BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19997_g1_i2 len=1508 path=[3195:0-869 809:870-898 838:899-1022
962:1023-1507]

Length=1508
                                                                      Score     E

ref|XP_011070832.1|  PREDICTED: uncharacterized protein LOC105156412    350   3e-112   
ref|XP_011077211.1|  PREDICTED: uncharacterized protein LOC105161268    327   2e-103   
ref|XP_007046296.1|  Myb-like transcription factor family protein...    315   8e-99    
ref|XP_003631224.1|  PREDICTED: probable transcription factor GLK2      311   2e-97    
ref|XP_011021741.1|  PREDICTED: probable transcription factor GLK2      309   1e-96    
emb|CBI27058.3|  unnamed protein product                                307   4e-96    
emb|CDP00582.1|  unnamed protein product                                308   4e-96    
ref|XP_004238956.1|  PREDICTED: uncharacterized protein LOC101263023    308   4e-96    
ref|XP_006362570.1|  PREDICTED: uncharacterized protein LOC102595401    306   1e-95    
ref|XP_002311443.2|  hypothetical protein POPTR_0008s11630g             306   1e-95    Populus trichocarpa [western balsam poplar]
ref|XP_009619370.1|  PREDICTED: two-component response regulator-...    305   9e-95    
ref|XP_009788853.1|  PREDICTED: transcription factor LUX-like           304   2e-94    
ref|XP_011008471.1|  PREDICTED: transcription factor LUX-like iso...    300   7e-93    
ref|XP_002315957.1|  hypothetical protein POPTR_0010s13900g             299   2e-92    Populus trichocarpa [western balsam poplar]
ref|XP_002529155.1|  DNA binding protein, putative                      297   7e-92    Ricinus communis
ref|XP_011008478.1|  PREDICTED: transcription factor LUX-like iso...    294   8e-91    
ref|XP_010695844.1|  PREDICTED: transcription factor LUX                288   2e-88    
gb|KDP29370.1|  hypothetical protein JCGZ_18291                         289   2e-88    
ref|XP_006484416.1|  PREDICTED: uncharacterized protein LOC102624045    285   3e-87    
ref|XP_006437730.1|  hypothetical protein CICLE_v10031793mg             285   3e-87    
ref|XP_007046297.1|  Myb-like transcription factor family protein...    278   7e-86    
ref|XP_007046298.1|  Myb-like transcription factor family protein...    277   1e-85    
ref|XP_009356299.1|  PREDICTED: uncharacterized protein LOC103947165    280   2e-85    
ref|XP_009336613.1|  PREDICTED: uncharacterized protein LOC103929184    280   3e-85    
gb|EYU29947.1|  hypothetical protein MIMGU_mgv1a008281mg                278   2e-84    
ref|NP_564236.1|  nitrate-inducible, GARP-type transcriptional re...    275   4e-84    Arabidopsis thaliana [mouse-ear cress]
gb|AAG50807.1|AC079281_9  hypothetical protein                          275   4e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008243179.1|  PREDICTED: probable transcription factor GLK2      276   9e-84    
ref|XP_007223224.1|  hypothetical protein PRUPE_ppa007222mg             273   7e-83    
ref|XP_010527541.1|  PREDICTED: uncharacterized protein LOC104804876    271   8e-83    
ref|XP_008339698.1|  PREDICTED: uncharacterized protein LOC103402722    273   8e-83    
ref|XP_010265235.1|  PREDICTED: uncharacterized protein LOC104603025    271   2e-82    
gb|AAM63125.1|  unknown                                                 268   1e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460352.1|  PREDICTED: probable transcription factor GLK2      269   2e-81    
gb|AES62046.2|  myb-like transcription factor family protein            269   4e-81    
ref|XP_007143802.1|  hypothetical protein PHAVU_007G102900g             268   5e-81    
ref|XP_010101716.1|  Two-component response regulator                   268   6e-81    
ref|XP_010532126.1|  PREDICTED: uncharacterized protein LOC104808201    268   6e-81    
ref|XP_010109406.1|  Two-component response regulator                   268   9e-81    
ref|XP_010499096.1|  PREDICTED: probable transcription factor GLK2      267   1e-80    
ref|XP_010551302.1|  PREDICTED: probable transcription factor GLK2      266   1e-80    
ref|XP_010066739.1|  PREDICTED: uncharacterized protein LOC104453813    265   2e-79    
ref|XP_006391112.1|  hypothetical protein EUTSA_v10018737mg             263   3e-79    
ref|XP_006305123.1|  hypothetical protein CARUB_v10009492mg             261   2e-78    
ref|XP_010477909.1|  PREDICTED: probable transcription factor GLK1      261   2e-78    
emb|CBY88799.1|  myb transcription factor                               261   3e-78    
ref|XP_003556266.1|  PREDICTED: uncharacterized protein LOC100789537    259   3e-77    
gb|KHN00905.1|  Two-component response regulator ARR18                  259   3e-77    
ref|XP_008445641.1|  PREDICTED: probable transcription factor GLK2      258   4e-77    
gb|KGN45944.1|  hypothetical protein Csa_6G031440                       257   8e-77    
ref|XP_004164475.1|  PREDICTED: uncharacterized LOC101210056            257   1e-76    
ref|XP_004150535.1|  PREDICTED: uncharacterized protein LOC101210056    256   2e-76    
ref|XP_007153350.1|  hypothetical protein PHAVU_003G028000g             256   2e-76    
ref|XP_004297138.1|  PREDICTED: uncharacterized protein LOC101305064    256   6e-76    
ref|XP_002893418.1|  predicted protein                                  253   2e-75    
ref|XP_010263063.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2     252   7e-75    
gb|KHN37827.1|  Two-component response regulator ARR18                  252   1e-74    
ref|XP_006415885.1|  hypothetical protein EUTSA_v10008115mg             250   2e-74    
ref|XP_010263055.1|  PREDICTED: uncharacterized protein LOC104601...    249   6e-74    
gb|KFK41291.1|  hypothetical protein AALP_AA2G110900                    248   1e-73    
ref|XP_003536313.1|  PREDICTED: probable transcription factor GLK...    249   1e-73    
ref|XP_003516846.1|  PREDICTED: probable transcription factor GLK...    249   1e-73    
ref|NP_564938.1|  nitrate-inducible, GARP-type transcriptional re...    247   3e-73    Arabidopsis thaliana [mouse-ear cress]
gb|AAD49976.1|AC008075_9  F24J5.9                                       247   3e-73    Arabidopsis thaliana [mouse-ear cress]
gb|KHN12830.1|  Two-component response regulator ARR18                  246   2e-72    
ref|XP_003518679.1|  PREDICTED: transcription factor LUX-like           246   2e-72    
ref|XP_010916475.1|  PREDICTED: uncharacterized protein LOC105041278    244   4e-72    
gb|ACU19314.1|  unknown                                                 244   7e-72    Glycine max [soybeans]
ref|XP_010926495.1|  PREDICTED: transcription factor LUX isoform X1     243   1e-71    
gb|AAM65539.1|  unknown                                                 242   3e-71    Arabidopsis thaliana [mouse-ear cress]
dbj|BAI63587.1|  MYB-type transcription factor                          240   1e-70    Lotus japonicus
gb|KEH43448.1|  myb-like transcription factor family protein            237   4e-70    
ref|XP_006302460.1|  hypothetical protein CARUB_v10020552mg             239   4e-70    
ref|XP_010415495.1|  PREDICTED: two-component response regulator-...    237   3e-69    
ref|XP_010470826.1|  PREDICTED: two-component response regulator-...    237   3e-69    
ref|XP_010528047.1|  PREDICTED: probable transcription factor GLK2      236   5e-69    
ref|XP_002887197.1|  hypothetical protein ARALYDRAFT_475994             236   1e-68    
ref|XP_008782297.1|  PREDICTED: probable transcription factor GLK2      235   1e-68    
ref|XP_009152112.1|  PREDICTED: two-component response regulator ...    236   1e-68    
emb|CDY54503.1|  BnaA02g35660D                                          234   5e-68    
ref|XP_009127661.1|  PREDICTED: uncharacterized protein LOC103852516    234   6e-68    
emb|CDY13584.1|  BnaA06g33390D                                          233   1e-67    
ref|XP_003614475.1|  Two-component response regulator ARR14             232   1e-67    
gb|AES97433.2|  myb-like transcription factor family protein            233   2e-67    
emb|CDX83554.1|  BnaC07g22940D                                          231   7e-67    
gb|KFK44548.1|  hypothetical protein AALP_AA1G271100                    229   9e-67    
ref|XP_009110590.1|  PREDICTED: transcription activator GLK2-like       230   1e-66    
ref|XP_004135112.1|  PREDICTED: uncharacterized protein LOC101203539    228   5e-66    
ref|XP_006395625.1|  hypothetical protein EUTSA_v10004475mg             228   6e-66    
ref|XP_010502461.1|  PREDICTED: uncharacterized protein LOC104779...    228   7e-66    
ref|XP_010514200.1|  PREDICTED: uncharacterized protein LOC104790195    228   8e-66    
ref|XP_008799311.1|  PREDICTED: probable transcription factor GLK...    227   1e-65    
ref|XP_009383634.1|  PREDICTED: uncharacterized protein LOC103971360    227   2e-65    
emb|CDY50179.1|  BnaC08g15800D                                          226   3e-65    
gb|EYU40864.1|  hypothetical protein MIMGU_mgv1a022733mg                224   3e-65    
ref|XP_010425231.1|  PREDICTED: uncharacterized protein LOC104710349    226   5e-65    
emb|CDX81535.1|  BnaC02g18390D                                          225   9e-65    
emb|CDX95998.1|  BnaA07g27330D                                          225   9e-65    
ref|XP_010502460.1|  PREDICTED: uncharacterized protein LOC104779...    225   1e-64    
ref|XP_009393569.1|  PREDICTED: transcription factor LUX-like           225   1e-64    
ref|XP_008446559.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    224   3e-64    
ref|XP_004954868.1|  PREDICTED: uncharacterized protein LOC101769398    228   3e-64    
ref|XP_002875280.1|  myb family transcription factor                    223   6e-64    
ref|XP_009105417.1|  PREDICTED: uncharacterized protein LOC103831280    223   7e-64    
ref|XP_006292736.1|  hypothetical protein CARUB_v10018983mg             221   2e-63    
gb|KFK35065.1|  hypothetical protein AALP_AA5G230700                    220   1e-62    
ref|XP_009114112.1|  PREDICTED: uncharacterized protein LOC103839...    219   2e-62    
ref|XP_003572723.1|  PREDICTED: uncharacterized protein LOC100841245    219   4e-62    
emb|CDY04180.1|  BnaA09g19580D                                          217   7e-62    
gb|EMT22828.1|  Two-component response regulator ARR2                   218   2e-61    
ref|XP_010495195.1|  PREDICTED: transcription activator GLK1-like...    216   2e-61    
emb|CDY38609.1|  BnaC06g30320D                                          216   4e-61    
ref|XP_010495201.1|  PREDICTED: transcription activator GLK1-like...    215   4e-61    
ref|NP_001046702.1|  Os02g0325600                                       216   7e-61    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ92842.1|  predicted protein                                      215   2e-60    
emb|CDY39188.1|  BnaC09g21560D                                          213   3e-60    
emb|CDY51129.1|  BnaA07g37120D                                          211   5e-60    
ref|XP_010476326.1|  PREDICTED: transcription activator GLK1-like       211   2e-59    
ref|XP_009413646.1|  PREDICTED: transcription factor LUX-like           211   2e-59    
ref|XP_009403982.1|  PREDICTED: probable transcription factor GLK2      210   3e-59    
ref|NP_563926.1|  protein HRS1                                          210   3e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458781.1|  PREDICTED: transcription activator GLK1-like       209   6e-59    
gb|EAZ27297.1|  hypothetical protein OsJ_11233                          210   1e-58    Oryza sativa Japonica Group [Japonica rice]
gb|AAM62792.1|  unknown                                                 208   2e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556381.1|  PREDICTED: two-component response regulator ...    208   2e-58    
ref|XP_009103752.1|  PREDICTED: uncharacterized protein LOC103829805    207   5e-58    
ref|NP_566778.1|  myb-like transcription factor family protein          207   6e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006833539.1|  hypothetical protein AMTR_s00093p00110710          206   8e-58    
ref|XP_006417135.1|  hypothetical protein EUTSA_v10008054mg             206   1e-57    
ref|XP_010926496.1|  PREDICTED: uncharacterized protein LOC105048...    201   2e-57    
ref|XP_010044289.1|  PREDICTED: uncharacterized protein LOC104433298    205   6e-57    
emb|CDY16075.1|  BnaC08g40480D                                          203   2e-56    
gb|KDO70083.1|  hypothetical protein CISIN_1g016585mg                   202   3e-56    
ref|XP_010554240.1|  PREDICTED: two-component response regulator-...    199   5e-56    
ref|XP_008799313.1|  PREDICTED: uncharacterized protein LOC103713...    198   6e-56    
ref|XP_006303753.1|  hypothetical protein CARUB_v10011925mg             201   1e-55    
ref|XP_008799314.1|  PREDICTED: uncharacterized protein LOC103713...    196   2e-55    
ref|XP_006417134.1|  hypothetical protein EUTSA_v10008054mg             200   3e-55    
emb|CDY20522.1|  BnaC07g11890D                                          198   6e-55    
ref|XP_008799312.1|  PREDICTED: uncharacterized protein LOC103713...    196   7e-55    
ref|XP_004171557.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    197   1e-54    
emb|CDY19382.1|  BnaC05g08910D                                          197   2e-54    
ref|NP_001136626.1|  uncharacterized protein LOC100216751               198   1e-53    Zea mays [maize]
gb|AFW56037.1|  putative MYB DNA-binding domain superfamily protein     198   1e-53    
ref|XP_002889999.1|  myb family transcription factor                    195   2e-53    
emb|CDX97993.1|  BnaA06g07440D                                          195   2e-53    
gb|KEH43449.1|  myb-like transcription factor family protein            190   1e-52    
ref|XP_009148528.1|  PREDICTED: uncharacterized protein LOC103871943    192   1e-52    
ref|XP_010533191.1|  PREDICTED: probable transcription factor GLK2      193   9e-52    
gb|EMS62450.1|  Two-component response regulator ARR1                   191   1e-51    
ref|XP_009129087.1|  PREDICTED: rho GTPase-activating protein gac...    190   6e-51    
ref|NP_001131917.2|  putative MYB DNA-binding domain superfamily ...    190   1e-50    Zea mays [maize]
ref|XP_011086148.1|  PREDICTED: probable transcription factor GLK2      189   2e-50    
ref|XP_006291183.1|  hypothetical protein CARUB_v10017308mg             188   3e-50    
ref|XP_006395699.1|  hypothetical protein EUTSA_v10004257mg             188   3e-50    
ref|XP_009152171.1|  PREDICTED: transcription repressor KAN1            188   4e-50    
emb|CDY02988.1|  BnaC07g22390D                                          187   1e-49    
emb|CDY51214.1|  BnaA06g39930D                                          186   2e-49    
ref|NP_027544.1|  homeodomain-like superfamily protein                  185   4e-49    Arabidopsis thaliana [mouse-ear cress]
gb|KFK33518.1|  hypothetical protein AALP_AA5G023500                    185   5e-49    
ref|XP_008792133.1|  PREDICTED: probable transcription factor GLK2      185   8e-49    
emb|CBI28136.3|  unnamed protein product                                184   9e-49    
gb|KFK35079.1|  myb family transcription factor                         182   2e-48    
ref|XP_002875207.1|  myb family transcription factor                    181   2e-47    
ref|XP_003609208.1|  Two-component response regulator ARR14             180   5e-47    
ref|XP_009371414.1|  PREDICTED: uncharacterized protein LOC103960659    180   6e-47    
gb|EYU33937.1|  hypothetical protein MIMGU_mgv1a005248mg                180   8e-47    
gb|KFK33519.1|  hypothetical protein AALP_AA5G023500                    178   1e-46    
ref|XP_006852953.1|  hypothetical protein AMTR_s00033p00241280          177   2e-46    
ref|XP_010425142.1|  PREDICTED: putative mediator of RNA polymera...    177   3e-46    
ref|XP_008463337.1|  PREDICTED: transcription activator GLK1-like       177   4e-46    
ref|XP_010502362.1|  PREDICTED: myb-like protein J isoform X1           177   5e-46    
ref|XP_010914965.1|  PREDICTED: probable transcription factor GLK2      177   5e-46    
gb|KHN39723.1|  Two-component response regulator ARR18                  177   6e-46    
ref|XP_009381734.1|  PREDICTED: uncharacterized protein LOC103969817    174   7e-46    
ref|XP_002965982.1|  hypothetical protein SELMODRAFT_66160              170   3e-45    
ref|XP_003524007.1|  PREDICTED: transcription factor LUX-like           174   7e-45    
ref|XP_003528276.1|  PREDICTED: uncharacterized protein LOC100809196    174   9e-45    
gb|KGN65397.1|  hypothetical protein Csa_1G408200                       171   8e-44    
ref|XP_009403477.1|  PREDICTED: uncharacterized protein LOC103987021    171   1e-43    
ref|XP_003591795.1|  Two-component response regulator ARR2              166   4e-43    
ref|XP_009774094.1|  PREDICTED: two-component response regulator-...    165   4e-42    
ref|XP_010107986.1|  Two-component response regulator                   164   6e-42    
gb|EMT03587.1|  Two-component response regulator ARR18                  165   7e-42    
ref|XP_010941843.1|  PREDICTED: uncharacterized protein LOC105059...    163   1e-41    
emb|CDM82058.1|  unnamed protein product                                165   2e-41    
gb|ABK95245.1|  unknown                                                 163   3e-41    Populus trichocarpa [western balsam poplar]
ref|XP_002457252.1|  hypothetical protein SORBIDRAFT_03g004090          165   3e-41    Sorghum bicolor [broomcorn]
gb|EPS59369.1|  hypothetical protein M569_15439                         159   3e-41    
ref|XP_009625720.1|  PREDICTED: two-component response regulator-...    162   4e-41    
ref|XP_011096177.1|  PREDICTED: uncharacterized protein LOC105175439    162   5e-41    
ref|XP_010999925.1|  PREDICTED: uncharacterized protein LOC105107622    162   7e-41    
gb|KHG11040.1|  putative transcription factor GLK1                      161   1e-40    
ref|XP_004290315.1|  PREDICTED: uncharacterized protein LOC101303079    161   2e-40    
ref|XP_006338223.1|  PREDICTED: uncharacterized protein LOC102591830    159   3e-40    
ref|XP_011092742.1|  PREDICTED: uncharacterized protein LOC105172852    160   3e-40    
ref|XP_002441840.1|  hypothetical protein SORBIDRAFT_08g003180          160   1e-39    Sorghum bicolor [broomcorn]
ref|XP_009345969.1|  PREDICTED: uncharacterized protein LOC103937746    158   2e-39    
ref|XP_002313089.1|  hypothetical protein POPTR_0009s10980g             158   2e-39    Populus trichocarpa [western balsam poplar]
ref|XP_009394712.1|  PREDICTED: uncharacterized protein LOC103980...    155   2e-39    
ref|XP_004288067.1|  PREDICTED: uncharacterized protein LOC101304222    155   7e-39    
ref|XP_004233639.1|  PREDICTED: putative two-component response r...    155   7e-39    
ref|XP_009416802.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2     154   1e-38    
ref|XP_009394713.1|  PREDICTED: probable transcription factor GLK...    152   2e-38    
ref|XP_008339250.1|  PREDICTED: uncharacterized protein LOC103402287    154   2e-38    
ref|XP_011001194.1|  PREDICTED: two-component response regulator-...    154   5e-38    
ref|XP_001756771.1|  predicted protein                                  155   7e-38    
ref|XP_009408601.1|  PREDICTED: uncharacterized protein LOC103990992    152   1e-37    
ref|XP_011039217.1|  PREDICTED: probable transcription factor KAN3      151   1e-37    
gb|EYU42654.1|  hypothetical protein MIMGU_mgv1a008635mg                151   2e-37    
gb|KHG07947.1|  Two-component response regulator ARR18 -like protein    152   3e-37    
ref|XP_002960068.1|  hypothetical protein SELMODRAFT_402040             151   5e-37    
ref|XP_002984071.1|  hypothetical protein SELMODRAFT_423260             150   6e-37    
ref|XP_006829666.1|  hypothetical protein AMTR_s00122p00127250          149   1e-36    
ref|XP_010263747.1|  PREDICTED: uncharacterized protein LOC104601936    149   3e-36    
ref|XP_011099213.1|  PREDICTED: uncharacterized protein LOC105177...    148   3e-36    
emb|CDY71874.1|  BnaAnng39110D                                          147   4e-36    
ref|XP_009622698.1|  PREDICTED: uncharacterized protein LOC104114057    147   9e-36    
ref|XP_001773715.1|  predicted protein                                  149   1e-35    
ref|XP_002310743.1|  hypothetical protein POPTR_0007s11470g             145   2e-35    Populus trichocarpa [western balsam poplar]
ref|XP_009416801.1|  PREDICTED: uncharacterized protein LOC103997...    145   3e-35    
gb|EYU42653.1|  hypothetical protein MIMGU_mgv1a008635mg                145   3e-35    
emb|CDY70722.1|  BnaAnng34750D                                          143   4e-35    
gb|ABF70013.1|  myb DNA-binding domain-containing protein               144   1e-34    Musa acuminata [banana]
ref|XP_008792589.1|  PREDICTED: uncharacterized protein LOC103709147    144   1e-34    
gb|KFK36001.1|  hypothetical protein AALP_AA4G064900                    142   1e-34    
emb|CAN83122.1|  hypothetical protein VITISV_044371                     143   2e-34    Vitis vinifera
ref|XP_002264629.2|  PREDICTED: uncharacterized protein LOC100243...    143   2e-34    Vitis vinifera
emb|CBI23283.3|  unnamed protein product                                142   3e-34    
ref|XP_010518594.1|  PREDICTED: transcription factor LUX-like           142   4e-34    
ref|XP_006601003.1|  PREDICTED: two-component response regulator-...    141   5e-34    
ref|XP_003528384.1|  PREDICTED: probable transcription factor KAN...    140   1e-33    
ref|XP_009388926.1|  PREDICTED: two-component response regulator-...    139   2e-33    
ref|XP_010652653.1|  PREDICTED: uncharacterized protein LOC100243...    138   8e-33    
ref|XP_009381136.1|  PREDICTED: probable transcription factor GLK2      137   3e-32    
ref|XP_009397289.1|  PREDICTED: uncharacterized protein LOC103982...    135   6e-32    
emb|CDP02468.1|  unnamed protein product                                135   7e-32    
ref|XP_007155959.1|  hypothetical protein PHAVU_003G246900g             134   2e-31    
ref|XP_011099214.1|  PREDICTED: uncharacterized protein LOC105177...    133   2e-31    
ref|XP_007153166.1|  hypothetical protein PHAVU_003G012400g             132   3e-31    
ref|XP_010526733.1|  PREDICTED: uncharacterized protein LOC104804217    131   2e-30    
ref|XP_010249933.1|  PREDICTED: transcription factor LUX-like           132   2e-30    
ref|XP_007156835.1|  hypothetical protein PHAVU_002G021400g             131   3e-30    
ref|XP_010540320.1|  PREDICTED: probable transcription factor KAN...    130   4e-30    
gb|KCW86362.1|  hypothetical protein EUGRSUZ_B03044                     127   6e-30    
ref|XP_003555716.1|  PREDICTED: uncharacterized protein LOC100809...    129   7e-30    
ref|XP_009397728.1|  PREDICTED: probable transcription factor KAN3      129   9e-30    
ref|XP_009766395.1|  PREDICTED: uncharacterized protein LOC104217775    129   1e-29    
ref|XP_010254263.1|  PREDICTED: probable transcription factor GLK2      130   1e-29    
ref|XP_010049950.1|  PREDICTED: transcription factor LUX isoform X2     130   1e-29    
ref|XP_006480140.1|  PREDICTED: uncharacterized protein LOC102611292    129   1e-29    
ref|XP_010688115.1|  PREDICTED: transcription factor LUX                130   1e-29    
gb|KHG18308.1|  Two-component response regulator ARR1 -like protein     129   1e-29    
gb|KDO49151.1|  hypothetical protein CISIN_1g015403mg                   129   1e-29    
ref|XP_006423074.1|  hypothetical protein CICLE_v10028556mg             129   1e-29    
ref|XP_009630682.1|  PREDICTED: transcription factor LUX                129   1e-29    
ref|XP_008337342.1|  PREDICTED: uncharacterized protein LOC103400468    130   2e-29    
gb|EAY72754.1|  hypothetical protein OsI_00620                          129   2e-29    Oryza sativa Indica Group [Indian rice]
ref|NP_001042183.2|  Os01g0176700                                       129   2e-29    Oryza sativa Japonica Group [Japonica rice]
gb|KDP32338.1|  hypothetical protein JCGZ_13263                         129   2e-29    
ref|XP_002529346.1|  conserved hypothetical protein                     129   2e-29    Ricinus communis
ref|XP_006350899.1|  PREDICTED: transcription factor LUX-like           129   2e-29    
ref|XP_010656386.1|  PREDICTED: uncharacterized protein LOC100250892    129   2e-29    
ref|XP_007138330.1|  hypothetical protein PHAVU_009G199700g             129   3e-29    
ref|XP_004139423.1|  PREDICTED: uncharacterized protein LOC101209032    129   4e-29    
gb|ABK95609.1|  unknown                                                 124   4e-29    Populus trichocarpa [western balsam poplar]
ref|XP_004508555.1|  PREDICTED: uncharacterized protein LOC101500047    128   4e-29    
gb|KHN27391.1|  Two-component response regulator ARR18                  128   4e-29    
ref|XP_007047162.1|  Homeodomain-like superfamily protein, putative     127   4e-29    
gb|KGN60646.1|  hypothetical protein Csa_2G005920                       129   5e-29    
ref|XP_002308314.1|  myb family transcription factor family protein     128   5e-29    Populus trichocarpa [western balsam poplar]
ref|XP_007042352.1|  Homeodomain-like superfamily protein, putati...    126   5e-29    
ref|XP_008457979.1|  PREDICTED: GATA zinc finger domain-containin...    129   5e-29    
ref|XP_004251582.1|  PREDICTED: transcription factor LUX                128   6e-29    
gb|EAZ10752.1|  hypothetical protein OsJ_00589                          128   6e-29    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007154940.1|  hypothetical protein PHAVU_003G159800g             128   6e-29    
ref|XP_011013227.1|  PREDICTED: uncharacterized protein LOC105117313    128   7e-29    
ref|XP_009374059.1|  PREDICTED: uncharacterized protein LOC103962996    128   7e-29    
ref|XP_010315241.1|  PREDICTED: uncharacterized protein LOC101243...    127   7e-29    
ref|XP_004230796.1|  PREDICTED: uncharacterized protein LOC101243...    127   8e-29    
ref|XP_006605467.1|  PREDICTED: uncharacterized protein LOC100809...    126   8e-29    
ref|XP_007202897.1|  hypothetical protein PRUPE_ppa016044mg             128   8e-29    
ref|XP_010941844.1|  PREDICTED: uncharacterized protein LOC105059...    126   8e-29    
ref|XP_008343961.1|  PREDICTED: myb-like protein J                      128   8e-29    
ref|XP_004288823.1|  PREDICTED: uncharacterized protein LOC101303940    127   9e-29    
ref|XP_006475768.1|  PREDICTED: ras guanine nucleotide exchange f...    128   1e-28    
ref|XP_003525655.1|  PREDICTED: uncharacterized protein LOC100807925    127   1e-28    
ref|XP_006451029.1|  hypothetical protein CICLE_v10008096mg             127   1e-28    
ref|XP_003550834.1|  PREDICTED: uncharacterized protein LOC100797015    127   1e-28    
ref|XP_010098958.1|  Two-component response regulator                   127   1e-28    
ref|XP_009398291.1|  PREDICTED: uncharacterized protein LOC103982...    125   1e-28    
ref|XP_006346440.1|  PREDICTED: uncharacterized protein LOC102600464    126   1e-28    
ref|XP_007042351.1|  Homeodomain-like superfamily protein, putati...    126   2e-28    
gb|KDP31885.1|  hypothetical protein JCGZ_12346                         125   2e-28    
gb|KCW63828.1|  hypothetical protein EUGRSUZ_G01503                     125   2e-28    
gb|AEV91191.1|  MYB-related protein                                     124   3e-28    
ref|XP_010066057.1|  PREDICTED: uncharacterized protein LOC104453232    125   3e-28    
ref|XP_007013309.1|  Homeodomain-like superfamily protein               126   3e-28    
tpg|DAA47290.1|  TPA: putative MYB DNA-binding domain superfamily...    120   4e-28    
ref|XP_011088301.1|  PREDICTED: uncharacterized protein LOC105169576    124   4e-28    
ref|XP_009397290.1|  PREDICTED: uncharacterized protein LOC103982...    124   4e-28    
ref|XP_010049949.1|  PREDICTED: transcription factor LUX isoform X1     125   4e-28    
ref|XP_008242700.1|  PREDICTED: myb-like protein J                      126   4e-28    
gb|EPS61273.1|  hypothetical protein M569_13525                         116   4e-28    
ref|XP_002324957.1|  myb family transcription factor family protein     125   5e-28    
ref|XP_003579224.1|  PREDICTED: probable transcription factor GLK2      124   5e-28    
ref|XP_004171014.1|  PREDICTED: uncharacterized LOC101221044            123   6e-28    
gb|KHG04305.1|  Two-component response regulator ARR18 -like protein    125   6e-28    
tpg|DAA53196.1|  TPA: putative MYB DNA-binding domain superfamily...    125   6e-28    
ref|XP_006384452.1|  hypothetical protein POPTR_0004s15220g             124   7e-28    
gb|KDP38239.1|  hypothetical protein JCGZ_04882                         124   7e-28    
gb|KHG08712.1|  Two-component response regulator ARR14                  121   8e-28    
gb|KHG19785.1|  Two-component response regulator ARR18 -like protein    124   9e-28    
ref|XP_008236633.1|  PREDICTED: uncharacterized protein LOC103335407    124   9e-28    
ref|XP_007201075.1|  hypothetical protein PRUPE_ppa006812mg             124   9e-28    
ref|XP_008454913.1|  PREDICTED: putative two-component response r...    123   1e-27    
ref|XP_002521841.1|  conserved hypothetical protein                     124   1e-27    
emb|CAN81424.1|  hypothetical protein VITISV_035944                     124   1e-27    
ref|XP_002284970.2|  PREDICTED: uncharacterized protein LOC100267...    124   1e-27    
ref|XP_006645558.1|  PREDICTED: uncharacterized protein LOC102711030    124   1e-27    
ref|XP_004968400.1|  PREDICTED: probable transcription factor GLK...    124   1e-27    
ref|XP_003518860.1|  PREDICTED: uncharacterized protein LOC100806237    123   1e-27    
ref|XP_009407424.1|  PREDICTED: uncharacterized protein LOC103990113    123   1e-27    
ref|XP_008792690.1|  PREDICTED: uncharacterized protein LOC103709...    122   3e-27    
ref|XP_003611799.1|  Two-component response regulator ARR1              121   3e-27    
ref|XP_011009201.1|  PREDICTED: uncharacterized protein LOC105114375    123   3e-27    
ref|XP_004505182.1|  PREDICTED: probable transcription factor RL9...    121   3e-27    
gb|KEH30918.1|  myb-like transcription factor family protein            122   3e-27    
ref|XP_003608037.1|  Two-component response regulator ARR14             122   3e-27    
ref|XP_010905632.1|  PREDICTED: uncharacterized protein LOC105032770    120   4e-27    
ref|XP_007156531.1|  hypothetical protein PHAVU_003G293800g             122   4e-27    
ref|XP_008440244.1|  PREDICTED: uncharacterized protein LOC103484758    121   4e-27    
ref|XP_004137119.1|  PREDICTED: uncharacterized protein LOC101221044    122   5e-27    
ref|XP_004141926.1|  PREDICTED: uncharacterized protein LOC101218926    121   5e-27    
ref|XP_008661501.1|  PREDICTED: uncharacterized protein LOC103640508    120   6e-27    
ref|XP_003529382.1|  PREDICTED: two-component response regulator-...    121   7e-27    
gb|EMT18307.1|  Two-component response regulator ARR2                   119   7e-27    
ref|XP_010680444.1|  PREDICTED: uncharacterized protein LOC104895588    119   1e-26    
dbj|BAK06955.1|  predicted protein                                      118   1e-26    
ref|XP_006657408.1|  PREDICTED: uncharacterized protein LOC102719878    120   1e-26    
gb|EAY83694.1|  hypothetical protein OsI_38917                          120   1e-26    
ref|NP_001067156.1|  Os12g0586300                                       120   1e-26    
ref|XP_009796235.1|  PREDICTED: uncharacterized protein LOC104242830    120   1e-26    
ref|XP_003538823.1|  PREDICTED: uncharacterized protein LOC100817326    119   2e-26    
gb|ACL54460.1|  unknown                                                 114   2e-26    
ref|XP_003517284.2|  PREDICTED: uncharacterized protein LOC100785723    119   2e-26    
ref|XP_009381276.1|  PREDICTED: uncharacterized protein LOC103969469    120   2e-26    
ref|XP_008241541.1|  PREDICTED: uncharacterized protein LOC103339953    120   2e-26    
gb|ACU21121.1|  unknown                                                 114   2e-26    
ref|XP_010691017.1|  PREDICTED: uncharacterized protein LOC104904462    120   2e-26    
gb|KEH27538.1|  myb-like DNA-binding domain, shaqkyf class protein      118   2e-26    
ref|XP_007204391.1|  hypothetical protein PRUPE_ppa006879mg             119   2e-26    
ref|XP_004511970.1|  PREDICTED: uncharacterized protein LOC101504...    119   3e-26    
ref|XP_004511968.1|  PREDICTED: uncharacterized protein LOC101504...    119   3e-26    
ref|XP_010070500.1|  PREDICTED: uncharacterized protein LOC104457261    119   3e-26    
gb|EAZ21036.1|  hypothetical protein OsJ_36683                          120   3e-26    
ref|XP_009366682.1|  PREDICTED: uncharacterized protein LOC103956...    119   4e-26    
ref|XP_010647783.1|  PREDICTED: uncharacterized protein LOC100267...    119   4e-26    
emb|CDO97142.1|  unnamed protein product                                119   5e-26    
ref|XP_010109894.1|  Two-component response regulator                   119   5e-26    
ref|XP_004145354.1|  PREDICTED: uncharacterized protein LOC101214647    119   5e-26    
ref|XP_003565416.2|  PREDICTED: uncharacterized protein LOC100822...    120   5e-26    
gb|KCW59312.1|  hypothetical protein EUGRSUZ_H01993                     119   7e-26    
ref|XP_008354692.1|  PREDICTED: uncharacterized protein LOC103418...    118   7e-26    
gb|KHG02881.1|  Two-component response regulator ARR1 -like protein     117   8e-26    
ref|XP_003551053.1|  PREDICTED: two-component response regulator-...    117   9e-26    
gb|KEH27537.1|  myb-like DNA-binding domain, shaqkyf class protein      116   1e-25    
ref|XP_008459219.1|  PREDICTED: uncharacterized protein LOC103498410    118   1e-25    
gb|KEH30917.1|  myb-like transcription factor family protein            118   1e-25    
ref|XP_009366793.1|  PREDICTED: uncharacterized protein LOC103956...    117   1e-25    
ref|XP_008338274.1|  PREDICTED: uncharacterized protein LOC103401...    117   1e-25    
ref|XP_004505183.1|  PREDICTED: probable transcription factor RL9...    117   1e-25    
gb|EPS60106.1|  hypothetical protein M569_14698                         113   1e-25    
ref|XP_006664688.1|  PREDICTED: transcription factor LUX-like           115   1e-25    
gb|EAZ28684.1|  hypothetical protein OsJ_12697                          115   1e-25    
ref|XP_010540321.1|  PREDICTED: probable transcription factor KAN...    117   1e-25    
ref|NP_001058770.1|  Os07g0119300                                       116   2e-25    
gb|EAZ02589.1|  hypothetical protein OsI_24699                          116   2e-25    
ref|XP_006605468.1|  PREDICTED: uncharacterized protein LOC100809...    115   2e-25    
ref|XP_002442420.1|  hypothetical protein SORBIDRAFT_08g019720          116   2e-25    
ref|NP_001146647.1|  uncharacterized protein LOC100280246               116   2e-25    
ref|XP_002891520.1|  myb family transcription factor                    115   2e-25    
ref|XP_006383295.1|  hypothetical protein POPTR_0005s14120g             114   3e-25    
gb|AGT16366.1|  MYB-related protein                                     115   3e-25    
ref|XP_006583869.1|  PREDICTED: two-component response regulator-...    117   3e-25    
ref|XP_010540319.1|  PREDICTED: probable transcription factor KAN...    116   3e-25    
gb|EYU37714.1|  hypothetical protein MIMGU_mgv1a007808mg                116   4e-25    
gb|AEV91172.1|  MYB-related protein                                     115   4e-25    
dbj|BAJ91849.1|  predicted protein                                      115   5e-25    
ref|NP_001051369.1|  Os03g0764600                                       115   6e-25    
gb|AFH57269.1|  MYB                                                     115   6e-25    
ref|XP_009782556.1|  PREDICTED: uncharacterized protein LOC104231288    115   6e-25    
ref|NP_001149103.1|  DNA binding protein                                114   8e-25    
ref|XP_010255132.1|  PREDICTED: uncharacterized protein LOC104595882    115   9e-25    
ref|XP_006650642.1|  PREDICTED: uncharacterized protein LOC102710679    114   9e-25    
ref|XP_004511969.1|  PREDICTED: uncharacterized protein LOC101504...    114   1e-24    
ref|XP_004963026.1|  PREDICTED: probable transcription factor GLK...    115   1e-24    
gb|AIB05547.1|  G2-like transcription factor                            114   1e-24    
ref|XP_002522328.1|  DNA binding protein, putative                      114   1e-24    
gb|EMT08108.1|  Two-component response regulator ARR1                   115   2e-24    
gb|AEV91185.1|  MYB-related protein                                     112   2e-24    
ref|XP_010229377.1|  PREDICTED: uncharacterized protein LOC100829239    113   2e-24    
ref|XP_006305302.1|  hypothetical protein CARUB_v10009677mg             113   2e-24    
ref|XP_009419059.1|  PREDICTED: uncharacterized protein LOC103999124    114   2e-24    
ref|XP_009398290.1|  PREDICTED: uncharacterized protein LOC103982...    114   2e-24    
ref|XP_011009272.1|  PREDICTED: uncharacterized protein LOC105114429    113   2e-24    
ref|XP_010479391.1|  PREDICTED: uncharacterized protein LOC104758260    113   2e-24    
ref|NP_001150001.1|  myb-like DNA-binding domain, SHAQKYF class f...    113   2e-24    
ref|NP_564549.1|  myb family transcription factor                       112   3e-24    
ref|XP_010500499.1|  PREDICTED: uncharacterized protein LOC104777868    112   3e-24    
ref|XP_009397288.1|  PREDICTED: uncharacterized protein LOC103982...    113   3e-24    
gb|AEV91184.1|  MYB-related protein                                     112   3e-24    
gb|KCW55246.1|  hypothetical protein EUGRSUZ_I01178                     112   3e-24    
gb|AAM63748.1|  unknown                                                 112   3e-24    
ref|XP_009420714.1|  PREDICTED: uncharacterized protein LOC104000409    113   4e-24    
ref|XP_010461797.1|  PREDICTED: uncharacterized protein LOC104742482    112   5e-24    
dbj|BAJ90415.1|  predicted protein                                      112   5e-24    
ref|XP_010531228.1|  PREDICTED: uncharacterized protein LOC104807573    112   5e-24    
ref|XP_010228443.1|  PREDICTED: uncharacterized protein LOC100838...    112   5e-24    
ref|XP_009366690.1|  PREDICTED: uncharacterized protein LOC103956...    112   7e-24    
emb|CDP03389.1|  unnamed protein product                                114   7e-24    
ref|XP_010028507.1|  PREDICTED: uncharacterized protein LOC104418763    112   7e-24    
gb|KFK30344.1|  hypothetical protein AALP_AA7G249300                    111   8e-24    
tpg|DAA59438.1|  TPA: putative MYB DNA-binding domain superfamily...    112   9e-24    
ref|XP_002459272.1|  hypothetical protein SORBIDRAFT_02g001600          111   1e-23    
ref|XP_008354694.1|  PREDICTED: uncharacterized protein LOC103418...    111   1e-23    
ref|NP_001148713.1|  myb-like DNA-binding domain, SHAQKYF class f...    111   1e-23    
gb|EMT28996.1|  Two-component response regulator ARR2                   112   2e-23    
ref|XP_009366794.1|  PREDICTED: uncharacterized protein LOC103956...    111   2e-23    
ref|XP_008338276.1|  PREDICTED: uncharacterized protein LOC103401...    110   2e-23    
ref|XP_006393245.1|  hypothetical protein EUTSA_v10011605mg             110   3e-23    
ref|XP_009145103.1|  PREDICTED: uncharacterized protein LOC103868788    109   3e-23    
ref|XP_004955370.1|  PREDICTED: uncharacterized protein LOC101755467    110   3e-23    
ref|XP_008643519.1|  PREDICTED: uncharacterized protein LOC100280...    110   4e-23    
emb|CDY44057.1|  BnaA08g15490D                                          109   4e-23    
emb|CDY71327.1|  BnaCnng72430D                                          108   9e-23    
ref|XP_006423073.1|  hypothetical protein CICLE_v10028556mg             107   1e-22    
ref|XP_009407257.1|  PREDICTED: transcription factor LUX-like           106   2e-22    
gb|KCW63831.1|  hypothetical protein EUGRSUZ_G01503                     107   2e-22    
ref|XP_003557660.1|  PREDICTED: uncharacterized protein LOC100838...    107   2e-22    
ref|XP_002866979.1|  hypothetical protein ARALYDRAFT_490936             107   2e-22    
gb|EYU39398.1|  hypothetical protein MIMGU_mgv1a010286mg                107   3e-22    
emb|CAN83719.1|  hypothetical protein VITISV_017077                     108   4e-22    
emb|CDY51048.1|  BnaA06g03110D                                          105   6e-22    
dbj|BAH19394.1|  AT4G37180                                              106   6e-22    
ref|NP_568018.1|  myb family transcription factor                       106   6e-22    
gb|AAK63945.1|  AT4g37180/C7A10_180                                     106   7e-22    
ref|XP_010437287.1|  PREDICTED: probable transcription factor KAN2      106   7e-22    
ref|NP_849513.1|  myb family transcription factor                       106   8e-22    
ref|XP_006283840.1|  hypothetical protein CARUB_v10004940mg             107   9e-22    
emb|CDX69259.1|  BnaC01g01940D                                          105   1e-21    
ref|XP_004981657.1|  PREDICTED: probable transcription factor GLK...    105   1e-21    
emb|CAB16780.1|  putative cytoskeletal protein                          100   4e-21    
gb|AAB38775.1|  putative cytoskeletal protein                           100   4e-21    
gb|KDO79316.1|  hypothetical protein CISIN_1g048452mg                   100   5e-21    
ref|XP_010432113.1|  PREDICTED: uncharacterized protein LOC104716435    103   5e-21    
ref|XP_006425832.1|  hypothetical protein CICLE_v10026557mg             100   6e-21    
ref|XP_009403111.1|  PREDICTED: transcription factor PCL1-like          103   8e-21    
emb|CDY59732.1|  BnaC05g51600D                                          100   2e-20    
ref|XP_011085658.1|  PREDICTED: uncharacterized protein LOC105167583    101   2e-20    
emb|CDY22459.1|  BnaC03g61720D                                          102   3e-20    
ref|XP_006411945.1|  hypothetical protein EUTSA_v10025593mg             100   6e-20    
ref|XP_010230531.1|  PREDICTED: uncharacterized protein LOC100822...    101   6e-20    
ref|XP_010446723.1|  PREDICTED: uncharacterized protein LOC104729...    100   8e-20    
ref|XP_010446722.1|  PREDICTED: uncharacterized protein LOC104729...    100   8e-20    
ref|XP_006466649.1|  PREDICTED: uncharacterized protein LOC102610013    100   9e-20    
emb|CDX75610.1|  BnaA01g00920D                                        99.8    1e-19    
ref|XP_007032891.1|  DNA binding protein, putative                    99.4    2e-19    
emb|CDX72616.1|  BnaC07g46380D                                          102   2e-19    
gb|KCW55247.1|  hypothetical protein EUGRSUZ_I01178                   98.2    3e-19    
ref|XP_009138462.1|  PREDICTED: probable transcription factor KAN2    97.4    4e-19    
ref|XP_009140580.1|  PREDICTED: protein PHR1-LIKE 1                   97.8    4e-19    
ref|XP_002525933.1|  DNA binding protein, putative                    97.1    7e-19    
gb|KHG30072.1|  hypothetical protein F383_15457                       95.9    1e-18    
ref|XP_010660566.1|  PREDICTED: uncharacterized protein LOC104881620  96.7    1e-18    
ref|XP_009109350.1|  PREDICTED: uncharacterized protein LOC103835011  96.3    1e-18    
ref|XP_009118140.1|  PREDICTED: uncharacterized protein LOC103843187  91.7    2e-17    
emb|CDY42715.1|  BnaA03g53680D                                        90.1    1e-16    
ref|XP_009396363.1|  PREDICTED: uncharacterized protein LOC103981370  89.0    2e-16    
ref|XP_008353549.1|  PREDICTED: uncharacterized protein LOC103417128  89.0    3e-16    
ref|XP_008362266.1|  PREDICTED: uncharacterized protein LOC103425948  88.6    4e-16    
ref|XP_004981656.1|  PREDICTED: probable transcription factor GLK...  89.7    5e-16    
gb|EPS74096.1|  hypothetical protein M569_00661                       84.7    1e-15    
gb|KDP24332.1|  hypothetical protein JCGZ_25628                       82.0    4e-14    
ref|XP_004167202.1|  PREDICTED: transcription activator GLK1-like     79.7    1e-13    
ref|XP_007032887.1|  DNA binding protein, putative                    81.3    1e-13    
ref|XP_009373817.1|  PREDICTED: uncharacterized protein LOC103962770  80.9    2e-13    
ref|XP_008230413.1|  PREDICTED: probable transcription factor KAN3    79.0    8e-13    
gb|KHG08713.1|  Two-component response regulator ARR1                 76.6    1e-12    
ref|XP_007147208.1|  hypothetical protein PHAVU_006G104700g           79.7    1e-12    
gb|KHN43166.1|  Myb family transcription factor APL                   79.3    1e-12    
ref|XP_006603737.1|  PREDICTED: uncharacterized protein LOC100813...  79.0    2e-12    
ref|XP_004493814.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1   79.7    2e-12    
ref|XP_006603739.1|  PREDICTED: uncharacterized protein LOC100813...  79.0    2e-12    
ref|XP_002885980.1|  hypothetical protein ARALYDRAFT_343166           75.9    2e-12    
ref|NP_001242015.1|  uncharacterized protein LOC100813604             79.0    2e-12    
ref|XP_006603736.1|  PREDICTED: uncharacterized protein LOC100813...  79.0    2e-12    
gb|KEH42994.1|  myb-like transcription factor family protein          77.0    2e-12    
emb|CDP03784.1|  unnamed protein product                              79.0    3e-12    
ref|XP_001766311.1|  predicted protein                                79.3    3e-12    



