ----------------TADLPI--PRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLT  464
                              +LP    +RSLPYR SRF V  +Y++ D + R+   +D SL 
Sbjct  531  SGSRAYNGTLRSKSKQVTELPDGPTQRSLPYRQSRFTVPARYQTADSTARNSC-SDGSLY  589

Query  465  DVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDD  644
            DVK+EVKS YR +H+P +SLMSKLNG+ I GH L VEVL DG           C D + D
Sbjct  590  DVKLEVKSNYRPQHVPLVSLMSKLNGKAIVGHPLTVEVLGDG-----------CSDXEVD  638

Query  645  SAPKGVDMVNKTKL--SFGGRLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREK  818
                 V    +     + G  +QPR S ++S K+KK  +  KK+R+LSSLTG  KQ+ E+
Sbjct  639  KTGYAVKPEKEIGRIPAKGLAVQPRNSPSRSPKTKKSGLQPKKIRKLSSLTG-HKQSEER  697

Query  819  NPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
             P V + +GP IAC+PLKVVFSRI  A+    RP+HR++  S
Sbjct  698  KPLVPKQKGPVIACIPLKVVFSRINEAV---ARPSHRVLRSS  736



>ref|XP_002515884.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46304.1| conserved hypothetical protein [Ricinus communis]
Length=786

 Score =   154 bits (389),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 142/226 (63%), Gaps = 18/226 (8%)
 Frame = +3

Query  291  DWSRNSPHKESQMKGPTADLPI-PRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTD  467
            DW ++  H+E+ ++G   ++ + P+R LPYR SRF VN +Y++ DF  R   I DS L D
Sbjct  569  DWRKSFSHRENHVRGAMMEVSLSPQRLLPYRQSRFTVNSRYQTSDFPGR--TITDSKLYD  626

Query  468  VKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDS  647
            VK+EVK+ Y+ +++P +SLMSKLNG+ I G  L +  L DG+CD ++VS+  C    D +
Sbjct  627  VKLEVKANYQPQNVPLVSLMSKLNGKAIIGRPLTIGHLADGYCD-VIVSSIEC----DPT  681

Query  648  APKGVDMVNKTKLSFGGR-------LQPRAsstksskskkesmlskkVRRLSSLTGPRKQ  806
                V+     + S  GR       +QPR  S   S  +K  +LSKK+R+LSSLTG +++
Sbjct  682  RVYAVEAPQGVRNSESGRIPAKHITMQPR-FSPSKSPKRKSGLLSKKIRKLSSLTGNKEE  740

Query  807  NREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
             R+  P V++L+GP IAC+PLKVVFSRI  A+N S R  HR +  S
Sbjct  741  YRK--PVVEKLKGPVIACIPLKVVFSRINEAVNGSARQTHRALTSS  784



>gb|KDP40807.1| hypothetical protein JCGZ_24806 [Jatropha curcas]
Length=770

 Score =   154 bits (388),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 144/226 (64%), Gaps = 16/226 (7%)
 Frame = +3

Query  291  DWSRNSPHKESQMKGPTADLPIP-RRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTD  467
            DWS++  H++  M+G   D+ +P +RSLPYR SRF VN +Y++ DF  R   I DS L D
Sbjct  551  DWSKSFSHRD--MRGAIGDVSLPPQRSLPYRQSRFTVNSRYQTSDFPGR--TITDSKLYD  606

Query  468  VKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDS  647
            VK+EVK+ Y+ +++P +SLMSKLNG+ I G  L VE +DDGFCD L++ ++ C D    S
Sbjct  607  VKLEVKANYQPQNVPLVSLMSKLNGKAIIGRPLTVECVDDGFCD-LIIRSNEC-DPTRAS  664

Query  648  APKGVDMVNKT-KLSFGGRLQPRAsstksskskkesmlsk------kVRRLSSLTGPRKQ  806
            A    ++ +   + S  GR+  +  + ++  S  +S   K      K+R+LS+LTG +++
Sbjct  665  ALDAAELGHAAMRNSDAGRIPAKHMTMQARFSPSKSPKRKCVLLPKKIRKLSTLTGNKEE  724

Query  807  NREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
             R+  P V++L+GP IAC+PLK+VFSRI  A+N S R  +R +  S
Sbjct  725  YRK--PVVEKLKGPVIACIPLKLVFSRINEAVNGSARQTNRALTSS  768



>ref|XP_009367515.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Pyrus x bretschneideri]
Length=705

 Score =   152 bits (384),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 131/347 (38%), Positives = 178/347 (51%), Gaps = 72/347 (21%)
 Frame = +3

Query  60   SSPI-VPCASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGK  233
            SSPI   C+  K +  A G  SS+S Q E +S  +   NESGCT+  +A + D    M K
Sbjct  377  SSPIRTACSPGKPQIGALGRQSSQSRQSEAVSLKNERINESGCTS--SAALHDISISMVK  434

Query  234  ETSKWQSKGKRNFRTGN---------FID-------WSRNSPHKESQMKGP---------  338
             +S+WQ KGKRN R  +         F+D       +S    H     +G          
Sbjct  435  GSSEWQLKGKRNSRQTSKDRKHDSRRFMDMDDEYNGYSAGIEHSNGLSQGSYQKVNCNGI  494

Query  339  ----------------TADLPI--PRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLT  464
                              +LP    +RSLPYR SRF V  +Y++ D + R+   +D SL 
Sbjct  495  SGSRAYNGTLRSKSKQVTELPDGPTQRSLPYRQSRFTVPARYQTADSTARNSC-SDGSLY  553

Query  465  DVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDD  644
            DVK+EVKS YR +H+P +SLMSKLN + I GH   VEVLDDG           C D + D
Sbjct  554  DVKLEVKSNYRPQHVPLVSLMSKLNSKAIVGHPRTVEVLDDG-----------CSDWEVD  602

Query  645  SAPKGVDMVNKTKLSFGGRL-------QPRAsstksskskkesmlskkVRRLSSLTGPRK  803
                 V    +      GR+       QPR S ++S K+KK  +  KK+R+LSSLTG  K
Sbjct  603  KTGYAVKPEKEI-----GRIPAKVLAVQPRNSPSRSPKTKKSGLQPKKIRKLSSLTG-HK  656

Query  804  QNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            Q+ ++ P V + +GP IAC+PLK+VFSRI  A+N   RP+HR++  S
Sbjct  657  QSEDRKPLVPKPKGPVIACIPLKLVFSRINEAVNGLARPSHRVLRSS  703



>gb|KHN11311.1| Hypothetical protein glysoja_023375 [Glycine soja]
Length=784

 Score =   153 bits (386),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 138/373 (37%), Positives = 187/373 (50%), Gaps = 91/373 (24%)
 Frame = +3

Query  63   SPI-VPCASQKGEFS-AGAPSSESGQVETMSCGSGEHNESGCTN-LGNADILDSGPRMGK  233
            SPI V C+S K + S  G  S  + Q E +S  +   NE GCT+ +    I+  G R  K
Sbjct  421  SPILVSCSSGKPQVSPLGEQSCNASQCEAVSLRNESKNEPGCTSSVAGHSIV--GHRADK  478

Query  234  ETSKWQSKGKRNFRTGN---------FIDWSRNS--------------------------  308
             +SKWQSKGKRN R  +         ++D  R S                          
Sbjct  479  GSSKWQSKGKRNSRNTSKNIKHASRKYVDTDRQSSAYFPGIGNSDGIYQGACQKVDWNGM  538

Query  309  ----------------PHKESQMKG------------------PTADLPIPRRSLPYRLS  386
                            P  E Q++G                  P   L  P+R LPYR S
Sbjct  539  GEPNTSYNCTSQVNCKPVAEGQLEGLRDLNKHVKVTTTEAKLLPDGSL-TPQRLLPYRHS  597

Query  387  RFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRL  566
            RF VN +Y++ DF  R++  +D+SL DVK+EVKS YR +H+P +SL+SKLNG+   GH L
Sbjct  598  RFTVNSRYQTADFPGRNYC-SDASLYDVKLEVKSSYRPQHVPLVSLVSKLNGKAFIGHPL  656

Query  567  AVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQ----PRAsstkss  734
            AVEV+ +G CD++L       D+  D     V  V K   S  GR+      R S +KSS
Sbjct  657  AVEVMVEGHCDKML------SDIGCDLEVGDVYCVAKPN-SVTGRIHSKNSTRFSPSKSS  709

Query  735  kskkesmlskkVRRLSSLTGPRK---QNREKNPTVQQLRGPTIACVPLKVVFSRIKAALN  905
            K KK  +L+KK+R+LSSLTG R+   + +EK P V + +GP IAC+PL+VVFSRI  A++
Sbjct  710  KMKKTGLLNKKIRKLSSLTGHRQSEEERKEKKPVVDK-KGPVIACIPLQVVFSRINEAVS  768

Query  906  SSIRPAHRLIAPS  944
               R  HR +  S
Sbjct  769  GQARSTHRALPTS  781



>ref|XP_010062582.1| PREDICTED: uncharacterized protein At1g51745 [Eucalyptus grandis]
 gb|KCW69713.1| hypothetical protein EUGRSUZ_F03102 [Eucalyptus grandis]
Length=770

 Score =   152 bits (385),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 175/347 (50%), Gaps = 74/347 (21%)
 Frame = +3

Query  108  GAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKETSKWQSKGKRNFR----  275
            G  SS+S QVE  S      NESGC +L    +   G ++ K TSKWQSKGKRN R    
Sbjct  423  GRQSSQSSQVEAASLACNHVNESGCNSLAAVRVDQVGQKIDKGTSKWQSKGKRNSRQLSK  482

Query  276  --------------------TG-----------------NFIDWSRNSPHK-----ESQM  329
                                TG                  FID S  S  K     E Q+
Sbjct  483  NRNRHPGRYLEMDEESNTYLTGLHNTDGCLPGSERKPGSTFIDGSVTSHAKLKSGSEGQV  542

Query  330  KGP----------------TADL-PIP------RRSLPYRLSRFVVNPKYESPDFSLRHH  440
             G                  A+L P+P      +RSLP+R SRF V+ ++++ ++ +   
Sbjct  543  DGVPDWGSRVFPGESHVKRQAELKPLPNGSPTSQRSLPHRQSRFAVHSRHKTDEYPI-GD  601

Query  441  VIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS  620
            + ++S L DV++EVK+ YR  H+P +SLMSKLNG+ I GH L+VEVLD G CD  LV+  
Sbjct  602  LYSNSPLYDVELEVKASYRPTHVPLVSLMSKLNGKAIVGHPLSVEVLDGGHCDN-LVNTG  660

Query  621  NCHDLDDDSAPKGVDMVNKTKLSFGG--RLQPRAsstksskskkesmlskkVRRLSSLTG  794
            +C D ++ S   G  M +    S     R     S  KSSK+KK   LSKK+R+LSSLTG
Sbjct  661  SC-DANNLSTWGGSKMAHPVHRSSAHVRRTGKSHSRKKSSKAKKSGQLSKKMRKLSSLTG  719

Query  795  PRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
             ++        V++  GP IAC+PLKVVFSRI  A+N S RP HR +
Sbjct  720  HKRGEDMGKFAVEKPAGPVIACIPLKVVFSRINEAVNGSARPTHRAL  766



>ref|XP_009367513.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009367514.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Pyrus x bretschneideri]
Length=741

 Score =   152 bits (384),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 131/347 (38%), Positives = 178/347 (51%), Gaps = 72/347 (21%)
 Frame = +3

Query  60   SSPI-VPCASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGK  233
            SSPI   C+  K +  A G  SS+S Q E +S  +   NESGCT+  +A + D    M K
Sbjct  413  SSPIRTACSPGKPQIGALGRQSSQSRQSEAVSLKNERINESGCTS--SAALHDISISMVK  470

Query  234  ETSKWQSKGKRNFRTGN---------FID-------WSRNSPHKESQMKGP---------  338
             +S+WQ KGKRN R  +         F+D       +S    H     +G          
Sbjct  471  GSSEWQLKGKRNSRQTSKDRKHDSRRFMDMDDEYNGYSAGIEHSNGLSQGSYQKVNCNGI  530

Query  339  ----------------TADLPI--PRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLT  464
                              +LP    +RSLPYR SRF V  +Y++ D + R+   +D SL 
Sbjct  531  SGSRAYNGTLRSKSKQVTELPDGPTQRSLPYRQSRFTVPARYQTADSTARNSC-SDGSLY  589

Query  465  DVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDD  644
            DVK+EVKS YR +H+P +SLMSKLN + I GH   VEVLDDG           C D + D
Sbjct  590  DVKLEVKSNYRPQHVPLVSLMSKLNSKAIVGHPRTVEVLDDG-----------CSDWEVD  638

Query  645  SAPKGVDMVNKTKLSFGGRL-------QPRAsstksskskkesmlskkVRRLSSLTGPRK  803
                 V    +      GR+       QPR S ++S K+KK  +  KK+R+LSSLTG  K
Sbjct  639  KTGYAVKPEKEI-----GRIPAKVLAVQPRNSPSRSPKTKKSGLQPKKIRKLSSLTG-HK  692

Query  804  QNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            Q+ ++ P V + +GP IAC+PLK+VFSRI  A+N   RP+HR++  S
Sbjct  693  QSEDRKPLVPKPKGPVIACIPLKLVFSRINEAVNGLARPSHRVLRSS  739



>ref|XP_010088115.1| hypothetical protein L484_001821 [Morus notabilis]
 gb|EXB31785.1| hypothetical protein L484_001821 [Morus notabilis]
Length=775

 Score =   151 bits (381),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 142/226 (63%), Gaps = 23/226 (10%)
 Frame = +3

Query  294  WSRNSPHKESQMKGPTADLPI-------PRRSLPYRLSRFVVNPKYESPDFSLRHHVIAD  452
            WS++  HKE  + G TA++ +       P+R LPYR SRF V+ +Y   DFS+++ +  D
Sbjct  560  WSKHLLHKEPNISGLTAEVKLLPDGSLPPQRLLPYRQSRFTVHSRYRMSDFSIKN-LPFD  618

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHD  632
            SSL +V VEVK+ YR  H+P +SLMSKL+G+ I GH LAVE L+DG CD LL +A    +
Sbjct  619  SSLYEVNVEVKANYRPSHVPLVSLMSKLHGKAIVGHPLAVESLEDGCCDSLLRTAEG--E  676

Query  633  LDDDSAPKGVDMVNKTKLSFGGR------LQPRAsstksskskkesmlskkVRRLSSLTG  794
             +D  A  G    NK +    GR      LQP+ S  KS+K+KK  +L KK+R+LSSLTG
Sbjct  677  FED--AHIGYVKRNKGR----GRIPKHLLLQPQNSPHKSAKTKKSGLLPKKIRKLSSLTG  730

Query  795  PRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRL  932
             +K   E    V++ +GP IAC+PLK+VFSRI  A+N   R  HR+
Sbjct  731  SKKL-EEMKSVVEKPKGPVIACIPLKLVFSRINEAVNGLARQTHRV  775



>gb|KHG23152.1| hypothetical protein F383_01193 [Gossypium arboreum]
Length=778

 Score =   150 bits (378),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/244 (41%), Positives = 144/244 (59%), Gaps = 15/244 (6%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPI-------PRRSLPYRLSRFV  395
            TS+ +SK     +   F DW   S  ++   +GP  +  +       P+RSLPYR SR+ 
Sbjct  540  TSQSKSKPVVEDQLNGFGDW--KSMSRQPHGRGPIVEAKVLPDSSGNPQRSLPYRQSRYT  597

Query  396  VNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVE  575
            +NP+Y++ +F  + +  ADSSL D+K++VK+ YR +H+P +SLMSKLNG+ I GH L VE
Sbjct  598  INPRYQTTNFPGKTYS-ADSSLYDIKIDVKANYRPQHVPLVSLMSKLNGKAIIGHPLTVE  656

Query  576  VLDDGFCDQ-LLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskkes  752
            VL+D + D     +A  C ++D          V +  +    +  PR    KS+K KK  
Sbjct  657  VLNDDYYDNPSQEAAVECTEVDHSLKQNSGGRVPRKHIKLQSQFPPR----KSAKVKKSG  712

Query  753  mlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRL  932
            +LSKK+R+LSSLTG +     + P  ++ +GP IAC+PLK+VFSRI  ALN S RP HR 
Sbjct  713  LLSKKIRKLSSLTGQKLGVGLRKPVAEKPKGPVIACIPLKLVFSRINEALNGSARPMHRS  772

Query  933  IAPS  944
            +  S
Sbjct  773  LTSS  776



>gb|KEH18280.1| tudor/PWWP/MBT superfamily protein [Medicago truncatula]
Length=782

 Score =   149 bits (375),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 134/207 (65%), Gaps = 11/207 (5%)
 Frame = +3

Query  324  QMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTR  503
             ++G TA+   P+RSLPYR SRF +N +YE+ DF  R+   +D +L DVK+EVKS YR +
Sbjct  581  HIEGTTAE--PPQRSLPYRQSRFAINSRYETADFPGRN-CSSDGTLYDVKLEVKSSYRPQ  637

Query  504  HIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTK  683
            H+P +SL SKL+G+   GH L VEVL+DG CD++L       ++DD      +D V K K
Sbjct  638  HVPLVSLASKLSGKAFIGHPLTVEVLEDGHCDKMLSGLRRDVEVDD------IDCVVKPK  691

Query  684  LSFGGRLQPRA--sstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIA  857
                 R +  +  S  KSSKSKK  +L+KK+R+LSSLTG R+   ++ P V +L+GP IA
Sbjct  692  PVTTRRPKRSSHFSRRKSSKSKKSGLLNKKIRKLSSLTGHRQSEEKRKPVVDKLKGPVIA  751

Query  858  CVPLKVVFSRIKAALNSSIRPAHRLIA  938
            C+PL +VFSRI  AL+   R  HR ++
Sbjct  752  CIPLTIVFSRINEALSGQARSTHRAVS  778



>ref|XP_011013035.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Populus euphratica]
Length=740

 Score =   147 bits (370),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 123/355 (35%), Positives = 179/355 (50%), Gaps = 68/355 (19%)
 Frame = +3

Query  69   IVPCASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLGNADIL-DSGPRMGKETS  242
            +V C+  K +    G    +S Q E +   +   NESG T+L  A +  D   R+ K  S
Sbjct  389  LVSCSPGKHQIGGLGKQFGQSSQAEALLLKNEACNESGSTSLAAACVYNDFSQRIEKGAS  448

Query  243  KWQSKGKRN---------------------------------FRTG--------------  281
            KWQ KGKRN                                 FR G              
Sbjct  449  KWQLKGKRNSRHTSKNRKQDSRKDDMGDEPNAHMAGMEHLDGFRQGPDQKVDCGGGKSEP  508

Query  282  ---NFIDWSRNSPHKESQ---MKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHV  443
                 +D  R+     SQ   M+    +L +P+RSLPYR SRF+VN +Y++ DF  R+ +
Sbjct  509  FSEYRVDAVRDRSKSSSQGEGMRAAMVELSVPQRSLPYRQSRFMVNSRYQTSDFPGRN-L  567

Query  444  IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASN  623
             + S L +V+++V+  YR +H+P +SLMSKLNG+ I GH L +E LDDG+ D +L   SN
Sbjct  568  SSGSKLFNVEIKVQRNYRQQHVPLVSLMSKLNGKAIVGHPLTIENLDDGYSDLML--GSN  625

Query  624  CHDLDDDSAPKGVDMVNKTKLSF-GGR-------LQPRAsstksskskkesmlskkVRRL  779
              D    +  +   + +    +   GR       ++PR+S +KS K +K  +LSKK+R+L
Sbjct  626  ERDTTHFTGGETPKLGHAAMRNIEAGRTPARRMTVKPRSSPSKSHKLRKCGLLSKKIRKL  685

Query  780  SSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            SSLTG R ++ +    V++  GP IAC+PLK+VFSRI  A+N S R  HR +  S
Sbjct  686  SSLTGKRVEDSK--LVVEKPGGPVIACIPLKLVFSRINEAVNGSARQTHRALPSS  738



>ref|XP_011013034.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Populus euphratica]
Length=778

 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 123/355 (35%), Positives = 179/355 (50%), Gaps = 68/355 (19%)
 Frame = +3

Query  69   IVPCASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLGNADIL-DSGPRMGKETS  242
            +V C+  K +    G    +S Q E +   +   NESG T+L  A +  D   R+ K  S
Sbjct  427  LVSCSPGKHQIGGLGKQFGQSSQAEALLLKNEACNESGSTSLAAACVYNDFSQRIEKGAS  486

Query  243  KWQSKGKRN---------------------------------FRTG--------------  281
            KWQ KGKRN                                 FR G              
Sbjct  487  KWQLKGKRNSRHTSKNRKQDSRKDDMGDEPNAHMAGMEHLDGFRQGPDQKVDCGGGKSEP  546

Query  282  ---NFIDWSRNSPHKESQ---MKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHV  443
                 +D  R+     SQ   M+    +L +P+RSLPYR SRF+VN +Y++ DF  R+ +
Sbjct  547  FSEYRVDAVRDRSKSSSQGEGMRAAMVELSVPQRSLPYRQSRFMVNSRYQTSDFPGRN-L  605

Query  444  IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASN  623
             + S L +V+++V+  YR +H+P +SLMSKLNG+ I GH L +E LDDG+ D +L   SN
Sbjct  606  SSGSKLFNVEIKVQRNYRQQHVPLVSLMSKLNGKAIVGHPLTIENLDDGYSDLML--GSN  663

Query  624  CHDLDDDSAPKGVDMVNKTKLSF-GGR-------LQPRAsstksskskkesmlskkVRRL  779
              D    +  +   + +    +   GR       ++PR+S +KS K +K  +LSKK+R+L
Sbjct  664  ERDTTHFTGGETPKLGHAAMRNIEAGRTPARRMTVKPRSSPSKSHKLRKCGLLSKKIRKL  723

Query  780  SSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            SSLTG R ++ +    V++  GP IAC+PLK+VFSRI  A+N S R  HR +  S
Sbjct  724  SSLTGKRVEDSK--LVVEKPGGPVIACIPLKLVFSRINEAVNGSARQTHRALPSS  776



>ref|XP_006369225.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
 gb|ERP65794.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
Length=698

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 114/311 (37%), Positives = 169/311 (54%), Gaps = 31/311 (10%)
 Frame = +3

Query  72   VPCASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLG-----------------N  197
            + C+S + +    G  SS+S Q E +   +   NESG T+L                  +
Sbjct  385  MSCSSGRQQIGGLGRQSSQSRQAEAVLFKNEACNESGSTSLAVNCVYNNISQRIEKGMEH  444

Query  198  ADILDSGPRMGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPY  377
             D    GP    + S  +S+           DWS++ P  +  MKG   ++ +P+RSLPY
Sbjct  445  LDEFCQGPGQEVDCSGGKSQPFTEDHGDAVRDWSKSFPQGDLSMKGLMVEMSVPQRSLPY  504

Query  378  RLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITG  557
            R SRF VN +Y++ DFS R+   + S L +V ++V+  YR +H+P +SLMSKLNG+ I G
Sbjct  505  RQSRFTVNSRYQTSDFSGRN-FSSGSKLFNVDIKVQQNYRQQHVPLVSLMSKLNGKAIVG  563

Query  558  HRLAVEVLDDGFCDQLLVSASNCHD---LDDDSAPKGV--DMVNKTKLSFGGR---LQPR  713
            H L +E L DG+ D LL   SN  D   + +   PK V   M N        R   ++P 
Sbjct  564  HPLTIENLQDGYSDLLL--GSNEGDTVHVTEIETPKLVYAAMRNLEAGRIPARHMTMKPL  621

Query  714  AsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIK  893
            +S +KS K +K  +LSKK+R+LSSLTG + ++R+    V++ +GP + C+PLK+VFSRI 
Sbjct  622  SSPSKSHKLRKCGLLSKKIRKLSSLTGKKVEDRK--LVVEKSKGPAVTCIPLKLVFSRIN  679

Query  894  AALNSSIRPAH  926
             A+N S R  H
Sbjct  680  EAVNGSARQTH  690



>gb|EYU21406.1| hypothetical protein MIMGU_mgv1a002564mg [Erythranthe guttata]
Length=659

 Score =   144 bits (363),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 130/338 (38%), Positives = 174/338 (51%), Gaps = 76/338 (22%)
 Frame = +3

Query  72   VPCASQKGEFSAGAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKETSKWQ  251
            VP  ++   F+ G           +S G+ EHNE+  T+    + L    ++ K TS+WQ
Sbjct  346  VPLLAEDKHFTKG-----------LSLGNEEHNETCSTSSDFHNNLSQ--KLEKSTSEWQ  392

Query  252  SKGKRN--------------------------FRTGN-------------FIDWSRNSPH  314
             KGKRN                          F TG+             F  WS N+P 
Sbjct  393  LKGKRNSRPRKIEVDNEAQTLLAATAISGDHHFLTGSSPNSGPHKIEAEEFRGWSWNAPR  452

Query  315  KESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSL--RHHVIADSSLTDVK--VEV  482
             +SQ            R LPYR SRF VNPKY+S DFSL   H   A ++L +VK  VEV
Sbjct  453  GDSQ------------RPLPYRQSRFTVNPKYDSSDFSLGPHHSNAAGAALYEVKVSVEV  500

Query  483  KS--CYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNC--HDLDDDSA  650
            K+    R +H+PYISLMSK NG+PI GH L++EVL DG   +   S+S     +L   S 
Sbjct  501  KTGGSNRPQHVPYISLMSKSNGRPIVGHPLSIEVLSDGHILECYSSSSEPARSNLKYVSG  560

Query  651  PKGVDMVNKTKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPT-  827
             +G   V   +   G       S  KS KSK+  +LSKK+R+LSSL+GP  ++ ++  T 
Sbjct  561  SRGGADVACGRKPRGSPAVRSRSLAKSRKSKRNGLLSKKIRKLSSLSGPHGESHQQYKTK  620