>ref|XP_011070832.1| PREDICTED: uncharacterized protein LOC105156412 [Sesamum indicum]
Length=393

 Score =   350 bits (897),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 230/364 (63%), Positives = 266/364 (73%), Gaps = 35/364 (10%)
 Frame = +1

Query  166   MLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQL  345
             MLI  H+    T++  KM+RCQ+YI ALEEERRKIQVFQRELPLCLELVTQAIEA KQQL
Sbjct  1     MLINSHN---HTDFSHKMQRCQDYIHALEEERRKIQVFQRELPLCLELVTQAIEACKQQL  57

Query  346   SGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANH  525
             SGT++E NL+ GQSECSEQT+S    + PV EEFIP+KRASS S  EE +  + PK+ + 
Sbjct  58    SGTSSEYNLH-GQSECSEQTSS----DVPVFEEFIPIKRASSQSDGEEQESSKKPKNDSD  112

Query  526   RTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-V  702
              ++ D  +  + N            S+K DWLRS QLWNQ+ +DP PKE SP    V  V
Sbjct  113   VSNKDGKNCYDKN------------SQKSDWLRSVQLWNQT-SDPPPKEHSPRKVAVMEV  159

Query  703   KRNGSGGAFHPFKREKSAGTSSP----AV-QTLDsttagvgngsggggggskkeeketQS  867
             KRNGSGGAFHPFK+EKS  T++P    AV +++   +    +  G  GGG+KKEEKE QS
Sbjct  160   KRNGSGGAFHPFKKEKSVATTAPSQGPAVNKSVPPASTSSADTGGNSGGGNKKEEKEGQS  219

Query  868   QRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTR  1047
             QRK RRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTR
Sbjct  220   QRKARRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTR  279

Query  1048  RPTPSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEA-----ATSN-GIYAPV  1209
             RP+PS+ N  +  Q PQFVVVGGIWV  P   A+MA   TSGEA     ATSN GIYAPV
Sbjct  280   RPSPSVPNTTATTQPPQFVVVGGIWV--PPEYASMATTATSGEACASGVATSNVGIYAPV  337

Query  1210  ATTP  1221
             A+ P
Sbjct  338   ASLP  341



>ref|XP_011077211.1| PREDICTED: uncharacterized protein LOC105161268 [Sesamum indicum]
Length=391

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 227/373 (61%), Positives = 259/373 (69%), Gaps = 41/373 (11%)
 Frame = +1

Query  166   MLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQL  345
             M+I  H+   +++  EKM+RCQ+YI ALEEERRKIQVFQRELPLCLELVTQAIE  KQQL
Sbjct  1     MMINTHN---NSDISEKMQRCQDYIHALEEERRKIQVFQRELPLCLELVTQAIETCKQQL  57

Query  346   SGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANH  525
             SGTTTECNL+ GQSECSEQT++      PV EEFIP+KRASS S D E+ E + PK+ ++
Sbjct  58    SGTTTECNLH-GQSECSEQTST------PVFEEFIPIKRASSHS-DGEEQESKKPKNESN  109

Query  526   RTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK-VGV  702
               + D  + N+ N            SKK DWLRS QLWNQ+  DP  KE+SP     V V
Sbjct  110   AGNKDGKNGNDKN------------SKKSDWLRSVQLWNQT-PDPPSKEDSPRKVAVVEV  156

Query  703   KRNGSGGAFHPFKREKSA----GTSSPAVQTL------Dsttagvgngsggggggskkee  852
             KRNG  GAFHPFK+EKS     GT++P  Q         ++T+      GG GGG+KKE 
Sbjct  157   KRNGGSGAFHPFKKEKSTAGDDGTATPPPQGSMNRPLPPASTSSTAETGGGSGGGNKKEG  216

Query  853   ketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKY  1032
             KE QSQRK RRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKY
Sbjct  217   KEGQSQRKARRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKY  276

Query  1033  RLHTRRPTPSIRNNgsqqqgpqf-vvvggIWVpppeyaaamapppTSGE---AATSNGIY  1200
             RLHTRRP PSI NN +        VVVGGIWV  P   AAMA   TSGE   AA S GIY
Sbjct  277   RLHTRRPNPSIHNNNNNNAQTPQFVVVGGIWV--PPEYAAMATTTTSGEAAGAAASKGIY  334

Query  1201  APVATTPKQTQQN  1239
              P+A  P   Q++
Sbjct  335   TPIAAPPPPFQES  347



>ref|XP_007046296.1| Myb-like transcription factor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY02128.1| Myb-like transcription factor family protein, putative isoform 
1 [Theobroma cacao]
Length=388

 Score =   315 bits (807),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 214/368 (58%), Positives = 248/368 (67%), Gaps = 39/368 (11%)
 Frame = +1

Query  196   STNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLN  375
             + +Y +KMRRC EY+EALEEERRKIQVFQRELPLCLELVTQAIEA K+++SG +T  +  
Sbjct  3     NMDYAKKMRRCHEYVEALEEERRKIQVFQRELPLCLELVTQAIEACKKEISGGSTTTDYM  62

Query  376   IGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddn  555
              GQSECSEQT+S    +GPVLEEFIP+KR+S  S  EEDDEQ+S KS +H T+  + +  
Sbjct  63    QGQSECSEQTSS----DGPVLEEFIPIKRSSDCS--EEDDEQESRKSKDHDTNTKEKNVA  116

Query  556   nnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESP--SNCKVGVKRNGSGGAF  729
               +             KK DWLRS QLWN + +   P +E    S   V VKRNG  GAF
Sbjct  117   AADK------------KKSDWLRSVQLWNNNQSPDPPLQEGAGKSGSAVEVKRNG--GAF  162

Query  730   HPFKREKSAGTSSPAVQTLDsttagvgngsgggggg-----------skkeeketQSQRK  876
              PF REK+   S P+V   +++         G  GG           SKKEEKE Q QRK
Sbjct  163   QPFHREKTVEKSVPSVGKANASATSTSTTESGSRGGGGGEANNGNTNSKKEEKEGQPQRK  222

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             QRRCWSPELHRRFL ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+
Sbjct  223   QRRCWSPELHRRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPS  282

Query  1057  PSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAAT---SNGIYAPVAT-TPK  1224
             P++ NN +  Q PQFVVVGGIWV PP   A MA    SGE A+   +NGIY PVA   PK
Sbjct  283   PTVHNN-ANAQAPQFVVVGGIWV-PPPEYAPMAATTASGETASVTPTNGIYTPVAAPLPK  340

Query  1225  QTQQNRTI  1248
               Q +  I
Sbjct  341   LPQPSGAI  348



>ref|XP_003631224.1| PREDICTED: probable transcription factor GLK2 [Vitis vinifera]
Length=362

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 208/355 (59%), Positives = 249/355 (70%), Gaps = 45/355 (13%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ +KM+RC +YIEALEEERRKIQVFQRELPLCLELV+QAIE+ +QQ+SGTT E     G
Sbjct  2     DFSDKMQRCHDYIEALEEERRKIQVFQRELPLCLELVSQAIESCRQQMSGTTQE--YFHG  59

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QSECSEQT+S    +GPVLEEFIP+K+ S     +++DEQQS +  +++  ++D      
Sbjct  60    QSECSEQTSS----DGPVLEEFIPIKKTS-----DDEDEQQSHQPNDNKDKNNDKS----  106

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNC-KVGVKRNGSGGAFHPF  738
                           KK DWLRS QLWNQ+  DP  KE++P     + VK+NG  GAFHPF
Sbjct  107   -------------GKKSDWLRSVQLWNQT-PDPPVKEDTPKKIPSMEVKKNG--GAFHPF  150

Query  739   KREKSAGT---SSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHR  909
             KR+K+ GT   S+P+  T     +     + G   GS+KEEKE QSQRK RRCWSPELHR
Sbjct  151   KRDKAVGTNPTSAPSAAT-----SSTAETATGCSSGSRKEEKEGQSQRKARRCWSPELHR  205

Query  910   RFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqq  1089
             RFL ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP P+I++N    Q
Sbjct  206   RFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPNPAIQHN-GNPQ  264

Query  1090  gpqfvvvggIWVpppeyaaamapppTSGEA---ATSNGIYAPVATTPKQTQQNRT  1245
              PQFVVVGGIWV PP    A+A   +SGEA    T+NGIYAPVA+ P    Q  T
Sbjct  265   APQFVVVGGIWV-PPPEYTAVAATTSSGEATGVTTANGIYAPVASVPPSHPQGST  318



>ref|XP_011021741.1| PREDICTED: probable transcription factor GLK2 [Populus euphratica]
Length=385

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 208/352 (59%), Positives = 250/352 (71%), Gaps = 29/352 (8%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ EK++RC EY+EALEEERRKIQVF+RELPLCLELVTQAIEA K++LSGTTTE N++ G
Sbjct  2     DFAEKIQRCGEYVEALEEERRKIQVFERELPLCLELVTQAIEACKKELSGTTTEYNMH-G  60

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDE-EDDEQQSPKSANHRTdddddddnn  558
              SECSEQT+S    EGPVLEEFIP+KR  S  ++E E+D+ Q  +S N+   +     ++
Sbjct  61    HSECSEQTSS----EGPVLEEFIPIKRTHSYDENENENDDHQEQQSQNNSKRNKTSISSS  116

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNGSGGAFHP  735
             NN             KK DWLRS  LWN S  DP  K++ P    V  VKRNG+GGAF P
Sbjct  117   NNDHK----------KKSDWLRSVHLWNHS-PDPPKKQDLPRKAAVTEVKRNGAGGAFQP  165

Query  736   FKREKSAGTSSP--------AVQTLDsttagvgngsggggggskkeeketQSQRKQRRCW  891
             F REKS G +S         +V    +++  V    G G G +KKE+ + ++QRKQRRCW
Sbjct  166   FLREKSIGKTSNQAIAKAPISVPASTTSSTAVVATGGLGDGSNKKEDMDGRNQRKQRRCW  225

Query  892   SPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRN  1071
             SPELHRRFL AL++LGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+P+I N
Sbjct  226   SPELHRRFLHALRELGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPTIHN  285

Query  1072  NgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATS--NGIYAPVATTP  1221
             N S QQ PQFVVVGGIWVPPPEYAA  A   ++  +  S  NGIYAP+A  P
Sbjct  286   N-SNQQAPQFVVVGGIWVPPPEYAAVAATTASAETSPISAANGIYAPIAAAP  336



>emb|CBI27058.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   307 bits (786),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 207/350 (59%), Positives = 245/350 (70%), Gaps = 45/350 (13%)
 Frame = +1

Query  217   MRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECS  396
             M+RC +YIEALEEERRKIQVFQRELPLCLELV+QAIE+ +QQ+SGTT E     GQSECS
Sbjct  1     MQRCHDYIEALEEERRKIQVFQRELPLCLELVSQAIESCRQQMSGTTQE--YFHGQSECS  58

Query  397   EQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdss  576
             EQT+S    +GPVLEEFIP+K+ S     +++DEQQS +  +++  ++D           
Sbjct  59    EQTSS----DGPVLEEFIPIKKTS-----DDEDEQQSHQPNDNKDKNNDKS---------  100

Query  577   dsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNC-KVGVKRNGSGGAFHPFKREKS  753
                      KK DWLRS QLWNQ+  DP  KE++P     + VK+NG  GAFHPFKR+K+
Sbjct  101   --------GKKSDWLRSVQLWNQT-PDPPVKEDTPKKIPSMEVKKNG--GAFHPFKRDKA  149

Query  754   AGT---SSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQA  924
              GT   S+P+  T     +     + G   GS+KEEKE QSQRK RRCWSPELHRRFL A
Sbjct  150   VGTNPTSAPSAAT-----SSTAETATGCSSGSRKEEKEGQSQRKARRCWSPELHRRFLHA  204

Query  925   LQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfv  1104
             LQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP P+I++N    Q PQFV
Sbjct  205   LQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPNPAIQHN-GNPQAPQFV  263

Query  1105  vvggIWVpppeyaaamapppTSGEA---ATSNGIYAPVATTPKQTQQNRT  1245
             VVGGIWV PP    A+A   +SGEA    T+NGIYAPVA+ P    Q  T
Sbjct  264   VVGGIWV-PPPEYTAVAATTSSGEATGVTTANGIYAPVASVPPSHPQGST  312



>emb|CDP00582.1| unnamed protein product [Coffea canephora]
Length=392

 Score =   308 bits (789),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 221/358 (62%), Positives = 250/358 (70%), Gaps = 41/358 (11%)
 Frame = +1

Query  217   MRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI-GQSEC  393
             M+R QEYI++LEEERRKI VFQRELPLCLELVTQAIE  KQQLS  TT    N  GQSEC
Sbjct  1     MQRTQEYIDSLEEERRKILVFQRELPLCLELVTQAIETCKQQLSSGTTVTEYNFHGQSEC  60

Query  394   SEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQS--PKSANHRTdddddddnnnng  567
             SEQT++    +GPVLEEFIP+KRA  LS D  DDEQQS  PK +N         + N+  
Sbjct  61    SEQTST----DGPVLEEFIPIKRA--LSSD--DDEQQSRKPKKSN-------ISNGNDKD  105

Query  568   dssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK-VGVKRNG-SGGAFHPFK  741
             + S+++     SKK DWLRS QLWNQ+  DP  KE+SP     V VKRNG SGGAFHPFK
Sbjct  106   NKSNNNDKAASSKKSDWLRSVQLWNQT-PDPPQKEDSPKKVSVVEVKRNGSSGGAFHPFK  164

Query  742   REKSAG--------------TSSPAVQTLDsttagvgngsggggggskkeeket-QSQRK  876
             +EKS G              TS PA +   +   G  +G GGGG G  K+E++  QSQRK
Sbjct  165   KEKSIGANAGKLDVPKSGDKTSIPAAEASSTEETGGTSGGGGGGNGGSKKEEKEGQSQRK  224

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
              RRCWSPELH+RFL ALQQLGG+HVATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRP+
Sbjct  225   SRRCWSPELHKRFLLALQQLGGAHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHNRRPS  284

Query  1057  PSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEA---ATSNGIYAPVATTP  1221
             PSI +N +  Q PQFVVVGGIWV PP   AAMA    SGEA   A SNGIYAP+ T P
Sbjct  285   PSIHSN-NNPQAPQFVVVGGIWV-PPPEYAAMAATTGSGEASGGANSNGIYAPIPTLP  340



>ref|XP_004238956.1| PREDICTED: uncharacterized protein LOC101263023 [Solanum lycopersicum]
Length=400

 Score =   308 bits (789),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 200/354 (56%), Positives = 246/354 (69%), Gaps = 26/354 (7%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ N+ +KM RCQ+YI+ALE+ER KIQVF RELPLCLELVTQAIE YKQQLSGTTTE NL
Sbjct  3     SNNNFSDKMERCQQYIDALEQERTKIQVFSRELPLCLELVTQAIETYKQQLSGTTTEYNL  62

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTddddddd  552
             N   +ECS+   +S D   P+LEEFIPLK  S+ S ++ED+++   ++ +H++   ++++
Sbjct  63    NAQSTECSDDEHTSSDV--PILEEFIPLK--STFSHEDEDEDENDEENQSHKSKSFNNNN  118

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEE-SPSNCKVGVKR-NGSGGA  726
             NN+             +KK DWLRS QLWNQ+ +DPTPKEE +P    V   + NGSGGA
Sbjct  119   NNSTSSKDAK------NKKSDWLRSVQLWNQT-SDPTPKEELTPKKVSVVEVKKNGSGGA  171

Query  727   FHPFKREK---SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSP  897
             FHPFK+EK   +A  ++PA+  +         GS         ++++   QRKQRRCWSP
Sbjct  172   FHPFKKEKNTVAAVETTPALAGV----VLAATGSSTAENSGGSKKEDKDGQRKQRRCWSP  227

Query  898   ELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNg  1077
             ELHRRFL ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS  +N 
Sbjct  228   ELHRRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPSSIHNN  287

Query  1078  sqqqgpqfvvvggIWV-----pppeyaaamapppTSGEAATSNGIYAPVATTPK  1224
             + QQ PQFVVVGGIWV           A  A    SG  A SNGIYAP+AT PK
Sbjct  288   NNQQPPQFVVVGGIWVPPPEYASMAAGAPAASGEASG-VANSNGIYAPIATHPK  340



>ref|XP_006362570.1| PREDICTED: uncharacterized protein LOC102595401 [Solanum tuberosum]
Length=358

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 207/344 (60%), Positives = 241/344 (70%), Gaps = 19/344 (6%)
 Frame = +1

Query  217   MRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECS  396
             M RCQ+YI+ALE+ER KIQVF RELPLCLELVTQAIE YKQQLSGTTTE NLN   +ECS
Sbjct  1     MERCQQYIDALEQERTKIQVFSRELPLCLELVTQAIETYKQQLSGTTTEYNLNAQSTECS  60

Query  397   EQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdss  576
             +   +S D   PVLEEFIPLK   S   ++ED+E+   ++ +H++     ++NN +  +S
Sbjct  61    DDEHTSSD--VPVLEEFIPLKSTFSHEDEDEDEEEDDEENQSHKSKSLIINNNNTSNSTS  118

Query  577   dsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEE-SPSNCKVGVKR-NGSGGAFHPFKREK  750
                     +KK DWLRS QLWNQ+ +DPTPKEE +P    V   + NGSGGAFHPFK+EK
Sbjct  119   SKDTK---NKKSDWLRSVQLWNQT-SDPTPKEELTPKKVSVVEVKKNGSGGAFHPFKKEK  174

Query  751   SAGTSSPAVQTLDsttagvgngsggggggskkeeketQ-SQRKQRRCWSPELHRRFLQAL  927
             +A  +   V+T   +   +              +KE +  QRKQRRCWSPELHRRFL AL
Sbjct  175   NAVAT---VETTPISGVVLAATDSSTVENGGGNKKEDKDGQRKQRRCWSPELHRRFLHAL  231

Query  928   QQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP-SIRNNgsqqqgpqfv  1104
             QQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+P SI NN   QQ  QFV
Sbjct  232   QQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPSSIHNN--NQQPTQFV  289

Query  1105  vvggIWV-pppeyaaamapppTSGEA---ATSNGIYAPVATTPK  1224
             VVGGIWV PP   A A A P  SGEA   A SNGIYAP+AT PK
Sbjct  290   VVGGIWVPPPEYAAMAAAAPAASGEASGVANSNGIYAPIATHPK  333



>ref|XP_002311443.2| hypothetical protein POPTR_0008s11630g [Populus trichocarpa]
 gb|EEE88810.2| hypothetical protein POPTR_0008s11630g [Populus trichocarpa]
Length=383

 Score =   306 bits (784),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 210/354 (59%), Positives = 247/354 (70%), Gaps = 35/354 (10%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ EK++RC EY+EALEEERRKIQVF+RELPLCLELVTQAIEA K++LSGTTTE N++ G
Sbjct  2     DFAEKIQRCGEYVEALEEERRKIQVFERELPLCLELVTQAIEACKRELSGTTTEYNMH-G  60

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQ-DEEDDEQQSPKSANHRTdddddddnn  558
             QSECSEQT+S    EGPVLEEFIP+KR  S  + D E+D+ Q  +S ++   +     + 
Sbjct  61    QSECSEQTSS----EGPVLEEFIPIKRTHSYDENDNENDDHQEQQSHDNSKRNKTSISSG  116

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPF  738
             NN             KK DWLRS QLWN S     P+++        VKRNG+GGAF PF
Sbjct  117   NNDHK----------KKSDWLRSVQLWNHS--PDLPQKQVLKAAVTEVKRNGAGGAFQPF  164

Query  739   KREKSAG-----------TSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRR  885
              REKS G           TS PA  T   ++  V    G GGG +KKE+ +  +QRKQRR
Sbjct  165   HREKSIGKTSNQAIAKAPTSVPASTT---SSTAVVATGGIGGGSNKKEDIDGGNQRKQRR  221

Query  886   CWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSI  1065
             CWSPELHRRFL AL+QLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+P+I
Sbjct  222   CWSPELHRRFLHALRQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPTI  281

Query  1066  RNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATS--NGIYAPVATTP  1221
              NN S QQ PQFVVVGGIWVPPPEYAA  A   ++  +  S  NGIYAP+A  P
Sbjct  282   HNN-SNQQAPQFVVVGGIWVPPPEYAAVAATTASAETSPISAANGIYAPIAAAP  334



>ref|XP_009619370.1| PREDICTED: two-component response regulator-like APRR2 [Nicotiana 
tomentosiformis]
Length=400

 Score =   305 bits (781),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 221/362 (61%), Positives = 254/362 (70%), Gaps = 28/362 (8%)
 Frame = +1

Query  166   MLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQL  345
             M+I  H+     NY EKM+RCQ+YI+ALEEER KIQVF RELPLCLELVTQAI+ YKQQL
Sbjct  1     MMINNHE----NNYTEKMQRCQQYIDALEEERNKIQVFSRELPLCLELVTQAIDTYKQQL  56

Query  346   SGTTTECNLNI-GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSAN  522
             SGTTTE NLN     ECSE+ TSSD    P+LEEFIPLKR  + S + E++++   +S  
Sbjct  57    SGTTTEYNLNAQSDVECSEEHTSSD---VPILEEFIPLKR--TFSHENEEEDEDERESHK  111

Query  523   HRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFT-DPTPKEE--SPSNCK  693
              +T +  D   + +  +SD S      KK DWLRS QLWN + T DPTPKEE        
Sbjct  112   SKTYNISDTSCSKDNKNSDKS-----CKKSDWLRSVQLWNNNPTPDPTPKEELKPKKVAV  166

Query  694   VGVKRNGSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQR  873
             V VK+NGSGGAFHPFK+EKSA     A++   S        S     GS  +++E   +R
Sbjct  167   VEVKKNGSGGAFHPFKKEKSAPA---AIEPPTSAVVSAAAASSTAETGSGSKKEEKDEKR  223

Query  874   KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP
Sbjct  224   KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  283

Query  1054  TP-SIRNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGE----AATSNGIYAPVATT  1218
             +P SI NN   QQ PQFVVVGGIWVPPPEYAA  A  P++       A SNGIYAP+AT 
Sbjct  284   SPSSIHNN--NQQPPQFVVVGGIWVPPPEYAAMAAAAPSASGEASGVANSNGIYAPIATL  341

Query  1219  PK  1224
             PK
Sbjct  342   PK  343



>ref|XP_009788853.1| PREDICTED: transcription factor LUX-like [Nicotiana sylvestris]
Length=398

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 217/362 (60%), Positives = 248/362 (69%), Gaps = 30/362 (8%)
 Frame = +1

Query  166   MLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQL  345
             M+I  H+     NY EKM+RCQ+YI+ALE+ER KIQVF RELPLCLELVTQAIE YKQQL
Sbjct  1     MMINNHE----NNYTEKMQRCQQYIDALEQERNKIQVFSRELPLCLELVTQAIETYKQQL  56

Query  346   SGTTTECNLNI-GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSAN  522
             SGTTTE N++     ECSE+ TSSD    P+LEEFIPLK   S  +DE++DE+ S KS  
Sbjct  57    SGTTTEYNVHTQSDVECSEEHTSSD---VPILEEFIPLKGTFS-HEDEDEDERDSHKSKT  112

Query  523   HRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFT-DPTPKEE-SPS-NCK  693
             +   D     +N N D S         KK DWLRS QLWN + T DPTPKEE +P     
Sbjct  113   YNISDTSCSKDNKNSDKS--------CKKSDWLRSVQLWNNNQTPDPTPKEEVTPKKGAV  164

Query  694   VGVKRNGSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQR  873
             V VK+NGSGGAFHPFK+EKSA  ++   +   S        S     GS  +++E   +R
Sbjct  165   VEVKKNGSGGAFHPFKKEKSAAATT---EPPTSAAVAAAAASSTAETGSGSKKEEKDEKR  221

Query  874   KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP
Sbjct  222   KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  281

Query  1054  TP-SIRNNgsqqqgpqfvvvggIWV----pppeyaaamapppTSGEAATSNGIYAPVATT  1218
             +P SI NN   QQ PQFVVVGGIWV         AAA +    +   A SNGIYAP+AT 
Sbjct  282   SPSSIHNN--HQQPPQFVVVGGIWVPPPEYSAMAAAAPSASGEASGVANSNGIYAPIATL  339

Query  1219  PK  1224
             PK
Sbjct  340   PK  341



>ref|XP_011008471.1| PREDICTED: transcription factor LUX-like isoform X1 [Populus 
euphratica]
Length=389

 Score =   300 bits (767),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 211/368 (57%), Positives = 248/368 (67%), Gaps = 39/368 (11%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ EKM+RC EY+EALEEERRKIQVF+RELPLCLELVTQAIEA K++LSGTT + N++ G
Sbjct  2     DFAEKMQRCHEYVEALEEERRKIQVFERELPLCLELVTQAIEACKRELSGTTEDHNMH-G  60

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASS--------LSQDEEDDEQQSPKSANHRTdd  537
             QSECSEQT+S    EGPVLEEFIP+KR  S           D++  EQQS ++ N R   
Sbjct  61    QSECSEQTSS----EGPVLEEFIPIKRTHSSDDDENDNNHDDDDHQEQQS-QNKNKRNKS  115

Query  538   dddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNG  714
             +    NN++             KK DWLRS QLWNQS  DP  K++ P    V  VKRNG
Sbjct  116   NSSISNNDHK------------KKSDWLRSVQLWNQS-PDPPQKQDLPRKAAVTEVKRNG  162

Query  715   SGGAFHPFKREKSAGTSS--------PAVQTLDsttagvgngsggggggskkeeketQSQ  870
             +GGAF PF RE S G SS        P+V    +++       G GGGG+KKE+KE  +Q
Sbjct  163   AGGAFQPFHRENSVGKSSHQAISKASPSVPASATSSIAGAVTGGTGGGGNKKEDKEEGNQ  222

Query  871   RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             RKQRRCWSPELHRRFL ALQQLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR
Sbjct  223   RKQRRCWSPELHRRFLHALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  282

Query  1051  PTPSIRNNgsqqqgpqfvvvggIWV--pppeyaaamapppTSGEAATSNGIYAPVATTPK  1224
             P+P++ NN S  Q PQFVVVGGIWV        AA      +   + +NGIYAP+A  P 
Sbjct  283   PSPTVHNN-SSPQAPQFVVVGGIWVPPTEYAAVAATTTAGETSTISAANGIYAPIAAPPP  341

Query  1225  QTQQNRTI  1248
                QNR +
Sbjct  342   AVPQNRQL  349



>ref|XP_002315957.1| hypothetical protein POPTR_0010s13900g [Populus trichocarpa]
 gb|EEF02128.1| hypothetical protein POPTR_0010s13900g [Populus trichocarpa]
Length=390

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 218/388 (56%), Positives = 255/388 (66%), Gaps = 50/388 (13%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ EKM+RC EY+EALEEERRKIQVF+RELPLCLELVTQAIEA K++LSGTT + N++ G
Sbjct  2     DFAEKMQRCHEYVEALEEERRKIQVFERELPLCLELVTQAIEACKRELSGTTEDHNMH-G  60

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASS--------LSQDEEDDEQQSPKSANHRTdd  537
             QSECSEQT+S    EGPVLEEFIP+KR  S           D++  EQQS ++ N R   
Sbjct  61    QSECSEQTSS----EGPVLEEFIPIKRTHSSDDEENDNNHDDDDHQEQQS-QNDNKRNKS  115

Query  538   dddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNG  714
             +    NN++             KK DWLRS QLWNQS  DP  K++ P    V  VKRNG
Sbjct  116   NSSISNNDHK------------KKSDWLRSVQLWNQS-PDPPQKQDLPRKAAVTEVKRNG  162

Query  715   SGGAFHPFKREKSAGTSS--------PAVQTLDsttagvgngsggggggskkeeketQSQ  870
             +GGAF PF REKS G SS        P+V    +++       G GGGG+KKE+KE  +Q
Sbjct  163   AGGAFQPFHREKSVGKSSNQAISKAPPSVPASATSSIAGAVTGGTGGGGNKKEDKEKGNQ  222

Query  871   RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             RKQRRCWSPELHRRFL +LQQLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR
Sbjct  223   RKQRRCWSPELHRRFLHSLQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  282

Query  1051  PTPSIRNNgsqqqgpqfvvvggIWV--pppeyaaamapppTSGEAATSNGIYAPVATTPK  1224
             P+P+I  N S QQ PQFVVVGGIWV        AA      +   + +NGIYAP+A  P 
Sbjct  283   PSPTIHTN-SSQQAPQFVVVGGIWVPPTEYAAVAATTTAGETSTISAANGIYAPIAAPPP  341

Query  1225  QTQQNRTIPFS-----------GEKGGA  1275
                QNR    S           GE+GGA
Sbjct  342   AVPQNRQHKQSEHSQSEGRGSHGERGGA  369



>ref|XP_002529155.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF33268.1| DNA binding protein, putative [Ricinus communis]
Length=393

 Score =   297 bits (761),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 211/359 (59%), Positives = 249/359 (69%), Gaps = 22/359 (6%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y EKM+RC EY+EALEEE+RKIQVFQRELPLCLELVTQAIEA K++LSGTTTE     G
Sbjct  2     DYAEKMQRCHEYVEALEEEKRKIQVFQRELPLCLELVTQAIEACKRELSGTTTE--YMHG  59

Query  382   QSECSEQTTSSDDDEGP------VLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddd  543
             QSECSEQTTS+D           VLEEFIP+KR +S S ++ D++  +        DD++
Sbjct  60    QSECSEQTTSTDGTANGTGTRSLVLEEFIPIKRINSSSHNDNDNDDDNENEKEDNDDDEE  119

Query  544   dddnnnngdssdsskdgkVSKKQ-DWLRSAQLWNQSFTDP-TPKEESPSNCKVG-VKRNG  714
             ++D +++  +          KK+ DWLRS QLWNQS  D   PKE+ P    V  VKRNG
Sbjct  120   EEDQDSHKPNKSIRDINNDQKKKSDWLRSVQLWNQSSPDSEPPKEDLPRKAAVTEVKRNG  179

Query  715   SGGAFHPFKREKSAGTSSPAV--QTLDsttagvgngsggggggskkeeketQSQRKQRRC  888
               GAF PF +EK    + P+V      S+      G   G G ++KE+K+ Q+QRKQRRC
Sbjct  180   --GAFQPFHKEKGIAKTPPSVPASATSSSAETGTGGGTSGAGNNRKEDKDGQAQRKQRRC  237

Query  889   WSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIR  1068
             WSPELHRRFL ALQQLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+P+I 
Sbjct  238   WSPELHRRFLHALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPTIH  297

Query  1069  NNgsqqqgpqfvvvggIWVpppeyaaamapppT--SGEAATSNGIYAPVA----TTPKQ  1227
             NN S  Q PQFVVVGGIWVPPPEYAA  A   +  +   A +NGIYAPVA    T PKQ
Sbjct  298   NN-SNPQAPQFVVVGGIWVPPPEYAAVAATTASMETVTTAAANGIYAPVAAPLGTIPKQ  355



>ref|XP_011008478.1| PREDICTED: transcription factor LUX-like isoform X2 [Populus 
euphratica]
Length=388

 Score =   294 bits (753),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 211/368 (57%), Positives = 248/368 (67%), Gaps = 40/368 (11%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ EKM+RC EY+EALEEERRKIQVF+RELPLCLELVTQAIEA K++LSGTT + N++ G
Sbjct  2     DFAEKMQRCHEYVEALEEERRKIQVFERELPLCLELVTQAIEACKRELSGTTEDHNMH-G  60

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASS--------LSQDEEDDEQQSPKSANHRTdd  537
             QSECSEQT+S    EGPVLEEFIP+KR  S           D++  EQQS ++ N R   
Sbjct  61    QSECSEQTSS----EGPVLEEFIPIKRTHSSDDDENDNNHDDDDHQEQQS-QNKNKRNKS  115

Query  538   dddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNG  714
             +    NN++             KK DWLRS QLWNQS  DP  K++ P    V  VKRNG
Sbjct  116   NSSISNNDHK------------KKSDWLRSVQLWNQS-PDPPQKQDLPRKAAVTEVKRNG  162