Query  828  --VQQL-RGPTIACVPLKVVFSRIKAALNSSIRPAHRL  932
              V+++ +GP++ACVPL VVFSRI AALNSSIR A R 
Sbjct  621  TGVEKVSKGPSVACVPLNVVFSRINAALNSSIRHAPRF  658



>ref|XP_006369226.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
 gb|ERP65795.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
Length=737

 Score =   144 bits (364),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 138/220 (63%), Gaps = 13/220 (6%)
 Frame = +3

Query  291  DWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDV  470
            DWS++ P  +  MKG   ++ +P+RSLPYR SRF VN +Y++ DFS R+   + S L +V
Sbjct  515  DWSKSFPQGDLSMKGLMVEMSVPQRSLPYRQSRFTVNSRYQTSDFSGRN-FSSGSKLFNV  573

Query  471  KVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHD---LDD  641
             ++V+  YR +H+P +SLMSKLNG+ I GH L +E L DG+ D LL   SN  D   + +
Sbjct  574  DIKVQQNYRQQHVPLVSLMSKLNGKAIVGHPLTIENLQDGYSDLLL--GSNEGDTVHVTE  631

Query  642  DSAPKGV--DMVNKTKLSFGGR---LQPRAsstksskskkesmlskkVRRLSSLTGPRKQ  806
               PK V   M N        R   ++P +S +KS K +K  +LSKK+R+LSSLTG + +
Sbjct  632  IETPKLVYAAMRNLEAGRIPARHMTMKPLSSPSKSHKLRKCGLLSKKIRKLSSLTGKKVE  691

Query  807  NREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  926
            +R+    V++ +GP + C+PLK+VFSRI  A+N S R  H
Sbjct  692  DRK--LVVEKSKGPAVTCIPLKLVFSRINEAVNGSARQTH  729



>ref|XP_003529739.1| PREDICTED: uncharacterized protein At1g51745-like [Glycine max]
Length=784

 Score =   145 bits (365),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 135/214 (63%), Gaps = 11/214 (5%)
 Frame = +3

Query  324  QMKGPTAD---LP----IPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEV  482
             +KG T +   LP     P+R LPYR SRF VN +Y++ DF  R++  +D+SL DVK+EV
Sbjct  572  HIKGTTTEAKLLPDGSLTPQRLLPYRHSRFTVNSRYQTADFPGRNY-YSDASLYDVKLEV  630

Query  483  KSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGV  662
            KS YR +H+P +SL+SKLNG+   GH LAVEVL +G CD++L       ++ D       
Sbjct  631  KSSYRPQHVPLVSLVSKLNGKAFIGHPLAVEVLVEGHCDKMLSDIGCDLEVGDVYCAAKP  690

Query  663  DMVNKTKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLR  842
            + V +   S   +   R S +KSSK KK  +L+KK+R+LSSLTG ++   E+ P V +L+
Sbjct  691  NSVTRRIHS---KNLTRFSPSKSSKMKKTGLLNKKIRKLSSLTGHKQLEEERKPVVDKLK  747

Query  843  GPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            GP IAC+PLKVVFSRI  A++   R  +R +  S
Sbjct  748  GPVIACIPLKVVFSRINEAVSGQARSTYRALPTS  781



>gb|KHN39281.1| Hypothetical protein glysoja_018053 [Glycine soja]
Length=784

 Score =   144 bits (364),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 135/214 (63%), Gaps = 11/214 (5%)
 Frame = +3

Query  324  QMKGPTAD---LP----IPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEV  482
             +KG T +   LP     P+R LPYR SRF VN +Y++ DF  R++  +D+SL DVK+EV
Sbjct  572  HIKGTTTEAKLLPDGSLTPQRLLPYRHSRFTVNSRYQTADFPGRNY-YSDASLYDVKLEV  630

Query  483  KSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGV  662
            KS YR +H+P +SL+SKLNG+   GH LAVEVL +G CD++L       ++ D       
Sbjct  631  KSSYRPQHVPLVSLVSKLNGKAFIGHPLAVEVLVEGHCDKMLSDIGCDLEVGDVYCAAKP  690

Query  663  DMVNKTKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLR  842
            + V +   S   +   R S +KSSK KK  +L+KK+R+LSSLTG ++   E+ P V +L+
Sbjct  691  NSVTRRIHS---KNLTRFSPSKSSKMKKTGLLNKKIRKLSSLTGHKQLEEERKPVVDKLK  747

Query  843  GPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            GP IAC+PLKVVFSRI  A++   R  +R +  S
Sbjct  748  GPVIACIPLKVVFSRINEAVSGQARSTYRALPTS  781



>ref|XP_004510340.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Cicer arietinum]
 ref|XP_004510341.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Cicer arietinum]
Length=789

 Score =   144 bits (363),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 126/198 (64%), Gaps = 8/198 (4%)
 Frame = +3

Query  357  PRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKL  536
            P+RSLPYR SRF VN +YE+ DF  R+   +D +L DVK+EVKS YR +H+P +SL+SKL
Sbjct  592  PQRSLPYRQSRFTVNSRYETTDFPGRNSS-SDGTLYDVKLEVKSSYRPQHVPLVSLVSKL  650

Query  537  NGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDD----DSAPKGVDMVNKTKLSFGGRL  704
            NG+   GH L VEVL++G CD+LL       ++ D       P    +  +       + 
Sbjct  651  NGKAFIGHPLTVEVLEEGHCDKLLSGIVGDMEVGDIYCEAEKPNSKSVTRRIPSK---KK  707

Query  705  QPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFS  884
              R S +KSSKSKK  +L+KK+R+LSSLTG R+   E+ P V +L+GP IAC+PL VVFS
Sbjct  708  SSRFSRSKSSKSKKSGLLNKKIRKLSSLTGHRQSEDERKPVVDKLKGPVIACIPLTVVFS  767

Query  885  RIKAALNSSIRPAHRLIA  938
            RI  A++   R  HR ++
Sbjct  768  RINEAVSGQARSTHRAVS  785



>ref|XP_011011986.1| PREDICTED: uncharacterized protein At1g51745-like [Populus euphratica]
Length=779

 Score =   144 bits (362),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 137/226 (61%), Gaps = 25/226 (11%)
 Frame = +3

Query  291  DWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDV  470
            DWS++ P     MKG T ++ +P+RSLPYR SRF VN +Y++ DFS R+   + S L +V
Sbjct  557  DWSKSFPQGGLSMKGLTVEMSVPQRSLPYRQSRFTVNSRYQTSDFSGRN-FSSGSKLFNV  615

Query  471  KVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSA  650
             ++V+  YR +H+P +SLMSKLNG+ I GH L +E L DG+ D LL S        ++  
Sbjct  616  DIKVQRNYRQQHVPLVSLMSKLNGKAIVGHPLTIEHLQDGYSDLLLGS--------NEGD  667

Query  651  PKGVDMVNKTKLSF-------GGR-------LQPRAsstksskskkesmlskkVRRLSSL  788
               V  +   KL +        GR       ++P +S +KS K +K  +LSKK+R+LSSL
Sbjct  668  TVHVAEIEIPKLGYAAMRNLEAGRIPARHMTMKPLSSPSKSHKLRKCGLLSKKIRKLSSL  727

Query  789  TGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  926
            TG + ++R+    V++ +GP + C+PLK+VFSRI  A+N S R  H
Sbjct  728  TGKKVEDRK--LVVEKSKGPAVTCIPLKLVFSRINEAVNGSARHTH  771



>ref|XP_011015418.1| PREDICTED: uncharacterized protein At1g51745-like [Populus euphratica]
Length=779

 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 137/226 (61%), Gaps = 25/226 (11%)
 Frame = +3

Query  291  DWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDV  470
            DWS++ P     MKG T ++ +P+RSLPYR SRF VN +Y++ DFS R+   + S L +V
Sbjct  557  DWSKSFPQGGLSMKGLTVEMSVPQRSLPYRQSRFTVNSRYQTSDFSGRN-FSSGSKLFNV  615

Query  471  KVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSA  650
             ++V+  YR +H+P +SLMSKLNG+ I GH L +E L DG+ D LL S        ++  
Sbjct  616  DIKVQRNYRQQHVPLVSLMSKLNGKAIVGHPLTIEHLQDGYSDLLLGS--------NEGD  667

Query  651  PKGVDMVNKTKLSF-------GGR-------LQPRAsstksskskkesmlskkVRRLSSL  788
               V  +   KL +        GR       ++P +S +KS K +K  +LSKK+R+LSSL
Sbjct  668  TVHVAEIEIPKLGYAAMRNLEAGRIPARHMTMKPLSSPSKSHKLRKCGLLSKKIRKLSSL  727

Query  789  TGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  926
            TG + ++R+    V++ +GP + C+PLK+VFSRI  A+N S R  H
Sbjct  728  TGKKVEDRK--LVVEKSKGPAVTCIPLKLVFSRINEAVNGSARHTH  771



>ref|XP_006426470.1| hypothetical protein CICLE_v10027499mg [Citrus clementina]
 gb|ESR39710.1| hypothetical protein CICLE_v10027499mg [Citrus clementina]
Length=763

 Score =   142 bits (357),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 119/351 (34%), Positives = 180/351 (51%), Gaps = 73/351 (21%)
 Frame = +3

Query  69   IVPCASQKGEFS-AGAPSSESGQVETMSCGSGEHNESG--CTNLGNADILDSGPRMGKET  239
            IVP +  K +   +G   S+  +VE ++  +   NESG  C+   +A+ +    RM K T
Sbjct  423  IVPSSPGKPQVGVSGRQPSQCSEVEAVTLRNEGLNESGSPCSMAVHANNISQ--RMEKGT  480

Query  240  SKWQSKGKRNFRT-------------------GNFID-----------------------  293
            SKWQSKGKR  R                      F+D                       
Sbjct  481  SKWQSKGKRKSRHMSKNRKQASRKYSDMNDEPNTFVDSLHRLDGLSHGSFDHKVDCDSIC  540

Query  294  ------------WSRNSPH-KESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLR  434
                        W ++ PH + +++K  + +   P+RSLP+R +R+ V+ +Y+  DF +R
Sbjct  541  GSKLKSETEEQPWGKSLPHMRTTEVKLLSDESLNPKRSLPFRQTRYTVHSRYQ--DFPVR  598

Query  435  HHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVS  614
            + +  DS L +V++EVK+ YR +H+P +SLMSKLNG+ I GH L VEVL DG+CD +   
Sbjct  599  N-LCVDSVLYNVELEVKAGYRRQHVPLVSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESD  657

Query  615  ASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskke----smlskkVRRLS  782
            A+    +  +SAP G  +  K++       + + SS  SS    +      LSKK+R+LS
Sbjct  658  ATRVFVV--ESAPMGYPVKQKSEAGRNSNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLS  715

Query  783  SLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            SLT       E+ P  Q+ +GP I+C+PLK+VFSRI  A+N S RPA+R +
Sbjct  716  SLT----SQVERKPAEQKPKGPVISCIPLKLVFSRINEAVNGSARPANRAL  762



>ref|XP_004297615.1| PREDICTED: uncharacterized protein At1g51745-like [Fragaria vesca 
subsp. vesca]
Length=698

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 123/339 (36%), Positives = 167/339 (49%), Gaps = 65/339 (19%)
 Frame = +3

Query  60   SSPIVPCASQKGEFSAGA-PSSESGQVETMSCGSGEHNESGCTNLGNA-DILDSGPRMGK  233
            S+ + PC+S + E    A  S+ S Q E  S  +G  NESG T+     DI  S  R G 
Sbjct  375  SAVLAPCSSGRPEIGVAARQSNRSSQAEAESLRNGRPNESGPTSSAAVHDICQSIERGG-  433

Query  234  ETSKWQSKGKRNFRTG--------------------------------NFIDWSRN----  305
              SKWQSKGKRN R                                  +  D  RN    
Sbjct  434  --SKWQSKGKRNSRQTSRDRKHNSRKYMNVDDLSNASLASIGCSDMLCHVSDLKRNCNGI  491

Query  306  --------SPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSL  461
                    +   +S+     +D P  +RSLPYR SRF+V  +Y++ D      +  ++SL
Sbjct  492  SGSATFDYTLQGKSKQVAELSDGPT-QRSLPYRQSRFMVPARYQTSD-----SIARNTSL  545

Query  462  TDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDD  641
             DVKVE+K+ YR +H+P +SL SKLNG+ I GH + V+ LDDG+ D+L  S   C DL  
Sbjct  546  YDVKVEIKAKYRPQHVPLVSLTSKLNGKAIVGHPVTVKALDDGYSDRLFGSM-EC-DLRG  603

Query  642  DSAPKGVDMVNKTKLSFGGRLQPRAsst-ksskskkesmlskkVRRLSSLTGPRKQNREK  818
                  V    +      G++  R   +  S K+KK  +L KK R+LSSLTG R+    K
Sbjct  604  GKLSYAVQQTAEI-----GKIPARHLGSPNSPKTKKSGLLQKKTRKLSSLTGHRQSEERK  658

Query  819  NPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
             P  +   GP IAC+PLK+VFSRI  A+N   RP HR++
Sbjct  659  LPVEKS--GPVIACIPLKLVFSRINEAVNGLARPTHRVL  695



>ref|XP_008462373.1| PREDICTED: uncharacterized protein At1g51745-like [Cucumis melo]
Length=828

 Score =   139 bits (351),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 136/227 (60%), Gaps = 13/227 (6%)
 Frame = +3

Query  285  FIDWSR-------NSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHV  443
              +WS+       N+   +++MK    D  +P++ LPYR SRF V+ +Y+  +F +R+H 
Sbjct  604  LCEWSKQVSYRKPNASDLKTEMKQLLDDPLVPQKLLPYRQSRFAVH-RYQMSEFYVRNHG  662

Query  444  IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASN  623
             A+S L DV++EVK+ YR +H+P +SLMSKLNG+ I GH L VE+++DG CD LL  A +
Sbjct  663  -ANSLLYDVELEVKASYRPQHVPLVSLMSKLNGKAIVGHPLTVEIVEDGHCDSLLSRADS  721

Query  624  CHDLDDDSAPKGVDMVN---KTKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLTG  794
              + D+     G    N   + K S     QP  S +KS + KK   L KK+R+LSSLTG
Sbjct  722  EREGDEHCYVTGKHSANARTQAKQSKQSPSQPCFSPSKSPRMKKSGHLCKKIRKLSSLTG  781

Query  795  PRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
             R QN+ K   VQ+     I C+PLKVVFSRI  A++   RP+H  +
Sbjct  782  NRHQNQPKR-MVQKSSDHVITCIPLKVVFSRINEAVSGLARPSHHAL  827



>ref|XP_007024422.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007024423.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY27044.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY27045.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=786

 Score =   139 bits (350),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 135/229 (59%), Gaps = 28/229 (12%)
 Frame = +3

Query  285  FIDWSRNSPHKESQMKGPTADLPI-------PRRSLPYRLSRFVVNPKYESPDFSLRHHV  443
            F DW   S  +E + +GP  +  I       P+R LPYR SR+ V+ +Y+  DF  + + 
Sbjct  560  FQDWKAMS--REPRARGPIVEAKILPDGSVTPQRLLPYRQSRYTVHSRYQMTDFPGKPYS  617

Query  444  IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS-  620
             ADSS  DVK+EVK+ YR +H+P +SLMSKLNG+ I GH L VEVL D +   L   A+ 
Sbjct  618  -ADSSFYDVKIEVKANYRPQHVPLLSLMSKLNGKAIIGHPLTVEVLSDDYYGSLTREAAM  676

Query  621  NCHDLDDDSAPKGVDMVNKTKLSFGGR-------LQPRAsstksskskkesmlskkVRRL  779
             C +         + +V K + S GGR       L  R    KS+K+KK  +LSKK+R+L
Sbjct  677  ECTE---------IGLVVK-RNSEGGRVPTKHMKLHSRFLPRKSAKAKKSGLLSKKIRKL  726

Query  780  SSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  926
            SSLTG +    ++   V++ +GP IACVPLK+VFSRI  ALN S RP H
Sbjct  727  SSLTGQKLGLADRKLVVEKPKGPVIACVPLKLVFSRINEALNGSARPTH  775



>gb|KDO58662.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=760

 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 118/351 (34%), Positives = 179/351 (51%), Gaps = 73/351 (21%)
 Frame = +3

Query  69   IVPCASQKGEFS-AGAPSSESGQVETMSCGSGEHNESG--CTNLGNADILDSGPRMGKET  239
            IVP +  K +   +G   S+  +VE ++  +   NESG  C+   +A+ +    RM K T
Sbjct  420  IVPSSPGKPQVGVSGRQPSQCSEVEAVTLRNEGLNESGSPCSMAVHANNISQ--RMEKGT  477

Query  240  SKWQSKGKR-------------------NFRTGNFID-----------------------  293
            SKWQSKGKR                   N     F+D                       
Sbjct  478  SKWQSKGKRKSRHMSKNRKQASRKYSDMNDEPNTFVDSLHRLDGLPHGSFDHKVDCDSIR  537

Query  294  ------------WSRNSPH-KESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLR  434
                        W ++ PH + +++K  + +   P+RSLP+R +R+ V+ +Y+  DF +R
Sbjct  538  GSKLKSETEEQPWGKSLPHMRTTEVKLLSDESLNPKRSLPFRQTRYTVHSRYQ--DFPVR  595

Query  435  HHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVS  614
            + +  DS L +V++ VK+ YR +H+P +SLMSKLNG+ I GH L VEVL DG+CD +   
Sbjct  596  N-LCVDSVLYNVELVVKAGYRRQHVPLVSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESD  654

Query  615  ASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskke----smlskkVRRLS  782
            A+    +  +SAP G  +  K++       + + SS  SS    +      LSKK+R+LS
Sbjct  655  ATRVFVV--ESAPMGYPVKQKSEPGRNSNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLS  712

Query  783  SLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            SLT       E+ P  Q+ +GP I+C+PLK+VFSRI  A+N S RPA+R +
Sbjct  713  SLT----SQVERKPAEQKPKGPVISCIPLKLVFSRINEAVNGSARPANRAL  759



>ref|XP_006466093.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Citrus sinensis]
Length=761

 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 118/351 (34%), Positives = 179/351 (51%), Gaps = 73/351 (21%)
 Frame = +3

Query  69   IVPCASQKGEFS-AGAPSSESGQVETMSCGSGEHNESG--CTNLGNADILDSGPRMGKET  239
            IVP +  K +   +G   S+  +VE ++  +   NESG  C+   +A+ +    RM K T
Sbjct  421  IVPSSPGKPQVGVSGRQPSQCSEVEAVTLRNEGLNESGSPCSMAVHANNISQ--RMEKGT  478

Query  240  SKWQSKGKR-------------------NFRTGNFID-----------------------  293
            SKWQSKGKR                   N     F+D                       
Sbjct  479  SKWQSKGKRKSRHMSKNRKQASRKYSDMNDEPNTFVDSLHRLDGLPHGSFDHKVDCDSIR  538

Query  294  ------------WSRNSPH-KESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLR  434
                        W ++ PH + +++K  + +   P+RSLP+R +R+ V+ +Y+  DF +R
Sbjct  539  GSKLKSETEEQPWGKSLPHMRTTEVKLLSDESLNPKRSLPFRQTRYTVHSRYQ--DFPVR  596

Query  435  HHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVS  614
            + +  DS L +V++ VK+ YR +H+P +SLMSKLNG+ I GH L VEVL DG+CD +   
Sbjct  597  N-LCVDSVLYNVELVVKAGYRRQHVPLVSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESD  655

Query  615  ASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskke----smlskkVRRLS  782
            A+    +  +SAP G  +  K++       + + SS  SS    +      LSKK+R+LS
Sbjct  656  ATRVFVV--ESAPMGYPVKQKSEPGRNSNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLS  713

Query  783  SLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            SLT       E+ P  Q+ +GP I+C+PLK+VFSRI  A+N S RPA+R +
Sbjct  714  SLT----SQVERKPAEQKPKGPVISCIPLKLVFSRINEAVNGSARPANRAL  760



>gb|KDO58660.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=762

 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 118/351 (34%), Positives = 179/351 (51%), Gaps = 73/351 (21%)
 Frame = +3

Query  69   IVPCASQKGEFS-AGAPSSESGQVETMSCGSGEHNESG--CTNLGNADILDSGPRMGKET  239
            IVP +  K +   +G   S+  +VE ++  +   NESG  C+   +A+ +    RM K T
Sbjct  422  IVPSSPGKPQVGVSGRQPSQCSEVEAVTLRNEGLNESGSPCSMAVHANNISQ--RMEKGT  479

Query  240  SKWQSKGKR-------------------NFRTGNFID-----------------------  293
            SKWQSKGKR                   N     F+D                       
Sbjct  480  SKWQSKGKRKSRHMSKNRKQASRKYSDMNDEPNTFVDSLHRLDGLPHGSFDHKVDCDSIR  539

Query  294  ------------WSRNSPH-KESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLR  434
                        W ++ PH + +++K  + +   P+RSLP+R +R+ V+ +Y+  DF +R
Sbjct  540  GSKLKSETEEQPWGKSLPHMRTTEVKLLSDESLNPKRSLPFRQTRYTVHSRYQ--DFPVR  597

Query  435  HHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVS  614
            + +  DS L +V++ VK+ YR +H+P +SLMSKLNG+ I GH L VEVL DG+CD +   
Sbjct  598  N-LCVDSVLYNVELVVKAGYRRQHVPLVSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESD  656

Query  615  ASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskke----smlskkVRRLS  782
            A+    +  +SAP G  +  K++       + + SS  SS    +      LSKK+R+LS
Sbjct  657  ATRVFVV--ESAPMGYPVKQKSEPGRNSNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLS  714

Query  783  SLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            SLT       E+ P  Q+ +GP I+C+PLK+VFSRI  A+N S RPA+R +
Sbjct  715  SLT----SQVERKPAEQKPKGPVISCIPLKLVFSRINEAVNGSARPANRAL  761



>ref|XP_006466092.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Citrus sinensis]
Length=763

 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 118/351 (34%), Positives = 179/351 (51%), Gaps = 73/351 (21%)
 Frame = +3

Query  69   IVPCASQKGEFS-AGAPSSESGQVETMSCGSGEHNESG--CTNLGNADILDSGPRMGKET  239
            IVP +  K +   +G   S+  +VE ++  +   NESG  C+   +A+ +    RM K T
Sbjct  423  IVPSSPGKPQVGVSGRQPSQCSEVEAVTLRNEGLNESGSPCSMAVHANNISQ--RMEKGT  480

Query  240  SKWQSKGKR-------------------NFRTGNFID-----------------------  293
            SKWQSKGKR                   N     F+D                       
Sbjct  481  SKWQSKGKRKSRHMSKNRKQASRKYSDMNDEPNTFVDSLHRLDGLPHGSFDHKVDCDSIR  540

Query  294  ------------WSRNSPH-KESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLR  434
                        W ++ PH + +++K  + +   P+RSLP+R +R+ V+ +Y+  DF +R
Sbjct  541  GSKLKSETEEQPWGKSLPHMRTTEVKLLSDESLNPKRSLPFRQTRYTVHSRYQ--DFPVR  598

Query  435  HHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVS  614
            + +  DS L +V++ VK+ YR +H+P +SLMSKLNG+ I GH L VEVL DG+CD +   
Sbjct  599  N-LCVDSVLYNVELVVKAGYRRQHVPLVSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESD  657

Query  615  ASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskke----smlskkVRRLS  782
            A+    +  +SAP G  +  K++       + + SS  SS    +      LSKK+R+LS
Sbjct  658  ATRVFVV--ESAPMGYPVKQKSEPGRNSNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLS  715

Query  783  SLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            SLT       E+ P  Q+ +GP I+C+PLK+VFSRI  A+N S RPA+R +
Sbjct  716  SLT----SQVERKPAEQKPKGPVISCIPLKLVFSRINEAVNGSARPANRAL  762



>gb|KGN45541.1| hypothetical protein Csa_7G451960 [Cucumis sativus]
Length=819

 Score =   138 bits (348),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 95/233 (41%), Positives = 136/233 (58%), Gaps = 29/233 (12%)
 Frame = +3

Query  291  DWSR-------NSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIA  449
            +WS+       N+   +++MK    D  +P++ LPYR SRF V+ +Y+ P+F +R+H  A
Sbjct  597  EWSKQVSYRKPNASELKTEMKQLLDDPLVPQKLLPYRQSRFAVH-RYQMPEFYVRNHG-A  654

Query  450  DSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCH  629
            +  L DV++EVK+ YR +H+P +SLMSKLNG+ I GH L VE+++DG CD LL  A    
Sbjct  655  NPLLYDVELEVKASYRPQHVPLVSLMSKLNGKAIVGHPLTVEIVEDGHCDSLLTRA----  710

Query  630  DLDDDSAPKGVDMV-----------NKTKLSFGGRLQPRAsstksskskkesmlskkVRR  776
                DS P+G +              + K S     QP  S ++S + KK   L KK+R+
Sbjct  711  ----DSEPEGNEQCYVTGKHTAPSRTQAKQSKQSPSQPCFSPSRSPRMKKSGHLCKKIRK  766

Query  777  LSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            LSSLTG R QN+ K   VQ+     I C+PLKVVFSRI  A++   RP+H  +
Sbjct  767  LSSLTGNRHQNQPKR-MVQKSSDHVITCIPLKVVFSRINEAVSGLARPSHHAL  818



>gb|KDO58661.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=751

 Score =   137 bits (345),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 173/338 (51%), Gaps = 72/338 (21%)
 Frame = +3