Query  715   SGGAFHPFKREKSAGTS--------SPAVQTLDsttagvgngsggggggskkeeketQSQ  870
             +GGAF PF RE S G S        SP+V    +++       G GGGG+KKE+KE  +Q
Sbjct  163   AGGAFQPFHRENSVGKSSHQAISKASPSVPASATSSIAGAVTGGTGGGGNKKEDKEEGNQ  222

Query  871   RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             RKQRRCWSPELHRRFL ALQQLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR
Sbjct  223   RKQRRCWSPELHRRFLHALQQLGGSH-ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  281

Query  1051  PTPSIRNNgsqqqgpqfvvvggIWV--pppeyaaamapppTSGEAATSNGIYAPVATTPK  1224
             P+P++ NN S  Q PQFVVVGGIWV        AA      +   + +NGIYAP+A  P 
Sbjct  282   PSPTVHNN-SSPQAPQFVVVGGIWVPPTEYAAVAATTTAGETSTISAANGIYAPIAAPPP  340

Query  1225  QTQQNRTI  1248
                QNR +
Sbjct  341   AVPQNRQL  348



>ref|XP_010695844.1| PREDICTED: transcription factor LUX [Beta vulgaris subsp. vulgaris]
Length=402

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 208/369 (56%), Positives = 241/369 (65%), Gaps = 54/369 (15%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSG----TTTECN  369
             ++ + M +CQEYI  LEEE+RKIQVFQRELPLCL+LVTQAIEA KQQL G    TTTEC 
Sbjct  3     DFRDNMEKCQEYINGLEEEKRKIQVFQRELPLCLDLVTQAIEACKQQLCGSGTNTTTEC-  61

Query  370   LNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
             LN G SECSEQTTS    +GPVLEEFIPLKR++S   D++D E +S KS           
Sbjct  62    LN-GHSECSEQTTS----DGPVLEEFIPLKRSNS--PDDDDYELESDKS-----------  103

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEES-PSNCKV-GVKRNGSGG  723
                   +S  ++      KK DWLRS QLWNQ+   PT +E+  P    V  VKRNG+G 
Sbjct  104   ----QINSDLNNNHENSGKKSDWLRSVQLWNQTPDPPTTQEDHQPKKVTVVEVKRNGNG-  158

Query  724   AFHPFKREKSA-------------------GTSSPAVQTLDsttagvg---ngsgggggg  837
             AFHPF++E +                      S+PA     S         +G  GGG  
Sbjct  159   AFHPFQKENNCNGNEKHNNNNNNNDNNNKQDASTPAASACSSAQEVDMGPSSGGSGGGSA  218

Query  838   skkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKS  1017
             SKKEEK  QSQRK RRCWSPELHRRF+ ALQQLGGSHVATPKQIR+LMKVDGLTNDEVKS
Sbjct  219   SKKEEKGGQSQRKSRRCWSPELHRRFVHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKS  278

Query  1018  HLQKYRLHTRRPTPSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATS--N  1191
             HLQKYRLHTRRP+  + NN +QQQ PQFVVVGGIW+PP EYAA  A   +  +   S  N
Sbjct  279   HLQKYRLHTRRPSSGVHNNANQQQAPQFVVVGGIWMPPQEYAAVTATTTSGDKTNVSPPN  338

Query  1192  GIYAPVATT  1218
             GIYAP+AT 
Sbjct  339   GIYAPIATV  347



>gb|KDP29370.1| hypothetical protein JCGZ_18291 [Jatropha curcas]
Length=410

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 211/363 (58%), Positives = 246/363 (68%), Gaps = 29/363 (8%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y EK++RC EY+EALEEERRKIQVFQRELPLCLELVTQAIEA K++LSGTTTE     G
Sbjct  2     DYTEKLQRCHEYVEALEEERRKIQVFQRELPLCLELVTQAIEACKRELSGTTTE--YMHG  59

Query  382   QSECSEQTTSSD-DDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
             QSECS QT+S       PVLEEFIP+KR  S S ++ ++E++     ++  DD +   +N
Sbjct  60    QSECSVQTSSDGIATRPPVLEEFIPIKRTHSSSDNDYEEEEEEDDDDDNENDDKEHHSHN  119

Query  559   nngdssdsskdgkVS----KKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNGSGG  723
                D +   KD   S    KK DWLRS QLWNQS  DP  KE+ P    V  VKRN  GG
Sbjct  120   KRNDKNIKDKDKNSSADHKKKSDWLRSVQLWNQS-ADPPLKEDLPRKIAVSEVKRN--GG  176

Query  724   AFHPFKREKSAG--------TSSPA-----VQTLDsttagvgngsggggggskkeeketQ  864
             AF PF++EKS G        T SP        T ++ T G GNGSG GGGGS K++++  
Sbjct  177   AFQPFQKEKSVGKNNQTITKTPSPVPASATSSTEETKTGGTGNGSGNGGGGSGKKDEKES  236

Query  865   SQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHT  1044
             SQRKQRRCWSPELHRRFL ALQQLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHT
Sbjct  237   SQRKQRRCWSPELHRRFLHALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHT  296

Query  1045  RRPTPSIRNNgsqqqgpqfvvvggIWV----pppeyaaamapppTSGEAATSNGIYAPVA  1212
             RRP+P+I NN +  Q PQFVVVGGIWV         A        +   A +NG+YAPVA
Sbjct  297   RRPSPTIHNN-NNPQAPQFVVVGGIWVPPADYATVAAGTTTTSGETATIAAANGLYAPVA  355

Query  1213  TTP  1221
             + P
Sbjct  356   SRP  358



>ref|XP_006484416.1| PREDICTED: uncharacterized protein LOC102624045 [Citrus sinensis]
 gb|KDO70082.1| hypothetical protein CISIN_1g016585mg [Citrus sinensis]
Length=387

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 232/349 (66%), Gaps = 41/349 (12%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y EKM+RC EY+EALEEE+RKIQVFQRELPLCLELVTQAI+A +++LSGTTTE  +++ 
Sbjct  2     DYAEKMQRCHEYVEALEEEKRKIQVFQRELPLCLELVTQAIQACRRELSGTTTEY-MHV-  59

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQS---PKSANHRTddddddd  552
             QSECSEQT+S    +GP+LEEFIP+KR+SS   ++ D++ +    P + N+  + + + D
Sbjct  60    QSECSEQTSS----DGPILEEFIPIKRSSSHDDNDNDNDDRHSNRPTTTNNNREKEKNSD  115

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK---VGVKRNGSGG  723
                              KK DWLRS QLWNQS  DP PKEE     K   V VKRNGSGG
Sbjct  116   K----------------KKSDWLRSVQLWNQS-PDPQPKEEEVVPRKATVVEVKRNGSGG  158

Query  724   AFHPFKREKSA---------GTSSPAVQTLDsttagvgngsggggggskkeeketQSQRK  876
             AF PF REK           G  +  V T  + ++      G G    K ++KE Q QRK
Sbjct  159   AFQPFHREKCGEKKDQQQRLGKVNTPVPTA-AASSTTDTAVGKGEKNDKDKDKEGQPQRK  217

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             QRR WSPELHRRFL ALQQLGGSH ATPKQIRELM VDGLTNDEVKSHLQKYRLHTRRP+
Sbjct  218   QRRSWSPELHRRFLHALQQLGGSHAATPKQIRELMNVDGLTNDEVKSHLQKYRLHTRRPS  277

Query  1057  PSIRNNgsqqqgpqfvvvggIWVpp-peyaaamapppTSGEAATSNGIY  1200
             P++ N     Q PQFVVVGGIWV      A A   P  +G  ATSNGIY
Sbjct  278   PAMHNG-GNPQAPQFVVVGGIWVQAPDYAAVAAKAPGEAGSIATSNGIY  325



>ref|XP_006437730.1| hypothetical protein CICLE_v10031793mg [Citrus clementina]
 gb|ESR50970.1| hypothetical protein CICLE_v10031793mg [Citrus clementina]
Length=387

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 232/349 (66%), Gaps = 41/349 (12%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y EKM+RC EY+EALEEE+RKIQVFQRELPLCLELVTQAI+A +++LSGTTTE  +++ 
Sbjct  2     DYAEKMQRCHEYVEALEEEKRKIQVFQRELPLCLELVTQAIQACRRELSGTTTEY-MHV-  59

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQS---PKSANHRTddddddd  552
             QSECSEQT+S    +GP+LEEFIP+KR+SS   ++ D++ +    P + N+  + + + D
Sbjct  60    QSECSEQTSS----DGPILEEFIPIKRSSSHDDNDNDNDDRHSNRPTTTNNNREKEKNSD  115

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK---VGVKRNGSGG  723
                              KK DWLRS QLWNQS  DP PKEE     K   V VKRNGSGG
Sbjct  116   K----------------KKSDWLRSVQLWNQS-PDPQPKEEEVVPRKATVVEVKRNGSGG  158

Query  724   AFHPFKREKSA---------GTSSPAVQTLDsttagvgngsggggggskkeeketQSQRK  876
             AF PF REK           G  +  V T  + ++      G G    K ++KE Q QRK
Sbjct  159   AFQPFHREKCGEKKDQQQRLGKVNTPVPTA-AASSTTDTAVGKGEKNDKDKDKEGQPQRK  217

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             QRR WSPELHRRFL ALQQLGGSH ATPKQIRELM VDGLTNDEVKSHLQKYRLHTRRP+
Sbjct  218   QRRSWSPELHRRFLHALQQLGGSHAATPKQIRELMNVDGLTNDEVKSHLQKYRLHTRRPS  277

Query  1057  PSIRNNgsqqqgpqfvvvggIWVpp-peyaaamapppTSGEAATSNGIY  1200
             P++ N     Q PQFVVVGGIWV      A A   P  +G  ATSNGIY
Sbjct  278   PAMHNG-GNPQAPQFVVVGGIWVQAPEYAAVAAKAPGEAGSIATSNGIY  325



>ref|XP_007046297.1| Myb-like transcription factor family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY02129.1| Myb-like transcription factor family protein, putative isoform 
2 [Theobroma cacao]
Length=278

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 197/290 (68%), Gaps = 33/290 (11%)
 Frame = +1

Query  196   STNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLN  375
             + +Y +KMRRC EY+EALEEERRKIQVFQRELPLCLELVTQAIEA K+++SG +T  +  
Sbjct  3     NMDYAKKMRRCHEYVEALEEERRKIQVFQRELPLCLELVTQAIEACKKEISGGSTTTDYM  62

Query  376   IGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddn  555
              GQSECSEQT+S    +GPVLEEFIP+KR+S  S  EEDDEQ+S KS +H T+  + +  
Sbjct  63    QGQSECSEQTSS----DGPVLEEFIPIKRSSDCS--EEDDEQESRKSKDHDTNTKEKNVA  116

Query  556   nnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESP--SNCKVGVKRNGSGGAF  729
               +             KK DWLRS QLWN + +   P +E    S   V VKRNG  GAF
Sbjct  117   AADK------------KKSDWLRSVQLWNNNQSPDPPLQEGAGKSGSAVEVKRNG--GAF  162

Query  730   HPFKREKSAGTSSPAVQTLDsttagvgngsgggggg-----------skkeeketQSQRK  876
              PF REK+   S P+V   +++         G  GG           SKKEEKE Q QRK
Sbjct  163   QPFHREKTVEKSVPSVGKANASATSTSTTESGSRGGGGGEANNGNTNSKKEEKEGQPQRK  222

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  1026
             QRRCWSPELHRRFL ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ
Sbjct  223   QRRCWSPELHRRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  272



>ref|XP_007046298.1| Myb-like transcription factor family protein, putative isoform 
3 [Theobroma cacao]
 gb|EOY02130.1| Myb-like transcription factor family protein, putative isoform 
3 [Theobroma cacao]
Length=291

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 197/290 (68%), Gaps = 33/290 (11%)
 Frame = +1

Query  196   STNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLN  375
             + +Y +KMRRC EY+EALEEERRKIQVFQRELPLCLELVTQAIEA K+++SG +T  +  
Sbjct  3     NMDYAKKMRRCHEYVEALEEERRKIQVFQRELPLCLELVTQAIEACKKEISGGSTTTDYM  62

Query  376   IGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddn  555
              GQSECSEQT+S    +GPVLEEFIP+KR+S  S  EEDDEQ+S KS +H T+  + +  
Sbjct  63    QGQSECSEQTSS----DGPVLEEFIPIKRSSDCS--EEDDEQESRKSKDHDTNTKEKNVA  116

Query  556   nnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESP--SNCKVGVKRNGSGGAF  729
               +             KK DWLRS QLWN + +   P +E    S   V VKRNG  GAF
Sbjct  117   AADK------------KKSDWLRSVQLWNNNQSPDPPLQEGAGKSGSAVEVKRNG--GAF  162

Query  730   HPFKREKSAGTSSPAVQTLDsttagvgngsgggggg-----------skkeeketQSQRK  876
              PF REK+   S P+V   +++         G  GG           SKKEEKE Q QRK
Sbjct  163   QPFHREKTVEKSVPSVGKANASATSTSTTESGSRGGGGGEANNGNTNSKKEEKEGQPQRK  222

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  1026
             QRRCWSPELHRRFL ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ
Sbjct  223   QRRCWSPELHRRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  272



>ref|XP_009356299.1| PREDICTED: uncharacterized protein LOC103947165 [Pyrus x bretschneideri]
Length=377

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 201/342 (59%), Positives = 227/342 (66%), Gaps = 34/342 (10%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             +EY++ALEEER KIQVFQRELPLCLELVTQAIE  KQQ+S TT   +   GQSECSEQT+
Sbjct  16    REYVKALEEERHKIQVFQRELPLCLELVTQAIERGKQQISDTT--ADYLHGQSECSEQTS  73

Query  409   SSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdssk  588
             S    EG V EEFIPLKR SS   DE++  +      N + D    DD            
Sbjct  74    S----EGHVFEEFIPLKRISSSDSDEDEVRESQEAKDNEKDDKITGDD------------  117

Query  589   dgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNGSGGAFHPFKREKSAG-T  762
                  KK DWLRS QLWN +   P  KEE P    V  VKRNG  GAF PF+REKS G T
Sbjct  118   ----GKKPDWLRSVQLWNTTPDAPL-KEELPRKALVMEVKRNG--GAFQPFQREKSIGKT  170

Query  763   SSPAVQ---TLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQ  933
             + P  +   +  +T++     SGG GG +KKEEK+ Q QRKQRR WSPELHRRFL ALQQ
Sbjct  171   NGPVAKEPYSAPATSSTTDTASGGSGGSNKKEEKDGQGQRKQRRNWSPELHRRFLHALQQ  230

Query  934   LGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqf-vvv  1110
             LGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP++  N +        VVV
Sbjct  231   LGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPTMHGNSNSSAPAPQFVVV  290

Query  1111  ggIWVpppeyaaamapppTSGEAATSNGIYAPVATTPKQTQQ  1236
             GGIWV PP+  AAMA    SGEAA  NGIYAP+A+TP    Q
Sbjct  291   GGIWV-PPQEYAAMAATTASGEAA--NGIYAPLASTPPAVAQ  329



>ref|XP_009336613.1| PREDICTED: uncharacterized protein LOC103929184 [Pyrus x bretschneideri]
Length=376

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 229/339 (68%), Gaps = 30/339 (9%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             +EY++ALEEE  KIQVF+RELPLC ELVT AIE  KQQ+S TT   +   GQSECS+QT+
Sbjct  16    REYVKALEEEMHKIQVFKRELPLCYELVTHAIERCKQQVSDTT--ADYMHGQSECSQQTS  73

Query  409   SSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdssk  588
             S    EG V EEFIPLKR SS   D EDDE    + A     DD     +          
Sbjct  74    S----EGHVFEEFIPLKRTSS--SDSEDDEVHESQEAKDNEKDDKIAGGDK---------  118

Query  589   dgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREKSAG-TS  765
                  KK DWLRS QLWN +   P  KEE P    V ++ N +GGAF PF++EKS G T+
Sbjct  119   -----KKSDWLRSVQLWNTTPDAPL-KEELPRKALV-MEVNRNGGAFQPFQKEKSIGKTN  171

Query  766   SPAVQ---TLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQL  936
              P  +   +  +T++     SG  G  +KKEEK+ Q QRKQRR WSPELHRRFL ALQQL
Sbjct  172   GPVAKQPSSAAATSSTTDTVSGSSGENNKKEEKDGQGQRKQRRNWSPELHRRFLNALQQL  231

Query  937   GGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfvvvgg  1116
             GGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP++R+N +    PQFVVVGG
Sbjct  232   GGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPTMRSNNNAAHAPQFVVVGG  291

Query  1117  IWVpppeyaaamapppTSGEAATSNGIYAPVATTPKQTQ  1233
             IWV PP+  AA+A    SGEAA +NGIYAPVA+TP  TQ
Sbjct  292   IWV-PPQDYAAVAATTASGEAA-NNGIYAPVASTPAVTQ  328



>gb|EYU29947.1| hypothetical protein MIMGU_mgv1a008281mg [Erythranthe guttata]
Length=379

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 230/363 (63%), Gaps = 63/363 (17%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
             ++Y EKM+RCQ+Y+  LE+ER KIQVFQRELPLCLELVTQAIEA KQQL G         
Sbjct  10    SDYSEKMQRCQDYVHGLEQERSKIQVFQRELPLCLELVTQAIEACKQQLHGQL-------  62

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRA-SSLSQDEEDDEQQSPKSANHRTdddddddn  555
               SECSEQT+S   D  PVLEEFIP+KRA SS   DE+D+E++  +S   + DDD     
Sbjct  63    --SECSEQTSS---DVVPVLEEFIPIKRAFSSFHSDEDDEEEEEQESKKLKNDDDSS---  114

Query  556   nnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNGSGGAFH  732
                            +KK DWLRS QLWN    D + KE+SP    V  VKRNG GGAFH
Sbjct  115   ---------------NKKSDWLRSVQLWNNQTPDLS-KEDSPRKVAVTEVKRNGGGGAFH  158

Query  733   PFKREKSA--------------GTSSPAVQTLDsttagvgngsggggggskkeeketQSQ  870
             PFK+EKS               G+  PA            + +   GGG+KKE+KE+QSQ
Sbjct  159   PFKKEKSTTTTTVAVVAAPPQEGSMPPA----------STSSTAETGGGNKKEDKESQSQ  208

Query  871   RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             RK RRCWSPELHRRFLQ+LQQLGGSH+ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR
Sbjct  209   RKSRRCWSPELHRRFLQSLQQLGGSHLATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  268

Query  1051  PTPSIRNNgsqqqgpq--fvvvggIWVpppeyaaamapppTSGEAAT----SNGIYAPVA  1212
             P      N +        FVVVGGIW+ P       A   TSGEAA+    S GIYAPVA
Sbjct  269   PNNQSMQNNNNNNQQAPQFVVVGGIWMQPEYATPMAAATTTSGEAASGVANSTGIYAPVA  328

Query  1213  TTP  1221
             + P
Sbjct  329   SLP  331



>ref|NP_564236.1| nitrate-inducible, GARP-type transcriptional repressor 1-like 
protein [Arabidopsis thaliana]
 gb|AAG41472.1|AF326890_1 unknown protein [Arabidopsis thaliana]
 gb|AAK00389.1|AF339707_1 unknown protein [Arabidopsis thaliana]
 gb|AAK49622.1|AF372906_1 At1g25550/F2J7_21 [Arabidopsis thaliana]
 gb|AAO11590.1| At1g25550/F2J7_21 [Arabidopsis thaliana]
 gb|AEE30641.1| myb-like transcription factor-like protein [Arabidopsis thaliana]
Length=344

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 224/351 (64%), Gaps = 46/351 (13%)
 Frame = +1

Query  190   AASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECN  369
             +   +Y +KM+RC EY+EALEEE++KIQVFQRELPLCLELVTQAIE+ +++LS ++    
Sbjct  6     SGDMDYTQKMKRCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIESCRKELSESSEHVG  65

Query  370   LNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
                GQSECSE+TTS  +  G V EEF+P+K  SS S DE D ++++ K+           
Sbjct  66    ---GQSECSERTTS--ECGGAVFEEFMPIK-WSSASSDETDKDEEAEKT-----------  108

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAF  729
                   +   +  +    KK DWLRS QLWNQS  DP P  + P    + VKR  S GAF
Sbjct  109   ------EMMTNENNDGDKKKSDWLRSVQLWNQS-PDPQPNNKKP--MVIEVKR--SAGAF  157

Query  730   HPFKREK-SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQ--RKQRRCWSPE  900
              PF++EK  A  S P ++ +  T+    + +    GG K+ E++ QS   RKQRRCWSPE
Sbjct  158   QPFQKEKPKAADSQPLIKAITPTSTTTTSSTAETVGGGKEFEEQKQSHSNRKQRRCWSPE  217

Query  901   LHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TPSIRNNg  1077
             LHRRFL ALQQLGGSHVATPKQIR+LMKVDGLTNDEVKSHLQKYRLHTRRP TP +R  G
Sbjct  218   LHRRFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRLHTRRPATPVVRTGG  277

Query  1078  sqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTPKQT  1230
                Q  QF+V+ GIWV                   T+N +YAPVAT P Q+
Sbjct  278   ENPQQRQFMVMEGIWV--------------PSHDTTNNRVYAPVATQPPQS  314



>gb|AAG50807.1|AC079281_9 hypothetical protein [Arabidopsis thaliana]
Length=343

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 224/351 (64%), Gaps = 46/351 (13%)
 Frame = +1

Query  190   AASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECN  369
             +   +Y +KM+RC EY+EALEEE++KIQVFQRELPLCLELVTQAIE+ +++LS ++    
Sbjct  5     SGDMDYTQKMKRCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIESCRKELSESSEHVG  64

Query  370   LNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
                GQSECSE+TTS  +  G V EEF+P+K  SS S DE D ++++ K+           
Sbjct  65    ---GQSECSERTTS--ECGGAVFEEFMPIK-WSSASSDETDKDEEAEKT-----------  107

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAF  729
                   +   +  +    KK DWLRS QLWNQS  DP P  + P    + VKR  S GAF
Sbjct  108   ------EMMTNENNDGDKKKSDWLRSVQLWNQS-PDPQPNNKKP--MVIEVKR--SAGAF  156

Query  730   HPFKREK-SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQ--RKQRRCWSPE  900
              PF++EK  A  S P ++ +  T+    + +    GG K+ E++ QS   RKQRRCWSPE
Sbjct  157   QPFQKEKPKAADSQPLIKAITPTSTTTTSSTAETVGGGKEFEEQKQSHSNRKQRRCWSPE  216

Query  901   LHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TPSIRNNg  1077
             LHRRFL ALQQLGGSHVATPKQIR+LMKVDGLTNDEVKSHLQKYRLHTRRP TP +R  G
Sbjct  217   LHRRFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRLHTRRPATPVVRTGG  276

Query  1078  sqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTPKQT  1230
                Q  QF+V+ GIWV                   T+N +YAPVAT P Q+
Sbjct  277   ENPQQRQFMVMEGIWV--------------PSHDTTNNRVYAPVATQPPQS  313



>ref|XP_008243179.1| PREDICTED: probable transcription factor GLK2 [Prunus mume]
Length=383

 Score =   276 bits (705),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 199/343 (58%), Positives = 226/343 (66%), Gaps = 41/343 (12%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             ++Y++ALEEER KIQVFQRELPLCLELVTQAIE  KQQLS TTT  +   GQSECSEQT+
Sbjct  15    RDYVKALEEERHKIQVFQRELPLCLELVTQAIERCKQQLSDTTT--DYMHGQSECSEQTS  72

Query  409   SSDDDEGPVLEEFIPLKRASSLSQDE-EDDEQQSPKSANHRTdddddddnnnngdssdss  585
             S    EG V EEFIPLKR SS   D+ E  E Q PK  +    + D              
Sbjct  73    S----EGLVFEEFIPLKRTSSSDSDDDEVQESQEPKINDKDKTNGDK-------------  115

Query  586   kdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNGSGGAFHPFKREKSAGT  762
                   KK DWLRSAQLWN +  DP  KEE P    V  VKRN  GGAF PF+REKS G 
Sbjct  116   ------KKSDWLRSAQLWNTT-PDPPLKEELPRKASVMEVKRN--GGAFQPFQREKSVGK  166

Query  763   SSPAVQTLDsttagvgngsgggg----ggskkeeketQSQRKQRRCWSPELHRRFLQALQ  930
             ++  V  + ++     + +           KKEEK+ Q QRKQRR WSPELHRRFL ALQ
Sbjct  167   TNRPVAKVPASAPATSSTTDTVSGGSGESLKKEEKDGQGQRKQRRNWSPELHRRFLHALQ  226

Query  931   QLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqf---  1101
             QLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP++ NN +     Q    
Sbjct  227   QLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPTMHNNNNSNSNTQAPQF  286

Query  1102  vvvggIWVpppeyaaamapppTSGEA---ATSNGIYAPVATTP  1221
             +VVGGIWV PP+  AA+A P  SGEA   A +NGIYAPVAT+P
Sbjct  287   LVVGGIWV-PPQDYAAVAAPTASGEAARVAAANGIYAPVATSP  328



>ref|XP_007223224.1| hypothetical protein PRUPE_ppa007222mg [Prunus persica]
 gb|EMJ24423.1| hypothetical protein PRUPE_ppa007222mg [Prunus persica]
Length=377

 Score =   273 bits (698),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 196/343 (57%), Positives = 225/343 (66%), Gaps = 41/343 (12%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             ++Y++ALEEER KIQVFQRELPLCLELVTQAIE  KQQLS TTT  +   GQSECSEQT+
Sbjct  9     RDYVKALEEERHKIQVFQRELPLCLELVTQAIERCKQQLSDTTT--DYMHGQSECSEQTS  66

Query  409   SSDDDEGPVLEEFIPLKRASSLSQDE-EDDEQQSPKSANHRTdddddddnnnngdssdss  585
             S    EG V EEFIPLKR SS   D+ E  E Q PK+ +    + D              
Sbjct  67    S----EGHVFEEFIPLKRTSSSDSDDDEVQESQEPKTNDKDKTNGDKI------------  110

Query  586   kdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNGSGGAFHPFKREKSAGT  762
                    K DWLRSAQLWN +  DP  K+E P    V  VKRN  GGAF PF+REKS G 
Sbjct  111   -------KSDWLRSAQLWNTT-PDPPLKDELPRKALVMEVKRN--GGAFQPFQREKSVGK  160

Query  763   SSPAVQTLDsttagvgngsgggg----ggskkeeketQSQRKQRRCWSPELHRRFLQALQ  930
             ++  V  + ++     + +           KKEEK+ Q QRKQRR WSPELHRRFL ALQ
Sbjct  161   TNRPVAKVPASAPATSSTTDTVSGGSGESHKKEEKDGQGQRKQRRNWSPELHRRFLHALQ  220