Query  105  AGAPSSESGQVETMSCGSGEHNESG--CTNLGNADILDSGPRMGKETSKWQSKGKRNFRT  278
            +G   S+  +VE ++  +   NESG  C+   +A+ +    RM K TSKWQSKGKR  R 
Sbjct  424  SGRQPSQCSEVEAVTLRNEGLNESGSPCSMAVHANNISQ--RMEKGTSKWQSKGKRKSRH  481

Query  279  -------------------GNFID-----------------------------------W  296
                                 F+D                                   W
Sbjct  482  MSKNRKQASRKYSDMNDEPNTFVDSLHRLDGLPHGSFDHKVDCDSIRGSKLKSETEEQPW  541

Query  297  SRNSPH-KESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVK  473
             ++ PH + +++K  + +   P+RSLP+R +R+ V+ +Y+  DF +R+ +  DS L +V+
Sbjct  542  GKSLPHMRTTEVKLLSDESLNPKRSLPFRQTRYTVHSRYQ--DFPVRN-LCVDSVLYNVE  598

Query  474  VEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAP  653
            + VK+ YR +H+P +SLMSKLNG+ I GH L VEVL DG+CD +   A+    +  +SAP
Sbjct  599  LVVKAGYRRQHVPLVSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESDATRVFVV--ESAP  656

Query  654  KGVDMVNKTKLSFGGRLQPRAsstksskskke----smlskkVRRLSSLTGPRKQNREKN  821
             G  +  K++       + + SS  SS    +      LSKK+R+LSSLT       E+ 
Sbjct  657  MGYPVKQKSEPGRNSNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLSSLT----SQVERK  712

Query  822  PTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            P  Q+ +GP I+C+PLK+VFSRI  A+N S RPA+R +
Sbjct  713  PAEQKPKGPVISCIPLKLVFSRINEAVNGSARPANRAL  750



>ref|XP_006466095.1| PREDICTED: uncharacterized protein At1g51745-like isoform X4 
[Citrus sinensis]
Length=750

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 173/338 (51%), Gaps = 72/338 (21%)
 Frame = +3

Query  105  AGAPSSESGQVETMSCGSGEHNESG--CTNLGNADILDSGPRMGKETSKWQSKGKRNFRT  278
            +G   S+  +VE ++  +   NESG  C+   +A+ +    RM K TSKWQSKGKR  R 
Sbjct  423  SGRQPSQCSEVEAVTLRNEGLNESGSPCSMAVHANNISQ--RMEKGTSKWQSKGKRKSRH  480

Query  279  -------------------GNFID-----------------------------------W  296
                                 F+D                                   W
Sbjct  481  MSKNRKQASRKYSDMNDEPNTFVDSLHRLDGLPHGSFDHKVDCDSIRGSKLKSETEEQPW  540

Query  297  SRNSPH-KESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVK  473
             ++ PH + +++K  + +   P+RSLP+R +R+ V+ +Y+  DF +R+ +  DS L +V+
Sbjct  541  GKSLPHMRTTEVKLLSDESLNPKRSLPFRQTRYTVHSRYQ--DFPVRN-LCVDSVLYNVE  597

Query  474  VEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAP  653
            + VK+ YR +H+P +SLMSKLNG+ I GH L VEVL DG+CD +   A+    +  +SAP
Sbjct  598  LVVKAGYRRQHVPLVSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESDATRVFVV--ESAP  655

Query  654  KGVDMVNKTKLSFGGRLQPRAsstksskskke----smlskkVRRLSSLTGPRKQNREKN  821
             G  +  K++       + + SS  SS    +      LSKK+R+LSSLT       E+ 
Sbjct  656  MGYPVKQKSEPGRNSNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLSSLT----SQVERK  711

Query  822  PTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            P  Q+ +GP I+C+PLK+VFSRI  A+N S RPA+R +
Sbjct  712  PAEQKPKGPVISCIPLKLVFSRINEAVNGSARPANRAL  749



>ref|XP_006466094.1| PREDICTED: uncharacterized protein At1g51745-like isoform X3 
[Citrus sinensis]
Length=752

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 173/338 (51%), Gaps = 72/338 (21%)
 Frame = +3

Query  105  AGAPSSESGQVETMSCGSGEHNESG--CTNLGNADILDSGPRMGKETSKWQSKGKRNFRT  278
            +G   S+  +VE ++  +   NESG  C+   +A+ +    RM K TSKWQSKGKR  R 
Sbjct  425  SGRQPSQCSEVEAVTLRNEGLNESGSPCSMAVHANNISQ--RMEKGTSKWQSKGKRKSRH  482

Query  279  -------------------GNFID-----------------------------------W  296
                                 F+D                                   W
Sbjct  483  MSKNRKQASRKYSDMNDEPNTFVDSLHRLDGLPHGSFDHKVDCDSIRGSKLKSETEEQPW  542

Query  297  SRNSPH-KESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVK  473
             ++ PH + +++K  + +   P+RSLP+R +R+ V+ +Y+  DF +R+ +  DS L +V+
Sbjct  543  GKSLPHMRTTEVKLLSDESLNPKRSLPFRQTRYTVHSRYQ--DFPVRN-LCVDSVLYNVE  599

Query  474  VEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAP  653
            + VK+ YR +H+P +SLMSKLNG+ I GH L VEVL DG+CD +   A+    +  +SAP
Sbjct  600  LVVKAGYRRQHVPLVSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESDATRVFVV--ESAP  657

Query  654  KGVDMVNKTKLSFGGRLQPRAsstksskskke----smlskkVRRLSSLTGPRKQNREKN  821
             G  +  K++       + + SS  SS    +      LSKK+R+LSSLT       E+ 
Sbjct  658  MGYPVKQKSEPGRNSNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLSSLT----SQVERK  713

Query  822  PTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            P  Q+ +GP I+C+PLK+VFSRI  A+N S RPA+R +
Sbjct  714  PAEQKPKGPVISCIPLKLVFSRINEAVNGSARPANRAL  751



>ref|XP_010690078.1| PREDICTED: uncharacterized protein At1g51745 [Beta vulgaris subsp. 
vulgaris]
Length=710

 Score =   129 bits (325),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 108/276 (39%), Positives = 139/276 (50%), Gaps = 47/276 (17%)
 Frame = +3

Query  222  RMGKETSKWQSKGKRNFRTGNFIDWSR-----NSPHKESQMKGPTADLPIP---------  359
            ++ K  SKWQSKGKR  R  +  D        +  H +S   G   D P P         
Sbjct  435  KVEKSASKWQSKGKRKARYVSKYDEMNCQKKPDVGHDKSDAYGMGLDSPGPSSNGLINGF  494

Query  360  ---------RRSLPYRLS--RFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCY-RTR  503
                     +RS  Y  S  RF+V    E PD       +   +L +V+V V++   + +
Sbjct  495  TDLRKHISSQRSFSYHQSHSRFLVPSSLELPD-------VPSLTLYEVEVTVEATRSQVQ  547

Query  504  HIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVS--ASNCHDLDDDSAPKGVDMVNK  677
            H+PYISLMSKL+G+PITGH +AVE L+DGFCD       AS   +LDD+       +  K
Sbjct  548  HVPYISLMSKLSGKPITGHPVAVEALEDGFCDLQTCDYPASGSCELDDEDTEMDFVIEPK  607

Query  678  TK-----------LSFGGRLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREK-N  821
            TK              G + + +     S   K+    SKK R+LSSLTGP K N EK  
Sbjct  608  TKHIKLQSHFPRRRGKGKKGKGKGKGKSSKSKKRHGSSSKKTRKLSSLTGPHKLNPEKRK  667

Query  822  PTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHR  929
            P VQ  +GPT+ACVPLK+VFSRI  ALN S R AHR
Sbjct  668  PMVQTSKGPTLACVPLKIVFSRINEALNGSTRSAHR  703



>gb|KHG19697.1| hypothetical protein F383_24275 [Gossypium arboreum]
Length=791

 Score =   128 bits (321),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 129/219 (59%), Gaps = 21/219 (10%)
 Frame = +3

Query  315  KESQMKGPTADLPI-------PRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVK  473
            +E +++G  A++ I       P+RSLPYR SR+ V+ +Y+  DF  + + + DSSL +VK
Sbjct  573  QEPRVRGEIAEVKILPDESLSPQRSLPYRQSRYTVHSRYQMKDFPGKAYSV-DSSLYNVK  631

Query  474  VEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAP  653
            +EVK+ YR +H+P +SLMSKLNG+ I GH L V+VL D     L      C      +  
Sbjct  632  IEVKANYRPQHVPLVSLMSKLNGKAIIGHPLMVKVLSDDHYGNL-----TCEAPIKGTEK  686

Query  654  KGVDMVNKTKLSFGGR-------LQPRAsstksskskkesmlskkVRRLSSLTGPRKQNR  812
              +  + K K S GGR       LQ      KS+K+KK  +LSKK R+LSSLTG +    
Sbjct  687  SEIGHLVKRK-SAGGRVPRKHMKLQSHFPPRKSTKAKKSGLLSKKTRKLSSLTGQKIGVG  745

Query  813  EKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHR  929
            ++ P   + +GP IACVP+K+VFSRI  A+N S R  HR
Sbjct  746  DRKPVTGKPKGPVIACVPIKLVFSRINEAVNGSARLTHR  784



>ref|XP_002304109.2| hypothetical protein POPTR_0003s03970g [Populus trichocarpa]
 gb|EEE79088.2| hypothetical protein POPTR_0003s03970g [Populus trichocarpa]
Length=707

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 134/231 (58%), Gaps = 24/231 (10%)
 Frame = +3

Query  270  FRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIA  449
            +R     D S++S H E  M+  T +L +P+R              Y++ DF  R+ + +
Sbjct  493  YRVDAVRDRSKSSSHGEG-MRAATVELSVPQR--------------YQTSDFPGRN-LSS  536

Query  450  DSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS--N  623
             S L +V+++V+  YR +H+P +SLMSKLNG+ I GH L +E LDDG+ D +L S     
Sbjct  537  CSKLFNVEIKVQRNYRQQHVPLVSLMSKLNGKAIVGHPLTIENLDDGYSDLMLGSNERDT  596

Query  624  CHDLDDDS-APKGVDMVNKTKLSFGGR---LQPRAsstksskskkesmlskkVRRLSSLT  791
             H  + ++  P  V M N        R   ++PR+S  KS K +K  +LSKK+R+LSSLT
Sbjct  597  THVTEGETPKPGYVAMRNIEAGRTPARRMTMKPRSSPRKSHKLRKCGLLSKKIRKLSSLT  656

Query  792  GPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            G R ++R+  P V++  GP IAC+PLK+VFSRI  A+N S R  HR +  S
Sbjct  657  GKRVEDRK--PVVEKPEGPVIACIPLKLVFSRINEAVNGSARQTHRALPSS  705



>ref|XP_004154875.1| PREDICTED: uncharacterized protein At1g51745-like [Cucumis sativus]
Length=744

 Score =   120 bits (301),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 126/215 (59%), Gaps = 16/215 (7%)
 Frame = +3

Query  312  HKESQMKG-PTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKS  488
             K ++MK  P     IPR  LP+R SR +   KY+  +FS       +SSL DV++ VK+
Sbjct  530  EKTTKMKQLPDYTWAIPRL-LPFRQSRLMDPSKYQRSEFSFTKFG-CNSSLYDVELLVKA  587

Query  489  CYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSA--------SNCHDLDDD  644
             Y+ +H+P +SLMSKLN + + GH L VE LDDG CD LL  +         + H +  +
Sbjct  588  SYKPQHVPLVSLMSKLNCKAVVGHPLTVEALDDGHCDDLLSRSELDPQKIVESSHSVQSN  647

Query  645  SAPKGVDMVNKTKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNP  824
            S  KG  M+ K +   G  +Q R S  K+SK+KK   LSKK R+LSSLT  ++   +  P
Sbjct  648  SW-KG-KMLGKPR---GRAVQLRPSQGKASKAKKSGQLSKKTRKLSSLTVQKQFVDDSRP  702

Query  825  TVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHR  929
             V++ +G  IAC+PLKVVFSRI  A+N   RP HR
Sbjct  703  VVEKSKGSFIACIPLKVVFSRINEAVNGLARPTHR  737



>gb|KGN59837.1| hypothetical protein Csa_3G849930 [Cucumis sativus]
Length=729

 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 117/197 (59%), Gaps = 14/197 (7%)
 Frame = +3

Query  363  RSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNG  542
            R LP+R SR +   KY+  +FS       +SSL DV++ VK+ Y+ +H+P +SLMSKLN 
Sbjct  532  RLLPFRQSRLMDPSKYQRSEFSFTKFG-CNSSLYDVELLVKASYKPQHVPLVSLMSKLNC  590

Query  543  QPITGHRLAVEVLDDGFCDQLLVS--------ASNCHDLDDDSAPKGVDMVNKTKLSFGG  698
            + + GH L VE LDDG CD LL            + H +  +S  KG  M+ K +   G 
Sbjct  591  KAVVGHPLTVEALDDGHCDDLLSRTELDPQKIVESSHSVQSNSW-KG-KMLGKPR---GR  645

Query  699  RLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVV  878
             +Q R S  K+SK+KK   LSKK R+LSSLT  ++   +  P V++ +G  IAC+PLKVV
Sbjct  646  AVQLRPSQGKASKAKKSGQLSKKTRKLSSLTVQKQFVDDSRPVVEKSKGSFIACIPLKVV  705

Query  879  FSRIKAALNSSIRPAHR  929
            FSRI  A+N   RP HR
Sbjct  706  FSRINKAVNGLARPTHR  722



>ref|XP_004146857.1| PREDICTED: uncharacterized protein At1g51745-like [Cucumis sativus]
Length=780

 Score =   118 bits (295),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 117/197 (59%), Gaps = 14/197 (7%)
 Frame = +3

Query  363  RSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNG  542
            R LP+R SR +   KY+  +FS       +SSL DV++ VK+ Y+ +H+P +SLMSKLN 
Sbjct  583  RLLPFRQSRLMDPSKYQRSEFSFTKFG-CNSSLYDVELLVKASYKPQHVPLVSLMSKLNC  641

Query  543  QPITGHRLAVEVLDDGFCDQLLVS--------ASNCHDLDDDSAPKGVDMVNKTKLSFGG  698
            + + GH L VE LDDG CD LL            + H +  +S  KG  M+ K +   G 
Sbjct  642  KAVVGHPLTVEALDDGHCDDLLSRTELDPQKIVESSHSVQSNSW-KG-KMLGKPR---GR  696

Query  699  RLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVV  878
             +Q R S  K+SK+KK   LSKK R+LSSLT  ++   +  P V++ +G  IAC+PLKVV
Sbjct  697  AVQLRPSQGKASKAKKSGQLSKKTRKLSSLTVQKQFVDDSRPVVEKSKGSFIACIPLKVV  756

Query  879  FSRIKAALNSSIRPAHR  929
            FSRI  A+N   RP HR
Sbjct  757  FSRINKAVNGLARPTHR  773



>ref|XP_008447587.1| PREDICTED: uncharacterized protein At1g51745-like [Cucumis melo]
Length=719

 Score =   114 bits (286),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 115/191 (60%), Gaps = 12/191 (6%)
 Frame = +3

Query  363  RSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNG  542
            R LP+R SRF+ + KY+  +FS       +SSL DV++ VK+ Y+ +H+P +SLMSKLN 
Sbjct  532  RLLPFRQSRFMDHSKYQRSEFSFTKFG-CNSSLYDVELLVKASYKPQHVPLVSLMSKLNC  590

Query  543  QPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVN------KTKLSFGGR-  701
            + + GH L VE LDDG CD LL  +    +LD     +   +V       KT     GR 
Sbjct  591  KAVVGHPLTVEALDDGHCDDLLSRS----ELDLQKIVESSHLVQSNSWKGKTLGKHRGRA  646

Query  702  LQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVF  881
            ++ R S  K+SK+KK   LSKK R+LSSLT  ++   +  P V++ +G  +AC+PLKVVF
Sbjct  647  VKLRPSQGKASKAKKSGQLSKKTRKLSSLTVQKQFVDDSRPVVEKFKGSFVACIPLKVVF  706

Query  882  SRIKAALNSSI  914
            SRI  A+N  I
Sbjct  707  SRINEAVNGPI  717



>ref|XP_010267045.1| PREDICTED: uncharacterized protein At1g51745-like [Nelumbo nucifera]
 ref|XP_010267046.1| PREDICTED: uncharacterized protein At1g51745-like [Nelumbo nucifera]
Length=880

 Score =   114 bits (286),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 124/230 (54%), Gaps = 35/230 (15%)
 Frame = +3

Query  354  IPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSK  533
            +  RSLP   SRF   P+Y++   + R ++   S+L DV ++V++ YR +H+P +SLMSK
Sbjct  651  MSHRSLPLHQSRFTTYPRYQTAG-APRRNISGTSTLFDVNLDVRASYRGQHVPLVSLMSK  709

Query  534  LNGQPITGHRLAVEVLDDGFCD---------------QLL-----------VSASNCHDL  635
            LNG+ I GH + VEVLD G+ D               +L            ++ SN   +
Sbjct  710  LNGKAIIGHPVTVEVLDTGYRDLQTSNTNYCAASSGTELYDISKENISDQSINVSNSSPI  769

Query  636  DDDSAPKGVDMVNKT-------KLSFGGRLQPRAsstksskskkesmlskkVRRLSSLTG  794
             ++    GV++  +T        L+    +QP     KS K KK  +LSKK R+LSSLT 
Sbjct  770  PEEGDNAGVNLQAETVEPQSNQALAKHLTVQPTLLPKKSPKFKKSGLLSKKTRKLSSLTV  829

Query  795  PRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
             +     + P V+   GP IACVPLKVVFSR+KAA+N S RP H + A +
Sbjct  830  SQDHREGRKPVVEN-SGPVIACVPLKVVFSRLKAAVNCSTRPVHHVSAST  878



>ref|XP_004155975.1| PREDICTED: uncharacterized protein At1g51745-like [Cucumis sativus]
Length=657

 Score =   110 bits (276),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 103/176 (59%), Gaps = 20/176 (11%)
 Frame = +3

Query  441  VIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS  620
            ++A+  L DV++EVK+ YR +H+P +SLMSKLNG+ I GH L VE+++DG CD LL  A 
Sbjct  490  LVANPLLYDVELEVKASYRPQHVPLVSLMSKLNGKAIVGHPLTVEIVEDGHCDSLLTRA-  548

Query  621  NCHDLDDDSAPKGVDMV-----------NKTKLSFGGRLQPRAsstksskskkesmlskk  767
                   DS P+G +              + K S     QP  S ++S + KK   L KK
Sbjct  549  -------DSEPEGNEQCYVTGKHTAPSRTQAKQSKQSPSQPCFSPSRSPRMKKSGHLCKK  601

Query  768  VRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            +R+LSSLTG R QN+ K   VQ+     I C+PLKVVFSRI  A++   RP+H  +
Sbjct  602  IRKLSSLTGNRHQNQPKR-MVQKSSDHVITCIPLKVVFSRINEAVSGLARPSHHAL  656



>ref|XP_004141802.1| PREDICTED: uncharacterized protein At1g51745-like [Cucumis sativus]
Length=657

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 103/176 (59%), Gaps = 20/176 (11%)
 Frame = +3

Query  441  VIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS  620
            ++A+  L DV++EVK+ YR +H+P +SLMSKLNG+ I GH L VE+++DG CD LL  A 
Sbjct  490  LVANPLLYDVELEVKASYRPQHVPLVSLMSKLNGKAIVGHPLTVEIVEDGHCDSLLTRA-  548

Query  621  NCHDLDDDSAPKGVDMV-----------NKTKLSFGGRLQPRAsstksskskkesmlskk  767
                   DS P+G +              + K S     QP  S ++S + KK   L KK
Sbjct  549  -------DSEPEGNEQCYVTGKHTAPSRTQAKQSKQSPSQPCFSPSRSPRMKKSGHLCKK  601

Query  768  VRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            +R+LSSLTG R QN+ K   VQ+     I C+PLKVVFSRI  A++   RP+H  +
Sbjct  602  IRKLSSLTGNRHQNQPKR-MVQKSSDHVITCIPLKVVFSRINEAVSGLARPSHHAL  656



>gb|KHG25774.1| hypothetical protein F383_10403 [Gossypium arboreum]
Length=656

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 97/307 (32%), Positives = 145/307 (47%), Gaps = 67/307 (22%)
 Frame = +3

Query  165  HNESGCTNLGNADILDSGPRMGKETSKWQSKGKRNFR-------------------TGNF  287
            HNESG T L   D   +  RM +  + WQ KGKR  R                   + + 
Sbjct  364  HNESGFTRLVAIDTNSTSQRMEEGATDWQLKGKRRMRQISKFHKRGLRKYVHMDDESKHS  423

Query  288  IDWSRNSPHK----------------ESQMKGPTADLPI-------PRRSLPYRLSRFVV  398
              +SR S  K                E +++GP  +  I        RRSL Y    + V
Sbjct  424  YGFSRGSDQKVEEQLDGFQDCKSMSQEPRVRGPIVEAKILPGRSMTSRRSLLYHHCHYTV  483

Query  399  NPKYESPDFSLRHHVI--ADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAV  572
            N +Y   +F   H +    DSSL DV++EVK+ YR +H+  +SL+SK+NG+ + GH L V
Sbjct  484  NSRYLMTEF---HGITDSTDSSLYDVRIEVKANYRPQHVQLVSLVSKVNGKALIGHPLTV  540

Query  573  EVLDDGFCDQLLVSASNCH--DLDDDSAPKGVDMVNKTKLSFGG-------RLQPRAsst  725
            E           VS+ +C+  DL  + A +  ++ +  K + GG       +++ R  S 
Sbjct  541  E-----------VSSDDCYYGDLTHEVAMECTEVGHLVKQNPGGLISTKHMKMESRFPSH  589

Query  726  ksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALN  905
            KS+K KK  + SKK R+L SL  P+    +     ++ +G  IAC+ +K+ FSRI  ALN
Sbjct  590  KSAKVKKTGLSSKKTRKLISLNCPKPGVDDWKLVTKKFKGHEIACIAVKLAFSRINEALN  649

Query  906  SSIRPAH  926
            +S  P H
Sbjct  650  NSNTPRH  656



>ref|XP_010545639.1| PREDICTED: uncharacterized protein At1g51745-like [Tarenaya hassleriana]
Length=717

 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 91/267 (34%), Positives = 130/267 (49%), Gaps = 32/267 (12%)
 Frame = +3

Query  168  NESGCTNLGNADILDSGPRMGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTAD  347
            N S C + G   +  S   + K TSKWQ KGKRN R        + S  +E++      +
Sbjct  458  NVSVCMSPGAKRVSGSINGIEKSTSKWQIKGKRNSR--------QMSKKQEARRTADADE  509

Query  348  LPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIA-------DSSLTDVKVEVKSCY-RTR  503
               P       LSRF ++ +   P  S     +        +S L +VK+EVK+ Y + R
Sbjct  510  TNDP-------LSRFFMSGQRGQPRLSANSCYMTRGDQTERNSGLYEVKIEVKANYNKPR  562

Query  504  HIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQL-LVSASNCHDL-----DDDSAPKGVD  665
            ++P +SLMSKLNG+ I GH L+VE L+DG CD   +V A +   +     DDD+      
Sbjct  563  NVPLVSLMSKLNGKAIVGHPLSVEPLEDGSCDHHHIVRAFDDVPMVDGGDDDDAHVNPKP  622

Query  666  MVNKTKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRG  845
              +K K      + PR  S     S          RRLS+LTG + + R K    ++ +G
Sbjct  623  SSSKKKKKKKTNMPPRKPSKSKKPSSSLLKK---TRRLSALTGHKPRGRGKKEMEEKPKG  679

Query  846  PTIACVPLKVVFSRIKAALNSSIRPAH  926
              +AC+PLK+VFSRI  A+ SS R  H
Sbjct  680  QVVACIPLKLVFSRINEAVKSSTRQMH  706



>ref|XP_010924938.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
 ref|XP_010924939.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
Length=830

 Score =   102 bits (255),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 114/226 (50%), Gaps = 36/226 (16%)
 Frame = +3

Query  330  KGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHV-------IADSSLTDVKVEVKS  488
            +G    + +P  ++P  L +   N +   P FS +H V         DS L DV++ V++
Sbjct  612  RGSANMVDVPISTIP--LQQLFANYQVHLPAFS-KHQVPKPSRSMSMDSLLFDVELNVQA  668

Query  489  CYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDM  668
             Y+  HIP +S MSKLNG+ I GH ++VEVL DG    L+     C  + +      +D 
Sbjct  669  SYQGPHIPLVSFMSKLNGKAIVGHPISVEVLQDGAAAALVPRNVWCAPISN------IDH  722

Query  669  VNKTKLSFGGRLQPRAsstksskskkesmlskk-------------------VRRLSSLT  791
              K +++  G+ QP+ S       K +    K                    +RRLSS+ 
Sbjct  723  SLKNRINIIGKSQPKESHLNIQGKKADHTKVKSPLMKKKSSKNKRSGFSPRKIRRLSSIA  782

Query  792  GPRKQNR-EKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  926
              RK  + E+ P V++++GP +ACVPL++VFSRI  AL+ S RPA+
Sbjct  783  VDRKDKKEERQPMVEKIKGPAVACVPLRLVFSRINEALSCSARPAN  828



>ref|XP_010911968.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
 ref|XP_010911976.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
Length=824

 Score =   102 bits (254),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 113/218 (52%), Gaps = 40/218 (18%)
 Frame = +3

Query  342  ADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHV-------IADSSLTDVKVEVKSCYRT  500
            A   +P  ++P R S   VN +   P FS RH V       + DS L DV++ V++ Y+ 
Sbjct  614  APFTVPVSTIPPRQS--FVNHQVHLPAFS-RHQVPKPVRSLLMDSLLFDVELNVQASYQG  670