Query  931   QLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqf---  1101
             QLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP++ NN +     Q    
Sbjct  221   QLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPTMHNNNNSDNNTQAPQF  280

Query  1102  vvvggIWVpppeyaaamapppTSGEA---ATSNGIYAPVATTP  1221
             +VVGGIWV PP+  AA+A    SGEA   A +NGIYAPVAT+P
Sbjct  281   LVVGGIWV-PPQDYAAVAATTASGEATRVAAANGIYAPVATSP  322



>ref|XP_010527541.1| PREDICTED: uncharacterized protein LOC104804876 [Tarenaya hassleriana]
Length=326

 Score =   271 bits (694),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 165/299 (55%), Positives = 204/299 (68%), Gaps = 31/299 (10%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQL-SGTTTECNLNI  378
             +Y +KM+RC EY+EALEEER+KIQVFQRELPLCLELVTQAIEA ++++ SGT +  +   
Sbjct  8     DYAQKMQRCHEYVEALEEERKKIQVFQRELPLCLELVTQAIEACRREIISGTPS--DYVQ  65

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
             GQS+CSEQTTS  D  GPV EEFIP+KR+SS  +D E + ++S    + +   +  ++ +
Sbjct  66    GQSDCSEQTTS--DCGGPVFEEFIPIKRSSSCDEDGEHESRESENDGDEKISTNSGNNTD  123

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPF  738
                            KK DWLRS QLWNQS  DP PKE+  +  K  V+   +GGAF PF
Sbjct  124   K--------------KKSDWLRSVQLWNQS-PDPQPKEDQAAKMKTVVEVKRNGGAFQPF  168

Query  739   KREK----------SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRC  888
             ++EK           A TS+PA  +  + T G  +         K+ + +TQ+QRKQRRC
Sbjct  169   QKEKLVPKSNQQPVKATTSAPAPASSQAVTGGGKSELEEAQPQQKQTQTQTQAQRKQRRC  228

Query  889   WSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TPS  1062
             WSPELHRRFL ALQ LGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP TP+
Sbjct  229   WSPELHRRFLNALQHLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPATPA  287



>ref|XP_008339698.1| PREDICTED: uncharacterized protein LOC103402722 [Malus domestica]
Length=370

 Score =   273 bits (697),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 201/341 (59%), Positives = 230/341 (67%), Gaps = 40/341 (12%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             +EY++ALEEER KIQVFQRELP CLELVTQAIE  +QQ+S TT   +   GQSECSEQT+
Sbjct  16    REYVKALEEERNKIQVFQRELPJCLELVTQAIERCRQQISDTT--ADYLHGQSECSEQTS  73

Query  409   SSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdssk  588
             S    EG V EEFIPLKR SS S  +ED+ Q+S ++ +   DD                 
Sbjct  74    S----EGHVFEEFIPLKRISS-SDSDEDEVQESQEAKDTEKDD-----------------  111

Query  589   dgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNGSGGAFHPFKREKSAG-T  762
                  KK DWLRS QLWN +   P  KEE P    V  VKRNG  GAF PF+REKS G T
Sbjct  112   ----KKKPDWLRSVQLWNTTPDAPL-KEELPRKALVMEVKRNG--GAFQPFQREKSIGKT  164

Query  763   SSPAVQ---TLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQ  933
             + P  +   +  +T++     SGG GG +KKEEK+ Q QRKQRR WSPELHRRFL ALQQ
Sbjct  165   NGPVAKEPSSAPATSSTTDTASGGSGGSNKKEEKDGQGQRKQRRNWSPELHRRFLHALQQ  224

Query  934   LGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqf-vvv  1110
             LGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP++  N +        VVV
Sbjct  225   LGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPTMHGNSNSGAPAPQFVVV  284

Query  1111  ggIWVpppeyaaamapppTSGEAATSNGIYAPVATTPKQTQ  1233
             GGIWV PP+  AAMA    SGEAA  NGIYAP+A+TP  TQ
Sbjct  285   GGIWV-PPQEYAAMAATTASGEAA--NGIYAPLASTPAVTQ  322



>ref|XP_010265235.1| PREDICTED: uncharacterized protein LOC104603025 [Nelumbo nucifera]
Length=365

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 195/345 (57%), Positives = 229/345 (66%), Gaps = 43/345 (12%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N+ EKM+RCQ Y+EALEEERRKIQVFQRELPLCLELVTQAIE  +QQL+ T+TE     G
Sbjct  4     NFAEKMQRCQTYMEALEEERRKIQVFQRELPLCLELVTQAIETCRQQLA-TSTE--YFPG  60

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
              +ECSEQT+S    EGPVLEEFIPLKR+SS  ++EE ++  + K  N             
Sbjct  61    PTECSEQTSS----EGPVLEEFIPLKRSSSSEEEEELNKPNN-KDRN-------------  102

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                           KK DWL+S QLWNQ+   P  ++  P    V  K+  SGGAFHPF+
Sbjct  103   -------------DKKADWLKSVQLWNQAPDPPLKQDLGPKLSVVETKK--SGGAFHPFE  147

Query  742   RE-----KSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELH  906
             R+     K   TS  A  +    TA   + +      S+++ KE QS RK RRCWSPELH
Sbjct  148   RDTKRVTKPTATSVAAAPSTAQATATTSSTAETITDDSRRDGKEGQSHRKPRRCWSPELH  207

Query  907   RRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqq  1086
             RRFL ALQQLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+P+I +N   Q
Sbjct  208   RRFLNALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPAIHSN-GNQ  266

Query  1087  qgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTP  1221
             Q PQFVVVGG+WVPPP+YAA  A    +   A +NGIYAPVA  P
Sbjct  267   QTPQFVVVGGLWVPPPDYAAVTATKREANGVA-ANGIYAPVAPQP  310



>gb|AAM63125.1| unknown [Arabidopsis thaliana]
Length=330

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 219/342 (64%), Gaps = 46/342 (13%)
 Frame = +1

Query  217   MRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECS  396
             M+RC EY+EALEEE++KIQVFQRELPLCLELVTQAIE+ +++LS ++       GQSECS
Sbjct  1     MKRCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIESCRKELSESSEHVG---GQSECS  57

Query  397   EQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdss  576
             E+TTS  +  G V EEF+P+K  SS S DE D ++++ K+                 +  
Sbjct  58    ERTTS--ECGGAVFEEFMPIK-WSSASSDETDKDEEAEKT-----------------EMM  97

Query  577   dsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREK-S  753
              +  +    KK DWLRS QLWNQS  DP P  + P    + VKR  S GAF PF++EK  
Sbjct  98    TNENNDGDKKKSDWLRSVQLWNQS-PDPQPNNKKP--MVIEVKR--SAGAFQPFQKEKPK  152

Query  754   AGTSSPAVQTLDsttagvgngsggggggskkeeketQSQ--RKQRRCWSPELHRRFLQAL  927
             A  S P ++ +  T+    + +    GG K+ E++ QS   RKQRRCWSPELHRRFL AL
Sbjct  153   AADSQPLIKAITPTSTTTTSSTAETVGGGKEFEEQKQSHSNRKQRRCWSPELHRRFLHAL  212

Query  928   QQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TPSIRNNgsqqqgpqfv  1104
             QQLGGSHVATPKQIR+LMKVDGLTNDEVKSHLQKYRLHTRRP TP +R  G   Q  QF+
Sbjct  213   QQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRLHTRRPATPVVRTGGENPQQRQFM  272

Query  1105  vvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTPKQT  1230
             V+ GIWV                   T+N +YAPVA+ P Q+
Sbjct  273   VMEGIWV--------------PSHDTTNNRVYAPVASQPPQS  300



>ref|XP_010460352.1| PREDICTED: probable transcription factor GLK2 [Camelina sativa]
Length=358

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 220/358 (61%), Gaps = 53/358 (15%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y  KM+RC EY+EALEEE +KI VFQRELPLCLELVTQAIE+ +++LSG+++       
Sbjct  2     DYTHKMKRCHEYVEALEEEHKKILVFQRELPLCLELVTQAIESCRKELSGSSSMSEHVRS  61

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDD----EQQSPKSANHRTdddddd  549
             QSECSE+TTS       V EEFIP+K +SS S D E+D    +++  K+ N    D    
Sbjct  62    QSECSERTTSECGGVAAVFEEFIPIKWSSSSSSDHENDRDGADEKKIKTNNENNGDK---  118

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEES------PSNCKVGVKRN  711
                               KK DWLRS QLWNQS  DP PKE+        +   +GVKRN
Sbjct  119   ------------------KKSDWLRSVQLWNQS-PDPQPKEDDQVVNKQKAAAVIGVKRN  159

Query  712   GSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsgggg-----ggskkeeketQSQRK  876
              + GAF PF++EK    +  + Q L + T      S             ++ K++QS RK
Sbjct  160   -NAGAFQPFQKEKPNKANDHSPQPLKTITPTPTTTSSSTAETVGGKSEFEQLKQSQSSRK  218

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-  1053
             QRRCWSPELHRRFL ALQQLGGSHVATPKQIR+LMKVDGLTNDEVKSHLQKYRLHTRRP 
Sbjct  219   QRRCWSPELHRRFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRLHTRRPA  278

Query  1054  TPSIRNNgsqqqgpqf--vvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTP  1221
             TPS  N G  QQ  Q   +VV GIWV            P+S + AT+  +YAPVAT P
Sbjct  279   TPSSTNGGENQQQQQRQFMVVEGIWV------------PSSHDHATNTRVYAPVATQP  324



>gb|AES62046.2| myb-like transcription factor family protein [Medicago truncatula]
Length=378

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 171/344 (50%), Positives = 215/344 (63%), Gaps = 37/344 (11%)
 Frame = +1

Query  232   EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTS  411
             +YI+ALE+ERRKIQVF +ELPL LELVTQAIEA +QQLSGTTTE NLN GQSECSEQTTS
Sbjct  10    DYIQALEQERRKIQVFPKELPLSLELVTQAIEACRQQLSGTTTEYNLN-GQSECSEQTTS  68

Query  412   SDDDEGPVLEEFIPL-KRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdssk  588
             +D   GPVLEEFIP+ KRASS SQ+  DD +   +  +H+      D+            
Sbjct  69    TD---GPVLEEFIPIKKRASSYSQEVFDDVEDYDQHFHHKQQKLSLDNK-----------  114

Query  589   dgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNC--KVGVKRNG-SGGAFHPFKREKSAG  759
                  KK DWLRS QLWN   +DP+ +E+        + +KRNG  GGAFHPF +E    
Sbjct  115   -----KKSDWLRSVQLWN---SDPSSEEDVTKKAVPVLELKRNGCGGGAFHPFHKEDRVN  166

Query  760   TSSPAV------QTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQ  921
              ++  +       +           +        ++  E + +RKQRRCWS ELH+RFL+
Sbjct  167   NTTSELLSKGQPSSTGVAAVSSNAATVTSNNVENRKRDEKEEKRKQRRCWSQELHKRFLK  226

Query  922   ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqf  1101
             ALQQLGG+  ATPKQIRE+M VDGLTNDEVKSHLQKYRLHTRRP+ +   + + Q    F
Sbjct  227   ALQQLGGADCATPKQIREVMNVDGLTNDEVKSHLQKYRLHTRRPSSTNNESANSQTAAPF  286

Query  1102  vvvggIWVpppeyaaamapppTSGE---AATSNGIYAPVATTPK  1224
             V+VG I+V   +    +A   T+GE       +GIYAPVAT P+
Sbjct  287   VLVGNIFV-QQQEYGGVASSTTTGEMTKVVAPSGIYAPVATHPQ  329



>ref|XP_007143802.1| hypothetical protein PHAVU_007G102900g [Phaseolus vulgaris]
 gb|ESW15796.1| hypothetical protein PHAVU_007G102900g [Phaseolus vulgaris]
Length=383

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 227/358 (63%), Gaps = 44/358 (12%)
 Frame = +1

Query  205   YPEKMRRCQ----EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             + EK++R +    +YI+ALEEERRKIQVF +ELPL LELVTQAIEA KQQLSGTT+E NL
Sbjct  4     FTEKIQRLKMGFPDYIQALEEERRKIQVFCKELPLSLELVTQAIEACKQQLSGTTSEYNL  63

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLS----QDEEDDEQQSPKSANHRTddd  540
             N GQSECSE+TTS+   EGPVLEEFIP+K+ +S S    +D+ED+EQ S K +       
Sbjct  64    N-GQSECSERTTST---EGPVLEEFIPIKKRASSSPCCDEDDEDNEQHSLKQS-------  112

Query  541   ddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG---VKRN  711
                          +  +    +K DWLRS QLWN     P P  E  +  KV    +KR+
Sbjct  113   -----------VLNENNDSDKRKSDWLRSVQLWN-----PDPPAEEDATRKVPGMELKRS  156

Query  712   GS-GGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRC  888
             GS GGAFHPF +E+ A  ++ ++    + ++     +    G    E+   + QRKQRRC
Sbjct  157   GSIGGAFHPFHKEERAAKAAESL--CKAPSSTRVAAASSSAGELTPEKNLNEGQRKQRRC  214

Query  889   WSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIR  1068
             WS +LH+RFL ALQQLGG+  ATPKQIRELM VDGLTNDEVKSHLQKYRLHTRRP+P + 
Sbjct  215   WSQDLHKRFLHALQQLGGADSATPKQIRELMNVDGLTNDEVKSHLQKYRLHTRRPSPLV-  273

Query  1069  NNgsqqqgpqfvvvggIWVpppeyaaamapppTSG--EAATSNGIYAPVATTPKQTQQ  1236
             +N S  Q   FV+VG I+V  PEYAA      +      A   G+YAPVAT P    Q
Sbjct  274   HNSSSPQAAPFVLVGNIFVQSPEYAAVATSTASREVITVAAPGGVYAPVATHPTPVSQ  331



>ref|XP_010101716.1| Two-component response regulator [Morus notabilis]
 gb|EXB89380.1| Two-component response regulator [Morus notabilis]
Length=373

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 167/286 (58%), Positives = 187/286 (65%), Gaps = 32/286 (11%)
 Frame = +1

Query  232   EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTS  411
             EY+E LEEER+KIQVFQ+ELP CLELVTQ IE  KQQLSGT T      GQSECSEQT+S
Sbjct  10    EYVETLEEERKKIQVFQKELPYCLELVTQTIERCKQQLSGTATTTECLHGQSECSEQTSS  69

Query  412   SDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPK---SANHRTdddddddnnnngdssds  582
                 EG V EEFIPLKR SS ++D+ED+EQQSPK   S N+    D+             
Sbjct  70    ----EGLVFEEFIPLKRTSSDNEDDEDEEQQSPKRKTSINNNNMADNK------------  113

Query  583   skdgkVSKKQDWLRSAQLWNQSFTDPTP-KEESPSNCKV-GVKRNGSGGAFHPFKREKSA  756
                    KK DWLRS QLWN    DP P KE+ P    V  VKRN  GGAF PF+REK+ 
Sbjct  114   -------KKADWLRSVQLWNNPTPDPAPQKEDVPKKASVLEVKRN--GGAFQPFQREKNV  164

Query  757   GTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQL  936
             G  + +     +        +    G    E +  QSQRKQRR WSPELH+RFL ALQQL
Sbjct  165   GKRNGSPAP--APAPASAPAASSSSGKRDDETEGQQSQRKQRRNWSPELHKRFLNALQQL  222

Query  937   GGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             GGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP+  NN
Sbjct  223   GGSHTATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPATPNN  268



>ref|XP_010532126.1| PREDICTED: uncharacterized protein LOC104808201 [Tarenaya hassleriana]
Length=360

 Score =   268 bits (684),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 157/291 (54%), Positives = 195/291 (67%), Gaps = 30/291 (10%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             +KM+RC EY+EALEEER+KI VFQRELPLCLELVT AIEA +++LSGT+++ N+  GQS+
Sbjct  13    QKMQRCHEYVEALEEERKKIHVFQRELPLCLELVTHAIEACRRELSGTSSD-NM-YGQSD  70

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
             CS+QTTS     GPV EEF+P+KR SS  +D E + ++     + +  ++  +D +    
Sbjct  71    CSDQTTSECAGTGPVFEEFLPIKRISSCGEDGEHESREPENDGDLKIANNTGNDTDK---  127

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREK  750
                        KK DWLRS QLWNQS  DP  KE + +   V VKRNG  GAF PF++EK
Sbjct  128   -----------KKSDWLRSVQLWNQS-PDPPSKEAAETTLVVEVKRNG--GAFQPFQKEK  173

Query  751   S----------AGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPE  900
                          TSSP   T  S++     G        ++++ +TQ+ RKQRRCWSPE
Sbjct  174   KPLPKSNKQPVKTTSSPPAPTA-SSSTAETGGGKRVSEKVEEQQHQTQTHRKQRRCWSPE  232

Query  901   LHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             LHRRFL ALQQLGGS+ ATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRP
Sbjct  233   LHRRFLNALQQLGGSNAATPKQIRELMKVDGLTNDEVKSHLQKYRLHKRRP  283



>ref|XP_010109406.1| Two-component response regulator [Morus notabilis]
 gb|EXC22244.1| Two-component response regulator [Morus notabilis]
Length=377

 Score =   268 bits (684),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 167/297 (56%), Positives = 190/297 (64%), Gaps = 32/297 (11%)
 Frame = +1

Query  202   NYPEKMRRC----QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECN  369
             ++ EKM       +EY+E LEEER+KIQVFQ+ELP CLELVTQ IE  KQQLSGT T   
Sbjct  2     DFSEKMNYSGLGFREYVETLEEERKKIQVFQKELPYCLELVTQTIERCKQQLSGTATTTE  61

Query  370   LNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
                GQSECSEQT+S    EG V EEF+PLKR SS ++D+ED+EQQSPK            
Sbjct  62    CLHGQSECSEQTSS----EGRVFEEFLPLKRTSSDNEDDEDEEQQSPK------------  105

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTP-KEESPSNCKVG-VKRNGSGG  723
                    S ++       KK DWLRS QLWN    DP P KE+ P    V  VKRNG  G
Sbjct  106   ----RKTSINNDNMADNKKKADWLRSVQLWNNPTPDPAPQKEDVPKKASVMEVKRNG--G  159

Query  724   AFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPEL  903
             AF PF+REK+ G  + +              +    G    E +  QSQRKQRR WSPEL
Sbjct  160   AFQPFQREKNVGKRNGSPAP----APASAPAASSSSGKRDDETEGQQSQRKQRRNWSPEL  215

Query  904   HRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             H+RFL ALQQLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP+  NN
Sbjct  216   HKRFLNALQQLGGSHTATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPATPNN  272



>ref|XP_010499096.1| PREDICTED: probable transcription factor GLK2 [Camelina sativa]
Length=357

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 222/352 (63%), Gaps = 44/352 (13%)
 Frame = +1

Query  205   YPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQ  384
             Y  KM+RC EY+EALEEE +KI VFQRELPLCLELVTQAIE+ +++LSG+++       Q
Sbjct  4     YAHKMKRCHEYVEALEEEHKKILVFQRELPLCLELVTQAIESCRKELSGSSSMSEHVRSQ  63

Query  385   SECSEQTTSSDDDEGP-VLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             SECSE+TTS     G  V EEFIP+K +S  S D E+D       A+ +    ++++N +
Sbjct  64    SECSERTTSECGGGGAAVFEEFIPIKWSSPSSSDHENDRD----GADEKKIKMNNENNGD  119

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEES-------PSNCKVGVKRNGSG  720
                           KK DWLRS QLWNQS  DP PKE+         +   + VKRN + 
Sbjct  120   K-------------KKSDWLRSVQLWNQS-PDPQPKEDDHQVINKQKAAAVIEVKRN-NA  164

Query  721   GAFHPFKREK-SAGTSSP---AVQTLDsttagvgngsggggggskkeeketQSQRKQRRC  888
             GAF PF+++K  A   SP      T   TT         GG    ++ K++QS RKQRRC
Sbjct  165   GAFQPFQKDKPKANERSPQPLKTITPTPTTTSSSTAETVGGKSEFEQLKQSQSSRKQRRC  224

Query  889   WSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TPSI  1065
             WSPELHRRFL ALQQLGGSHVATPKQIR+LMKVDGLTNDEVKSHLQKYRLHTRRP TPS 
Sbjct  225   WSPELHRRFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRLHTRRPATPSS  284

Query  1066  RNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTP  1221
              N G  QQ  QF+VV GIWV            P+S + AT+  +YAP+AT P
Sbjct  285   TNGGENQQQRQFMVVEGIWV------------PSSHDRATNTRVYAPIATQP  324



>ref|XP_010551302.1| PREDICTED: probable transcription factor GLK2 [Tarenaya hassleriana]
Length=344

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 196/287 (68%), Gaps = 25/287 (9%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y +KM++C EY+EALE E++KIQVFQRELPLCLELVTQAIEA +++LSG++    +N G
Sbjct  2     DYAQKMQKCHEYVEALEGEQKKIQVFQRELPLCLELVTQAIEACRRELSGSSASEYVN-G  60

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QS+CSEQTTS  +  G + EEFIP+KR SS    EED E +S KS N   +       N+
Sbjct  61    QSDCSEQTTS--ECGGHLFEEFIPIKRRSSC---EEDGEHESRKSENDGDEKMAKSSGND  115

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK--VGVKRNGSGGAFHP  735
               D           KK DWLRS QLWNQS  DP P+E+        V VKRNG  GAF P
Sbjct  116   ITDK----------KKSDWLRSVQLWNQS-PDPRPEEDQAPKMATVVEVKRNG--GAFQP  162

Query  736   FKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRF  915
             F+++K +  S+P+     +      + +   G G +  EK  Q +RKQRRCWSPELHRRF
Sbjct  163   FQKDKPSPKSNPS----PTPALTTSSSTAETGAGKRDAEKLEQQKRKQRRCWSPELHRRF  218

Query  916   LQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             L ALQQLGGS+VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP 
Sbjct  219   LNALQQLGGSYVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPV  265



>ref|XP_010066739.1| PREDICTED: uncharacterized protein LOC104453813 [Eucalyptus grandis]
 gb|KCW64762.1| hypothetical protein EUGRSUZ_G02343 [Eucalyptus grandis]
Length=394

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 193/368 (52%), Positives = 230/368 (63%), Gaps = 50/368 (14%)
 Frame = +1

Query  214   KMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSEC  393
             + ++ Q Y+EALEEE+RKIQVFQRELPLCLELV QAIEA +QQLSGTTTE N+  GQS+C
Sbjct  10    QFQKMQSYMEALEEEKRKIQVFQRELPLCLELVNQAIEACRQQLSGTTTE-NMQGGQSQC  68

Query  394   SEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngds  573
             S+QT++    +GPVLEEFIP+KR  S S DEE++E     S  H+    D   +      
Sbjct  69    SDQTST----DGPVLEEFIPIKRICSASDDEEEEEGDEQHS--HKKSKSDGAADK-----  117

Query  574   sdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREKS  753
                       KK DWLRSAQLWNQ+   PTP++E+       V+   +GGAF PF RE  
Sbjct  118   ----------KKSDWLRSAQLWNQTTPGPTPQQEATPRRVSVVEVTRNGGAFQPFLRENK  167

Query  754   AGTSSPAVQTLDsttagvgn--------------------gsggggggskkeeketQSQR  873
                 +      D       +                     + G G G++KEEKE Q+QR
Sbjct  168   IPVKTSTSHDSDRQNKNNQSLIELHSPVPVTATSSTADTTTANGNGNGTRKEEKEGQTQR  227

Query  874   KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             KQRRCWSPELHRRFLQ+LQQLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP
Sbjct  228   KQRRCWSPELHRRFLQSLQQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  287

Query  1054  TPSIRNNgsqqqgpqfvvvggIWV--pppeyaaamapppTSGEAA----TSNGIYAPVAT  1215
             +P+   +G   Q PQFVVVGGIWV  P     AA      SGEAA    +S G+YAP+A 
Sbjct  288   SPT--QHGGNSQAPQFVVVGGIWVPPPEYATVAASTTTTASGEAARPSPSSAGVYAPLAI  345

Query  1216  TPKQTQQN  1239
                  Q+N
Sbjct  346   AAAPQQRN  353



>ref|XP_006391112.1| hypothetical protein EUTSA_v10018737mg [Eutrema salsugineum]
 gb|ESQ28398.1| hypothetical protein EUTSA_v10018737mg [Eutrema salsugineum]
Length=371

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 160/307 (52%), Positives = 198/307 (64%), Gaps = 45/307 (15%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
             T++ +KM+RC EY+EALEEE++KI VFQRELPLCLELVT+ IEAY+++LSGT++E  ++ 
Sbjct  8     TDHAQKMQRCHEYVEALEEEQKKILVFQRELPLCLELVTKTIEAYRKELSGTSSE-QIH-  65

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
             GQS+CSEQTTS     GPVLEEFIP+K+ SSLSQ+EED E +S +   +  D        
Sbjct  66    GQSDCSEQTTSFCG--GPVLEEFIPIKK-SSLSQEEEDGEHESLEPEINNVDK-------  115

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPS------NCKVGVKRNGSG  720
                            KK DWLRS QLWN    D  P E S S        KV   +  +G
Sbjct  116   ---------------KKSDWLRSVQLWNNPSPDLNPIEVSDSERVVAKKAKVVEVKPNNG  160

Query  721   GAFHPFKREKS-----AGTSSPAVQTLDsttagvgn-------gsggggggskkeeketQ  864
             GAF PF++EK           PAV+   +T++                    K+++ ++Q
Sbjct  161   GAFQPFRKEKKRVFLETQPPQPAVKAATTTSSTTETTGGGKSDSVKAREEQMKQDQSQSQ  220

Query  865   SQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHT  1044
             + RKQRRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLHT
Sbjct  221   THRKQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLHT  280

Query  1045  RRPTPSI  1065
             RRP  S+
Sbjct  281   RRPATSV  287



>ref|XP_006305123.1| hypothetical protein CARUB_v10009492mg [Capsella rubella]
 gb|EOA38021.1| hypothetical protein CARUB_v10009492mg [Capsella rubella]
Length=370

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 172/366 (47%), Positives = 222/366 (61%), Gaps = 49/366 (13%)
 Frame = +1

Query  190   AASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECN  369
             + + +Y   M+RC +Y+EALE+E++KIQVFQRELPLCLELVTQAIE+ +++LS +++   
Sbjct  4     SGAMDYTNNMKRCHDYVEALEQEQKKIQVFQRELPLCLELVTQAIESCRKELSESSSMSE  63