Query  501  RHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKT  680
             H+P +SLMSKLNG+PI GH ++VE L+DG    L+     C           +D   K 
Sbjct  671  PHVPLVSLMSKLNGKPIVGHPISVEALEDGAAVALVTRNGRC------PITSNIDRSLKN  724

Query  681  KLSFGGRLQPRAsstksskskkesmls-----------------------kkVRRLSSLT  791
            ++S   +LQPR   T+S+ + +    +                       +K+RRLSS+ 
Sbjct  725  RISMIDKLQPREYKTQSNLNIQGKKANHIKVKSPSMKKKSSKNKKSGFSPRKIRRLSSIA  784

Query  792  GPRK-QNREKNPTVQQLRGPTIACVPLKVVFSRIKAAL  902
              +K +  E+ P V++++GP +ACVPL++VFSRI  AL
Sbjct  785  VDQKYKQEERKPMVEKIKGPAVACVPLRLVFSRINEAL  822



>ref|XP_007043473.1| Tudor/PWWP/MBT superfamily protein [Theobroma cacao]
 gb|EOX99304.1| Tudor/PWWP/MBT superfamily protein [Theobroma cacao]
Length=264

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 100/161 (62%), Gaps = 10/161 (6%)
 Frame = +3

Query  447  ADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS-N  623
            ADSS+ DVK+EVK+ YR +H+P +SLMSKLNG+ I GH L V+VL D +   L   A+  
Sbjct  96   ADSSIYDVKIEVKANYRPQHVPLVSLMSKLNGKAIIGHPLTVQVLSDDYYGSLPCEAAVE  155

Query  624  CHDLD---DDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLTG  794
            C ++      ++  G   V  T +    R  PR    KS+K+KK  +LS+K+R+LSSLTG
Sbjct  156  CTEIGPAVKRNSEGG--RVPTTHMRLHSRFPPR----KSAKAKKSGLLSEKIRKLSSLTG  209

Query  795  PRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  917
             +    ++   V++ +GP  ACV LK+VFSRI  ALN S R
Sbjct  210  QKLGLADRKLVVEKPKGPVRACVLLKLVFSRIDEALNGSAR  250



>ref|XP_008809885.1| PREDICTED: uncharacterized protein At1g51745-like [Phoenix dactylifera]
Length=777

 Score =   100 bits (248),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/230 (32%), Positives = 118/230 (51%), Gaps = 40/230 (17%)
 Frame = +3

Query  330  KGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHV-------IADSSLTDVKVEVKS  488
            +G +  + +P  ++P + S    + +   P FS +H V         DS L DV++ V++
Sbjct  555  RGTSFTVDVPISTIPPQQS--FADHQVHLPAFS-KHQVPKPIRSMSMDSLLFDVELNVQA  611

Query  489  CYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDM  668
             Y+  HIP +SL SKLNG+ I GH ++VEVL DG    L+     C  + +      +D 
Sbjct  612  SYQGPHIPLVSLTSKLNGKAIVGHPISVEVLQDGATAALVTRNGWCPPISN------IDH  665

Query  669  VNKTKLSFGGRLQPRAsstksskskkesmlskk-----------------------VRRL  779
              K +++  G+L+P+  +T+S  + +                              +RRL
Sbjct  666  SLKNRINIIGKLRPKGYTTQSHLNIQGKKADHTKVKSPLLKKKSSNNKKSGFSPRKIRRL  725

Query  780  SSLTGPRKQNRE-KNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  926
            SS+   RK N E + P V++++GP +ACVPL++VFSRI  AL+ S RPA+
Sbjct  726  SSIAVDRKDNEEERKPMVEKIKGPAVACVPLRLVFSRINEALSCSARPAN  775



>ref|XP_006406288.1| hypothetical protein EUTSA_v10020246mg [Eutrema salsugineum]
 gb|ESQ47741.1| hypothetical protein EUTSA_v10020246mg [Eutrema salsugineum]
Length=655

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 124/237 (52%), Gaps = 23/237 (10%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
            TSKWQ KGKRN         SR    K+ + +   A+      S P+  S +   P    
Sbjct  431  TSKWQLKGKRN---------SRQMSKKQEERRNAFAE-EANNNSRPH-CSVYDQKPHVH-  478

Query  417  PDFSLRHHVIA-DSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGF  593
              FS+    +  +S L DVK+EVK+ Y+ R +P ISL SKLNG+ I GH L VEVL DG 
Sbjct  479  --FSVGTQAMGRNSQLYDVKIEVKANYKPRSVPLISLRSKLNGEAIVGHPLTVEVLQDGS  536

Query  594  CDQLLVSASNCHDLDDDSAP--KGVDMVNKTKLSFGGRLQPRAsstksskskkesmlskk  767
            CD++L     C  +   + P   GV     T      + +P     KSSKSKK S LSKK
Sbjct  537  CDRIL-----CSHIKSLAVPMVDGVVKPKPTWKKKSKKKKPNIPPHKSSKSKKPSALSKK  591

Query  768  VRRLSSLTGPR-KQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
             R LS+L+G +   +  K   +++ +   +AC+PLKVVFSRI  A+  S R  HR +
Sbjct  592  TRCLSALSGQKLTVSSNKKVMIEKTKERIVACIPLKVVFSRINEAVKGSARQVHRAL  648



>ref|XP_010535212.1| PREDICTED: uncharacterized protein At1g51745 [Tarenaya hassleriana]
Length=660

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 97/265 (37%), Positives = 130/265 (49%), Gaps = 47/265 (18%)
 Frame = +3

Query  219  PRMGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVV  398
            P + K +S+WQ KGKRN R  +     +  P ++         LP    S      RF  
Sbjct  416  PGIEKSSSEWQLKGKRNSRQMS----RKQEPRRKEDTDETKDSLPQCSVSGQEGQPRFNF  471

Query  399  NPKYESPDFSLRHHVIADSSLT-DVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVE  575
            N +Y + D + R     DS+L  +VK+EVK+ Y+ R++P +SL SKLNG+ I G+ LAVE
Sbjct  472  NTRYRTRDQTGR-----DSALYYEVKIEVKANYKPRNVPMVSLRSKLNGKAIVGNPLAVE  526

Query  576  VLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRA-------------  716
            VL DG       S+SN    DD      V MV+   +   G+L                 
Sbjct  527  VLGDG-------SSSNIRAFDD------VPMVDDAVM---GQLVKPKSSSSKRKSVKKKK  570

Query  717  --------sstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLK  872
                    +   SSKSKK S LSKK RRLS+LTG +   R K    ++ +   +AC+PLK
Sbjct  571  KKKKPHIPTRKSSSKSKKTSSLSKKTRRLSALTGHKPGERGKKVMAEKPKEQVVACIPLK  630

Query  873  VVFSRIKAALNSSIRPAHRLIAPSI  947
            VVFSRI  A+  S R  H    PSI
Sbjct  631  VVFSRINEAVKGSTRQLHHRPLPSI  655



>ref|NP_001078195.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE76489.1| uncharacterized protein AT3G21295 [Arabidopsis thaliana]
Length=645

 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 87/237 (37%), Positives = 124/237 (52%), Gaps = 28/237 (12%)
 Frame = +3

Query  225  MGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNP  404
            + K TSKWQ KGKRN         SR    K+ + +   A+      +LP+    + V+ 
Sbjct  426  IKKSTSKWQLKGKRN---------SRQMSKKQVERRNAYAE-EANNNALPH----WSVSD  471

Query  405  KYESPDFSLRHHVIA-DSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVL  581
            +     FS+    +  +S L DVK+EVK+ Y+ R++P ISL SKLNG+ I GH   VEVL
Sbjct  472  QKPRSLFSVGTQAMGRNSELYDVKIEVKANYKPRNVPLISLRSKLNGEAIVGHPSVVEVL  531

Query  582  DDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskkesmls  761
            +DG C  ++ S    H +DD          +K K        P+A     SKSKK S L+
Sbjct  532  EDGSCGHIVSS----HRIDDAKPKPSSKKKSKKKKPH---FPPQA-----SKSKKSSSLA  579

Query  762  kkVRRLSSLTGPR-KQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHR  929
             K R LS+L+G +   + +K   ++  +   +AC+PLKVVFSRI  A+  S R  HR
Sbjct  580  IKTRCLSALSGQKLTLSSKKKVMIESTKERIVACIPLKVVFSRINEAVKGSARQVHR  636



>gb|EPS60051.1| hypothetical protein M569_14754, partial [Genlisea aurea]
Length=516

 Score = 95.5 bits (236),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 114/244 (47%), Gaps = 62/244 (25%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
             S+W SKGKRN R         ++   ES   G        +R LP RLSR+ VNPKY+ 
Sbjct  317  ASEWLSKGKRNSRLRRV-----DAEEDESLPDGS-------KRLLPNRLSRYAVNPKYDP  364

Query  417  PDFSLRHH---VIADSSLTDVKVEVKSCYRTRH------IPYISLMSKLNGQPITGHRLA  569
             +F LRHH    I    L DV VE K   R  H      +PY+SL S+ NG PI GH + 
Sbjct  365  AEFPLRHHHHHRIPSPRLYDVAVEEKPSSRPHHHQQRNHVPYVSLASEANGAPIAGHPVT  424

Query  570  VEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskke  749
            VEVLD G CD L+ +                     +K + G R + ++           
Sbjct  425  VEVLDRGSCDGLVAA---------------------SKPAAGSRSRRKS-----------  452

Query  750  smlskkVRRLSSLTGPRKQN---------REKNPTVQQLRGPTIACVPLKVVFSRIKAAL  902
             + SKK R+LSS T   KQ          +++    QQ +  ++ CVP+++VF RI AAL
Sbjct  453  GIQSKKTRKLSSFTAAGKQQATIENSKQQQQQKHQKQQQQPSSVTCVPIRIVFGRINAAL  512

Query  903  NSSI  914
            +  +
Sbjct  513  SERL  516



>ref|XP_010510070.1| PREDICTED: uncharacterized protein At1g51745 [Camelina sativa]
Length=650

 Score = 95.9 bits (237),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 127/247 (51%), Gaps = 33/247 (13%)
 Frame = +3

Query  231  KETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKY  410
            K TSKWQ KGKRN R  +     R + + E+                   LSR  V+ + 
Sbjct  426  KSTSKWQLKGKRNSRQMSKKQEERRNAYAEANNNF---------------LSRCSVSDQK  470

Query  411  ESPDFSLRHHVIA-DSSLTDVKVE-VKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLD  584
             +  FS     +  +S + DVK+E VK+ Y+ R++P ISL SKLNG+ I GH   VEVL+
Sbjct  471  LNGHFSFGTRALGKNSEMYDVKIEEVKASYKPRNVPLISLRSKLNGEAIVGHPSTVEVLE  530

Query  585  DGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsst-----ksskskke  749
            DG CD ++ S  N         P GV MV+  K     + + +   +     KSSKS K 
Sbjct  531  DGSCDLIVSSHLN---------PLGVPMVDDAKPKPSSKKKAKKKKSHFPPYKSSKSNKS  581

Query  750  smlskkVRRLSSLTGPR-KQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  926
              LS K R LS+L+G +   + +K   +++ +   +AC+PLKV FSRI  AL  S R  H
Sbjct  582  LSLSIKTRCLSTLSGQKLTVSCKKKVMIEKTKERVVACIPLKVAFSRINEALKGSTRQVH  641

Query  927  RLIAPSI  947
            R + PS+
Sbjct  642  RAL-PSV  647



>ref|XP_008797875.1| PREDICTED: uncharacterized protein At1g51745-like [Phoenix dactylifera]
Length=830

 Score = 92.8 bits (229),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 110/222 (50%), Gaps = 46/222 (21%)
 Frame = +3

Query  354  IPRRSLPYRLSRFVVNPKYESPDFSLRHHV-------IADSSLTDVKVEVKSCYRTRHIP  512
            +PR+S          N     P FS RH V       + DS L DV++ V++ Y+  H+P
Sbjct  622  LPRQSF--------ANHHVHLPAFS-RHQVPKPVRSLLMDSILFDVELNVQASYQGPHVP  672

Query  513  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSF  692
             +SLMSKLNG+ I GH ++VEVL DG     +     C                + ++S 
Sbjct  673  LVSLMSKLNGKAIVGHPISVEVLQDGATVAPVTRNEWC------PITSNTGQSVRNRISG  726

Query  693  GGRLQPRAsstksskskkesmlsk-----------------------kVRRLSSLTGPRK  803
             G+LQP+  +T+S  + +    +                        K+RRLSS+   +K
Sbjct  727  MGKLQPKEHTTQSHCNIQGKKTNHIKVKSPVMKKKSSKNKKSGFSPRKIRRLSSIAVDQK  786

Query  804  -QNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  926
             +  E+ P V++++GP +ACVPL++VFSRI  AL+ S RPA+
Sbjct  787  YKQEERKPMVEKIKGPAVACVPLRLVFSRINEALSCSGRPAN  828



>ref|XP_009410801.1| PREDICTED: uncharacterized protein At1g51745-like [Musa acuminata 
subsp. malaccensis]
Length=807

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 89/177 (50%), Gaps = 35/177 (20%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHD  632
            S L DV+V V+S YR  H+P ISLMSK N + I GH + +EV++DG  D LL +      
Sbjct  639  SCLYDVEVTVQSSYRGPHVPLISLMSKSNSKEIVGHPVPIEVVEDGLVDTLLTTRHIDQS  698

Query  633  LDD------DSAPK---------------GVDMVNKTKLSFGGRLQPRAsstksskskke  749
            L D       S PK                V  V   K  +    +PR            
Sbjct  699  LKDGGNSIGKSLPKRKSAQMYLNVVGINCEVTNVTSLKRKYSKNRKPRL-----------  747

Query  750  smlskkVRRLSSLTGPRKQN-REKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  917
                +K+RRLSS+   +K+   E+ P V+++ GP +ACVPL++VFSRI  AL+SS R
Sbjct  748  --SPRKIRRLSSINVDQKEKGEERKPVVEKMVGPAVACVPLRLVFSRITEALSSSTR  802



>ref|XP_006297135.1| hypothetical protein CARUB_v10013137mg [Capsella rubella]
 gb|EOA30033.1| hypothetical protein CARUB_v10013137mg [Capsella rubella]
Length=669

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 119/233 (51%), Gaps = 21/233 (9%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
            T+KWQ KGKRN R  +     R + + E+                   LS   V+ +   
Sbjct  448  TTKWQIKGKRNSRQMSKKQEERRNAYAEANNNF---------------LSGCSVSDQKIY  492

Query  417  PDFSLRHHVIA-DSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGF  593
              FS     +  +S + +VK+EVK+ Y+ R++P ISL SKLNG+ I GH   VEVL+DG 
Sbjct  493  GQFSFGTSTMGRNSEMYNVKIEVKANYKPRNVPLISLRSKLNGEAIVGHPSTVEVLEDGS  552

Query  594  CDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskkesmlskkVR  773
            CD+++ S  +   +  D   K      K        + P     KSSKSKK S LS K R
Sbjct  553  CDRIVSSHLDPFAVPMDDDEKPKPSSKKKGKKKKSHIPP----YKSSKSKKSSSLSIKTR  608

Query  774  RLSSLTGPR-KQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHR  929
             LS+L+G +   + +K   +++ +   +AC+PLKVVFSRI  AL  S R  HR
Sbjct  609  CLSTLSGQKLTASSKKKMMIEKTKDRIVACIPLKVVFSRINEALKGSTRQVHR  661



>ref|XP_006392999.1| hypothetical protein EUTSA_v10011307mg [Eutrema salsugineum]
 gb|ESQ30285.1| hypothetical protein EUTSA_v10011307mg [Eutrema salsugineum]
Length=643

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 88/262 (34%), Positives = 121/262 (46%), Gaps = 51/262 (19%)
 Frame = +3

Query  165  HNESGCTNLGNADILDSGPRMGKETSKWQSKGKRNFR-TGNFIDWSRNSPHKESQMKGPT  341
            +N S CTN        +G  + K TSKWQ KGKRN R      + SRN   +E+    P 
Sbjct  427  NNGSACTNPPAVHCNLNG--IEKNTSKWQLKGKRNSRQMSKKQEASRNVYGEEANNNSP-  483

Query  342  ADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTDVKVEVKSCY-RTRHIPYI  518
              LP+                                S+L +V++EVK+ Y + R++P +
Sbjct  484  --LPL--------------------------------STLHEVRIEVKANYNKPRNVPLV  509

Query  519  SLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGG  698
            S MS+LNG+ I GH L VEVL++G+C+ + +S               V+    +K     
Sbjct  510  SRMSELNGKAIVGHPLTVEVLEEGYCNGMGMSQV------------IVNAKLLSKKKSKK  557

Query  699  RLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVV  878
            R    A    S  +KK S L KK RRLS+LT  R   R K  T ++ +   +AC+PLKVV
Sbjct  558  RKSHGALRKASKSNKKSSSLLKKTRRLSTLTSQRLTERSKKQTTEKAKETVVACIPLKVV  617

Query  879  FSRIKAALNSSIRPAHRLIAPS  944
            FSRI   L  S R       PS
Sbjct  618  FSRINQVLKGSARQTQHRALPS  639



>ref|XP_010500760.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Camelina sativa]
Length=644

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 109/240 (45%), Gaps = 52/240 (22%)
 Frame = +3

Query  231  KETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKY  410
            K TSKWQ KGKRN         SR    K+   +    +      S+P+           
Sbjct  451  KSTSKWQLKGKRN---------SRQMSKKQEARRTVYGEQANNNSSVPH-----------  490

Query  411  ESPDFSLRHHVIADSSLTDVKVEVKSCYRT-RHIPYISLMSKLNGQPITGHRLAVEVLDD  587
                          S L +VK+EVK  Y+  R++P +S MS+LNG+ I GH + VE+L++
Sbjct  491  --------------SGLYEVKIEVKENYKKPRNVPLVSRMSELNGKAIVGHPITVEILEE  536

Query  588  GFCDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSFGGRLQPRAsstksskskkesmlsk  764
            G+C+ +++S                 +V KTK LS     + ++     +  KK S  S 
Sbjct  537  GYCNGVVMS----------------QVVVKTKSLSKKNGKKRKSRGASWNTKKKSSSQSI  580

Query  765  kVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            K RRLS+LT  R   + K     + +   +AC+PLKVVFSRI   L  S R       PS
Sbjct  581  KTRRLSTLTSQRLTEKIKKQATGKAKETVVACIPLKVVFSRINQVLKGSARQTQHRALPS  640



>ref|XP_010500759.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
Length=645

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 109/240 (45%), Gaps = 52/240 (22%)
 Frame = +3

Query  231  KETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKY  410
            K TSKWQ KGKRN         SR    K+   +    +      S+P+           
Sbjct  452  KSTSKWQLKGKRN---------SRQMSKKQEARRTVYGEQANNNSSVPH-----------  491

Query  411  ESPDFSLRHHVIADSSLTDVKVEVKSCYRT-RHIPYISLMSKLNGQPITGHRLAVEVLDD  587
                          S L +VK+EVK  Y+  R++P +S MS+LNG+ I GH + VE+L++
Sbjct  492  --------------SGLYEVKIEVKENYKKPRNVPLVSRMSELNGKAIVGHPITVEILEE  537

Query  588  GFCDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSFGGRLQPRAsstksskskkesmlsk  764
            G+C+ +++S                 +V KTK LS     + ++     +  KK S  S 
Sbjct  538  GYCNGVVMS----------------QVVVKTKSLSKKNGKKRKSRGASWNTKKKSSSQSI  581

Query  765  kVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            K RRLS+LT  R   + K     + +   +AC+PLKVVFSRI   L  S R       PS
Sbjct  582  KTRRLSTLTSQRLTEKIKKQATGKAKETVVACIPLKVVFSRINQVLKGSARQTQHRALPS  641



>ref|XP_006304889.1| hypothetical protein CARUB_v10012660mg [Capsella rubella]
 gb|EOA37787.1| hypothetical protein CARUB_v10012660mg [Capsella rubella]
Length=643

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 84/240 (35%), Positives = 112/240 (47%), Gaps = 52/240 (22%)
 Frame = +3

Query  231  KETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKY  410
            K TSKWQ KGKRN R                QM            S    L R V   + 
Sbjct  450  KSTSKWQLKGKRNSR----------------QM------------SKKQELRRTVYGEEA  481

Query  411  ESPDFSLRHHVIADSSLTDVKVEVKSCY-RTRHIPYISLMSKLNGQPITGHRLAVEVLDD  587
             + + S+ H     S L +VK+EVKS Y + R++P +S MS+LNG+ I GH L VE+L++
Sbjct  482  NN-NSSMPH-----SGLYEVKIEVKSNYSKPRNVPLVSRMSELNGKAIVGHPLTVEILEE  535

Query  588  GFCDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSFGGRLQPRAsstksskskkesmlsk  764
             +C+ +++S                 +V KTK L      + ++        KK S LS 
Sbjct  536  DYCNGVVMS----------------QVVVKTKSLPKKNGKKRKSRGACWKPKKKSSSLSI  579

Query  765  kVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            K RRLSSLT  R   R K  T  + +   +AC+PLKVVFSRI   L  S R       PS
Sbjct  580  KTRRLSSLTSQRLTERSKKHTTGKAKQTVVACIPLKVVFSRINEVLKGSARQTQHRALPS  639



>ref|XP_009145492.1| PREDICTED: uncharacterized protein At1g51745 [Brassica rapa]
Length=604

 Score = 89.4 bits (220),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 91/247 (37%), Positives = 123/247 (50%), Gaps = 47/247 (19%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
            TSKWQ KGKRN R  +     R   + E               SLP+  S    NP    
Sbjct  383  TSKWQIKGKRNPRQMSKKQEERRLAYAEEA----------NNNSLPH-CSLSDQNPHGH-  430

Query  417  PDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFC  596
              FS    +  +S L DVK+E K  Y+ R++P ISLMSKL+G+ I GH L VEVL DG C
Sbjct  431  --FS---GMGRNSQLYDVKIEEKGSYKPRNVPMISLMSKLDGEAIVGHPLTVEVLQDGSC  485

Query  597  DQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsst-------------kssk  737
            D++L     C  +     P    MV        G ++P+ S               KSSK
Sbjct  486  DRIL-----CSHIKSLVVP----MV-------AGDVKPKPSWKNKSKKKKPHIPPHKSSK  529

Query  738  skkesmlskkVRRLSSLTGPR-KQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSI  914
            SKK S LS K R LS+L+G +   + +K   +++++   ++C+PLKVVFSRI  A+  S 
Sbjct  530  SKKASSLSVKTRCLSALSGQKLTVSSKKKVMIEKMKEGIVSCIPLKVVFSRINEAVKGSA  589

Query  915  RPAHRLI  935
            R  HR +
Sbjct  590  RQVHRAL  596



>emb|CDY51454.1| BnaA05g36710D [Brassica napus]
Length=600

 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 124/250 (50%), Gaps = 47/250 (19%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
            TSKWQ KGKRN R  +     R   + E               SLP+  S    NP    
Sbjct  379  TSKWQIKGKRNPRQMSKKQEERRLAYAEEA----------NNNSLPH-CSLSDQNPHGH-  426

Query  417  PDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFC  596
              FS    +  +S L DVK+E K  Y+ R++P ISLMSKL+G+ I GH L VEVL DG C
Sbjct  427  --FS---GMGRNSQLYDVKIEEKGSYKPRNVPMISLMSKLDGEAIVGHPLTVEVLQDGSC  481

Query  597  DQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsst-------------kssk  737
            D++L     C  +     P    MV        G ++P+ S               KSSK
Sbjct  482  DRIL-----CSHIKSLVVP----MV-------AGDVKPKPSWKNKSKKKKPHIPPHKSSK  525

Query  738  skkesmlskkVRRLSSLTGPR-KQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSI  914
            SKK S LS K R LS+L+G +   + +K   +++++   ++C+PLKVVFSRI  A+  S 
Sbjct  526  SKKASSLSVKTRCLSALSGQKLTVSSKKKVMIEKMKEGIVSCIPLKVVFSRINEAVKGSA  585

Query  915  RPAHRLIAPS  944
            R  HR +  S
Sbjct  586  RQVHRALPSS  595



>emb|CDY56919.1| BnaCnng31400D [Brassica napus]
Length=613

 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 116/240 (48%), Gaps = 32/240 (13%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
            TSKWQ KGKRN R  +     R   + E               SLP+  S    NP    
Sbjct  391  TSKWQIKGKRNPRQMSKKQEERRLAYAEEAN----------NNSLPH-CSLSDQNP--HG  437

Query  417  PDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFC  596
              FS    +  +S L DVK+E K  Y+ R++P ISLMSKL+G+ I GH L +EVL DG C
Sbjct  438  VHFS---GMGRNSQLYDVKIEEKGSYKPRNVPMISLMSKLDGEAIVGHPLTLEVLQDGSC  494

Query  597  DQLLVSASNCHDLDDDSAP------KGVDMVNKTKLSFGGRLQPRAsstksskskkesml  758
            D++L     C  +     P      K               + P      SSKSKK S L
Sbjct  495  DRIL-----CSHIKSLVVPMVAGDAKPKPSWKNKSKKKKPHIPPHK----SSKSKKASSL  545

Query  759  skkVRRLSSLTGPR-KQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  935
            S K R LS+L+G +   + +K   +++ R   ++C+PLKVVFSRI  A+  S R  HR +
Sbjct  546  SIKTRCLSALSGKKLTVSSKKKVMIEKTREGIVSCIPLKVVFSRINEAVKGSARQVHRAL  605



>emb|CBI35984.3| unnamed protein product [Vitis vinifera]
Length=238

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 85/174 (49%), Gaps = 36/174 (21%)
 Frame = +3

Query  63   SPI-VPCASQKGEFSA-GAPSSESGQVETMSCGSGEHNESGCTNLGNADILDSGPRMGKE  236
            SPI V C+S K +    G  SS+S Q ET+S  +   NESG T+       +   R+ K 
Sbjct  29   SPIFVSCSSGKPQVGGLGRQSSQSSQAETVSLRNEGLNESGSTSSEAVHTSNCNQRIEKG  88

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
            TSKWQ KGKRN R  N         +++  ++    DLP                     
Sbjct  89   TSKWQLKGKRNSRHIN--------KNRKQNLRKSMPDLPF--------------------  120

Query  417  PDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEV  578
                   +  ++S L DV +EVK+ YR +H+P +SLMSKLNG+ I GH L VEV
Sbjct  121  ------RNFYSNSCLYDVNLEVKANYRPQHVPLVSLMSKLNGKAIVGHPLTVEV  168


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  801  KQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            K++ E+ P V +L+GP IAC+PLK+VFSR+  A+NSS RPAH  + PS
Sbjct  189  KRDEERKPVVDKLKGPAIACIPLKLVFSRLNEAVNSSARPAHHALTPS  236



>gb|KFK39439.1| hypothetical protein AALP_AA3G245000 [Arabis alpina]
Length=664

 Score = 86.7 bits (213),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 122/242 (50%), Gaps = 31/242 (13%)
 Frame = +3

Query  231  KETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKY  410
            K TSKWQ KGKRN         SR    K+ + +   A       SLP       V+ + 
Sbjct  441  KSTSKWQLKGKRN---------SRRMSKKQEERRNAFAQ-EANNNSLPL----CSVSDQN  486

Query  411  ESPDFSLRHHVIA-DSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDD  587
                FS+    +  +S L DV +EVK+ Y+ R +P ISL SKL G+ I GH L VEVL+D
Sbjct  487  PHGHFSIGTQAMGRNSQLYDVNIEVKANYKPRDVPLISLRSKLYGEAIVGHPLTVEVLED  546

Query  588  GFCDQLLVSASNCHDL----DDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskkesm  755
            G  D ++ S      +    DDD  PK        K        P      +SKSKK S 
Sbjct  547  GSSDGIVSSHIKSLSVPMVDDDDVKPKPSWKNKSKKKKP--HFPPH----NTSKSKKSSP  600

Query  756  lskkVRRLSSLTGPRKQ--NREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHR  929
            LSKK R LS+LTG +    +++K  T +Q+    +AC+PLK+VFSRI  A+  S R  HR
Sbjct  601  LSKKTRCLSALTGQKLTVISKKKVMTKEQV----VACIPLKIVFSRINEAVKGSGRQVHR  656

Query  930  LI  935
            ++
Sbjct  657  VL  658



>ref|XP_010479675.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
 ref|XP_010479676.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
Length=642

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 108/238 (45%), Gaps = 54/238 (23%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
            TSKWQ KGKRN R  +    +R + + E   K           S+P+             
Sbjct  453  TSKWQLKGKRNSRQMSKKQEARRTVYGEEANKNS---------SMPH-------------  490

Query  417  PDFSLRHHVIADSSLTDVKVEVKSCYRT-RHIPYISLMSKLNGQPITGHRLAVEVLDDGF  593
                        S L +V +EVK  Y+  R++P +S MS+LNG+ I GH L VE+L++G+
Sbjct  491  ------------SGLYEVNIEVKENYKKPRNVPLVSRMSELNGKAIVGHPLTVEILEEGY  538

Query  594  CDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSFGGRLQPRAsstksskskkesmlskkV  770
            C+  ++S                 +V KTK LS     + R   +  +  KK S  S K 
Sbjct  539  CNGAVLS----------------QVVVKTKPLSKKNGKKRRG--SSWNTKKKSSSQSIKT  580

Query  771  RRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            RRLS+LT  R   + K     + +   +AC+PLKVVFSRI   L  S R       PS
Sbjct  581  RRLSTLTSQRLTEKIKKQATGKAKETVVACIPLKVVFSRINEVLKGSARQTQHRALPS  638



>ref|XP_010479677.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Camelina sativa]
Length=641

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 108/238 (45%), Gaps = 54/238 (23%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
            TSKWQ KGKRN R  +    +R + + E   K           S+P+             
Sbjct  452  TSKWQLKGKRNSRQMSKKQEARRTVYGEEANKNS---------SMPH-------------  489

Query  417  PDFSLRHHVIADSSLTDVKVEVKSCYRT-RHIPYISLMSKLNGQPITGHRLAVEVLDDGF  593
                        S L +V +EVK  Y+  R++P +S MS+LNG+ I GH L VE+L++G+
Sbjct  490  ------------SGLYEVNIEVKENYKKPRNVPLVSRMSELNGKAIVGHPLTVEILEEGY  537

Query  594  CDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSFGGRLQPRAsstksskskkesmlskkV  770
            C+  ++S                 +V KTK LS     + R   +  +  KK S  S K 
Sbjct  538  CNGAVLS----------------QVVVKTKPLSKKNGKKRRG--SSWNTKKKSSSQSIKT  579

Query  771  RRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            RRLS+LT  R   + K     + +   +AC+PLKVVFSRI   L  S R       PS
Sbjct  580  RRLSTLTSQRLTEKIKKQATGKAKETVVACIPLKVVFSRINEVLKGSARQTQHRALPS  637



>ref|XP_010462016.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Camelina sativa]
Length=643

 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 107/238 (45%), Gaps = 54/238 (23%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
            TSKWQ KGKRN R  +    +R + + E   K           S+P+             
Sbjct  454  TSKWQLKGKRNSRQMSKKQEARRTVYGEEANKNS---------SMPH-------------  491

Query  417  PDFSLRHHVIADSSLTDVKVEVKSCYRT-RHIPYISLMSKLNGQPITGHRLAVEVLDDGF  593
                        S L +V +EVK  Y+  R++P +S MS+LNG+ I GH L VE+L +G+
Sbjct  492  ------------SGLYEVNIEVKENYKKPRNVPLVSRMSELNGKAIVGHPLTVEILKEGY  539

Query  594  CDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSFGGRLQPRAsstksskskkesmlskkV  770
            C+  ++S                 +V KTK LS     + R   +  +  KK S  S K 
Sbjct  540  CNGAVLS----------------QVVVKTKPLSKKNGKKRRG--SSWNTKKKSSSQSIKT  581

Query  771  RRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            RRLS+LT  R   + K     + +   +AC+PLKVVFSRI   L  S R       PS
Sbjct  582  RRLSTLTSQRLTEKIKKQATGKAKETVVACIPLKVVFSRINEVLKGSARQTQHRALPS  639



>ref|XP_010462014.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
 ref|XP_010462015.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
Length=644

 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 107/238 (45%), Gaps = 54/238 (23%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
            TSKWQ KGKRN R  +    +R + + E   K           S+P+             
Sbjct  455  TSKWQLKGKRNSRQMSKKQEARRTVYGEEANKNS---------SMPH-------------  492

Query  417  PDFSLRHHVIADSSLTDVKVEVKSCYRT-RHIPYISLMSKLNGQPITGHRLAVEVLDDGF  593
                        S L +V +EVK  Y+  R++P +S MS+LNG+ I GH L VE+L +G+
Sbjct  493  ------------SGLYEVNIEVKENYKKPRNVPLVSRMSELNGKAIVGHPLTVEILKEGY  540

Query  594  CDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSFGGRLQPRAsstksskskkesmlskkV  770
            C+  ++S                 +V KTK LS     + R   +  +  KK S  S K 
Sbjct  541  CNGAVLS----------------QVVVKTKPLSKKNGKKRRG--SSWNTKKKSSSQSIKT  582

Query  771  RRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  944
            RRLS+LT  R   + K     + +   +AC+PLKVVFSRI   L  S R       PS
Sbjct  583  RRLSTLTSQRLTEKIKKQATGKAKETVVACIPLKVVFSRINEVLKGSARQTQHRALPS  640



>dbj|BAJ91774.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 102/201 (51%), Gaps = 20/201 (10%)
 Frame = +3

Query  372  PYRLSRFVVNPKYESPDF-SLRHHVI-------ADSSLTDVKVEVKSCYRTRHIPYISLM  527
            PY  S   V P  + PD  S R HV+       AD  L DV++ V+  Y+    P +SL 
Sbjct  565  PYYGSPLQVIPPEQKPDMKSTRCHVVKPIKSVQADYKLYDVELAVEGTYKDHRAPLVSLT  624

Query  528  SKLNGQPITGHRLAVEVLDDGFC------DQLLVSASNCHDL--DDDSAPKGVDMVNKTK  683
            SK N +P+ G  + V VLDD  C      +Q L   S  H L   + + P+     + +K
Sbjct  625  SKWNRKPVMGFPVPVVVLDDS-CHVESRDNQHLAKNSLTHLLKRSEVAEPRQPRSSHASK  683

Query  684  LSFGGRLQPRAsstkss---kskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTI  854
               GGR +        S    +KK +   +K+RRLSS    R+++  KN  VQ++  PTI
Sbjct  684  SKLGGRKKVSEHDMDKSWRPHTKKSASSPRKMRRLSSFGSSRRESTNKNTVVQKIGRPTI  743

Query  855  ACVPLKVVFSRIKAALNSSIR  917
            AC+P+++VFSRI  AL+  +R
Sbjct  744  ACIPVRLVFSRINEALSFQVR  764



>ref|XP_010488139.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
 ref|XP_010488140.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Camelina sativa]
 ref|XP_010488141.1| PREDICTED: uncharacterized protein At1g51745-like isoform X3 
[Camelina sativa]
Length=643

 Score = 83.6 bits (205),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 116/228 (51%), Gaps = 28/228 (12%)
 Frame = +3

Query  231  KETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKY  410
            K TSKWQ KGKRN R  +     R + + E+                   LSR  V+ + 
Sbjct  438  KSTSKWQLKGKRNSRQMSKKQEERRNAYAEANNNF---------------LSRCSVSDQK  482

Query  411  ESPDFSLRHHVIA-DSSLTDVKVE-VKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLD  584
             +  FS     +  +S + +VK+E VK+ Y+ R++P ISL SKLNG+ I GH   VEVL+
Sbjct  483  LNGHFSFGTRAMGKNSEMYNVKIEEVKASYKPRNVPLISLRSKLNGEAIVGHPSTVEVLE  542

Query  585  DGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAs-stksskskkesmls  761
            DG CD ++    N         P GV MV+  K     + +       KSSKS K   LS
Sbjct  543  DGSCDLIVSRHLN---------PLGVPMVDDAKPKPSSKKKASHFPPYKSSKSNKSLSLS  593

Query  762  kkVRRLSSLTGPR-KQNREKNPTVQQLRGPTIACVPLKVVFSRIKAAL  902
             K R LS+L+G +   + +K   +++ +   +AC+PLKV FSRI  AL
Sbjct  594  IKTRCLSTLSGQKLTVSCKKKVMIEKTKERVVACIPLKVAFSRINEAL  641



>pir||D96556 hypothetical protein F19C24.5 [imported] - Arabidopsis thaliana
 gb|AAG50888.1|AC025294_26 hypothetical protein [Arabidopsis thaliana]
Length=896

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 108/241 (45%), Gaps = 51/241 (21%)
 Frame = +3

Query  225  MGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNP  404
            + K TSKWQ KGKRN         SR    K+ + +    +      S P+         
Sbjct  702  IEKNTSKWQLKGKRN---------SRQMSKKQEERRNVYGEEANNNSSTPH---------  743

Query  405  KYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLD  584
                            S+L +VK+EVK+ Y    +P +S MS+L+G+ I GH L+VE+L+
Sbjct  744  ----------------STLYEVKIEVKASYTKPRVPLVSRMSELSGKAIVGHPLSVEILE  787

Query  585  DGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSFGGRLQPRAsstksskskkesmls  761
            + + + +++                  +V K K L      + ++     +  KK S LS
Sbjct  788  EDYSNGMVMPP----------------VVAKAKSLPKKNGKKKKSRGFSWNSKKKSSSLS  831

Query  762  kkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAP  941
             K RRLS+LT  R   R K  T ++ +   +AC+PLKVVFSRI   L  S R       P
Sbjct  832  VKTRRLSTLTSQRLTERSKKQTTEKAKETVVACIPLKVVFSRINEVLKGSARQTQHRALP  891

Query  942  S  944
            S
Sbjct  892  S  892



>gb|AFW83010.1| hypothetical protein ZEAMMB73_581703 [Zea mays]
Length=618

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 89/176 (51%), Gaps = 27/176 (15%)
 Frame = +3

Query  447  ADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDD-------------  587
            AD  L DV+V V+  Y+  H P ISLMSK  G+PI G+ + +EVL D             
Sbjct  446  ADYRLYDVEVTVQRSYKGHHAPLISLMSKWTGKPIVGYPVTLEVLKDSRHTTSRDEHRPV  505

Query  588  -GFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstkss-----kskke  749
             G  D LL S          S P+     + ++  F    + +A+           +KK 
Sbjct  506  MGSLDSLLKSRV--------SEPRQARSSHASRSKFKSSGRKKATEHDLDRSWWPHTKKP  557

Query  750  smlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  917
            +   +K+RRLSS  G R+++ ++ P V +  GP +ACVPL++VFSRI  AL+  +R
Sbjct  558  ASSPRKMRRLSSFAGSRRESADQKPVVAKTGGPAVACVPLRLVFSRINEALSFPLR  613



>ref|XP_008657775.1| PREDICTED: uncharacterized protein At1g51745-like, partial [Zea 
mays]
Length=682

 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 89/176 (51%), Gaps = 27/176 (15%)
 Frame = +3

Query  447  ADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDD-------------  587
            AD  L DV+V V+  Y+  H P ISLMSK  G+PI G+ + +EVL D             
Sbjct  510  ADYRLYDVEVTVQRSYKGHHAPLISLMSKWTGKPIVGYPVTLEVLKDSRHTTSRDEHRPV  569

Query  588  -GFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstkss-----kskke  749
             G  D LL S          S P+     + ++  F    + +A+           +KK 
Sbjct  570  MGSLDSLLKSRV--------SEPRQARSSHASRSKFKSSGRKKATEHDLDRSWWPHTKKP  621

Query  750  smlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  917
            +   +K+RRLSS  G R+++ ++ P V +  GP +ACVPL++VFSRI  AL+  +R
Sbjct  622  ASSPRKMRRLSSFAGSRRESADQKPVVAKTGGPAVACVPLRLVFSRINEALSFPLR  677



>ref|XP_009144882.1| PREDICTED: uncharacterized protein At1g51745 [Brassica rapa]
Length=534

 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 76/246 (31%), Positives = 113/246 (46%), Gaps = 53/246 (22%)
 Frame = +3

Query  222  RMGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVN  401
            R+ K TS+WQ KGKRN R  +    +R   + E       + LP+P              
Sbjct  336  RIEKSTSEWQLKGKRNSRQMSKKQEARRFVYGEE--ANNNSSLPLP--------------  379

Query  402  PKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVL  581
                              +L +VK+EVK+      +P +S MS+LNG+ I GH ++VE L
Sbjct  380  ------------------ALFEVKIEVKASSNKPRVPLVSRMSELNGKAIVGHPVSVEAL  421

Query  582  -DDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKL--SFGGRLQPRAsstksskskkes  752
             ++G+C+  L+S                D+V    L      + +   ++   SK K  S
Sbjct  422  KEEGYCNGKLMSQ---------------DVVKAKPLLSEKKSKKRKSQAAFGKSKKKSSS  466

Query  753  mlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPA-HR  929
             +S K+RRLS+LT  +   R K  T  + +   +AC+PLKVVFSRI   L  S R   HR
Sbjct  467  SVSIKIRRLSTLTSQKLTGRSKMQTTGKAKETVVACIPLKVVFSRINQVLKGSARQTQHR  526

Query  930  LIAPSI  947
             + PS+
Sbjct  527  PLPPSV  532



>dbj|BAB01723.1| unnamed protein product [Arabidopsis thaliana]
Length=695

 Score = 77.8 bits (190),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 76/140 (54%), Gaps = 19/140 (14%)
 Frame = +3

Query  225  MGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNP  404
            + K TSKWQ KGKRN         SR    K+ + +   A+      +LP+    + V+ 
Sbjct  426  IKKSTSKWQLKGKRN---------SRQMSKKQVERRNAYAE-EANNNALPH----WSVSD  471

Query  405  KYESPDFSLRHHVIA-DSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVL  581
            +     FS+    +  +S L DVK+EVK+ Y+ R++P ISL SKLNG+ I GH   VEVL
Sbjct  472  QKPRSLFSVGTQAMGRNSELYDVKIEVKANYKPRNVPLISLRSKLNGEAIVGHPSVVEVL  531

Query  582  DDGFCDQLLVSASNCHDLDD  641
            +DG C  ++ S    H +DD
Sbjct  532  EDGSCGHIVSS----HRIDD  547



>gb|EEE54805.1| hypothetical protein OsJ_02221 [Oryza sativa Japonica Group]
Length=731

 Score = 77.4 bits (189),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 86/170 (51%), Gaps = 14/170 (8%)
 Frame = +3

Query  450  DSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFC----DQLLVSA  617
            D  + DV++  +  Y+   +P +SLMSK NG+PI G+ + VEVL D       + L  + 
Sbjct  557  DYKVYDVELAAQGSYKGHRVPLVSLMSKWNGKPIVGYPITVEVLKDSSSAASRNDLRPAT  616

Query  618  SNCHDLDDDSAPKGVDMVNKTKLSF-GGRLQPRAsstkssk---------skkesmlskk  767
            S+ ++L   S P        +  S    R +P      S           +KK +   +K
Sbjct  617  SSLNNLLKRSEPAEPRQARSSHSSRPASRPKPSGKKKISEHDTDKSRRPHTKKSATSPRK  676

Query  768  VRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  917
            +RRLSS    R+    + P V ++ GPTIAC+PL++VFSRI  AL+  +R
Sbjct  677  MRRLSSFASSRRDGASRKPVVGKISGPTIACIPLRLVFSRINEALSFPVR  726



>gb|EMT19851.1| hypothetical protein F775_09638 [Aegilops tauschii]
Length=740

 Score = 77.4 bits (189),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 101/204 (50%), Gaps = 26/204 (13%)
 Frame = +3

Query  372  PYRLSRFVVNPKYESPDF-SLRHHVI-------ADSSLTDVKVEVKSCYRTRHIPYISLM  527
            PY  S   V    + PD  S R HV+       AD  L DV++ V+  Y+    P +SL 
Sbjct  536  PYYGSPLKVILPEQKPDMKSTRCHVVKPMKSVQADYKLYDVELAVEGTYKGHRAPLVSLT  595

Query  528  SKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDS-----------APKGVDMVN  674
            SK N +P+ G  + V VLDD  C    V + + H L  +S            P+     +
Sbjct  596  SKWNRKPVMGFPVPVVVLDDS-CP---VESRDNHHLAKNSLTNLLKRSEVAEPRQPRSAH  651

Query  675  KTKLSFGGRLQPRAsstkss---kskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRG  845
             +K   GGR +        S    +KK +   +K+RRLSS    R+++  +N  V+++ G
Sbjct  652  SSKSKLGGRKKVSEHDIDKSWRPHTKKSASSPRKMRRLSSFGSSRRESSNRNTVVRKIGG  711

Query  846  PTIACVPLKVVFSRIKAALNSSIR  917
            PTIAC+P+++VFSRI  AL+  +R
Sbjct  712  PTIACIPVRLVFSRINEALSFHVR  735



>ref|NP_001043335.1| Os01g0558500 [Oryza sativa Japonica Group]
 dbj|BAB85386.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC00676.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05249.1| Os01g0558500 [Oryza sativa Japonica Group]
 gb|EAY74529.1| hypothetical protein OsI_02419 [Oryza sativa Indica Group]
Length=774

 Score = 77.4 bits (189),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 86/170 (51%), Gaps = 14/170 (8%)
 Frame = +3

Query  450  DSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFC----DQLLVSA  617
            D  + DV++  +  Y+   +P +SLMSK NG+PI G+ + VEVL D       + L  + 
Sbjct  600  DYKVYDVELAAQGSYKGHRVPLVSLMSKWNGKPIVGYPITVEVLKDSSSAASRNDLRPAT  659

Query  618  SNCHDLDDDSAPKGVDMVNKTKLSF-GGRLQPRAsstkssk---------skkesmlskk  767
            S+ ++L   S P        +  S    R +P      S           +KK +   +K
Sbjct  660  SSLNNLLKRSEPAEPRQARSSHSSRPASRPKPSGKKKISEHDTDKSRRPHTKKSATSPRK  719

Query  768  VRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  917
            +RRLSS    R+    + P V ++ GPTIAC+PL++VFSRI  AL+  +R
Sbjct  720  MRRLSSFASSRRDGASRKPVVGKISGPTIACIPLRLVFSRINEALSFPVR  769



>ref|XP_002455796.1| hypothetical protein SORBIDRAFT_03g025340 [Sorghum bicolor]
 gb|EES00916.1| hypothetical protein SORBIDRAFT_03g025340 [Sorghum bicolor]
Length=737

 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 85/174 (49%), Gaps = 31/174 (18%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDD--------------GFC  596
            L DV++ V+  Y+  H+P +SLMSK  G+PI G+ + VEVL+D              G  
Sbjct  569  LYDVELTVQRSYKGHHVPLVSLMSKWTGKPIVGYPVTVEVLEDSCPITSRDEHHPVKGSL  628

Query  597  DQLLVS-------ASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskkesm  755
            D LL S       A + H     S   G    ++  L    R   +          K + 
Sbjct  629  DSLLKSKVAEPRQARSSHAPRSKSKSSGRKKASEHDLDKSWRPHTK----------KPAS  678

Query  756  lskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  917
              +K+RRLSS  G R++  ++ P V +  GP +ACVPL++VFSRI  AL+  +R
Sbjct  679  SPRKMRRLSSFAGSRRECADQKPVVAKTGGPAVACVPLRLVFSRINEALSFPLR  732



>emb|CDY33863.1| BnaC06g04900D [Brassica napus]
Length=911

 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 107/244 (44%), Gaps = 58/244 (24%)
 Frame = +3

Query  225  MGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNP  404
            + K   KWQ KGKRN R  +    +R S + E         LP                 
Sbjct  718  IEKSACKWQLKGKRNSRQMSKKQEARRSVYSEEANNNRPLLLP-----------------  760

Query  405  KYESPDFSLRHHVIADSSLTDVKVEVK-SCYRTRHIPYISLMSKLNGQPITGHRLAVEVL  581
                             +L +VK+EV+ SC + R +P +S MSKLNG+ I GH ++VE L
Sbjct  761  -----------------ALFEVKIEVRASCNKPR-VPLVSRMSKLNGKAIVGHPVSVEAL  802

Query  582  DDGFCDQLLVSAS---NCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskkes  752
            ++G+ +  +V +        L +    K      KT  +FG   + +          K S
Sbjct  803  EEGYYNGGVVKSQAVVKAKSLSEKKCKK-----RKTNGAFGKSSKSKK---------KSS  848

Query  753  mlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRL  932
             LS K RRLS+LT      R K  T+++L+   +AC+PLKVVFSRI   L  S R     
Sbjct  849  SLSVKTRRLSTLT-----ERSKKQTIEKLKETVVACIPLKVVFSRINQVLKGSARQTQHR  903

Query  933  IAPS  944
              PS
Sbjct  904  ALPS  907



>ref|XP_006646000.1| PREDICTED: uncharacterized protein At1g51745-like, partial [Oryza 
brachyantha]
Length=724

 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 86/177 (49%), Gaps = 33/177 (19%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDD---GFCDQLLVSASNCH  629
            L +V++ V+  Y+   +P +SLMSK NG+PI G+ + VEVL+D      D L  + S+ +
Sbjct  554  LYEVELAVQGSYKGHRVPLVSLMSKWNGKPIVGYPVPVEVLEDSSRASQDDLHPATSSLN  613

Query  630  DLDDDSA--------------------PKGVDMVNKTKLSFGGRLQPRAsstksskskke  749
             L   S                     P G   ++   +    R   +          K 
Sbjct  614  HLLKRSEPTEPRQARSSHSSRSASRPKPSGKKKISDHDMDKSWRPHTK----------KS  663

Query  750  smlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRP  920
            +   +K+RRLSS    R+ +  + P V ++ GPTIAC+PL++VFSRI  AL+  +RP
Sbjct  664  ASSPRKMRRLSSFASSRRDSTSRKPVVGKIGGPTIACIPLRLVFSRINEALSFPVRP  720



>emb|CDY43925.1| BnaA05g15350D [Brassica napus]
Length=530

 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 111/246 (45%), Gaps = 53/246 (22%)
 Frame = +3

Query  222  RMGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVN  401
            R+ K TS+WQ KGKRN R  +    +R   + E       + LP+P              
Sbjct  332  RIEKSTSEWQLKGKRNSRQMSKKQEARRFVYGEE--ANNNSSLPLP--------------  375

Query  402  PKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVL  581
                              +L +VK+EVK+      +P +S MS+LNG+ I GH ++VE L
Sbjct  376  ------------------ALFEVKIEVKASSNKPRVPLVSRMSELNGKAIVGHPVSVEAL  417

Query  582  -DDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKL--SFGGRLQPRAsstksskskkes  752
             ++G C+  ++S                D+V    L      + +   ++   SK K  S
Sbjct  418  KEEGCCNGKVMSQ---------------DVVKAKPLLSEKKSKKRKSQAAFGKSKKKSSS  462

Query  753  mlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPA-HR  929
             +S K RRLS+LT  +   R K  T  + +   +AC+PLKVVFSRI   L  S R   HR
Sbjct  463  SVSIKTRRLSTLTSQKLTGRSKMQTTGKAKETVVACIPLKVVFSRINQVLKGSARQTQHR  522

Query  930  LIAPSI  947
             + PS+
Sbjct  523  PLPPSV  528



>emb|CDM83021.1| unnamed protein product [Triticum aestivum]
Length=759

 Score = 74.3 bits (181),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 100/201 (50%), Gaps = 20/201 (10%)
 Frame = +3