Query  370   LNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
                 QSECSE+TTS   D  PV EEFIP+K  SS S D  D +  + +  + +T+ D++ 
Sbjct  64    HARSQSECSERTTSECGDAAPVFEEFIPIKWTSS-SSDANDKDHVADRDESIKTNSDNNA  122

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEE----SPSNCKVGVKRNGS  717
               +               KK DWLRS QLWNQS  DP PK++    +     + VKRN +
Sbjct  123   GGDK--------------KKSDWLRSVQLWNQSSPDPQPKDDQVIINKKAAVIEVKRN-N  167

Query  718   GGAFHPFKREKS------AGTSSP-----AVQTLDsttagvgngsggggggskkeeketQ  864
              GAF PF+++K           SP     A+    +TT+     +  GG    ++ K++ 
Sbjct  168   AGAFQPFQKDKPNKKANYNNDDSPQPLIKAITPTPTTTSSSTAETTVGGKNEFEQLKQSP  227

Query  865   SQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHT  1044
             S RKQRRCWSPELHRRFL ALQQLGGSHVATPKQIR+LMKVDGLTNDEVKSHLQKYRLHT
Sbjct  228   SNRKQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRLHT  287

Query  1045  RRPTPSIRNNgsqqqgpqf-----vvvggIWVpppeyaaamapppTSGEAATSNGIYAPV  1209
             RRP   +  N  +    Q      +VV GIWV              S   AT+  +YAPV
Sbjct  288   RRPATPVSTNVGENTQQQQQQRQFMVVEGIWV-------------PSSHDATNGRVYAPV  334

Query  1210  ATTPKQ  1227
             AT P+Q
Sbjct  335   ATQPQQ  340



>ref|XP_010477909.1| PREDICTED: probable transcription factor GLK1 [Camelina sativa]
Length=362

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 223/357 (62%), Gaps = 48/357 (13%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y  KM+RC EY+EALEEE +KI VFQRELPLCLELVTQAIE+ +++LSG+++       
Sbjct  3     DYTHKMKRCHEYVEALEEEHKKILVFQRELPLCLELVTQAIESCRKELSGSSSMSEHVRS  62

Query  382   QSECSEQTTSSDDDEGP-VLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
              SECSE+TTS     G  V EEFIP+K +SS S D E+D+  +                 
Sbjct  63    PSECSERTTSECGGGGAAVFEEFIPIKWSSSSSSDHENDKDGA-----------------  105

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEES-------PSNCKVGVKRNGS  717
             +      +++     KK DWLRS QLWNQS  DP PKE+         +   + VKRN +
Sbjct  106   DEKKMKMNNESNGDKKKSDWLRSVQLWNQS-PDPQPKEDDHQVINKKAAAAVIEVKRN-N  163

Query  718   GGAFHPFKREK--SAGTSSP-AVQTLDsttagvgngsggggggskkeeketQSQ--RKQR  882
              GAF PF++EK   A   SP  ++T+  T     + +    GG  + E+  QS   RKQR
Sbjct  164   AGAFQPFQKEKPNKANDHSPQPLKTISPTPTTTSSSTAETVGGKSEFEQLKQSHSNRKQR  223

Query  883   RCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TP  1059
             RCWSPELHRRFL ALQQLGGSHVATPKQIR+LMKVDGLTNDEVKSHLQKYRLHTRRP TP
Sbjct  224   RCWSPELHRRFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRLHTRRPATP  283

Query  1060  SIRN---NgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTP  1221
             S  N   N  QQQ  QF+VV GIWV            P+S + AT+  +YAP+AT P
Sbjct  284   SSTNGGENPQQQQQRQFMVVEGIWV------------PSSHDRATNTRVYAPIATQP  328



>emb|CBY88799.1| myb transcription factor [Humulus lupulus]
Length=378

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 186/334 (56%), Positives = 217/334 (65%), Gaps = 42/334 (13%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             ++YIEALE ER+KIQVFQRELPLCLELV Q I+  KQQLSGTTT   ++ GQSECSEQT+
Sbjct  9     EKYIEALEVERKKIQVFQRELPLCLELVNQTIDRCKQQLSGTTTTEYVH-GQSECSEQTS  67

Query  409   SSDDDEGPVLEEFIPLKRASSLSQDEEDDEQ-QSPKSANHRTdddddddnnnngdssdss  585
             S       V EEF+PLKR+SS   DEE++++ QSPK                       +
Sbjct  68    SEGHH---VFEEFMPLKRSSSSDNDEEEEKEEQSPK---------------------RQT  103

Query  586   kdgkVSKKQDWLRSAQLWNQSFTDPTP----KEESPSNCKVG-VKRNGSGGAFHPFKREK  750
              +    KK DWLRS QLWN   T P P    KEE P    V  VK NG  GAF PF+REK
Sbjct  104   TEKDNKKKSDWLRSVQLWN---TTPDPVSSQKEELPKKASVTEVKSNG--GAFQPFQREK  158

Query  751   SAG----TSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFL  918
             + G    TSS A  T    +A   + +  GG   ++E+K+ Q+QRKQRR WSPELH+RFL
Sbjct  159   NVGKPNGTSSSAC-TTPVASAPATSSNADGGSNKREEDKDGQNQRKQRRNWSPELHKRFL  217

Query  919   QALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpq  1098
              ALQQLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP P+I NN    Q PQ
Sbjct  218   NALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPNPAIHNN-GNAQTPQ  276

Query  1099  fvvvggIWVpppeyaaamapppTSGEAATSNGIY  1200
              V VGGIW+ P EYAA +     S   A +NG+Y
Sbjct  277   VVFVGGIWMQPSEYAATVGGSSDSPNGAATNGVY  310



>ref|XP_003556266.1| PREDICTED: uncharacterized protein LOC100789537 [Glycine max]
Length=381

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 219/351 (62%), Gaps = 42/351 (12%)
 Frame = +1

Query  205   YPEKMRRCQ----EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             + EKM+  +    +YI+ LEEERRKIQVF +ELPL LELVTQAIE  KQQLSGTT+E NL
Sbjct  4     FTEKMQSLKMGFPDYIQTLEEERRKIQVFSKELPLSLELVTQAIETCKQQLSGTTSEYNL  63

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQD--EEDDEQQSPKSANHRTddddd  546
             N G SECSEQTTS+   EGPVLEEFIP+K+ +S S    +EDDEQ S K    + +++ D
Sbjct  64    N-GHSECSEQTTST---EGPVLEEFIPIKKRASSSSPCCDEDDEQHSHKQRVSKENNNSD  119

Query  547   ddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSN--CKVGVKRNGSG  720
                                +K DWLRS QLWN    DP P EE  S   C V +KR+GSG
Sbjct  120   K------------------RKSDWLRSVQLWN---PDP-PAEEDVSKIVCGVELKRSGSG  157

Query  721   G-AFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSP  897
             G AF P  +E+   +S P+     + ++     +        +E+   + QRK RRCWS 
Sbjct  158   GGAFQPLHKEEK--SSKPSESLSKTPSSTPVVATSSSAVEPAEEKSLNEGQRKLRRCWSQ  215

Query  898   ELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNg  1077
             +LH+RFL ALQQLGG+  ATPKQIRELM VDGLTNDEVKSHLQKYRLHTRRP P + N+ 
Sbjct  216   DLHKRFLHALQQLGGADSATPKQIRELMNVDGLTNDEVKSHLQKYRLHTRRPIPMVHNS-  274

Query  1078  sqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNG---IYAPVATTP  1221
             S  Q   FV+VG I+V      AA+A    S E AT      IYAPVAT P
Sbjct  275   SDPQAAPFVLVGNIFV-QSPEYAAVATSTASREVATVAAPARIYAPVATHP  324



>gb|KHN00905.1| Two-component response regulator ARR18 [Glycine soja]
Length=381

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 219/351 (62%), Gaps = 42/351 (12%)
 Frame = +1

Query  205   YPEKMRRCQ----EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             + EKM+  +    +YI+ LEEERRKIQVF +ELPL LELVTQAIE  KQQLSGTT+E NL
Sbjct  4     FTEKMQSLKMGFPDYIQTLEEERRKIQVFSKELPLSLELVTQAIETCKQQLSGTTSEYNL  63

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQD--EEDDEQQSPKSANHRTddddd  546
             N G SECSEQTTS+   EGPVLEEFIP+K+ +S S    +EDDEQ S K    + +++ D
Sbjct  64    N-GHSECSEQTTST---EGPVLEEFIPIKKRASSSSPCCDEDDEQHSHKQRVSKENNNSD  119

Query  547   ddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSN--CKVGVKRNGSG  720
                                +K DWLRS QLWN    DP P EE  S   C V +KR+GSG
Sbjct  120   K------------------RKSDWLRSVQLWN---PDP-PAEEDVSKIVCGVELKRSGSG  157

Query  721   G-AFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSP  897
             G AF P  +E+   +S P+     + ++     +        +E+   + QRK RRCWS 
Sbjct  158   GGAFQPLHKEEK--SSKPSESLSKTPSSTPVVATSSSAVEPAEEKSLNEGQRKLRRCWSQ  215

Query  898   ELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNg  1077
             +LH+RFL ALQQLGG+  ATPKQIRELM VDGLTNDEVKSHLQKYRLHTRRP P + N+ 
Sbjct  216   DLHKRFLHALQQLGGADSATPKQIRELMNVDGLTNDEVKSHLQKYRLHTRRPIPMVHNS-  274

Query  1078  sqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNG---IYAPVATTP  1221
             S  Q   FV+VG I+V      AA+A    S E AT      IYAPVAT P
Sbjct  275   SDPQTAPFVLVGNIFV-QSPEYAAVATSTASREVATVAAPARIYAPVATHP  324



>ref|XP_008445641.1| PREDICTED: probable transcription factor GLK2 [Cucumis melo]
Length=373

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 210/332 (63%), Gaps = 43/332 (13%)
 Frame = +1

Query  232   EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTS  411
             ++ + LE+ERRK+ +FQRELPLCL+LV+ AI+  +QQLSGTTTE      QSECSEQT+S
Sbjct  20    DFADTLEQERRKVLMFQRELPLCLQLVSHAIDCCRQQLSGTTTENR----QSECSEQTSS  75

Query  412   SDDDEGPVLEEFIPLKR--ASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdss  585
                D GPVLEEFIP+ R   S   + E+ ++   P   N                     
Sbjct  76    ---DIGPVLEEFIPINRNGVSDFEKTEKINKNDDPDLNNLNLA-----------------  115

Query  586   kdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREKSAGTS  765
                      DWLRSAQLWNQ+   P   ++ P N  V V+ N +GGAF PF++EK+ G  
Sbjct  116   -------PSDWLRSAQLWNQTSDPPPLNQDLPENTPV-VEVNRNGGAFRPFQKEKTGGCG  167

Query  766   SPAVQTLDsttagvgngsggggg----gskkeeketQSQRKQRRCWSPELHRRFLQALQQ  933
                  +  S  A     S          S++EEKE Q+QRKQRRCWSPELHRRFL ALQQ
Sbjct  168   GGGGASSSSPPAPAAETSSTTETGSGGSSRREEKEAQNQRKQRRCWSPELHRRFLHALQQ  227

Query  934   LGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfvvvg  1113
             LGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP+I NN      PQF+VVG
Sbjct  228   LGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPTIHNN-ESGHTPQFLVVG  286

Query  1114  gIWVpppeyaaamapppTSGE---AATSNGIY  1200
             GIWV P    AA++   +SGE   AAT+NGIY
Sbjct  287   GIWV-PAAEYAAVSTTTSSGEVVSAATTNGIY  317



>gb|KGN45944.1| hypothetical protein Csa_6G031440 [Cucumis sativus]
Length=371

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 177/330 (54%), Positives = 212/330 (64%), Gaps = 39/330 (12%)
 Frame = +1

Query  232   EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTS  411
             ++ + LE+ERRK+ +FQRELPLCL LV+ AI+  +QQLSGTTTE      QSECSEQT+S
Sbjct  20    DFADTLEQERRKVLMFQRELPLCLHLVSHAIDCCRQQLSGTTTENR----QSECSEQTSS  75

Query  412   SDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdsskd  591
                D GPVLEEFIP+ R         D E+    + NH +D ++ +              
Sbjct  76    ---DMGPVLEEFIPINRNGV-----SDFEKTEKNNKNHDSDLNNLNLA------------  115

Query  592   gkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREKSAGTSSP  771
                    DWLRSAQLWNQ+   P   ++ P N  V V+ N +GGAF PF++EK+ G    
Sbjct  116   -----PSDWLRSAQLWNQTSDPPPLNQDLPENTPV-VEVNRNGGAFRPFQKEKTGGGGGG  169

Query  772   AVQTLDsttagvgngsggggg----gskkeeketQSQRKQRRCWSPELHRRFLQALQQLG  939
                +  S  A     S          S++EEKE Q+QRKQRRCWSPELHRRFL ALQQLG
Sbjct  170   GGASSSSPPAPAAETSSTTETGSGGSSRREEKEAQNQRKQRRCWSPELHRRFLHALQQLG  229

Query  940   GSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfvvvggI  1119
             GSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP+I NN      PQF+VVGGI
Sbjct  230   GSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPTIHNN-EGGHAPQFLVVGGI  288

Query  1120  WVpppeyaaamapppTSGE---AATSNGIY  1200
             WV P    AA++   +SGE   AAT+NGIY
Sbjct  289   WV-PAAEYAAVSTTTSSGEVVSAATTNGIY  317



>ref|XP_004164475.1| PREDICTED: uncharacterized LOC101210056 [Cucumis sativus]
Length=375

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 213/337 (63%), Gaps = 49/337 (15%)
 Frame = +1

Query  232   EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTS  411
             ++ + LE+ERRK+ +FQRELPLCL LV+ AI+  +QQLSGTTTE      QSECSEQT+S
Sbjct  20    DFADTLEQERRKVLMFQRELPLCLHLVSHAIDCCRQQLSGTTTENR----QSECSEQTSS  75

Query  412   SDDDEGPVLEEFIPLKR--ASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdss  585
                D GPVLEEFIP+ R   S   + E++++       N                     
Sbjct  76    ---DMGPVLEEFIPINRNGVSDFEKTEKNNKNDDSDLNNLNLA-----------------  115

Query  586   kdgkVSKKQDWLRSAQLWNQSFTDPTP-----KEESPSNCKVGVKRNGSGGAFHPFKREK  750
                      DWLRSAQLWNQ+ +DP P     KE+ P N  V V+ N +GGAF PF++EK
Sbjct  116   -------PSDWLRSAQLWNQT-SDPPPLNQVKKEDLPENTPV-VEVNRNGGAFRPFQKEK  166

Query  751   SAGTSSPAVQTLDsttagvgngsggggg----gskkeeketQSQRKQRRCWSPELHRRFL  918
             + G       +  S  A     S          S++EEKE Q+QRKQRRCWSPELHRRFL
Sbjct  167   TGGGGGGGGASSSSPPAPAAETSSTTETGSGGSSRREEKEAQNQRKQRRCWSPELHRRFL  226

Query  919   QALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpq  1098
              ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP+I NN      PQ
Sbjct  227   HALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPTIHNN-EGGHAPQ  285

Query  1099  fvvvggIWVpppeyaaamapppTSGE---AATSNGIY  1200
             F+VVGGIWV P    AA++   +SGE   AAT+NGIY
Sbjct  286   FLVVGGIWV-PAAEYAAVSTTTSSGEVVSAATTNGIY  321



>ref|XP_004150535.1| PREDICTED: uncharacterized protein LOC101210056 [Cucumis sativus]
Length=375

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 185/351 (53%), Positives = 222/351 (63%), Gaps = 54/351 (15%)
 Frame = +1

Query  232   EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTS  411
             ++ + LE+ERRK+ +FQRELPLCL LV+ AI+  +QQLSGTTTE      QSECSEQT+S
Sbjct  7     DFADTLEQERRKVLMFQRELPLCLHLVSHAIDCCRQQLSGTTTENR----QSECSEQTSS  62

Query  412   SDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdsskd  591
                D GPVLEEFIP+ R         D E+    + NH +D ++ +              
Sbjct  63    ---DMGPVLEEFIPINRNGV-----SDFEKTEKNNKNHDSDLNNLNLA------------  102

Query  592   gkVSKKQDWLRSAQLWNQSFTDPTP-----KEESPSNCKVGVKRNGSGGAFHPFKREKSA  756
                    DWLRSAQLWNQ+ +DP P     KE+ P N  V V+ N +GGAF PF++EK+ 
Sbjct  103   -----PSDWLRSAQLWNQT-SDPPPLNQVKKEDLPENTPV-VEVNRNGGAFRPFQKEKTG  155

Query  757   GTSSPAVQTLDsttagvgngsggggg----gskkeeketQSQRKQRRCWSPELHRRFLQA  924
             G       +  S  A     S          S++EEKE Q+QRKQRRCWSPELHRRFL A
Sbjct  156   GGGGGGGASSSSPPAPAAETSSTTETGSGGSSRREEKEAQNQRKQRRCWSPELHRRFLHA  215

Query  925   LQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfv  1104
             LQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP+I NN      PQF+
Sbjct  216   LQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPTIHNN-EGGHAPQFL  274

Query  1105  vvggIWVpppeyaaamapppTSGE---AATSNGIYA---------PVATTP  1221
             VVGGIWV P    AA++   +SGE   AAT+NGIYA         P+ T+P
Sbjct  275   VVGGIWV-PAAEYAAVSTTTSSGEVVSAATTNGIYAPVVAAAAPQPLVTSP  324



>ref|XP_007153350.1| hypothetical protein PHAVU_003G028000g [Phaseolus vulgaris]
 gb|ESW25344.1| hypothetical protein PHAVU_003G028000g [Phaseolus vulgaris]
Length=373

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 180/342 (53%), Positives = 217/342 (63%), Gaps = 33/342 (10%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             +EYIEALEEERRKIQVF +ELPL LELVTQAIE  +QQLSGT TE NLN GQSECSEQT+
Sbjct  9     REYIEALEEERRKIQVFPKELPLSLELVTQAIEGCRQQLSGTVTEYNLN-GQSECSEQTS  67

Query  409   SSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdssk  588
             +   DEGPV EEFIP+K+ +  SQD          S     +++++D+  +   S    K
Sbjct  68    T---DEGPVFEEFIPIKKMA--SQD----------SVEEEEEEENEDEVEDEQHSHQHRK  112

Query  589   dgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNGSGGAFHPFKREKSAGT-  762
                  +K DWLRS QLWN +   P  KE+ P    V  VKRN  GGAF PF+RE+ +G  
Sbjct  113   TTSDKRKSDWLRSVQLWNPN--PPPTKEDVPRKANVVEVKRN--GGAFQPFQREEKSGVV  168

Query  763   ------SSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQA  924
                    + A+    S+       S G      K+E++ Q+QRKQRRCWS ELH+RFL A
Sbjct  169   DGKVNNYASAIGKAPSSPPVPATSSTGPVRIDSKKEEKGQAQRKQRRCWSQELHKRFLHA  228

Query  925   LQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfv  1104
             LQQLGG+  ATPKQIRELMKVDGLTNDEVKSHLQK+RLHTRR +P + NN +  Q     
Sbjct  229   LQQLGGADSATPKQIRELMKVDGLTNDEVKSHLQKFRLHTRR-SPIMHNN-ASSQAAPLF  286

Query  1105  vvggIWVpppeyaaamapppTSGEAAT---SNGIYAPVATTP  1221
             +VG I+V PPEY A      + GE  T     GIYAPVA  P
Sbjct  287   LVGNIFVQPPEYGAVATSSASGGELTTVTAPTGIYAPVAAHP  328



>ref|XP_004297138.1| PREDICTED: uncharacterized protein LOC101305064 [Fragaria vesca 
subsp. vesca]
Length=392

 Score =   256 bits (653),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 217/347 (63%), Gaps = 37/347 (11%)
 Frame = +1

Query  235   YIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTSS  414
             Y++ALE E++KIQVFQRELPLCLELVTQAIE  KQ++S  + E     GQSECSEQT+S 
Sbjct  17    YVKALEVEKQKIQVFQRELPLCLELVTQAIERCKQEISDNSIE--YRHGQSECSEQTSS-  73

Query  415   DDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdsskdg  594
                EG V EEFIPLKR+SS   D+E+ E+                 +  N ++     + 
Sbjct  74    ---EGHVFEEFIPLKRSSSSDSDDEELEESD---------------HLRNKNNDKDKSNS  115

Query  595   kVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK-VGVKRNGSGGAFHPFKREKSAGTSSP  771
                KK DWLRS QLWN +   P  KEE P     V VKRN  GGAFHPF++EKS G ++ 
Sbjct  116   GDKKKSDWLRSVQLWNTTPDVPQ-KEELPRKASVVEVKRN--GGAFHPFQKEKSIGNTNG  172

Query  772   AVQTLDsttagvgngsggg---gggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGG  942
             AV    ++     + +       GG   ++++ + QRKQRR WSPELHRRFL ALQQLGG
Sbjct  173   AVAKSPASAPATSSTADTVSGGSGGGNSKKEDKEGQRKQRRNWSPELHRRFLHALQQLGG  232

Query  943   SHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfv----vv  1110
             SH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP+I NN +            VV
Sbjct  233   SHTATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPTIHNNNNNNNSNAQAPQFVVV  292

Query  1111  ggIWV-pppeyaaamapppTSGE----AATSNGIYAPVATTPKQTQQ  1236
             GGIWV P    AA  A    SGE    AA +NGIYAPVA+ P    Q
Sbjct  293   GGIWVPPQDYNAAVAAANTASGEATRVAAAANGIYAPVASAPSAVTQ  339



>ref|XP_002893418.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69677.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=340

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 213/345 (62%), Gaps = 53/345 (15%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ +KM+RC EY+EALE E++KIQVFQRELPLCLELVTQAIE+ +++LS ++       G
Sbjct  11    DHTQKMKRCHEYVEALEVEQKKIQVFQRELPLCLELVTQAIESCRKELSESSEHVG---G  67

Query  382   QSECSEQTTSS-DDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
             QSECSE+TTS      G V EEFIP+K  SS S DE D ++++  +   +          
Sbjct  68    QSECSERTTSECGGGGGVVFEEFIPIKWTSS-SSDETDKDEEAENNGGDK----------  116

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK---VGVKRNGSGGAF  729
                            KK DWLRS QLWNQS  DP PKE+   N K   + VKRN   GAF
Sbjct  117   ---------------KKSDWLRSVQLWNQS-PDPKPKEDHVINKKTNVIEVKRNA--GAF  158

Query  730   HPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQ--RKQRRCWSPEL  903
              PF++EK     S  ++T+  T+    + +    GG  + E   QS   RKQRRCWSPEL
Sbjct  159   QPFQKEKPKAADSQPLKTITPTSTTTSSSTAETVGGKSELEDPKQSHSNRKQRRCWSPEL  218

Query  904   HRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TPSIRNNgs  1080
             HRRFL ALQQLGGSHVATPKQIR+LMKVDGLTNDEVKSHLQKYRLHTRRP TP I N G 
Sbjct  219   HRRFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRLHTRRPATPVITNAGE  278

Query  1081  qqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
               Q  QF+VV GIWV                   T+N +YAPVA 
Sbjct  279   NPQQRQFMVVEGIWV--------------PSHDTTNNRVYAPVAV  309



>ref|XP_010263063.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Nelumbo nucifera]
Length=366

 Score =   252 bits (643),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 160/291 (55%), Positives = 188/291 (65%), Gaps = 33/291 (11%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             NY E   +CQ Y+EALEEERRKIQVF+RELPLCLELVTQAIE  +QQL+ TTTE     G
Sbjct  12    NYTENAHKCQTYMEALEEERRKIQVFRRELPLCLELVTQAIETCRQQLA-TTTE--YFPG  68

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QSECSE+T+S      PVLEEFIPLKR  S    EED+E   PK+ +             
Sbjct  69    QSECSEETSSE----APVLEEFIPLKRCFS---SEEDEESNKPKNED-------------  108

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                      + K  KK DWL+S QLWNQ   DP+  ++      V   + G GGAFHPF+
Sbjct  109   --------INEKPGKKADWLKSVQLWNQD-PDPSLNQDLSRKPSVIESKKG-GGAFHPFQ  158

Query  742   REKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQ  921
             R+      S  V    + T    + +     G  + E ++QS RK RRCWSPELHRRFL 
Sbjct  159   RDDKLTAPSITVIPSSAQTTAAISSTADTINGDNRGEDKSQSNRKPRRCWSPELHRRFLH  218

Query  922   ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             ALQQLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+P+++NN
Sbjct  219   ALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPAVQNN  269



>gb|KHN37827.1| Two-component response regulator ARR18 [Glycine soja]
Length=371

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 207/345 (60%), Gaps = 50/345 (14%)
 Frame = +1

Query  232   EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTS  411
             +YI+ LEEERRKIQVF +ELPL LELVTQAIEA KQQLSGTT+E NLN G SECSEQTTS
Sbjct  5     DYIQTLEEERRKIQVFSKELPLSLELVTQAIEACKQQLSGTTSEYNLN-GHSECSEQTTS  63

Query  412   SDDDEGPVLEEFIPLKRASSLS---------QDEEDDEQQSPKSANHRTdddddddnnnn  564
             +   EGPVLEEFIP+K+ +S S          ++   +Q+  K  N+             
Sbjct  64    T---EGPVLEEFIPIKKMASSSPFCDEEDEDDEQHSHKQRVSKENNNSDK----------  110

Query  565   gdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG---VKRNGSGG-AFH  732
                          +K DWLRS QLWN     P P  E   N KV    +KR+G+GG AF 
Sbjct  111   -------------RKSDWLRSVQLWN-----PDPPAEEDVNKKVPGLELKRSGNGGGAFQ  152

Query  733   PFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRR  912
             PF +E+    +S ++    + ++     +         E+   + QRKQRRCWS +LH+R
Sbjct  153   PFHKEERGAKTSESLS--KAPSSTSVAAASSSAAEPAAEKSLNEGQRKQRRCWSQDLHKR  210

Query  913   FLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqg  1092
             FL ALQQLGG+  ATPKQIRE+M VDGLTNDEVKSHLQKYRLHTRRP+P + N+ + Q  
Sbjct  211   FLHALQQLGGADTATPKQIREIMNVDGLTNDEVKSHLQKYRLHTRRPSPMVHNSSNPQAA  270

Query  1093  pqfvvvggIWVpppeyaaamapppT--SGEAATSNGIYAPVATTP  1221
             P  +V   I+V  PEYAA      +      A   GIYAPVAT P
Sbjct  271   PFVLVGN-IFVQSPEYAAVATSTASREVATVAAPAGIYAPVATHP  314