Query  372  PYRLSRFVVNPKYESPDF-SLRHHVI-------ADSSLTDVKVEVKSCYRTRHIPYISLM  527
            PY  S   V    + PD  S R HV+       AD  L DV++ V+  Y+    P +SL 
Sbjct  555  PYYGSPLKVILPEQKPDMKSTRCHVVKPMKSVQADYKLYDVELAVEGTYKGHRAPLVSLT  614

Query  528  SKLNGQPITGHRLAVEVLDDGFC------DQLLVSASNCHDL--DDDSAPKGVDMVNKTK  683
            SK N +P+ G  + V VLDD  C      +  L   S  H L   + + P+     + +K
Sbjct  615  SKWNRKPVMGFPVPVVVLDDS-CPVESRDNHHLAKNSLTHLLKRSEVAEPRQPRSSHSSK  673

Query  684  LSFGGRLQPRAsstkss---kskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTI  854
                GR +        S    +KK +   +K+RRLSS    R+++  +N  V+++ GPTI
Sbjct  674  SKLCGRKKVSEHDMDKSWRPHTKKSASSPRKMRRLSSFGSSRRESANRNTVVRKIGGPTI  733

Query  855  ACVPLKVVFSRIKAALNSSIR  917
            AC+P+++VFSRI  AL+  +R
Sbjct  734  ACIPVRLVFSRINEALSFQVR  754



>ref|XP_003569211.1| PREDICTED: uncharacterized protein LOC100833692 [Brachypodium 
distachyon]
Length=760

 Score = 74.3 bits (181),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 89/179 (50%), Gaps = 29/179 (16%)
 Frame = +3

Query  441  VIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS  620
            V  D  L DV++E    ++   +P +SL S+ NG+PI G  + V+VLDD  C      A+
Sbjct  573  VFRDYKLYDVELEADGTFKGHRVPLVSLDSEWNGKPIVGLPVTVKVLDDS-C------AA  625

Query  621  NCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstkss--------------------ks  740
               D+D  +      ++  +K++     QPR+S    S                      
Sbjct  626  ESRDVDHPATSSLNHLLKGSKVA--EPRQPRSSHASRSKHSGRKKISERDTDKSWRPHTK  683

Query  741  kkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  917
            +  +   KK+RRLSS    R++ + + P + ++ GPTIAC+PL++VFSRI  AL+  +R
Sbjct  684  QSTTSSPKKMRRLSSFASSRRERKNRKPVLGKIGGPTIACIPLRLVFSRINEALSFPVR  742



>ref|XP_009147732.1| PREDICTED: uncharacterized protein At1g51745-like [Brassica rapa]
Length=607

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 109/241 (45%), Gaps = 53/241 (22%)
 Frame = +3

Query  225  MGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNP  404
            + K TSKW+ KGKRN R  +    +R+  + E         LP                 
Sbjct  415  IEKSTSKWKLKGKRNSRQRSKKQEARSGVYSEEANNNRPLLLP-----------------  457

Query  405  KYESPDFSLRHHVIADSSLTDVKVEVK-SCYRTRHIPYISLMSKLNGQPITGHRLAVEVL  581
                             +L +VK+EV+ SC + R +P +S MSKLNG+ I GH ++VE L
Sbjct  458  -----------------ALFEVKIEVRASCNKPR-VPLVSRMSKLNGKAIVGHPVSVEAL  499

Query  582  DDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskkesmls  761
            ++ + + +++S +    +   S  K      KT   FG   + +          K S LS
Sbjct  500  EESYYNGMVMSQA---VVKAKSLSKKKSNKRKTTGPFGKSSKSKK---------KSSSLS  547

Query  762  kkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAP  941
             K RRLS+LT      R K  T+++L+   +AC+PLKVVFSRI   L  S R       P
Sbjct  548  VKTRRLSTLT-----ERSKKQTIEKLKETVVACIPLKVVFSRINQVLKGSARQTQHRALP  602

Query  942  S  944
            S
Sbjct  603  S  603



>emb|CDY22868.1| BnaA06g02090D [Brassica napus]
Length=909

 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 109/241 (45%), Gaps = 53/241 (22%)
 Frame = +3

Query  225  MGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNP  404
            + K TSKW+ KGKRN R  +    +R+  + E         LP                 
Sbjct  717  IEKSTSKWKLKGKRNSRQRSKKQEARSGVYSEEANNNRPLLLP-----------------  759

Query  405  KYESPDFSLRHHVIADSSLTDVKVEVK-SCYRTRHIPYISLMSKLNGQPITGHRLAVEVL  581
                             +L +VK+EV+ SC + R +P +S MSKLNG+ I GH ++VE L
Sbjct  760  -----------------ALFEVKIEVRASCNKPR-VPLVSRMSKLNGKAIVGHPVSVEAL  801

Query  582  DDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskkesmls  761
            ++ + + +++S +    +   S  K      KT   FG   + +          K S LS
Sbjct  802  EESYYNGMVMSQAV---VKAKSLSKKKSNKRKTTGPFGKSSKSKK---------KSSSLS  849

Query  762  kkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAP  941
             K RRLS+LT      R K  T+++L+   +AC+PLKVVFSRI   L  S R       P
Sbjct  850  VKTRRLSTLT-----ERSKKQTIEKLKETVVACIPLKVVFSRINQVLKGSARQTQHRALP  904

Query  942  S  944
            S
Sbjct  905  S  905



>ref|XP_006853959.1| hypothetical protein AMTR_s00036p00215850 [Amborella trichopoda]
 gb|ERN15426.1| hypothetical protein AMTR_s00036p00215850 [Amborella trichopoda]
Length=737

 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 89/177 (50%), Gaps = 29/177 (16%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASN-----  623
            L DV + V++ Y+ +H+P +SLMS+LNG+ I GH + VEVL+DG  D LL    +     
Sbjct  560  LFDVDLNVRTSYQGQHVPLVSLMSRLNGKAIIGHPITVEVLEDGSSDALLARVGHLLPSR  619

Query  624  -CHDLDD------DSAPKGVDM---------VNKTKLSFGGRL-------QPRAsstkss  734
              H   D      DS    V+          V + K  + G L       +P     KS 
Sbjct  620  GAHLSTDGGIWSPDSGAAAVETNAWGYGSGDVLQNKGGYSGHLYKKNQLEKPSLLGKKSP  679

Query  735  kskkesmlskkVRRLSSLTGPRK-QNREKNPTVQQLRGPTIACVPLKVVFSRIKAAL  902
            K KK     KK R+LS ++  +  ++ ++   V +L GP  AC+P+ +VFSRIK A+
Sbjct  680  KMKKCGSSMKKTRKLSLISLDKGIKDEQRKSWVGKLGGPVTACIPVNLVFSRIKEAV  736



>ref|XP_009395771.1| PREDICTED: uncharacterized protein At1g51745-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395772.1| PREDICTED: uncharacterized protein At1g51745-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395773.1| PREDICTED: uncharacterized protein At1g51745-like [Musa acuminata 
subsp. malaccensis]
Length=799

 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 87/171 (51%), Gaps = 27/171 (16%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHD  632
            SSL DV++ V++     H+P  SLMSKLNG+ I GH   VEV++DG  D  L++ ++C  
Sbjct  639  SSLYDVELTVETKTGRPHVPLNSLMSKLNGKAIVGHPAPVEVMEDGSSDT-LITKNDCWP  697

Query  633  LDDD---SAPKGVDMVNKTK-----------LSFGGRLQ---PRAsstksskskkesmls  761
               +   S   G+ ++ +             + +G   Q   P     K S S+   +  
Sbjct  698  ATSNINRSLKNGLVIIGRATPGKKAAQTYRGVQWGNYDQLNVPSLLERKHSNSRTSRLSP  757

Query  762  kkVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSI  914
            +K+RRLSS+         + P V+ +  P +ACVPL +VFSRI  A  SS+
Sbjct  758  RKIRRLSSI---------RKPEVETIVRPAVACVPLGLVFSRITEAFPSSL  799



>ref|XP_006854154.1| hypothetical protein AMTR_s00048p00187700 [Amborella trichopoda]
 gb|ERN15621.1| hypothetical protein AMTR_s00048p00187700 [Amborella trichopoda]
Length=719

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 105/240 (44%), Gaps = 55/240 (23%)
 Frame = +3

Query  288  IDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLTD  467
            +DW+  +       +  T D+ I   +LP     F  +  YE+ D       + +  L +
Sbjct  488  VDWAARASSDRRSWEEATEDIGIENYNLPG----FKPDQLYETTD-------MLEPMLVE  536

Query  468  VKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDS  647
            V ++V++ Y+   +P +SLMS+LNG+ I GH + +E+L+DG         S+ HD ++  
Sbjct  537  VDIKVQASYQGERVPLVSLMSRLNGKAIVGHPVQIEILEDG---------SSEHDRNEGR  587

Query  648  A-PKGVDMVNKTKLSFGGRLQPRAsstksskskkesmlskkVRRLSSL----TGPRKQNR  812
            A P       +T +    R Q RA S     S  +  +    R LS++     G + Q R
Sbjct  588  ALPPVWRTGRRTAMHRVPRPQVRALSPLKKASSSQFKMRFMKRSLSNMCRSSMGKKSQKR  647

Query  813  --------------------EKNPTVQQLR----------GPTIACVPLKVVFSRIKAAL  902
                                EK P ++              P+++C+P++VVFSRIK AL
Sbjct  648  LLKKVGFASQKTRTLSSISTEKKPKIENGDSSGLIKDIGASPSLSCIPVRVVFSRIKEAL  707



>ref|XP_004235289.1| PREDICTED: uncharacterized protein At1g51745 [Solanum lycopersicum]
Length=776

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +3

Query  405  KYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLD  584
            +Y  P  S RH V   + L DV ++V+S Y+  H+P ISLMSKLNGQ I GH + VE+L 
Sbjct  557  EYFDPMSSYRH-VGGRTMLVDVDLKVQSSYQREHVPMISLMSKLNGQAIIGHPIQVEILA  615

Query  585  DGFCDQLLVSASN  623
            DG  D  L    N
Sbjct  616  DGSTDSFLGDIDN  628



>ref|XP_003565804.1| PREDICTED: uncharacterized protein LOC100844359 [Brachypodium 
distachyon]
Length=684

 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 100/207 (48%), Gaps = 38/207 (18%)
 Frame = +3

Query  390  FVVNPKYESPDFSLRHHVIA------DSSLTDVKVEVK-----SCYRTRHIPYISLMSKL  536
            F + P++  P  +  H V A      +S+L DV++ V+     S  + RH+P +SLMS+ 
Sbjct  485  FELPPQHTDPAVASCHAVKATKTLQLNSALYDVELSVQGSSSSSNNKGRHVPLVSLMSRS  544

Query  537  NGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDD----SAPKGVDMVNKTKL------  686
            + +P+ G+ ++VEVLD  +C            +DDD    S+  G+    +T +      
Sbjct  545  SRRPVVGYPVSVEVLDVVYC-------PPASSIDDDHPSTSSANGLVKEQETAVPQCAMP  597

Query  687  -SFGGRLQPRAsstksskskkes---------mlskkVRRLSSLTGPRKQNREKNPTVQQ  836
             S  GR + R+    S     +S            +K+RRLSS    ++   ++   V +
Sbjct  598  SSHKGRAKARSRRKTSEDDMDKSWRPHNKNPVSSPRKMRRLSSFATSQRGGEDRKTLVGK  657

Query  837  LRGPTIACVPLKVVFSRIKAALNSSIR  917
              G  +AC+PL+VVFSRI  AL+ S +
Sbjct  658  FCGTAVACIPLRVVFSRINEALSYSAK  684



>ref|XP_006347560.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Solanum tuberosum]
Length=776

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = +3

Query  405  KYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLD  584
            +Y  P  S RH V   + L DV ++V+S Y+  H+P ISLMSKLNGQ I GH + VE L 
Sbjct  557  EYFDPMNSYRH-VGGRTMLVDVDLKVQSSYQREHVPMISLMSKLNGQAIIGHPIQVETLA  615

Query  585  DGFCDQLLVSASN  623
            +G  D  L    N
Sbjct  616  NGSTDSFLGDIDN  628



>tpg|DAA59003.1| TPA: hypothetical protein ZEAMMB73_224631 [Zea mays]
Length=693

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 60/216 (28%), Positives = 95/216 (44%), Gaps = 37/216 (17%)
 Frame = +3

Query  363  RSLPYRLSRFVVNPKYESPDFSL----------------RHHVIADSSLTDVKVEVKSCY  494
            +SLP      V+ P  + PD  L                R H  A   L DV++ V+  Y
Sbjct  479  KSLPNYFPLQVLPPPGQQPDLKLPRCPVTSPTKRTSPTKRAH--AGYRLYDVELTVQRSY  536

Query  495  RTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDL---DDDSAPKG--  659
            +  H+P +SL+SK  G+PI G+ + VEVL+D        ++ N H        S PK   
Sbjct  537  KGHHVPLVSLISKWTGKPIVGYPVTVEVLEDS----RPTTSRNEHRPPMGSLGSLPKSRV  592

Query  660  -------VDMVNKTKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLT---GPRKQN  809
                       +++K    GR +        S        +   R++  L+   G R+++
Sbjct  593  AEPRQARSSPASRSKSKPSGRKKASEHDLDKSWRPHIKKPASSPRKMRRLSSFAGSRRES  652

Query  810  REKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  917
             ++ P V +  GP +ACVPL++V SRI  AL+  +R
Sbjct  653  ADQKPVVVKAGGPAVACVPLRLVLSRINEALSFPLR  688



>ref|XP_008676390.1| PREDICTED: uncharacterized protein At1g51745, partial [Zea mays]
Length=678

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 60/216 (28%), Positives = 95/216 (44%), Gaps = 37/216 (17%)
 Frame = +3

Query  363  RSLPYRLSRFVVNPKYESPDFSL----------------RHHVIADSSLTDVKVEVKSCY  494
            +SLP      V+ P  + PD  L                R H  A   L DV++ V+  Y
Sbjct  464  KSLPNYFPLQVLPPPGQQPDLKLPRCPVTSPTKRTSPTKRAH--AGYRLYDVELTVQRSY  521

Query  495  RTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDL---DDDSAPKG--  659
            +  H+P +SL+SK  G+PI G+ + VEVL+D        ++ N H        S PK   
Sbjct  522  KGHHVPLVSLISKWTGKPIVGYPVTVEVLEDS----RPTTSRNEHRPPMGSLGSLPKSRV  577

Query  660  -------VDMVNKTKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLT---GPRKQN  809
                       +++K    GR +        S        +   R++  L+   G R+++
Sbjct  578  AEPRQARSSPASRSKSKPSGRKKASEHDLDKSWRPHIKKPASSPRKMRRLSSFAGSRRES  637

Query  810  REKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  917
             ++ P V +  GP +ACVPL++V SRI  AL+  +R
Sbjct  638  ADQKPVVVKAGGPAVACVPLRLVLSRINEALSFPLR  673



>emb|CBI26559.3| unnamed protein product [Vitis vinifera]
Length=597

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 73/156 (47%), Gaps = 25/156 (16%)
 Frame = +3

Query  237  TSKWQSKGKRNFR-----TGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVN  401
             SKWQ KGKRN R     +   +D    +   +  +KG   D                  
Sbjct  420  VSKWQLKGKRNMRNLTKRSAEVVDGKELTWEDQPALKGYWED-----------------T  462

Query  402  PKYESPDFSLRHHVIA--DSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVE  575
             +   P F  RH+      ++L DV + V++ Y+  H+P ISLMS+LN + I GH + +E
Sbjct  463  GECFDPIFVGRHNPAGRIKTTLVDVDLRVQTNYQREHVPIISLMSRLNDKSIVGHPIQIE  522

Query  576  VLDDGFCDQLLVSASNC-HDLDDDSAPKGVDMVNKT  680
             L+DG  + LL S  +  +D+ D+   + +  V +T
Sbjct  523  ALEDGSSEMLLSSNEDFGNDVFDNDRNRAIPPVWRT  558



>ref|XP_009402955.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=850

 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 93/209 (44%), Gaps = 62/209 (30%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVS---ASN  623
            S+L +V ++VK+ Y+  H+P +SLMS+LNG+ I GH L +E+L+DG   Q   S    S 
Sbjct  634  SNLFNVDLKVKASYQGEHVPLVSLMSRLNGKAIIGHPLQIEILEDGSTGQYFSSNPDEST  693

Query  624  CHD----------------------LDDDSAPKGVDMVNK--------------------  677
             H                       L+DD A  GV + ++                    
Sbjct  694  AHQPVWRTARRTAMQRVPRSNPVSSLEDDEA--GVSLYSEIENKHLPDMYSGHSKNQSRS  751

Query  678  TKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRG----  845
            TK      L+P   +++    K+ S+ S+K R LSS    ++ +RE N  V+  R     
Sbjct  752  TKKKVFHDLRPPLGNSQKKSLKRASLSSQKTRTLSSFATEQRNSRE-NGDVRLGRDRDIL  810

Query  846  ----------PTIACVPLKVVFSRIKAAL  902
                      P++ CVP+KV FSRI  A+
Sbjct  811  SGLMKPEGQLPSVTCVPVKVAFSRILEAV  839



>ref|XP_009402956.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=849

 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 93/209 (44%), Gaps = 62/209 (30%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVS---ASN  623
            S+L +V ++VK+ Y+  H+P +SLMS+LNG+ I GH L +E+L+DG   Q   S    S 
Sbjct  633  SNLFNVDLKVKASYQGEHVPLVSLMSRLNGKAIIGHPLQIEILEDGSTGQYFSSNPDEST  692

Query  624  CHD----------------------LDDDSAPKGVDMVNK--------------------  677
             H                       L+DD A  GV + ++                    
Sbjct  693  AHQPVWRTARRTAMQRVPRSNPVSSLEDDEA--GVSLYSEIENKHLPDMYSGHSKNQSRS  750

Query  678  TKLSFGGRLQPRAsstksskskkesmlskkVRRLSSLTGPRKQNREKNPTVQQLRG----  845
            TK      L+P   +++    K+ S+ S+K R LSS    ++ +RE N  V+  R     
Sbjct  751  TKKKVFHDLRPPLGNSQKKSLKRASLSSQKTRTLSSFATEQRNSRE-NGDVRLGRDRDIL  809

Query  846  ----------PTIACVPLKVVFSRIKAAL  902
                      P++ CVP+KV FSRI  A+
Sbjct  810  SGLMKPEGQLPSVTCVPVKVAFSRILEAV  838



>ref|XP_008234588.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Prunus 
mume]
Length=715

 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 63/133 (47%), Gaps = 14/133 (11%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
             SKWQ KGKRN R  N    S ++      + GP ++         +   R   N  ++ 
Sbjct  401  VSKWQLKGKRNIR--NLTKRSMDATDGRGYIYGPYSEEKTDWEDSTWE-DRSAWNEYWDI  457

Query  417  PDFSLRHHVIAD---------SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLA  569
                 R H + D           L DV ++V++ Y+   +P +SLMSKLNG+ I GH + 
Sbjct  458  K--RDRFHPVYDGRYHYRRRPRYLIDVDLKVQASYQKEPVPIVSLMSKLNGKAIIGHPIQ  515

Query  570  VEVLDDGFCDQLL  608
            +E L+DG  + LL
Sbjct  516  IEALEDGSSNSLL  528



>ref|XP_008234587.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Prunus 
mume]
Length=773

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 63/133 (47%), Gaps = 14/133 (11%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
             SKWQ KGKRN R  N    S ++      + GP ++         +   R   N  ++ 
Sbjct  459  VSKWQLKGKRNIR--NLTKRSMDATDGRGYIYGPYSEEKTDWEDSTWE-DRSAWNEYWDI  515

Query  417  PDFSLRHHVIAD---------SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLA  569
                 R H + D           L DV ++V++ Y+   +P +SLMSKLNG+ I GH + 
Sbjct  516  K--RDRFHPVYDGRYHYRRRPRYLIDVDLKVQASYQKEPVPIVSLMSKLNGKAIIGHPIQ  573

Query  570  VEVLDDGFCDQLL  608
            +E L+DG  + LL
Sbjct  574  IEALEDGSSNSLL  586



>ref|XP_008811047.1| PREDICTED: uncharacterized protein LOC103722315 [Phoenix dactylifera]
Length=157

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLD  638
            L DV ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+L DG  D L+  + N   LD
Sbjct  40   LFDVDLKVQASYQGEHVPLVSLMSRLNGKAIIGHPVQIEILKDGSTDPLV--SRNLFGLD  97

Query  639  DDSA  650
            +++A
Sbjct  98   ENTA  101



>ref|XP_008234589.1| PREDICTED: uncharacterized protein LOC103333519 isoform X3 [Prunus 
mume]
Length=581

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 63/133 (47%), Gaps = 14/133 (11%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
             SKWQ KGKRN R  N    S ++      + GP ++         +   R   N  ++ 
Sbjct  267  VSKWQLKGKRNIR--NLTKRSMDATDGRGYIYGPYSEEKTDWEDSTWE-DRSAWNEYWDI  323

Query  417  PDFSLRHHVIAD---------SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLA  569
                 R H + D           L DV ++V++ Y+   +P +SLMSKLNG+ I GH + 
Sbjct  324  K--RDRFHPVYDGRYHYRRRPRYLIDVDLKVQASYQKEPVPIVSLMSKLNGKAIIGHPIQ  381

Query  570  VEVLDDGFCDQLL  608
            +E L+DG  + LL
Sbjct  382  IEALEDGSSNSLL  394



>gb|KHN46442.1| Hypothetical protein glysoja_035118 [Glycine soja]
Length=740

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            S L DV ++V++ YR  H+P+ISLMSKL+G+ I GH + VE L DG  D L 
Sbjct  507  SMLVDVDLKVQASYRKEHVPFISLMSKLDGRAIVGHPIQVEALKDGSSDILF  558



>ref|XP_006592019.1| PREDICTED: uncharacterized protein At1g51745-like [Glycine max]
Length=740

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            S L DV ++V++ YR  H+P+ISLMSKL+G+ I GH + VE L DG  D L 
Sbjct  507  SMLVDVDLKVQASYRKEHVPFISLMSKLDGRAIVGHPIQVEALKDGSSDILF  558



>emb|CDP04947.1| unnamed protein product [Coffea canephora]
Length=744

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 68/128 (53%), Gaps = 13/128 (10%)
 Frame = +3

Query  267  NFRTGNFIDWSRNSPHKESQM--KGPTADLPIPRRSLPYR------LSRFVVNPKYESPD  422
            N R  N++   +NS HK +    +GP     I RR++ ++         +  + KY +P 
Sbjct  466  NGRAENYL-VEKNSTHKMAGYGSRGPDG---ISRRTMQWQHCDWNDQQYWEDSGKYFAPV  521

Query  423  FSLRHHVIADSSLTDVKVEVKSCYRTRH-IPYISLMSKLNGQPITGHRLAVEVLDDGFCD  599
            F   HH  +   L DV + V+S Y+ +H +P ISLMSK+NGQ I G+ + VE L++G  +
Sbjct  522  FLGHHHDGSRVMLIDVDLNVQSSYQRQHPVPMISLMSKINGQAIVGYPVQVEALENGSSE  581

Query  600  QLLVSASN  623
             +L    +
Sbjct  582  SVLAETDD  589



>ref|XP_008800030.1| PREDICTED: uncharacterized protein At1g51745-like [Phoenix dactylifera]
Length=851

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLD  638
            L DV ++V++ Y+   +P +SLMS+LNG+PI GH + +E+L+DG  D L+  + N   +D
Sbjct  626  LFDVDLKVQASYQGERVPLVSLMSRLNGKPIVGHPVQIEMLEDGSTDPLV--SRNVFGVD  683

Query  639  DDSAP  653
            + +AP
Sbjct  684  ERTAP  688



>ref|XP_009402985.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=868

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHD  632
            S L DV ++VK+ Y+  H+P +SLMS+LNG+ I GH + +E+L+DG   Q   S  +C D
Sbjct  643  SILFDVNLKVKASYQGEHVPLVSLMSRLNGKAIIGHPVQIEILEDGSAGQYTSSNYSCPD  702



>gb|KHN05521.1| Hypothetical protein glysoja_020486 [Glycine soja]
Length=740

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            L DV ++V++ YR  H+P+ISLMSKL+G+ I GH + VE L DG  D L 
Sbjct  509  LVDVDLKVQASYRKEHVPFISLMSKLDGRAIVGHPIQVEALKDGSSDILF  558



>ref|XP_009402986.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=847

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHD  632
            S L DV ++VK+ Y+  H+P +SLMS+LNG+ I GH + +E+L+DG   Q   S  +C D
Sbjct  622  SILFDVNLKVKASYQGEHVPLVSLMSRLNGKAIIGHPVQIEILEDGSAGQYTSSNYSCPD  681



>ref|XP_006590768.1| PREDICTED: uncharacterized protein At1g51745-like [Glycine max]
Length=740

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            L DV ++V++ YR  H+P+ISLMSKL+G+ I GH + VE L DG  D L 
Sbjct  509  LVDVDLKVQASYRKEHVPFISLMSKLDGRAIVGHPIQVEALKDGSSDILF  558



>ref|XP_004953538.1| PREDICTED: uncharacterized protein At1g51745-like [Setaria italica]
Length=824

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 3/81 (4%)
 Frame = +3

Query  375  YRLSRFVV--NPKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQP  548
            YR+ R V    P +    F+ R   +    L DV ++V++ Y+  H+P +SLMS+LNG+ 
Sbjct  567  YRVDRNVYWDGPSFYQRKFTSRFGGMG-PMLFDVNLKVQASYQGEHVPLVSLMSRLNGKA  625

Query  549  ITGHRLAVEVLDDGFCDQLLV  611
            I GH + +E+L+DG  D L+ 
Sbjct  626  IVGHPIQIEILEDGSTDHLVF  646



>ref|XP_010943463.1| PREDICTED: uncharacterized protein At1g51745 [Elaeis guineensis]
Length=827

 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLD  638
            L DV ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+L DG  D L+  + N   LD
Sbjct  604  LFDVDLKVQASYQGEHVPLVSLMSRLNGKAIIGHPVQIEILKDGSTDPLV--SRNVFSLD  661

Query  639  DDSA  650
            +++A
Sbjct  662  ENTA  665



>ref|XP_008785043.1| PREDICTED: uncharacterized protein At1g51745 [Phoenix dactylifera]
Length=822

 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLD  638
            L DV ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+L DG  D L+  + N   LD
Sbjct  599  LFDVDLKVQASYQGEHVPLVSLMSRLNGKAIIGHPVQIEILKDGSTDPLV--SRNVFGLD  656

Query  639  DDSA  650
            +++A
Sbjct  657  ENTA  660



>ref|XP_004137270.1| PREDICTED: uncharacterized protein LOC101221045 [Cucumis sativus]
Length=735

 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = +3

Query  393  VVNPKYESPD-FSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLA  569
            V NP Y  P  F  R   I    L DV ++V + Y+   +P +SLMSKLNGQ I GH + 
Sbjct  490  VKNPLYGIPHHFGERPRTI----LIDVDLKVHASYQKEPVPIVSLMSKLNGQAIIGHPIQ  545

Query  570  VEVLDDGFCDQLL  608
            +E L+DGF + +L
Sbjct  546  IETLEDGFSETIL  558



>gb|KGN53739.1| hypothetical protein Csa_4G114200 [Cucumis sativus]
Length=643

 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = +3

Query  393  VVNPKYESPD-FSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLA  569
            V NP Y  P  F  R   I    L DV ++V + Y+   +P +SLMSKLNGQ I GH + 
Sbjct  398  VKNPLYGIPHHFGERPRTI----LIDVDLKVHASYQKEPVPIVSLMSKLNGQAIIGHPIQ  453

Query  570  VEVLDDGFCDQLL  608
            +E L+DGF + +L
Sbjct  454  IETLEDGFSETIL  466



>ref|XP_010278764.1| PREDICTED: uncharacterized protein At1g51745 [Nelumbo nucifera]
Length=850

 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 7/82 (9%)
 Frame = +3

Query  381  LSRFVVNPKYESPDFSL-------RHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLN  539
            LS   +   +E PD  L       R H   D    D+KV+ ++ Y+  H+P +SLMSKLN
Sbjct  574  LSHSTLRGYWEEPDECLDPLYAGHRLHNGMDLVDVDLKVQTQTSYQGEHVPLVSLMSKLN  633

Query  540  GQPITGHRLAVEVLDDGFCDQL  605
            G+ I GH + +EVL++G  D L
Sbjct  634  GKAIIGHPIQIEVLENGSSDLL  655



>ref|XP_007220250.1| hypothetical protein PRUPE_ppa001649mg [Prunus persica]
 gb|EMJ21449.1| hypothetical protein PRUPE_ppa001649mg [Prunus persica]
Length=786

 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 68/150 (45%), Gaps = 32/150 (21%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYES  416
             SKWQ KGKRN R  N    S ++      + GP ++     +  P+     V N  +++
Sbjct  456  VSKWQLKGKRNIR--NLTKRSMDATDGRGYIYGPYSE----EKVCPFSQRANVDNNDFQT  509

Query  417  -------PDFSL----------RHHVIAD---------SSLTDVKVEVKSCYRTRHIPYI  518
                    D S           R H + D           L DV ++V++ Y+   +P +
Sbjct  510  DWEDSTWEDRSAWNEYWDIKRDRFHPVYDGRYHYRRRPRYLIDVDLKVQASYQKEPVPIV  569

Query  519  SLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            SLMSKLNG+ I GH + +E L+DG  + LL
Sbjct  570  SLMSKLNGKAIIGHPIQIEALEDGSSNSLL  599



>ref|XP_004968966.1| PREDICTED: uncharacterized protein At1g51745-like [Setaria italica]
Length=717

 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  768  VRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  917
            +RRLSS  G R+++ ++ P V +  GPT+ACVPL++VFSRI  AL+ S+R
Sbjct  663  MRRLSSFAGSRRESGDRKPVVVKTGGPTVACVPLRLVFSRINEALSFSVR  712



>ref|XP_010227249.1| PREDICTED: uncharacterized protein At1g51745-like [Brachypodium 
distachyon]
Length=791

 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 94/202 (47%), Gaps = 46/202 (23%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLV-------  611
            ++L DV+++V++ Y+   +P +SLM+ +N + I GH + +E+L+DG  D  ++       
Sbjct  590  TTLFDVELKVQAIYQGERVPLVSLMN-MNRKAIVGHPIQIELLEDGSTDHFVLGSDIVLG  648

Query  612  ----------------------SASNCHDLDDDSAPKGVDMVNKTKLSFGGRLQPRAsst  725
                                  S S+   LD D+AP    +     +S  GR   + S  
Sbjct  649  HSTGAAPAWRKGRRTAMPRVPRSNSSQATLDSDAAPSNQQLGLAKNISSSGRPFSQKSRK  708

Query  726  ksskskkesmlskkVRRLSSLTGPRKQNRE----KNPTVQQLRG---------PTIACVP  866
            K S  K+ S  S+K+R LSS+   +K+ RE    K      + G         P + CVP
Sbjct  709  KPSNFKEGSSPSQKIRILSSIHIAKKRLRECGLAKAHRSSNILGGLIEPEGAIPLVTCVP  768

Query  867  LKVVFSRIKAALNSSIRPAHRL  932
             KVVFSRI  A+    RP+H L
Sbjct  769  AKVVFSRIMEAVG---RPSHAL  787



>ref|XP_008451676.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Cucumis 
melo]
Length=735

 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = +3

Query  393  VVNPKYESPD-FSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLA  569
            V NP Y  P  F  R   I    L DV ++V + Y+   +P +SLMSKLNGQ I GH + 
Sbjct  490  VKNPLYGIPHHFGGRPRTI----LIDVDLKVHASYQKEPVPIVSLMSKLNGQAIIGHPIQ  545

Query  570  VEVLDDGFCDQLL  608
            +E L+DGF + +L
Sbjct  546  IETLEDGFSETIL  558



>ref|XP_004171220.1| PREDICTED: uncharacterized protein LOC101227164, partial [Cucumis 
sativus]
Length=664

 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = +3

Query  393  VVNPKYESPD-FSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLA  569
            V NP Y  P  F  R   I    L DV ++V + Y+   +P +SLMSKLNGQ I GH + 
Sbjct  476  VKNPLYGIPHHFGERPRTI----LIDVDLKVHASYQKEPVPIVSLMSKLNGQAIIGHPIQ  531

Query  570  VEVLDDGFCDQLL  608
            +E L+DGF + +L
Sbjct  532  IETLEDGFSETIL  544



>ref|XP_004307887.1| PREDICTED: uncharacterized protein LOC101303560 [Fragaria vesca 
subsp. vesca]
Length=745

 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 81/188 (43%), Gaps = 37/188 (20%)
 Frame = +3

Query  240  SKWQSKGKRNFR--TGNFIDWSRN-----SPHKESQ--MKGPTADLPIPRRSLPYR--LS  386
            SKWQ KGKRN R  +   ID +        P+ E +  M G     P+ R +   R  + 
Sbjct  399  SKWQLKGKRNTRNLSKRSIDTTEGRGFFYGPYSEEKAGMTGLDNGYPLSRAASRSRNRVG  458

Query  387  RFVVN-------------------PKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHI  509
             ++++                    +Y+     L +H      L DV ++V++ Y+   +
Sbjct  459  LYMIDWEDGTWEDRSAWDECWDKRERYDQIYDDLYNHRRRPKYLIDVDLKVQASYQKEPV  518

Query  510  PYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLS  689
            P +SLMSKLNG+ I GH + VE L+DG  + L  +        DDS  + +D    T L 
Sbjct  519  PIVSLMSKLNGKAIIGHPIQVEALEDGLSNTLFSTF-------DDSGDEAIDNDGGTTLP  571

Query  690  FGGRLQPR  713
               R   R
Sbjct  572  HAWRTARR  579



>ref|XP_008451680.1| PREDICTED: uncharacterized protein At1g51745 isoform X4 [Cucumis 
melo]
Length=643

 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = +3

Query  393  VVNPKYESPD-FSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLA  569
            V NP Y  P  F  R   I    L DV ++V + Y+   +P +SLMSKLNGQ I GH + 
Sbjct  398  VKNPLYGIPHHFGGRPRTI----LIDVDLKVHASYQKEPVPIVSLMSKLNGQAIIGHPIQ  453

Query  570  VEVLDDGFCDQLL  608
            +E L+DGF + +L
Sbjct  454  IETLEDGFSETIL  466



>ref|XP_010549813.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Tarenaya 
hassleriana]
Length=760

 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  390  FVVNPKYESPDFSLRHHVIAD--SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHR  563
            + V P    P+F   H       S L DV++EV+ CY+   +P +SLMSKL+G+ I GH 
Sbjct  504  WEVKPDGFRPEFGASHQFGGKMRSPLIDVELEVQGCYQKGPVPIVSLMSKLDGRAIIGHP  563

Query  564  LAVEVLDDGFCDQLL  608
            + +EVL DG  +  L
Sbjct  564  IGIEVLVDGSSETYL  578



>gb|EAY87184.1| hypothetical protein OsI_08586 [Oryza sativa Indica Group]
Length=827

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLV  611
            L DV ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+L+DG  D L+ 
Sbjct  593  LFDVDLKVQASYQGEHVPLVSLMSRLNGKAIVGHPVQIEILEDGSTDHLVF  643



>ref|NP_001047836.1| Os02g0700000 [Oryza sativa Japonica Group]
 dbj|BAD07514.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD07885.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09750.1| Os02g0700000 [Oryza sativa Japonica Group]
 gb|EAZ24294.1| hypothetical protein OsJ_08046 [Oryza sativa Japonica Group]
 dbj|BAG94731.1| unnamed protein product [Oryza sativa Japonica Group]
Length=827

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLV  611
            L DV ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+L+DG  D L+ 
Sbjct  593  LFDVDLKVQASYQGEHVPLVSLMSRLNGKAIVGHPVQIEILEDGSTDHLVF  643



>ref|XP_010549814.1| PREDICTED: uncharacterized protein LOC104820875 isoform X2 [Tarenaya 
hassleriana]
Length=643

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  390  FVVNPKYESPDFSLRHHVIAD--SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHR  563
            + V P    P+F   H       S L DV++EV+ CY+   +P +SLMSKL+G+ I GH 
Sbjct  387  WEVKPDGFRPEFGASHQFGGKMRSPLIDVELEVQGCYQKGPVPIVSLMSKLDGRAIIGHP  446

Query  564  LAVEVLDDGFCDQLL  608
            + +EVL DG  +  L
Sbjct  447  IGIEVLVDGSSETYL  461



>ref|XP_008451679.1| PREDICTED: uncharacterized protein At1g51745 isoform X3 [Cucumis 
melo]
Length=726

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = +3

Query  393  VVNPKYESPD-FSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLA  569
            V NP Y  P  F  R   I    L DV ++V + Y+   +P +SLMSKLNGQ I GH + 
Sbjct  481  VKNPLYGIPHHFGGRPRTI----LIDVDLKVHASYQKEPVPIVSLMSKLNGQAIIGHPIQ  536

Query  570  VEVLDDGFCDQLL  608
            +E L+DGF + +L
Sbjct  537  IETLEDGFSETIL  549



>ref|XP_011075809.1| PREDICTED: uncharacterized protein LOC105160226 [Sesamum indicum]
 ref|XP_011075810.1| PREDICTED: uncharacterized protein LOC105160226 [Sesamum indicum]
Length=679

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 67/161 (42%), Gaps = 37/161 (23%)
 Frame = +3

Query  237  TSKWQSKGKRN-------------------FRTGNFIDWSRNSPHKESQMK---------  332
             SKWQ KGKRN                   + T    +W+ N    +S  K         
Sbjct  364  VSKWQLKGKRNNRNLGKRSLDRTDAEVSRAYMTSRNSNWTNNGFKADSIDKSFRTHISRY  423

Query  333  GPT--------ADLPIPRRSLPYRLSRFVVN-PKYESPDFSLRHHVIADSSLTDVKVEVK  485
            GPT        ADL     + P  +  +  +  +Y  P    RH      +L DV ++V+
Sbjct  424  GPTSQHSSSDIADLEGLAWNSPSSMRGYWEDRQEYVDPLLVARHRFGGRITLIDVDLKVQ  483

Query  486  SCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            +    R +P ISLMSKLNG  I GH + +E L+ G  + LL
Sbjct  484  ANNYRRDVPMISLMSKLNGHAIVGHPIQIEALESGLSENLL  524



>ref|XP_008451678.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Cucumis 
melo]
Length=732

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = +3

Query  393  VVNPKYESPD-FSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLA  569
            V NP Y  P  F  R   I    L DV ++V + Y+   +P +SLMSKLNGQ I GH + 
Sbjct  487  VKNPLYGIPHHFGGRPRTI----LIDVDLKVHASYQKEPVPIVSLMSKLNGQAIIGHPIQ  542

Query  570  VEVLDDGFCDQLL  608
            +E L+DGF + +L
Sbjct  543  IETLEDGFSETIL  555



>gb|EEC77915.1| hypothetical protein OsI_17245 [Oryza sativa Indica Group]
Length=803

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASN  623
            L +V + V++ Y+  H+P +SLMS+LNG+ I GH + +E+L+DG  D L++++ +
Sbjct  578  LFNVDLNVQAGYQGEHVPLVSLMSRLNGKAIVGHPIQIEILEDGSTDHLVLASDD  632



>emb|CAE03465.2| OSJNBa0083N12.2 [Oryza sativa Japonica Group]
 gb|EEE61605.1| hypothetical protein OsJ_16022 [Oryza sativa Japonica Group]
Length=863

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASN  623
            L +V + V++ Y+  H+P +SLMS+LNG+ I GH + +E+L+DG  D L++++ +
Sbjct  638  LFNVDLNVQAGYQGEHVPLVSLMSRLNGKAIVGHPIQIEILEDGSTDHLVLASDD  692



>ref|XP_002274927.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Vitis 
vinifera]
Length=838

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 68/148 (46%), Gaps = 22/148 (15%)
 Frame = +3

Query  186  NLGNADIL--DSGPRM-GKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPI  356
            +L  AD++  D G +M G +   +    K   R  N IDW   +   +  +KG   D   
Sbjct  522  DLHEADLIEKDFGTQMAGLDGRGYSLTSKTAPRARNMIDWEELTWEDQPALKGYWED---  578

Query  357  PRRSLPYRLSRFVVNPKYESPDFSLRHHVIA--DSSLTDVKVEVKSCYRTRHIPYISLMS  530
                            +   P F  RH+      ++L DV + V++ Y+  H+P ISLMS
Sbjct  579  --------------TGECFDPIFVGRHNPAGRIKTTLVDVDLRVQTNYQREHVPIISLMS  624

Query  531  KLNGQPITGHRLAVEVLDDGFCDQLLVS  614
            +LN + I GH + +E L+DG  + LL S
Sbjct  625  RLNDKSIVGHPIQIEALEDGSSEMLLSS  652



>emb|CAI44650.1| OSJNba0093F12.23 [Oryza sativa Japonica Group]
Length=886

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASN  623
            L +V + V++ Y+  H+P +SLMS+LNG+ I GH + +E+L+DG  D L++++ +
Sbjct  661  LFNVDLNVQAGYQGEHVPLVSLMSRLNGKAIVGHPIQIEILEDGSTDHLVLASDD  715



>ref|NP_001031172.1| Tudor/PWWP/MBT superfamily protein [Arabidopsis thaliana]
 gb|AEE32711.1| Tudor/PWWP/MBT superfamily protein [Arabidopsis thaliana]
Length=504

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 60/127 (47%), Gaps = 34/127 (27%)
 Frame = +3

Query  231  KETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKY  410
            K TSKWQ KGKRN         SR    K+ + +    +      S P+           
Sbjct  384  KNTSKWQLKGKRN---------SRQMSKKQEERRNVYGEEANNNSSTPH-----------  423

Query  411  ESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDG  590
                          S+L +VK+EVK+ Y    +P +S MS+L+G+ I GH L+VE+L++ 
Sbjct  424  --------------STLYEVKIEVKASYTKPRVPLVSRMSELSGKAIVGHPLSVEILEED  469

Query  591  FCDQLLV  611
            + + +++
Sbjct  470  YSNGMVM  476



>ref|XP_010662138.1| PREDICTED: uncharacterized protein LOC100254467 isoform X2 [Vitis 
vinifera]
Length=649

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 79/171 (46%), Gaps = 23/171 (13%)
 Frame = +3

Query  186  NLGNADIL--DSGPRM-GKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPI  356
            +L  AD++  D G +M G +   +    K   R  N IDW   +   +  +KG   D   
Sbjct  333  DLHEADLIEKDFGTQMAGLDGRGYSLTSKTAPRARNMIDWEELTWEDQPALKGYWED---  389

Query  357  PRRSLPYRLSRFVVNPKYESPDFSLRHHVIA--DSSLTDVKVEVKSCYRTRHIPYISLMS  530
                            +   P F  RH+      ++L DV + V++ Y+  H+P ISLMS
Sbjct  390  --------------TGECFDPIFVGRHNPAGRIKTTLVDVDLRVQTNYQREHVPIISLMS  435

Query  531  KLNGQPITGHRLAVEVLDDGFCDQLLVSASNC-HDLDDDSAPKGVDMVNKT  680
            +LN + I GH + +E L+DG  + LL S  +  +D+ D+   + +  V +T
Sbjct  436  RLNDKSIVGHPIQIEALEDGSSEMLLSSNEDFGNDVFDNDRNRAIPPVWRT  486



>ref|XP_009776963.1| PREDICTED: uncharacterized protein LOC104226632 [Nicotiana sylvestris]
Length=408

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  447  ADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNC  626
            + ++L DV + V+  YR  H P +SLMS+LNG+ I GH + +EVLDD   + LLV   + 
Sbjct  265  SSNTLIDVDMTVQGTYRGEHTPLVSLMSRLNGKAIVGHPVNIEVLDDS-SEILLVKKESS  323

Query  627  HDLDDDS  647
              L D S
Sbjct  324  DQLKDKS  330



>gb|AFW72945.1| hypothetical protein ZEAMMB73_974607 [Zea mays]
Length=408

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLV  611
            L +V ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+++DG  D L++
Sbjct  183  LFNVNLKVQASYQGEHVPLVSLMSRLNGKAIVGHPIQIEIVEDGSTDHLIL  233



>emb|CDY48880.1| BnaA03g36190D [Brassica napus]
Length=101

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +3

Query  450  DSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVS  614
            D  L DV++E K+ Y   ++P ISL SKLN + + GH   VE+L+DG CD++L S
Sbjct  4    DFQLYDVEIEEKANYEPWNVPLISLESKLNDEAVVGHPSTVEMLEDGSCDRVLCS  58



>emb|CAN77845.1| hypothetical protein VITISV_020829 [Vitis vinifera]
Length=797

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 80/171 (47%), Gaps = 23/171 (13%)
 Frame = +3

Query  186  NLGNADIL--DSGPRM-GKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPI  356
            ++  AD++  D G +M G ++  +    K   R  N IDW   +   +  +KG   D   
Sbjct  522  DVHEADLIEKDFGTQMAGLDSRGYSLTSKTAPRARNMIDWEELTWEDQPALKGYWED---  578

Query  357  PRRSLPYRLSRFVVNPKYESPDFSLRHHVIA--DSSLTDVKVEVKSCYRTRHIPYISLMS  530
                            +   P F  RH+      ++L DV + V++ Y+  H+P ISLMS
Sbjct  579  --------------TGECFDPIFVGRHNPAGRIKTTLVDVDLRVQTNYQREHVPIISLMS  624

Query  531  KLNGQPITGHRLAVEVLDDGFCDQLLVSASNC-HDLDDDSAPKGVDMVNKT  680
            +LN + I GH + +E L+DG  + LL S  +  +D+ D+   + +  V +T
Sbjct  625  RLNDKSIVGHPIQIEALEDGSSEMLLSSNEDFGNDVFDNDRNRAIPPVWRT  675



>sp|P59278.2|Y1745_ARATH RecName: Full=Uncharacterized protein At1g51745 [Arabidopsis 
thaliana]
Length=597

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 61/129 (47%), Gaps = 34/129 (26%)
 Frame = +3

Query  225  MGKETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNP  404
            + K TSKWQ KGKRN         SR    K+ + +    +      S P+         
Sbjct  441  IEKNTSKWQLKGKRN---------SRQMSKKQEERRNVYGEEANNNSSTPH---------  482

Query  405  KYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLD  584
                            S+L +VK+EVK+ Y    +P +S MS+L+G+ I GH L+VE+L+
Sbjct  483  ----------------STLYEVKIEVKASYTKPRVPLVSRMSELSGKAIVGHPLSVEILE  526

Query  585  DGFCDQLLV  611
            + + + +++
Sbjct  527  EDYSNGMVM  535



>gb|AAO22798.1| unknown protein [Arabidopsis thaliana]
Length=597

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 60/127 (47%), Gaps = 34/127 (27%)
 Frame = +3

Query  231  KETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKY  410
            K TSKWQ KGKRN         SR    K+ + +    +      S P+           
Sbjct  443  KNTSKWQLKGKRN---------SRQMSKKQEERRNVYGEEANNNSSTPH-----------  482

Query  411  ESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDG  590
                          S+L +VK+EVK+ Y    +P +S MS+L+G+ I GH L+VE+L++ 
Sbjct  483  --------------STLYEVKIEVKASYTKPRVPLVSRMSELSGKAIVGHPLSVEILEED  528

Query  591  FCDQLLV  611
            + + +++
Sbjct  529  YSNGMVM  535



>ref|NP_564598.2| Tudor/PWWP/MBT superfamily protein [Arabidopsis thaliana]
 gb|AEE32710.1| Tudor/PWWP/MBT superfamily protein [Arabidopsis thaliana]
Length=563

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 60/127 (47%), Gaps = 34/127 (27%)
 Frame = +3

Query  231  KETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKY  410
            K TSKWQ KGKRN         SR    K+ + +    +      S P+           
Sbjct  443  KNTSKWQLKGKRN---------SRQMSKKQEERRNVYGEEANNNSSTPH-----------  482

Query  411  ESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDG  590
                          S+L +VK+EVK+ Y    +P +S MS+L+G+ I GH L+VE+L++ 
Sbjct  483  --------------STLYEVKIEVKASYTKPRVPLVSRMSELSGKAIVGHPLSVEILEED  528

Query  591  FCDQLLV  611
            + + +++
Sbjct  529  YSNGMVM  535



>ref|XP_010918108.1| PREDICTED: uncharacterized protein LOC105042543 [Elaeis guineensis]
Length=847

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLD  638
            L DV ++VK+ Y+   +P +SLMS+LNG+ I GH + +E+L+DG  D L+  + N   +D
Sbjct  629  LFDVDLKVKASYQGERVPLVSLMSRLNGKAIVGHPVQIEMLEDGSTDPLV--SRNVFCVD  686

Query  639  DDSAP  653
            + +AP
Sbjct  687  ERAAP  691



>ref|XP_009783633.1| PREDICTED: uncharacterized protein At1g51745-like [Nicotiana 
sylvestris]
Length=761

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 97/258 (38%), Gaps = 69/258 (27%)
 Frame = +3

Query  39   LGLKDTCSSPIVPC---ASQKGEFSA-------GAPSSESGQVETMSCGSG---------  161
            L  KD CS P   C   AS   E++         A S    ++ T+S G+          
Sbjct  349  LKRKDNCSHPAELCQQNASVSTEYTETDSSETDSAESDTDDELATLSDGAASIELEPKYI  408

Query  162  -------EHNESGCTNLGNADILDSGPRM---GKETSKWQSKGKRNFRTGN------FID  293
                   EH       L    + D        G E SKWQ KGKRN R+ N      F  
Sbjct  409  GRSEAQPEHGSMSSEELDELALTDGTSHTVSAGFEVSKWQIKGKRNNRSLNRRPLDTFDG  468

Query  294  WSRNSPHKESQMKGP-----TADLPIPRRSL---------PYRLSRFVVN----------  401
                 P + +  KG      + D P+    +         P+  +R + N          
Sbjct  469  NLARRPSQTTNFKGKRGYGCSQDDPVTNSWVQNAGYGSRTPHSATRNMFNWADWAWDDQP  528

Query  402  ---------PKYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPIT  554
                      +Y  P  S  HH    + L DV ++V+S Y+   +P ISLMSK+NG  I 
Sbjct  529  ASRGYWEESSEYFDP-VSNYHHSGDRTMLVDVDLKVQSSYQRERVPIISLMSKINGHAIV  587

Query  555  GHRLAVEVLDDGFCDQLL  608
            G+ + +E L +G  + LL
Sbjct  588  GYPIKIEALSNGSSEGLL  605



>ref|XP_008646117.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Zea 
mays]
 gb|AFW72946.1| hypothetical protein ZEAMMB73_974607 [Zea mays]
Length=822

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLV  611
            L +V ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+++DG  D L++
Sbjct  597  LFNVNLKVQASYQGEHVPLVSLMSRLNGKAIVGHPIQIEIVEDGSTDHLIL  647



>ref|XP_008646118.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Zea 
mays]
Length=818

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLV  611
            L +V ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+++DG  D L++
Sbjct  593  LFNVNLKVQASYQGEHVPLVSLMSRLNGKAIVGHPIQIEIVEDGSTDHLIL  643



>ref|XP_006647738.1| PREDICTED: uncharacterized protein LOC102704308 [Oryza brachyantha]
Length=824