>ref|XP_006415885.1| hypothetical protein EUTSA_v10008115mg [Eutrema salsugineum]
 gb|ESQ34238.1| hypothetical protein EUTSA_v10008115mg [Eutrema salsugineum]
Length=342

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 170/347 (49%), Positives = 202/347 (58%), Gaps = 51/347 (15%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y  KM+RC +Y+EALE+E++KIQVFQRELPLCLELVTQ I++ +++LS  +T      G
Sbjct  9     DYTLKMKRCHDYVEALEQEQKKIQVFQRELPLCLELVTQEIQSCRKELSEFSTTSEQVHG  68

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QSECSE+TTS   D   V EEF+P+K  SS S + E   + +         D        
Sbjct  69    QSECSERTTSESGDGAAVFEEFMPIKLNSSSSNEHESTCEPNKDDGAENNGDK-------  121

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                           KK DWLRS QLWNQ      PKE+  +   V  KRNG  GAF PF 
Sbjct  122   --------------KKSDWLRSVQLWNQ------PKEDQTTTVVVDGKRNG--GAFQPFH  159

Query  742   REKSA------GTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPEL  903
             +EK          S P      + T         G     +  K +Q  RKQRRCWSPEL
Sbjct  160   KEKPVVAAAAKADSQPVKAITPTPTTSSSTAETVGSKREPENHKHSQMHRKQRRCWSPEL  219

Query  904   HRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TPSIRNNgs  1080
             HRRFL ALQQLGGSHVATPKQIR+LMKV+GLTNDEVKSHLQKYRLHTRRP TP++ N G 
Sbjct  220   HRRFLHALQQLGGSHVATPKQIRDLMKVNGLTNDEVKSHLQKYRLHTRRPATPAMTNGGE  279

Query  1081  qqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTP  1221
               Q PQF+VV GIWV              S +AA  N +YAPVA  P
Sbjct  280   NPQQPQFMVVEGIWV-------------PSHDAA--NRVYAPVAVQP  311



>ref|XP_010263055.1| PREDICTED: uncharacterized protein LOC104601429 isoform X1 [Nelumbo 
nucifera]
Length=369

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 160/295 (54%), Positives = 187/295 (63%), Gaps = 38/295 (13%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             NY E   +CQ Y+EALEEERRKIQVF+RELPLCLELVTQAIE  +QQL+ TTTE     G
Sbjct  12    NYTENAHKCQTYMEALEEERRKIQVFRRELPLCLELVTQAIETCRQQLA-TTTE--YFPG  68

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QSECSE+T+S      PVLEEFIPLKR  S    EED+E   PK+ +             
Sbjct  69    QSECSEETSSE----APVLEEFIPLKRCFS---SEEDEESNKPKNED-------------  108

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTP----KEESPSNCKVGVKRNGSGGAF  729
                      + K  KK DWL+S QLWNQ   DP P      +  S     ++    GGAF
Sbjct  109   --------INEKPGKKADWLKSVQLWNQ---DPDPSLNQNLQDLSRKPSVIESKKGGGAF  157

Query  730   HPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHR  909
             HPF+R+      S  V    + T    + +     G  + E ++QS RK RRCWSPELHR
Sbjct  158   HPFQRDDKLTAPSITVIPSSAQTTAAISSTADTINGDNRGEDKSQSNRKPRRCWSPELHR  217

Query  910   RFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             RFL ALQQLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+P+++NN
Sbjct  218   RFLHALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPAVQNN  272



>gb|KFK41291.1| hypothetical protein AALP_AA2G110900 [Arabis alpina]
Length=357

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 155/306 (51%), Positives = 187/306 (61%), Gaps = 53/306 (17%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
              +Y +KM++C EY+EALEEE++KIQVFQRELPLCLELVTQAIEA +++LS T+ + +  +
Sbjct  8     IDYAKKMQKCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIEACRKELSNTSEQTH--V  65

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
             GQSECSEQTTS     G V EEFIP+KR      +EED E +S                 
Sbjct  66    GQSECSEQTTSVCGG-GHVFEEFIPIKR------NEEDGEHES-----------------  101

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGS-------  717
                            KK DWLRS QLWN S  DP PK+ S S+  V V +          
Sbjct  102   ---------TPPPPEKKSDWLRSVQLWNPS-PDPNPKDVSDSDRVVLVAKKAKVVEVKPK  151

Query  718   GGAFHPFKREKS--AGTSSPAVQTL--------DsttagvgngsggggggskkeeketQS  867
              GAF PF +EK     T  P V +          S+T   G          ++++ ++Q+
Sbjct  152   SGAFKPFLKEKQRVLETQPPVVNSALVPVPATTTSSTTETGGVDKEREEALQRDQSQSQT  211

Query  868   QRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTR  1047
              RKQRRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLHTR
Sbjct  212   HRKQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLHTR  271

Query  1048  RPTPSI  1065
             RP  S+
Sbjct  272   RPATSV  277



>ref|XP_003536313.1| PREDICTED: probable transcription factor GLK2-like [Glycine max]
Length=383

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 169/358 (47%), Positives = 210/358 (59%), Gaps = 54/358 (15%)
 Frame = +1

Query  205   YPEKMRRCQ----EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             + EKM   +    +YI+ LEEERRKIQVF +ELPL LELVTQAIEA KQQLSGT +E NL
Sbjct  4     FTEKMHSLKMGFPDYIQTLEEERRKIQVFSKELPLSLELVTQAIEACKQQLSGTASEYNL  63

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLS---------QDEEDDEQQSPKSANH  525
             N G SECSEQTTS+   EGPVLEEFIP+K+ +S S          ++   +Q+  K  N+
Sbjct  64    N-GHSECSEQTTST---EGPVLEEFIPIKKMASSSPFCDEEDEDDEQHSHKQRVSKENNN  119

Query  526   RTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG--  699
                                       +K DWLRS QLWN     P P  E   N KV   
Sbjct  120   SDK-----------------------RKSDWLRSVQLWN-----PDPPAEEDVNKKVPGL  151

Query  700   -VKRNGSGG-AFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQR  873
              +KR+G+GG AF PF +E+    +S ++    + ++     +         E+   +  R
Sbjct  152   ELKRSGNGGGAFQPFHKEERGAKTSESLS--KAPSSTSVAAASSSAAEPAAEKSLNEGHR  209

Query  874   KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             KQRRCWS +LH+RFL ALQQLGG+  ATPKQIRE+M VDGLTNDEVKSHLQKYRLHTRRP
Sbjct  210   KQRRCWSQDLHKRFLHALQQLGGADTATPKQIREIMNVDGLTNDEVKSHLQKYRLHTRRP  269

Query  1054  TPSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppT--SGEAATSNGIYAPVATTP  1221
             +P + N+ + Q  P  +V   I+V  PEYAA      +      A   GIYAPVAT P
Sbjct  270   SPMVHNSSNPQAAPFVLVGN-IFVQSPEYAAVATSTASREVATVAAPAGIYAPVATHP  326



>ref|XP_003516846.1| PREDICTED: probable transcription factor GLK2-like [Glycine max]
 gb|KHN32268.1| Two-component response regulator ARR18 [Glycine soja]
Length=379

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 183/371 (49%), Positives = 218/371 (59%), Gaps = 53/371 (14%)
 Frame = +1

Query  208   PEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQS  387
             P KM   Q YIEALEEERRKIQVF +ELPL LELVTQAIEA +QQL+GT  E NLN GQS
Sbjct  9     PLKMGFLQ-YIEALEEERRKIQVFPKELPLSLELVTQAIEACRQQLAGTVAEYNLN-GQS  66

Query  388   ECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnng  567
             ECSEQT++    +GPV EEFIPLK+ +S     +D  ++  +   H         +    
Sbjct  67    ECSEQTST----DGPVFEEFIPLKKRAS-----QDSVEEEDEDEEHFHKHKKTATDK---  114

Query  568   dssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEES---PSNCKVG-VKRNGSGGAFHP  735
                         KK DWLRS QLWN    +P P +E    P    V  VKRNG  GAF P
Sbjct  115   ------------KKSDWLRSVQLWN---PNPPPTKEDVVVPRKTDVVEVKRNG--GAFQP  157

Query  736   FKREKSAGTS-------SPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWS  894
             F+RE+ +G +       + A+    S+       S G      K+E++ Q+QRKQRRCWS
Sbjct  158   FQREEKSGDAKASINNDASAIGKAPSSPPVPATSSTGPVRVENKKEEKGQAQRKQRRCWS  217

Query  895   PELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
              ELH+RFL ALQQLGG+  ATPKQIRELMKVDGLTNDEVKSHLQK+RLHTRR +P I NN
Sbjct  218   QELHKRFLHALQQLGGADSATPKQIRELMKVDGLTNDEVKSHLQKFRLHTRR-SPIIHNN  276

Query  1075  gsqqqgpqfvvvggIWVpppeyaaamapppTSGE-------AATSNGIYAPVATTPKQTQ  1233
              +  Q     +VG I+V PPEYAA       SGE            GIYAPVA  P    
Sbjct  277   -ASSQAGPLFLVGNIFVQPPEYAAVATTSTASGEELTTVTTTTAPTGIYAPVAAHPPAV-  334

Query  1234  QNRTIPFSGEK  1266
                T+P   +K
Sbjct  335   -THTLPIMKQK  344



>ref|NP_564938.1| nitrate-inducible, GARP-type transcriptional repressor 1-like 
protein [Arabidopsis thaliana]
 gb|AAL36242.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14180.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34826.1| nitrate-inducible, GARP-type transcriptional repressor 1-like 
protein [Arabidopsis thaliana]
Length=354

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 178/366 (49%), Positives = 219/366 (60%), Gaps = 63/366 (17%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y +KM++C EY+EALEEE++KIQVFQRELPLCLELVTQAIEA +++LSGTTT  +    
Sbjct  6     DYAKKMQKCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIEACRKELSGTTTTTS----  61

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQ------SPKSANHRTdddd  543
               +CSEQTTS     GPV EEFIP+K+ SSL ++ +++E++      SP+  N+      
Sbjct  62    -EQCSEQTTSVCG--GPVFEEFIPIKKISSLCEEVQEEEEEDGEHESSPELVNN------  112

Query  544   dddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGG  723
                                 KK DWLRS QLWN S  D  PKEE  +     V+     G
Sbjct  113   --------------------KKSDWLRSVQLWNHS-PDLNPKEERVAKKAKVVEVKPKSG  151

Query  724   AFHPFKREK---------SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQ--  870
             AF PF++              +S PA  T  +T    G       G  ++  ++ QSQ  
Sbjct  152   AFQPFQKRVLETDLQPAVKVASSMPATTTSSTTETCGGKSDLIKAGDEERRIEQQQSQSH  211

Query  871   --RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHT  1044
               RKQRRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLHT
Sbjct  212   THRKQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLHT  271

Query  1045  RRP--TPSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT-  1215
             RRP  T     +   QQ PQFVVVGGIWV       +    P   + A   G+YAPVA  
Sbjct  272   RRPAATSVAAQSTGNQQQPQFVVVGGIWV------PSSQDFPPPSDVANKGGVYAPVAVA  325

Query  1216  -TPKQT  1230
              +PK++
Sbjct  326   QSPKRS  331



>gb|AAD49976.1|AC008075_9 F24J5.9 [Arabidopsis thaliana]
Length=353

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 178/366 (49%), Positives = 219/366 (60%), Gaps = 63/366 (17%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y +KM++C EY+EALEEE++KIQVFQRELPLCLELVTQAIEA +++LSGTTT  +    
Sbjct  5     DYAKKMQKCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIEACRKELSGTTTTTS----  60

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQ------SPKSANHRTdddd  543
               +CSEQTTS     GPV EEFIP+K+ SSL ++ +++E++      SP+  N+      
Sbjct  61    -EQCSEQTTSVCG--GPVFEEFIPIKKISSLCEEVQEEEEEDGEHESSPELVNN------  111

Query  544   dddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGG  723
                                 KK DWLRS QLWN S  D  PKEE  +     V+     G
Sbjct  112   --------------------KKSDWLRSVQLWNHS-PDLNPKEERVAKKAKVVEVKPKSG  150

Query  724   AFHPFKREK---------SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQ--  870
             AF PF++              +S PA  T  +T    G       G  ++  ++ QSQ  
Sbjct  151   AFQPFQKRVLETDLQPAVKVASSMPATTTSSTTETCGGKSDLIKAGDEERRIEQQQSQSH  210

Query  871   --RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHT  1044
               RKQRRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLHT
Sbjct  211   THRKQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLHT  270

Query  1045  RRP--TPSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT-  1215
             RRP  T     +   QQ PQFVVVGGIWV       +    P   + A   G+YAPVA  
Sbjct  271   RRPAATSVAAQSTGNQQQPQFVVVGGIWV------PSSQDFPPPSDVANKGGVYAPVAVA  324

Query  1216  -TPKQT  1230
              +PK++
Sbjct  325   QSPKRS  330



>gb|KHN12830.1| Two-component response regulator ARR18 [Glycine soja]
Length=371

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 217/353 (61%), Gaps = 47/353 (13%)
 Frame = +1

Query  205   YPEKMRRCQ----EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             + EKM+  +    EYIEALEEER+KIQVF +ELPL LELVTQAIEA +QQL GT  E NL
Sbjct  3     FAEKMQPLKMGFREYIEALEEERKKIQVFPKELPLSLELVTQAIEACRQQLCGTVAEYNL  62

Query  373   NIGQSECSEQTTSSDDDEGPVLEEF-IPL-KRASSLSQDEEDDEQQSPKSANHRTddddd  546
             N  QSECSEQT++    +GPV EEF IP+ K+AS  S +E+DDE+ S K     TD    
Sbjct  63    N-AQSECSEQTST----DGPVFEEFIIPIKKKASQASVEEDDDEEHSHKHTKTTTD----  113

Query  547   ddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK-VGVKRNGSGG  723
                                KK DWLRS QLWN +   PT ++  P     V VKRNG GG
Sbjct  114   ------------------KKKSDWLRSVQLWNPN-PPPTKEDVVPRKTNVVEVKRNG-GG  153

Query  724   AFHPFKREKSAGTS-------SPAVQTLDsttagvgngsggggggskkeeketQSQRKQR  882
             AF PF+RE+ +G S       + A+    S+                K+E++  +QRKQR
Sbjct  154   AFQPFQREEKSGVSKANNNNEASAIGKAPSSPPVPATSYTEPVRVDSKKEEKGDAQRKQR  213

Query  883   RCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             RCWS ELH+RFL ALQQLGG+  ATPKQIRELMKVDGLTNDEVKSHLQK+RLHTRR +P 
Sbjct  214   RCWSQELHKRFLHALQQLGGADSATPKQIRELMKVDGLTNDEVKSHLQKFRLHTRR-SPI  272

Query  1063  IRNNgsqqqgpqfvvvggIWVpppeyaaamap--ppTSGEAATSNGIYAPVAT  1215
             I N+ +  Q     +VG I+V PPEYA + A     T+   A   GIYAPVA 
Sbjct  273   IHNS-ASSQAGSLFLVGNIFVQPPEYATSSASGGELTTATPAAPTGIYAPVAA  324



>ref|XP_003518679.1| PREDICTED: transcription factor LUX-like [Glycine max]
Length=371

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 218/353 (62%), Gaps = 47/353 (13%)
 Frame = +1

Query  205   YPEKMRRCQ----EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             + EKM+  +    EYIEALEEER+KIQVF +ELPL LELVTQAIEA +QQL GT  E NL
Sbjct  3     FAEKMQPLKMGFREYIEALEEERKKIQVFPKELPLSLELVTQAIEACRQQLCGTVAEYNL  62

Query  373   NIGQSECSEQTTSSDDDEGPVLEEF-IPL-KRASSLSQDEEDDEQQSPKSANHRTddddd  546
             N  QSECSEQT++    +GPV EEF IP+ K+AS  S +E+DDE+ S K     TD    
Sbjct  63    N-AQSECSEQTST----DGPVFEEFIIPIKKKASQASVEEDDDEEHSHKHTKTTTD----  113

Query  547   ddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNGSGG  723
                                KK DWLRS QLWN +   PT ++  P    V  VKRNG GG
Sbjct  114   ------------------KKKSDWLRSVQLWNPN-PPPTKEDVVPRKTNVVEVKRNG-GG  153

Query  724   AFHPFKREKSAGTS-------SPAVQTLDsttagvgngsggggggskkeeketQSQRKQR  882
             AF PF+RE+ +G S       + A+    S+         G      K+E++  +QRKQR
Sbjct  154   AFQPFQREEKSGVSKANNNNEASAIGKAPSSPPVPATSYTGPVRVDSKKEEKGDAQRKQR  213

Query  883   RCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             RCWS ELH+RFL ALQQLGG+  ATPKQIRELMKVDGLTNDEVKSHLQK+RLHTRR +P 
Sbjct  214   RCWSQELHKRFLHALQQLGGADSATPKQIRELMKVDGLTNDEVKSHLQKFRLHTRR-SPI  272

Query  1063  IRNNgsqqqgpqfvvvggIWVpppeyaaamap--ppTSGEAATSNGIYAPVAT  1215
             I N+ +  Q     +VG I+V PPEYA + A     T+   A   GIYAPVA 
Sbjct  273   IHNS-ASSQAGSLFLVGNIFVQPPEYATSSASGGELTTATPAAPTGIYAPVAA  324



>ref|XP_010916475.1| PREDICTED: uncharacterized protein LOC105041278 [Elaeis guineensis]
Length=356

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 167/343 (49%), Positives = 201/343 (59%), Gaps = 50/343 (15%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             E+ RRCQEY+EALEEERRKIQVFQRELPLCL+LV QAIE+ + Q+               
Sbjct  5     ERARRCQEYVEALEEERRKIQVFQRELPLCLQLVNQAIESIRMQMG--------------  50

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
              SE+T + +    PVLEEFIPLK  SS  ++E+    +                      
Sbjct  51    SSEETVTDE----PVLEEFIPLKPTSSSIEEEKGGSME----------------------  84

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREK  750
                     +  KK DWLRS QLWNQ      PK E P    + V     GGAF PF REK
Sbjct  85    ----INQERSDKKPDWLRSVQLWNQDPDLSLPKAEPPKK-PIAVNAKKIGGAFRPFDREK  139

Query  751   SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQ  930
                       +  +  +    G  G G   K +E ++QS RK RRCWSPELHRRF+ ALQ
Sbjct  140   HVPAPV---PSAAAPASSTTVGGDGDGEKEKDKEGQSQSHRKARRCWSPELHRRFVHALQ  196

Query  931   QLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqf-vv  1107
             QLGGSH ATPKQIRE+MKVDGLTNDEVKSHLQKYRLHTRRP+ +++N+ +        VV
Sbjct  197   QLGGSHAATPKQIREMMKVDGLTNDEVKSHLQKYRLHTRRPSSAVQNSSTSSPPTPQFVV  256

Query  1108  vggIWV-pppeyaaamapppTSGEAATSNGIYAPVATTPKQTQ  1233
             VGGIWV PP   AAA A  PT G  A+ +GIYAPVA+ P  ++
Sbjct  257   VGGIWVPPPDYAAAAAAAQPTDGAGASPSGIYAPVASLPSDSR  299



>gb|ACU19314.1| unknown [Glycine max]
Length=371

 Score =   244 bits (623),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 217/353 (61%), Gaps = 47/353 (13%)
 Frame = +1

Query  205   YPEKMRRCQ----EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             + EKM+  +    EYIEALEEER+KIQVF +ELPL LELVTQAIEA +QQL GT  E NL
Sbjct  3     FAEKMQPLKMGFREYIEALEEERKKIQVFPKELPLSLELVTQAIEACRQQLCGTVAEYNL  62

Query  373   NIGQSECSEQTTSSDDDEGPVLEEF-IPL-KRASSLSQDEEDDEQQSPKSANHRTddddd  546
             N  QSECSEQT++    +GPV EEF IP+ K+AS  S +E+DDE+ S K     TD    
Sbjct  63    N-AQSECSEQTST----DGPVFEEFIIPIKKKASQASVEEDDDEEHSHKHTKTTTD----  113

Query  547   ddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNGSGG  723
                                KK DWLRS QLWN +   PT ++  P    V  VKRNG GG
Sbjct  114   ------------------KKKSDWLRSVQLWNPN-PPPTKEDVVPRKTNVVEVKRNG-GG  153

Query  724   AFHPFKREKSAGTS-------SPAVQTLDsttagvgngsggggggskkeeketQSQRKQR  882
             AF PF+RE+ +G S       + A+    S+         G      K+E++  +QRKQR
Sbjct  154   AFQPFQREEKSGVSKANNNNEASAIGKAPSSPPVPATSYTGPVRVDSKKEEKGDAQRKQR  213

Query  883   RCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             RCWS ELH+RFL ALQQLGG+  ATPKQ RELMKVDGLTNDEVKSHLQK+RLHTRR +P 
Sbjct  214   RCWSQELHKRFLHALQQLGGADFATPKQTRELMKVDGLTNDEVKSHLQKFRLHTRR-SPI  272

Query  1063  IRNNgsqqqgpqfvvvggIWVpppeyaaamap--ppTSGEAATSNGIYAPVAT  1215
             I N+ +  Q     +VG I+V PPEYA + A     T+   A   GIYAPVA 
Sbjct  273   IHNS-ASSQAGSLFLVGNIFVQPPEYATSSAFGGELTTATPAAPTGIYAPVAA  324



>ref|XP_010926495.1| PREDICTED: transcription factor LUX isoform X1 [Elaeis guineensis]
Length=347

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 205/342 (60%), Gaps = 50/342 (15%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
              ++ E+ RR QEY+EALEEERRKI+VFQRELPLCL+LVTQAIE  +           + I
Sbjct  1     MDFAERARRYQEYVEALEEERRKIEVFQRELPLCLQLVTQAIEGIR-----------IQI  49

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
             G SE  E  T     +GPVLEEFIPLK  SS  ++E+    +  +  +            
Sbjct  50    GSSE--EMVT-----DGPVLEEFIPLKPTSSSIEEEKGGLMEIEQERS------------  90

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPF  738
                            KK DWLRS QLWNQ      PK E P    + V    S GAFHPF
Sbjct  91    --------------EKKPDWLRSVQLWNQETDHSLPKGEPPKK-PIAVNAKKSSGAFHPF  135

Query  739   KREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFL  918
             +REK             + ++    G GGGG   K +E ++Q  RK RRCWSPELH RFL
Sbjct  136   EREKHVPAVP----AGAAASSSTVGGGGGGGEKEKDKEGQSQPPRKARRCWSPELHCRFL  191

Query  919   QALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpq  1098
               L QLGGSH ATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRP P+++++ +      
Sbjct  192   HVLDQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLHARRPNPAVQSSSAGSPPAP  251

Query  1099  f-vvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTP  1221
               VVVGG+WVPPP+YAAA A  P+ G  A+SNG+YAPVA+ P
Sbjct  252   QFVVVGGLWVPPPDYAAAAAAQPSDGAGASSNGVYAPVASLP  293



>gb|AAM65539.1| unknown [Arabidopsis thaliana]
Length=344

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 176/361 (49%), Positives = 215/361 (60%), Gaps = 63/361 (17%)
 Frame = +1

Query  217   MRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECS  396
             M++C EY+EALEEE++KIQVFQRELPLCLELVTQAIEA +++LSGTTT  +      +CS
Sbjct  1     MQKCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIEACRKELSGTTTTTS-----EQCS  55

Query  397   EQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQ------SPKSANHRTdddddddnn  558
             EQTTS     GPV EEFIP+K+ SSL ++ +++E++      SP+  N+           
Sbjct  56    EQTTSVCG--GPVFEEFIPIKKISSLCEEVQEEEEEDGEHESSPELVNN-----------  102

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPF  738
                            KK DWLRS QLWN S  D  PKEE  +     V+     GAF PF
Sbjct  103   ---------------KKSDWLRSVQLWNHS-PDLNPKEERVAKKAKVVEVKPKSGAFQPF  146

Query  739   KREK---------SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQ----RKQ  879
             ++              +S PA  T  +T    G       G  ++  ++ QSQ    RKQ
Sbjct  147   QKRVLETDLQPAVKVASSMPATTTSSTTETCGGKSDLIKAGDEERRIEQQQSQSHTHRKQ  206

Query  880   RRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP--  1053
             RRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLHTRRP  
Sbjct  207   RRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLHTRRPAA  266

Query  1054  TPSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT--TPKQ  1227
             T     +   QQ PQFVVVGGIWV       +    P   + A   G+YAPVA   +PK+
Sbjct  267   TSVAAQSTGNQQQPQFVVVGGIWV------PSSQDFPPPSDVANKGGVYAPVAVAQSPKR  320

Query  1228  T  1230
             +
Sbjct  321   S  321



>dbj|BAI63587.1| MYB-type transcription factor [Lotus japonicus]
Length=351

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 159/299 (53%), Positives = 190/299 (64%), Gaps = 44/299 (15%)
 Frame = +1

Query  208   PEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQS  387
             P KM   +EYI+ALEEER+KIQVF RELPL LELVTQAIEA +QQLSGTTT+ NLN GQS
Sbjct  9     PHKMGS-REYIQALEEERKKIQVFPRELPLSLELVTQAIEACRQQLSGTTTDYNLNNGQS  67

Query  388   ECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnng  567
             ECS QT++ D   GPV EEF P+K+ ++   DE+D++    +  +++             
Sbjct  68    ECSGQTSTED---GPVFEEFFPMKKRAAPDCDEKDEDDDDDELHSYK-------------  111

Query  568   dssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-VKRNGSGGAFHPFKR  744
                         KK DWLRS QLWN + +  T KE+ P    V  VKRN  GGAFHPF R
Sbjct  112   ------------KKSDWLRSVQLWNPNPS--TTKEDLPRKTNVVEVKRN--GGAFHPFHR  155

Query  745   EKSA-GTSSPAVQTLDs--------ttagvgngsggggggskkeeketQSQRKQRRCWSP  897
             E+S  G +S  V              T+  G        G  K +++ Q+QRKQRRCWS 
Sbjct  156   EESGVGKASNVVSAACKAPSSPPVPATSSTGPVRVDSNDGGSKRDEKGQAQRKQRRCWSQ  215

Query  898   ELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             ELH+RFL ALQQLGG  VATPKQIRE MKVDGLTNDEVKSHLQK+RLHTRR +P I NN
Sbjct  216   ELHKRFLHALQQLGGPDVATPKQIREHMKVDGLTNDEVKSHLQKFRLHTRR-SPVIHNN  273



>gb|KEH43448.1| myb-like transcription factor family protein [Medicago truncatula]
Length=283

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 142/275 (52%), Positives = 175/275 (64%), Gaps = 33/275 (12%)
 Frame = +1