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            L DV ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+L DG  D L+
Sbjct  596  LFDVDLKVQASYQGEHVPLVSLMSRLNGKAIVGHPVQIEILGDGSTDNLV  645



>ref|XP_003570168.1| PREDICTED: uncharacterized protein LOC100840926 [Brachypodium 
distachyon]
Length=816

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            L DV ++V++ Y   H+P +SLMS+L+G+ I GH + +E+L+DG  D L+
Sbjct  591  LFDVDLKVQASYHGEHVPLVSLMSRLDGKAIVGHPIQIEILEDGTTDHLV  640



>gb|EYU45368.1| hypothetical protein MIMGU_mgv1a018253mg [Erythranthe guttata]
Length=643

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  405  KYESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLD  584
            +Y  P F   H     + L DV ++V+     R +P ISLMSKLNG  I GH + +E L+
Sbjct  435  EYVDPLFVDMHQFGGRTMLMDVDLQVQGNNYRRDVPMISLMSKLNGHAIIGHPITIEALE  494

Query  585  DGFCDQLLVS  614
            +G  + LL +
Sbjct  495  NGLSEDLLTA  504



>ref|XP_010243122.1| PREDICTED: uncharacterized protein At1g51745-like [Nelumbo nucifera]
Length=813

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +3

Query  450  DSSLTDV--KVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            DS L DV  KV+ ++ Y+  H+P +SLMS+LNG+ I GH + +E L++G  D LL
Sbjct  569  DSVLVDVDLKVQAQASYQGEHVPLVSLMSRLNGKAIIGHPIQIEALENGSSDILL  623



>ref|XP_002452698.1| hypothetical protein SORBIDRAFT_04g030860 [Sorghum bicolor]
 gb|EES05674.1| hypothetical protein SORBIDRAFT_04g030860 [Sorghum bicolor]
Length=818

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLV  611
            L +V ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+++DG  D L+ 
Sbjct  595  LFNVNLKVQASYQGEHVPLVSLMSRLNGKAIVGHPIQIEIVEDGSTDHLVF  645



>ref|XP_003607394.1| hypothetical protein MTR_4g077550 [Medicago truncatula]
Length=745

 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 72/181 (40%), Gaps = 59/181 (33%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYR------------  380
             SKWQ KGKRN R  N I  S  +P  +  + G   D    R +L ++            
Sbjct  391  VSKWQLKGKRNNR--NLIKRSYGAPDGKGIIYGAEGDFEEGRTNLSHKSLHCYENGFSDA  448

Query  381  --------------------LSRF------------------VVNPKY-----ESPDFSL  431
                                +S+F                  V + +Y      +P +  
Sbjct  449  LYEDDQMLELEDEDSLTPRPVSKFQNKIHRGTDWNDLTWDENVASKEYWDMKEYNPTYGD  508

Query  432  RHHV--IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQL  605
            R+HV     S L +V V V++ YR   +P ISLMSKL+G+ I GH + VEVL DG  D  
Sbjct  509  RYHVGRRMRSMLINVDVRVQAGYRKEPVPIISLMSKLDGKAIIGHPIQVEVLKDGSSDTF  568

Query  606  L  608
             
Sbjct  569  F  569



>gb|AES89591.2| tudor/PWWP/MBT superfamily protein [Medicago truncatula]
Length=736

 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 72/181 (40%), Gaps = 59/181 (33%)
 Frame = +3

Query  237  TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYR------------  380
             SKWQ KGKRN R  N I  S  +P  +  + G   D    R +L ++            
Sbjct  382  VSKWQLKGKRNNR--NLIKRSYGAPDGKGIIYGAEGDFEEGRTNLSHKSLHCYENGFSDA  439

Query  381  --------------------LSRF------------------VVNPKY-----ESPDFSL  431
                                +S+F                  V + +Y      +P +  
Sbjct  440  LYEDDQMLELEDEDSLTPRPVSKFQNKIHRGTDWNDLTWDENVASKEYWDMKEYNPTYGD  499

Query  432  RHHV--IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQL  605
            R+HV     S L +V V V++ YR   +P ISLMSKL+G+ I GH + VEVL DG  D  
Sbjct  500  RYHVGRRMRSMLINVDVRVQAGYRKEPVPIISLMSKLDGKAIIGHPIQVEVLKDGSSDTF  559

Query  606  L  608
             
Sbjct  560  F  560



>ref|XP_008376887.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Malus domestica]
Length=793

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +3

Query  417  PDFSLRHHVIAD-SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGF  593
            P +  RHH       L DV ++V++ Y+   +P +SLMSKLNG+ I GH + +E L+DG 
Sbjct  541  PVYDGRHHYRRRPKYLIDVDLKVQASYQKEPVPIVSLMSKLNGKAIIGHPIQIEALEDGS  600

Query  594  CDQLL  608
             + LL
Sbjct  601  SNSLL  605



>ref|XP_002891656.1| hypothetical protein ARALYDRAFT_474292 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67915.1| hypothetical protein ARALYDRAFT_474292 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 34/127 (27%)
 Frame = +3

Query  231  KETSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKY  410
            K TSKW+ KGKRN         SR    K+ + +    +        P+           
Sbjct  390  KSTSKWKLKGKRN---------SRQMSKKQEERRNVYGEEANNNSCTPH-----------  429

Query  411  ESPDFSLRHHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDG  590
                          S+L +VK+EVK+ Y    +P +S MS+LNG+ I GH L+VE+L++ 
Sbjct  430  --------------SALYEVKIEVKANYNKPRVPLVSRMSELNGKAIVGHPLSVEILEED  475

Query  591  FCDQLLV  611
            + + +++
Sbjct  476  YSNGMVM  482



>ref|XP_008376888.1| PREDICTED: uncharacterized protein LOC103439999 isoform X2 [Malus 
domestica]
Length=609

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +3

Query  417  PDFSLRHHVIAD-SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGF  593
            P +  RHH       L DV ++V++ Y+   +P +SLMSKLNG+ I GH + +E L+DG 
Sbjct  357  PVYDGRHHYRRRPKYLIDVDLKVQASYQKEPVPIVSLMSKLNGKAIIGHPIQIEALEDGS  416

Query  594  CDQLL  608
             + LL
Sbjct  417  SNSLL  421



>ref|XP_004505617.1| PREDICTED: uncharacterized protein At1g51745-like [Cicer arietinum]
Length=741

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  414  SPDFSLRHHV--IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDD  587
            +P +  R+H      S L +V V+V++ Y+   +P+ISLMSKL+G+ I GH + VEVL D
Sbjct  490  TPMYDDRYHFGERMRSMLVNVDVKVQARYQKEPVPFISLMSKLDGKAIIGHPVQVEVLKD  549

Query  588  GFCDQLL  608
            G  D L 
Sbjct  550  GSSDTLF  556



>ref|XP_002520007.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42331.1| conserved hypothetical protein [Ricinus communis]
Length=757

 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +3

Query  432  RHHV--IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQL  605
            RHH      S L DV ++V++ Y+   +P +SLMSKLNG+ I GH + +E L+DG  + +
Sbjct  519  RHHFGGRTRSMLLDVDLKVQASYQKEPVPIVSLMSKLNGKAIIGHPIQIEALEDGSSEAV  578

Query  606  LVSASNC  626
            + +   C
Sbjct  579  ISTNDYC  585



>ref|XP_009119103.1| PREDICTED: uncharacterized protein At1g51745-like [Brassica rapa]
Length=716

 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +3

Query  405  KYESPDFSLRHHVIADSS-LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVL  581
            K+E  D S RH        L DV +EV+  YR   +P++SLMSKLNG+ I GH + V+VL
Sbjct  475  KHEGSDASHRHFGRKTYPPLMDVDLEVQGSYRKGPVPFVSLMSKLNGRAIIGHPVEVQVL  534

Query  582  DDGFCD--QLLVSASNCHD  632
             DG  +  +   + ++ HD
Sbjct  535  ADGSSESYEYFSNETSYHD  553



>ref|XP_009626996.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana tomentosiformis]
Length=761

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 69/168 (41%), Gaps = 44/168 (26%)
 Frame = +3

Query  228  GKETSKWQSKGKRNFR--------------------TGNFI---------------DWSR  302
            G E SKWQ KGKRN R                    T NF                 W +
Sbjct  441  GFEVSKWQIKGKRNNRSLNRRPLDTFDVNLARRPSHTTNFKGKRGYGCSQDDPVTNSWVQ  500

Query  303  N------SPHKESQMKGPTADLPIPRRSLPYRLSRFVVNPKYESPDFSLRHHVIADSSLT  464
            N      +PH  ++     AD     +  P     +  + +Y  P  +  HH    + L 
Sbjct  501  NAGYGSRTPHSATRNMFSWADWAWDDQ--PASRGYWEESSEYFDP-VNNYHHSGDRTMLV  557

Query  465  DVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            DV ++V+S Y+   +P ISLMSK+NG  I G+ + +E L +G  + LL
Sbjct  558  DVDLKVQSSYQRERVPIISLMSKINGHAIVGYPIKIEALSNGSSEGLL  605



>ref|XP_002325377.2| hypothetical protein POPTR_0019s07270g [Populus trichocarpa]
 gb|EEE99758.2| hypothetical protein POPTR_0019s07270g [Populus trichocarpa]
Length=782

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 54/96 (56%), Gaps = 3/96 (3%)
 Frame = +3

Query  405  KYESPDFSLRHHV--IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEV  578
            ++ +P F  +HH    A S L DV ++V+S Y+   +P +SL+SK +G+ I GH + +E 
Sbjct  520  EHSNPIFVGQHHFGGRARSLLVDVDLKVQSSYQKDRVPIVSLISKFDGKAIIGHPIPIEA  579

Query  579  LDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKL  686
            ++DGF +      ++   L+D  + + VD    T L
Sbjct  580  VEDGFSETQF-PLNDQFPLNDYYSNEAVDQDESTSL  614



>emb|CDY23461.1| BnaC04g49890D [Brassica napus]
Length=715

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = +3

Query  405  KYESPDFSLRHHVIADSS--LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEV  578
            K+E  D S RH     +   L DV +EV+  YR   +P++SLMSKLNG+ I GH + V+V
Sbjct  473  KHEGSDASHRHLGRRKTYPPLMDVDLEVQGSYRKGPVPFVSLMSKLNGRAIIGHPVEVQV  532

Query  579  LDDGFCD--QLLVSASNCHD  632
            L DG  +  +   + ++ HD
Sbjct  533  LADGSSESYEYFGNETSYHD  552



>ref|XP_009351866.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Pyrus 
x bretschneideri]
Length=609

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = +3

Query  264  RNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYR-LSRFVVNPKYESPDFSLRHH  440
            RN    N IDW  +   ++   +    D+   R    Y    R++  PKY          
Sbjct  324  RNSVGQNMIDW-EDWTWEDRSARNEYWDIKRERFHPVYDGRHRYLRRPKY----------  372

Query  441  VIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
                  L DV ++V++ Y+   +P +SLMSKLNG+ I GH + +E L+DG  + LL
Sbjct  373  ------LIDVDLKVQASYQKEPVPIVSLMSKLNGKAIIGHPIQIEALEDGSSNSLL  422



>ref|XP_009351865.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Pyrus 
x bretschneideri]
Length=793

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = +3

Query  264  RNFRTGNFIDWSRNSPHKESQMKGPTADLPIPRRSLPYR-LSRFVVNPKYESPDFSLRHH  440
            RN    N IDW  +   ++   +    D+   R    Y    R++  PKY          
Sbjct  508  RNSVGQNMIDW-EDWTWEDRSARNEYWDIKRERFHPVYDGRHRYLRRPKY----------  556

Query  441  VIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
                  L DV ++V++ Y+   +P +SLMSKLNG+ I GH + +E L+DG  + LL
Sbjct  557  ------LIDVDLKVQASYQKEPVPIVSLMSKLNGKAIIGHPIQIEALEDGSSNSLL  606



>ref|XP_010087499.1| hypothetical protein L484_019705 [Morus notabilis]
 gb|EXB29180.1| hypothetical protein L484_019705 [Morus notabilis]
Length=815

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            S L DV ++V++ Y+   +P +SLMSKLNG+ I GH + +E L+DG    LL
Sbjct  574  SMLMDVDLKVQASYQKEPVPIVSLMSKLNGKAIIGHPIQIETLEDGSSSNLL  625



>ref|XP_006590455.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Glycine max]
Length=625

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 68/147 (46%), Gaps = 29/147 (20%)
 Frame = +3

Query  192  GNADILDSGPRM-GKE-----TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLP  353
            G +D+ D   +M G E     TSK  +KG+     G  +DW   +   ++ +KG      
Sbjct  316  GISDVFDDTDQMFGFEDEYSPTSKALAKGQNKIDHG--VDWDEWAWEDQTALKG------  367

Query  354  IPRRSLPYRLSRFVVNPKYESPDFSLRHHVIAD--SSLTDVKVEVKSCYRTRHIPYISLM  527
                             K  +P +S R+H      S L DV ++V++ YR   +P +S+ 
Sbjct  368  -------------YWESKGFAPLYSDRYHFDGRIRSMLVDVDLKVQASYRKAPVPIVSIT  414

Query  528  SKLNGQPITGHRLAVEVLDDGFCDQLL  608
            SKL+G+ I GH + +E L DG  D+L 
Sbjct  415  SKLDGKSIIGHPIQIESLKDGSSDKLF  441



>ref|XP_006590454.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Glycine max]
Length=626

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 68/147 (46%), Gaps = 29/147 (20%)
 Frame = +3

Query  192  GNADILDSGPRM-GKE-----TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLP  353
            G +D+ D   +M G E     TSK  +KG+     G  +DW   +   ++ +KG      
Sbjct  317  GISDVFDDTDQMFGFEDEYSPTSKALAKGQNKIDHG--VDWDEWAWEDQTALKG------  368

Query  354  IPRRSLPYRLSRFVVNPKYESPDFSLRHHVIAD--SSLTDVKVEVKSCYRTRHIPYISLM  527
                             K  +P +S R+H      S L DV ++V++ YR   +P +S+ 
Sbjct  369  -------------YWESKGFAPLYSDRYHFDGRIRSMLVDVDLKVQASYRKAPVPIVSIT  415

Query  528  SKLNGQPITGHRLAVEVLDDGFCDQLL  608
            SKL+G+ I GH + +E L DG  D+L 
Sbjct  416  SKLDGKSIIGHPIQIESLKDGSSDKLF  442



>gb|KHN35122.1| Hypothetical protein glysoja_004888 [Glycine soja]
Length=632

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 68/147 (46%), Gaps = 29/147 (20%)
 Frame = +3

Query  192  GNADILDSGPRM-GKE-----TSKWQSKGKRNFRTGNFIDWSRNSPHKESQMKGPTADLP  353
            G +D+ D   +M G E     TSK  +KG+     G  +DW   +   ++ +KG      
Sbjct  323  GISDVFDDTDQMFGFEDEYSPTSKALAKGQNKIDHG--VDWDEWAWEDQTALKG------  374

Query  354  IPRRSLPYRLSRFVVNPKYESPDFSLRHHVIAD--SSLTDVKVEVKSCYRTRHIPYISLM  527
                             K  +P +S R+H      S L DV ++V++ YR   +P +S+ 
Sbjct  375  -------------YWESKGFAPLYSDRYHFDGRIRSMLVDVDLKVQASYRKAPVPIVSIT  421

Query  528  SKLNGQPITGHRLAVEVLDDGFCDQLL  608
            SKL+G+ I GH + +E L DG  D+L 
Sbjct  422  SKLDGKSIIGHPIQIESLKDGSSDKLF  448



>ref|XP_009361204.1| PREDICTED: uncharacterized protein At1g51745-like [Pyrus x bretschneideri]
Length=793

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            L DV ++V++ Y+   +P +SLMSKLNG+ I GH + +E L+DG  + LL
Sbjct  556  LIDVDLKVQASYQKEPVPIVSLMSKLNGKAIIGHPIQIEALEDGSSNSLL  605



>gb|EMS66663.1| hypothetical protein TRIUR3_34844 [Triticum urartu]
Length=863

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            L D+ ++V++ Y   H+P +SLMS+L+G+ I GH + +E+L DG  D L+
Sbjct  613  LFDIDLKVQASYHGEHVPLVSLMSRLDGKAIVGHPIQIEILVDGSTDHLV  662



>ref|NP_186964.1| PWWP domain-containing protein [Arabidopsis thaliana]
 gb|AAF26110.1|AC012328_13 hypothetical protein [Arabidopsis thaliana]
 gb|AEE73906.1| PWWP domain-containing protein [Arabidopsis thaliana]
Length=769

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            SSL DV +EV+  Y+   +P +SLMSKLNG+ I GH + VEVL DG  +  +
Sbjct  529  SSLMDVDLEVRGSYQKGPVPIVSLMSKLNGRAIIGHPVEVEVLADGSSESYI  580



>gb|EMT25308.1| hypothetical protein F775_01904 [Aegilops tauschii]
Length=838

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            L D+ ++V++ Y   H+P +SLMS+L+G+ I GH + +E+L DG  D L+
Sbjct  591  LFDIDLKVQASYHGEHVPLVSLMSRLDGKAIVGHPIQIEILVDGSTDHLV  640



>ref|XP_010671152.1| PREDICTED: uncharacterized protein LOC104888033 [Beta vulgaris 
subsp. vulgaris]
Length=807

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +3

Query  459  LTDVKVEVKSCYRT-RHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNC  626
            L DV ++V++  +   H+P++SLMS+LNG+ I GH + +E L+DG  D L+ ++  C
Sbjct  571  LIDVDLQVQANRQGGEHVPWVSLMSRLNGKAIIGHPIQIETLEDGLTDILVSTSDAC  627



>ref|XP_010506908.1| PREDICTED: uncharacterized protein At1g51745 [Camelina sativa]
 ref|XP_010506986.1| PREDICTED: uncharacterized protein At1g51745 [Camelina sativa]
Length=765

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            SSL DV +EV+  Y+   +P +SLMSKLNG+ I GH + +EVL DG  +  +
Sbjct  526  SSLMDVDLEVRGSYQKGPVPIVSLMSKLNGRAIIGHPVEIEVLADGSSESYI  577



>ref|XP_007131537.1| hypothetical protein PHAVU_011G021400g [Phaseolus vulgaris]
 gb|ESW03531.1| hypothetical protein PHAVU_011G021400g [Phaseolus vulgaris]
Length=734

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            L +V ++V++ YR   +P+ISLMSKL+G+ I GH + VE L DG  D L 
Sbjct  499  LVNVDLKVQASYRKECVPFISLMSKLDGRAIVGHPIQVEALKDGSSDILF  548



>ref|XP_006652748.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Oryza brachyantha]
 ref|XP_006652749.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Oryza brachyantha]
Length=802

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVS  614
            L +V + V++ Y+   +P +SLMS+LNG+ I GH + +E+L+DG  D L+++
Sbjct  578  LFNVDLNVQAGYQGERVPLVSLMSRLNGKAIVGHPIQIEILEDGSTDHLVLA  629



>ref|XP_010463763.1| PREDICTED: uncharacterized protein At1g51745-like [Camelina sativa]
Length=756

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  420  DFSLRHH-VIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDG  590
            D S RH      SSL DV +EV+  Y+   +P +SLMSKLNG+ I GH + +EVL DG
Sbjct  505  DVSQRHFGRKTRSSLMDVDLEVRGSYQKGPVPIVSLMSKLNGRAIIGHPVEIEVLADG  562



>emb|CDY49929.1| BnaCnng18390D [Brassica napus]
Length=713

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCD--QLLVSASNCHD  632
            L DV +EV+  YR   +P++SLMSKLNG+ I GH + V+VL DG  +  +   + ++ HD
Sbjct  490  LMDVDLEVQGSYRKGPVPFVSLMSKLNGRAIIGHPVEVQVLADGSSESYEYFGNETSYHD  549



>ref|XP_010485649.1| PREDICTED: uncharacterized protein At1g51745-like [Camelina sativa]
 ref|XP_010485650.1| PREDICTED: uncharacterized protein At1g51745-like [Camelina sativa]
Length=765

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDG  590
            SSL DV +EV+  Y+   +P +SLMSKLNG+ I GH + +EVL DG
Sbjct  526  SSLMDVDLEVRGSYQKGPVPIVSLMSKLNGRAIIGHPVQIEVLADG  571



>gb|KDP21792.1| hypothetical protein JCGZ_00579 [Jatropha curcas]
Length=781

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 68/137 (50%), Gaps = 26/137 (19%)
 Frame = +3

Query  216  GPRMGKE--TSKWQSKGKRNFRTG-NFIDWSRNSPHKESQMKGPT-ADLPIPRRSLPYRL  383
            GP  G+   TS+  SKGK   R+G N IDW           +G T  D P  R      +
Sbjct  476  GPDNGRYSYTSRLASKGK--IRSGHNNIDW-----------RGMTWEDRPAFRGHWEDGM  522

Query  384  SRFVVNPKYESPDFSLRHHV--IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITG  557
             RF       +P    R+H    A S L DV ++V++ Y+   +P +SL SKL+G+ I G
Sbjct  523  ERF-------NPIIFGRYHSGGRARSMLIDVDLKVQASYQKEPVPLVSLRSKLDGKAIIG  575

Query  558  HRLAVEVLDDGFCDQLL  608
            H + +E L+DG  + L+
Sbjct  576  HPIQIEALEDGSSENLI  592



>gb|AFW63510.1| hypothetical protein ZEAMMB73_379388 [Zea mays]
Length=686

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 36/50 (72%), Gaps = 4/50 (8%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDG----FC  596
            L +V ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+++DG    FC
Sbjct  460  LFNVNLKVQASYQGEHVPLVSLMSRLNGKAIVGHPIQIEIVEDGSTAVFC  509



>ref|XP_006352937.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum tuberosum]
Length=467

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  456  SLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDD  587
            +L DV + V+S YR  H P +SLMS+LNG+ I GH + +EVL D
Sbjct  302  TLIDVHMTVQSTYRGEHTPLVSLMSRLNGKTIVGHPINIEVLYD  345



>ref|XP_008678998.1| PREDICTED: uncharacterized protein At1g51745-like [Zea mays]
Length=817

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 36/50 (72%), Gaps = 4/50 (8%)
 Frame = +3

Query  459  LTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDG----FC  596
            L +V ++V++ Y+  H+P +SLMS+LNG+ I GH + +E+++DG    FC
Sbjct  591  LFNVNLKVQASYQGEHVPLVSLMSRLNGKAIVGHPIQIEIVEDGSTAVFC  640



>ref|XP_002319249.2| hypothetical protein POPTR_0013s08000g [Populus trichocarpa]
 gb|EEE95172.2| hypothetical protein POPTR_0013s08000g [Populus trichocarpa]
Length=775

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 9/96 (9%)
 Frame = +3

Query  405  KYESPDFSLRHHV--IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEV  578
            ++ +P F+  HH    A S L DV ++VKS Y+   +P +SL+SK +G+ I GH + +E 
Sbjct  519  EHSNPIFAGHHHFGGRARSMLIDVDLKVKSSYQKDRVPIVSLISKFDGKAIIGHPILIEA  578

Query  579  LDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKL  686
            ++DG       S+     L+D  + + VD    T L
Sbjct  579  VEDG-------SSETYFPLNDYYSNEAVDHDESTSL  607



>dbj|BAF01144.1| hypothetical protein [Arabidopsis thaliana]
Length=769

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  453  SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDGFCDQLL  608
            SSL DV +EV+  Y+   +P +SLMS+LNG+ I GH + VEVL DG  +  +
Sbjct  529  SSLMDVDLEVRGSYQKGPVPIVSLMSRLNGRAIIGHPVEVEVLADGSSESYI  580



>ref|XP_004245942.1| PREDICTED: uncharacterized protein LOC101257099 [Solanum lycopersicum]
Length=463

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  456  SLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDD  587
            +L DV + V+S YR  H P +SLMS+LNG+ I GH + +EVL D
Sbjct  302  TLIDVHMTVQSTYRGEHTPLVSLMSRLNGKAIIGHPINIEVLYD  345



>ref|XP_011010169.1| PREDICTED: uncharacterized protein At1g51745-like [Populus euphratica]
 ref|XP_011010170.1| PREDICTED: uncharacterized protein At1g51745-like [Populus euphratica]
Length=775

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 9/96 (9%)
 Frame = +3

Query  405  KYESPDFSLRHHV--IADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEV  578
            ++ +P F+  HH    A S L DV ++VKS Y+   +P +SL+SK +G+ I GH + +E 
Sbjct  519  EHSNPIFAGHHHFGGRARSMLIDVDLKVKSSYQKDRVPIVSLISKFDGKAIIGHPILIEA  578

Query  579  LDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKL  686
            ++DG       S+     L+D  + + VD    T L
Sbjct  579  VEDG-------SSETYFPLNDYYSNEAVDHDESTSL  607



>emb|CDP11755.1| unnamed protein product [Coffea canephora]
Length=508

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  435  HHVIADSSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDD  587
             H + ++ L DV + V++ YR  H+P +SLMSK N + I G+ + VEVL+D
Sbjct  336  QHNMMETMLIDVNITVQASYRKEHVPLVSLMSKSNKKAIIGYPIEVEVLED  386



>gb|KHG23776.1| hypothetical protein F383_28480 [Gossypium arboreum]
Length=776

 Score = 52.0 bits (123),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 2/66 (3%)
 Frame = +3

Query  417  PDFSLRHHVIAD--SSLTDVKVEVKSCYRTRHIPYISLMSKLNGQPITGHRLAVEVLDDG  590
            P+FS+  +      S L DV + V++ Y+   +P +SLMSKL+G+ I GH + +E LDD 
Sbjct  526  PEFSIHRNFGGKRRSILIDVDLNVQASYQKEPVPIVSLMSKLDGKAIIGHPIQIEALDDN  585

Query  591  FCDQLL  608
              + LL
Sbjct  586  SIETLL  591



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3368954703288