Query  232   EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTS  411
             +YI+ALE+ERRKIQVF +ELPL LELVTQAIEA +QQLSGTTTE NLN GQSECSEQTTS
Sbjct  10    DYIQALEQERRKIQVFPKELPLSLELVTQAIEACRQQLSGTTTEYNLN-GQSECSEQTTS  68

Query  412   SDDDEGPVLEEFIPL-KRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdssk  588
             +D   GPVLEEFIP+ KRASS SQ+  DD +   +  +H+      D+            
Sbjct  69    TD---GPVLEEFIPIKKRASSYSQEVFDDVEDYDQHFHHKQQKLSLDNK-----------  114

Query  589   dgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNC--KVGVKRNG-SGGAFHPFKREKSAG  759
                  KK DWLRS QLWN   +DP+ +E+        + +KRNG  GGAFHPF +E    
Sbjct  115   -----KKSDWLRSVQLWN---SDPSSEEDVTKKAVPVLELKRNGCGGGAFHPFHKEDRVN  166

Query  760   TSSPAV------QTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQ  921
              ++  +       +           +        ++  E + +RKQRRCWS ELH+RFL+
Sbjct  167   NTTSELLSKGQPSSTGVAAVSSNAATVTSNNVENRKRDEKEEKRKQRRCWSQELHKRFLK  226

Query  922   ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  1026
             ALQQLGG+  ATPKQIRE+M VDGLTNDEVKSHLQ
Sbjct  227   ALQQLGGADCATPKQIREVMNVDGLTNDEVKSHLQ  261



>ref|XP_006302460.1| hypothetical protein CARUB_v10020552mg [Capsella rubella]
 gb|EOA35358.1| hypothetical protein CARUB_v10020552mg [Capsella rubella]
Length=353

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 167/360 (46%), Positives = 213/360 (59%), Gaps = 61/360 (17%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y +KM++C EY+EALE+E++KIQVFQRELPLCLELVTQAIEA +++LSGTTT       
Sbjct  6     DYAKKMQKCHEYVEALEQEQKKIQVFQRELPLCLELVTQAIEACRKELSGTTTS------  59

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
               +CSEQTTS     GPV EEFIP+K+  SL Q+++D++++  +S+              
Sbjct  60    -EQCSEQTTSVCG--GPVFEEFIPIKK-RSLCQEDDDEDEEEHESS--------------  101

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                        +++KK DWLRS QLWN S  D  PKEE        V+     GAF PF+
Sbjct  102   ----------PELNKKSDWLRSVQLWNPS-PDLNPKEERVVKKAKVVEVKPKSGAFQPFQ  150

Query  742   REKS----AGTSSPAVQTLDs----------------ttagvgngsggggggskkeeket  861
             +EK           AV+ + S                  +              +++ ++
Sbjct  151   KEKKRVLETDLQPAAVKVVSSAPAPATTTSSTTETGGAKSDADKVGEEQIQMLPQQQSQS  210

Query  862   QSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH  1041
             Q+ RKQRRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLH
Sbjct  211   QTHRKQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH  270

Query  1042  TRRPTPSI-RNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATT  1218
             TRRP  ++   +      PQFVVVGGIWVP P+     +    +G      G+YAPVA  
Sbjct  271   TRRPATAVAAQSNGNPPQPQFVVVGGIWVPSPQEFPPPSDVANNG-----GGVYAPVAVA  325



>ref|XP_010415495.1| PREDICTED: two-component response regulator-like APRR2 [Camelina 
sativa]
Length=355

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 215/356 (60%), Gaps = 52/356 (15%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y +KM++C EY+EALE+E++KIQVFQRELP CLELVTQAIEA +++LSGTT      I 
Sbjct  6     DYAKKMQKCHEYVEALEQEQKKIQVFQRELPFCLELVTQAIEACRKELSGTT------IS  59

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             + +CSEQTTS     GPV EEFIP+K+  SLSQ++E+DE++    ++             
Sbjct  60    EQQCSEQTTSVCG--GPVFEEFIPIKK-RSLSQEDEEDEEEDEHESS-------------  103

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                     +  + +KK DWLRS QLWN S  D  PKEE        V+     GAF PF+
Sbjct  104   -------PELEQTNKKSDWLRSVQLWNPS-PDLNPKEERVVKRAKVVEVKPKSGAFQPFQ  155

Query  742   REKSAGTSS---PAVQTLDstt-------------agvgngsggggggskkeeketQSQR  873
             +EK     +   PA   + S+              A       G       ++ +TQ+ R
Sbjct  156   KEKKRVLETDLQPAAVKVASSAPATTTSSTTETGGAKSDLDKVGEEQIQMTQQHQTQTHR  215

Query  874   KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             KQRRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLHTRRP
Sbjct  216   KQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLHTRRP  275

Query  1054  TPSI-RNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATT  1218
               ++   +    Q PQFVVVGGIWVP P+     +    +G      G+YAPVA  
Sbjct  276   ATTVAAQSNGNPQQPQFVVVGGIWVPSPQDFHPPSDAANNG-----GGVYAPVAVA  326



>ref|XP_010470826.1| PREDICTED: two-component response regulator-like APRR2 [Camelina 
sativa]
Length=359

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 169/359 (47%), Positives = 212/359 (59%), Gaps = 56/359 (16%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y +KM++C EY+EALE+E++KIQVFQRELPLCLELVTQAIEA +++LSGTTT       
Sbjct  6     DYAKKMQKCHEYVEALEQEQKKIQVFQRELPLCLELVTQAIEACRKELSGTTT------S  59

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             + +CSEQTTS     GPV EEFIP+K+  SLSQ++E+DE++    ++             
Sbjct  60    EQQCSEQTTSVCG--GPVFEEFIPIKK-RSLSQEDEEDEEEDEHESS-------------  103

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                     +  + +KK DWLRS QLWN S  D  PKEE        V+     GAF PF+
Sbjct  104   -------PELEQTNKKSDWLRSVQLWNPS-PDLNPKEERVVKRAKVVEVKPKSGAFQPFQ  155

Query  742   REKSAGTSS---PAVQTLD-----------------sttagvgngsggggggskkeeket  861
             +EK     +   PA   +                   +                + + ++
Sbjct  156   KEKKRVLETDLQPAAVKVASSAPATTTSSTTETGGAKSDLDKVGEEQIQMTQQHQTQTQS  215

Query  862   QSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH  1041
             Q+ RKQRRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLH
Sbjct  216   QTHRKQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH  275

Query  1042  TRRPTPSI-RNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
             TRRP  ++   +    Q PQFVVVGGIWVP P+          +G      G+YAPVA 
Sbjct  276   TRRPATTVAAQSNVNPQQPQFVVVGGIWVPSPQEFHPPTDAANNG-----GGVYAPVAV  329



>ref|XP_010528047.1| PREDICTED: probable transcription factor GLK2 [Tarenaya hassleriana]
Length=349

 Score =   236 bits (602),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 149/289 (52%), Positives = 177/289 (61%), Gaps = 40/289 (14%)
 Frame = +1

Query  205   YPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQ  384
             Y +K++RC EYIEAL+EER KI VFQRELPLCL+LVTQAIEA K+++SGTTTE N+N GQ
Sbjct  10    YSQKLQRCGEYIEALQEERSKILVFQRELPLCLDLVTQAIEACKREISGTTTE-NVN-GQ  67

Query  385   SECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnn  564
             SECSEQTT   +  GPVLEEFIP++                P S++H    DDDDD + +
Sbjct  68    SECSEQTTG--ECGGPVLEEFIPIR----------------PPSSSHDDGGDDDDDGDEH  109

Query  565   gdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKR  744
                  + K    + K DWL+SAQLWNQ    PTP EE P   +          A    K 
Sbjct  110   ESHHSNEKSDDNNTKSDWLKSAQLWNQPV--PTPAEERPQEKE----------AVDEVKS  157

Query  745   EKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQA  924
                     PA +       G    +                +RKQRRCWS  LHRRFL A
Sbjct  158   NGDENRKIPATEGSGGCGGGGCQKNEPEKESG--------GKRKQRRCWSQYLHRRFLNA  209

Query  925   LQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRN  1071
             LQQLGG+HVATPKQIRE+MKVDGLTNDEVKSHLQKYRLHTRRP+ ++ N
Sbjct  210   LQQLGGAHVATPKQIREVMKVDGLTNDEVKSHLQKYRLHTRRPSQTVPN  258



>ref|XP_002887197.1| hypothetical protein ARALYDRAFT_475994 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63456.1| hypothetical protein ARALYDRAFT_475994 [Arabidopsis lyrata subsp. 
lyrata]
Length=353

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 174/363 (48%), Positives = 212/363 (58%), Gaps = 57/363 (16%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y +KM++C EY+EALEEE++KIQVFQRELPLCLELVTQAIEA +++LSGTTT       
Sbjct  5     DYAKKMQKCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIEACRKELSGTTTT------  58

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
               +CSEQTTS     GPV EEFIP+K+ S   + EED E +S        +         
Sbjct  59    SEQCSEQTTSVCG--GPVFEEFIPIKKRSLCEEQEEDGEHESSPELEQIGN---------  107

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                          +KK DWLRS QLW  S  D  PKEE        V+     GAF PF+
Sbjct  108   -------------NKKSDWLRSVQLWTPS-PDLNPKEERVVKKAKVVEVKPKSGAFQPFQ  153

Query  742   REKSAGTSS---PAVQTLDst-------------tagvgngsggggggskkeeketQSQR  873
             +EK     +   PAV+   ST                     G      ++++ ++Q+ R
Sbjct  154   KEKKRVLETDLQPAVKVASSTPATTTSSTTETGGAKSELVKVGEEQRQIEQQQSQSQTHR  213

Query  874   KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             KQRRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLHTRRP
Sbjct  214   KQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLHTRRP  273

Query  1054  --TPSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT--TP  1221
               T     +    Q PQFVVVGGIWV       +    P   + A + G+YAPVA   +P
Sbjct  274   AATSVAAQSNGNPQQPQFVVVGGIWV------PSPQDFPPPSDVANNGGVYAPVAVAQSP  327

Query  1222  KQT  1230
             K++
Sbjct  328   KRS  330



>ref|XP_008782297.1| PREDICTED: probable transcription factor GLK2 [Phoenix dactylifera]
Length=354

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 172/347 (50%), Positives = 212/347 (61%), Gaps = 56/347 (16%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ E+ R+CQEY+EALEEERRKI+VFQRELPLCL+LVTQAIE+ + Q+            
Sbjct  2     DFAERARKCQEYVEALEEERRKIEVFQRELPLCLQLVTQAIESIRMQIW-----------  50

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
                 SE+T +    +GPVLEEFIPLK  SS +++E+    +  +  +             
Sbjct  51    ---SSEETVT----DGPVLEEFIPLKPTSSSTEEEKGGFMEMEQERS-------------  90

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                           KK DWLRS QLWNQ      PK + P    + V     GGAFHPF+
Sbjct  91    -------------EKKPDWLRSVQLWNQETDHSLPKGDPPKR-PIAVNAKKIGGAFHPFE  136

Query  742   REKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQ  921
             R    G  +PA     S+T G G G G GG   K +E ++Q  RK RRCWS ELHRRFL 
Sbjct  137   R----GKHAPAAPAASSSTVGGGGGGGVGGEKEKDKEGQSQPPRKARRCWSAELHRRFLH  192

Query  922   ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqq-qgpq  1098
             AL QLGGSH ATPKQIRE+MKVDGLTNDEVKSHLQKYRLH RRP  +++++ +     PQ
Sbjct  193   ALDQLGGSHAATPKQIREMMKVDGLTNDEVKSHLQKYRLHARRPNLAVQSSSTSNPLAPQ  252

Query  1099  fvvvggIWVpppeyaaamapppT------SGEAATSNGIYAPVATTP  1221
             FVVVGGIWVPPP+YAAA A          +G  A+ NG+YAPVA+ P
Sbjct  253   FVVVGGIWVPPPDYAAAPAASAAAQPSHGAGAGASPNGVYAPVASLP  299



>ref|XP_009152112.1| PREDICTED: two-component response regulator ARR10 [Brassica rapa]
Length=378

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 169/345 (49%), Positives = 204/345 (59%), Gaps = 33/345 (10%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             NY EK  +C EYIEALEEERRKI VFQRELPLCLELVTQAIEAYK+++SGTTT+     G
Sbjct  10    NYNEKREKCCEYIEALEEERRKINVFQRELPLCLELVTQAIEAYKKEISGTTTDTLY--G  67

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRAS-SLSQDEEDDEQQSPKSANHRTdddddddnn  558
             Q ECSEQTT    + GPVL+ F+P+K++S S  ++EE++E    +  +H T  D  D   
Sbjct  68    QPECSEQTTG---ECGPVLDLFLPIKQSSASTDEEEEEEEVDDVEHESHDTGIDFVDK--  122

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEE----SPSNCKVGVKRNGSGGA  726
                           + K +WL+S QLWNQ    P  K E            +K N +G  
Sbjct  123   --------------NMKSEWLKSVQLWNQPEAVPVSKSERSQQETQTLVEPIKENDNGAG  168

Query  727   FH--PFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPE  900
              H  P            ++ T  S +      +   G G        + QRKQRRCWS E
Sbjct  169   SHQPPCYESNEKNDYIISLATTSSGSGRQQTEAERDGSGGSGGSSSRRGQRKQRRCWSHE  228

Query  901   LHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgs  1080
             LH RFL AL+QLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+ +I NN  
Sbjct  229   LHIRFLNALKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSQTIPNN-R  287

Query  1081  qqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
               Q   FVVVGGIWVP   ++ A A         T+ GIY P+A+
Sbjct  288   DSQTQHFVVVGGIWVPQASHSKANAV----ASRETTTGIYGPMAS  328



>emb|CDY54503.1| BnaA02g35660D [Brassica napus]
Length=368

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 186/317 (59%), Gaps = 68/317 (21%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y +KM+RC EY+EAL+EE++KIQVFQRELPLCLELVTQAIEA +++LS T+T       
Sbjct  4     DYAQKMQRCHEYVEALKEEQKKIQVFQRELPLCLELVTQAIEACRKELSSTSTT------  57

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
               +CSEQTTS     GPVLEEFIP K+       EE+ E +SP                 
Sbjct  58    SEQCSEQTTSVSG--GPVLEEFIPTKKI------EENGEHESP-----------------  92

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK---------VGVKRN-  711
                + +   +    KK DWLRS QLWN     P+P     SN +         V VK N 
Sbjct  93    ---TPEEIGNNVDKKKSDWLRSVQLWN-----PSPDTNEVSNPERVVGKKAKVVEVKPNN  144

Query  712   -GSGGAFHPFKREKS-----------AGTSSPAVQTLDsttagvg-------ngsggggg  834
               + G F PF+REK            A   +PAV+ + S  A                  
Sbjct  145   YNNCGGFQPFQREKKRETDLQPAAVRAVALAPAVKVVASAPATTTSSTTETCAVGKEREE  204

Query  835   gskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVK  1014
                +++ ++Q++RKQRRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVK
Sbjct  205   QVLQQQSQSQTRRKQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVK  264

Query  1015  SHLQKYRLHTRRPTPSI  1065
             SHLQKYRLHTRRP  ++
Sbjct  265   SHLQKYRLHTRRPATTV  281



>ref|XP_009127661.1| PREDICTED: uncharacterized protein LOC103852516 [Brassica rapa]
Length=368

 Score =   234 bits (597),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 188/317 (59%), Gaps = 68/317 (21%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y +KM+RC EY+EAL+EE++KIQVFQRELPLCLELVTQAIEA +++LS T+T       
Sbjct  4     DYAQKMQRCHEYVEALKEEQKKIQVFQRELPLCLELVTQAIEACRKELSSTSTT------  57

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
               +CSEQTTS     GPVLEEFIP K+       EE+ E +SP                 
Sbjct  58    SEQCSEQTTSVSG--GPVLEEFIPTKKI------EENGEHESP-----------------  92

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK---------VGVKRN-  711
                + +   +    KK DWLRS QLWN     P+P     SN +         V VK N 
Sbjct  93    ---TPEEIGNNVDKKKSDWLRSVQLWN-----PSPDTNEVSNPERVVGKKAKVVEVKPNN  144

Query  712   -GSGGAFHPFKREKSAGTS-----------SPAVQTLDsttagvgngsggg-------gg  834
               + G F PF+REK   T            +PAV+ + S  A   + +            
Sbjct  145   YNNCGGFQPFQREKKRETDLQPAAVRAVALAPAVKVVASAPATTTSSTTETCGVGREGEE  204

Query  835   gskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVK  1014
                +++ ++Q++RKQRRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVK
Sbjct  205   HVLQQQSQSQTRRKQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVK  264

Query  1015  SHLQKYRLHTRRPTPSI  1065
             SHLQKYRLHTRRP  ++
Sbjct  265   SHLQKYRLHTRRPATTV  281



>emb|CDY13584.1| BnaA06g33390D [Brassica napus]
Length=357

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 167/345 (48%), Positives = 205/345 (59%), Gaps = 54/345 (16%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             NY EK  +C EYIEALEEERRKI VFQRELPLCLELVTQAIEAYK+++SGTTT+     G
Sbjct  10    NYNEKREKCCEYIEALEEERRKINVFQRELPLCLELVTQAIEAYKKEISGTTTDTLY--G  67

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRAS-SLSQDEEDDEQQSPKSANHRTdddddddnn  558
             Q ECSEQTT    + GPVL+ F+P+K++S S  ++EE++E        H + D   D  +
Sbjct  68    QPECSEQTTG---ECGPVLDLFLPIKQSSASTDEEEEEEEVDEDDDVEHESHDTGIDFVD  124

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPK-EESPSNCKVGVK-----RNGSG  720
                           + K +WL+S QLWNQ    P  K E S    +  V+      NG+G
Sbjct  125   K-------------NMKSEWLKSVQLWNQPEAVPVSKWERSQQETQTLVEPIKENDNGAG  171

Query  721   GAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPE  900
             G+     R+K+      +  +                          + QRKQRRCWS E
Sbjct  172   GS----ARQKTEAERGGSGGS--------------------GGSSSRRGQRKQRRCWSHE  207

Query  901   LHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgs  1080
             LHRRFL AL+QLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+ ++ NN  
Sbjct  208   LHRRFLNALKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSQTVPNN-R  266

Query  1081  qqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
               Q   FVVVGGIWVP   ++ A A         T+ GIY P+A+
Sbjct  267   DSQTQHFVVVGGIWVPQASHSKANAV----ASRETTTGIYGPMAS  307



>ref|XP_003614475.1| Two-component response regulator ARR14 [Medicago truncatula]
Length=347

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 200/343 (58%), Gaps = 52/343 (15%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             ++YI ALEEE++KIQVF R+LPL LELVTQAIE  KQQL GT         QSECSEQT+
Sbjct  4     RDYILALEEEKKKIQVFPRDLPLSLELVTQAIETCKQQLFGT---------QSECSEQTS  54

Query  409   SSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdssk  588
             +   DEG V EEFIP+K+ +     +E+DE+       H +                   
Sbjct  55    T---DEGLVFEEFIPIKKRALSPDCDENDEEDDDDEEQHSSHKM----------------  95

Query  589   dgkVSKKQDWLRSAQLWNQSFTDPTP---KEESPSNCKVG-VKRNGSGGAFHPFKREKSA  756
                   K DWLRS QLWN     P P   KE+ P    V  VKRNG  GAF PF +E+ A
Sbjct  96    ------KSDWLRSVQLWN-----PNPSSAKEDVPRKTNVVEVKRNG--GAFQPFHKEEIA  142

Query  757   GTSSPAVQT--LDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQ  930
                  A+++    +++  V   S          +K+ + QRKQRRCWS ELH+RFL ALQ
Sbjct  143   AEKDNALESDKAPTSSPQVPATSSTEPVPESGSKKDDKGQRKQRRCWSQELHKRFLHALQ  202

Query  931   QLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfvvv  1110
             QLGGS+ ATPKQIRELMKVDGLTNDEVKSHLQK+RLHTRR +P I NN S        +V
Sbjct  203   QLGGSNSATPKQIRELMKVDGLTNDEVKSHLQKFRLHTRR-SPIIHNN-SNSHTAPMFLV  260

Query  1111  ggIWVpppeyaaamapppTSGE---AATSNGIYAPVATTPKQT  1230
             G I+V P EYAA       SGE     T  GIYAPVAT P  T
Sbjct  261   GNIYVQPQEYAAVATKTTVSGELTTVTTPTGIYAPVATHPSST  303



>gb|AES97433.2| myb-like transcription factor family protein [Medicago truncatula]
Length=361

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 200/343 (58%), Gaps = 52/343 (15%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             ++YI ALEEE++KIQVF R+LPL LELVTQAIE  KQQL GT         QSECSEQT+
Sbjct  18    RDYILALEEEKKKIQVFPRDLPLSLELVTQAIETCKQQLFGT---------QSECSEQTS  68

Query  409   SSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdssk  588
             +   DEG V EEFIP+K+ +     +E+DE+       H +                   
Sbjct  69    T---DEGLVFEEFIPIKKRALSPDCDENDEEDDDDEEQHSSHKM----------------  109

Query  589   dgkVSKKQDWLRSAQLWNQSFTDPTP---KEESPSNCKVG-VKRNGSGGAFHPFKREKSA  756
                   K DWLRS QLWN     P P   KE+ P    V  VKRNG  GAF PF +E+ A
Sbjct  110   ------KSDWLRSVQLWN-----PNPSSAKEDVPRKTNVVEVKRNG--GAFQPFHKEEIA  156

Query  757   GTSSPAVQT--LDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQ  930
                  A+++    +++  V   S          +K+ + QRKQRRCWS ELH+RFL ALQ
Sbjct  157   AEKDNALESDKAPTSSPQVPATSSTEPVPESGSKKDDKGQRKQRRCWSQELHKRFLHALQ  216

Query  931   QLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfvvv  1110
             QLGGS+ ATPKQIRELMKVDGLTNDEVKSHLQK+RLHTRR +P I NN S        +V
Sbjct  217   QLGGSNSATPKQIRELMKVDGLTNDEVKSHLQKFRLHTRR-SPIIHNN-SNSHTAPMFLV  274

Query  1111  ggIWVpppeyaaamapppTSGE---AATSNGIYAPVATTPKQT  1230
             G I+V P EYAA       SGE     T  GIYAPVAT P  T
Sbjct  275   GNIYVQPQEYAAVATKTTVSGELTTVTTPTGIYAPVATHPSST  317



>emb|CDX83554.1| BnaC07g22940D [Brassica napus]
Length=354

 Score =   231 bits (588),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 196/338 (58%), Gaps = 45/338 (13%)
 Frame = +1

Query  205   YPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQ  384
             Y EK  +C EYIEALEEERRKI VFQRELPLCLELVT+AIEAYK+++SGTTT+     GQ
Sbjct  11    YNEKREKCCEYIEALEEERRKINVFQRELPLCLELVTRAIEAYKKEISGTTTDTLY--GQ  68

Query  385   SECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnn  564
              ECSEQTT    + GPVL+ F+P+K+ SS S DEE++E        H + D   D  +  
Sbjct  69    PECSEQTTG---ECGPVLDLFLPVKQ-SSASTDEEEEEVYEDDDVEHESHDTGIDFVDK-  123

Query  565   gdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK-  741
                         + K +WL+S QLWNQ    P  K E          +  +     P K 
Sbjct  124   ------------NMKSEWLKSVQLWNQPEAVPVSKSER--------SQQETQTVVEPIKE  163

Query  742   REKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQ  921
              +  AG+  P    + +                         QRKQRRCWS ELHRRFL 
Sbjct  164   NDNGAGSHQPPCYEMSNEKNDYIISLATTR------------QRKQRRCWSHELHRRFLN  211

Query  922   ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqf  1101
             AL+QLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+ +I NN    Q   F
Sbjct  212   ALKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSQTIPNN-RDSQTQHF  270

Query  1102  vvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
             VVVGGIWVP   ++ A A         T+ GIY P+ +
Sbjct  271   VVVGGIWVPQANHSKANAV----ASRKTTTGIYGPMVS  304



>gb|KFK44548.1| hypothetical protein AALP_AA1G271100 [Arabis alpina]
Length=308

 Score =   229 bits (583),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 156/335 (47%), Positives = 193/335 (58%), Gaps = 57/335 (17%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             +RC +++ ALEEE++KI  FQRELPLCL+LVT AIE+ +++L           GQSECS 
Sbjct  4     QRCHQFVVALEEEQKKIHAFQRELPLCLQLVTLAIESCRKELEQIH-------GQSECSV  56

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
             QTTS   + G V EEFIP+ + SS S   +D  ++  +    +T                
Sbjct  57    QTTS---ECGAVFEEFIPINKWSSSSSFNKDGAEKISEDKVDKT----------------  97

Query  580   sskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREKSAG  759
                      K DWLRS QLWNQS  DP PKE+      + +KR   GGAF PF +EK   
Sbjct  98    ---------KPDWLRSTQLWNQS-PDPQPKEDQAMTTVLELKRK--GGAFQPFHKEKYVA  145

Query  760   TSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLG  939
               + + Q L    A     +      S   +++ QS RKQRRCWS ELHRRFL AL  LG
Sbjct  146   AKADS-QPL---KAISPTTTWSSTAESDGGKQQKQSHRKQRRCWSSELHRRFLHALHHLG  201

Query  940   GSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TPSIRNNgsqqqgpqfvvvgg  1116
             GSHVATPKQI + MKVDGLTNDEVKSHLQKYRLHTRRP TP + N G  QQ PQF++V G
Sbjct  202   GSHVATPKQIIDFMKVDGLTNDEVKSHLQKYRLHTRRPATPVVTNGGENQQQPQFMMVEG  261

Query  1117  IWVpppeyaaamapppTSGEAATSNGIYAPVATTP  1221
             IW+P               + A +N +YAPVA  P
Sbjct  262   IWLPL--------------QDAANNRVYAPVAVQP  282



>ref|XP_009110590.1| PREDICTED: transcription activator GLK2-like [Brassica rapa]
 emb|CDY21091.1| BnaA08g24340D [Brassica napus]
Length=346

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 147/295 (50%), Positives = 181/295 (61%), Gaps = 55/295 (19%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ +Y +K  RC +YIEALEEERRKI VFQRELPLCL+LVTQAIEA K++L GT TE N+
Sbjct  6     SNMDYKQKQERCGQYIEALEEERRKIHVFQRELPLCLDLVTQAIEACKRELPGTATE-NM  64

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTddddddd  552
               GQSECSEQTT    +  PVLE+F+ +K +S+ +++EE D++      NH  D+D +D 
Sbjct  65    -YGQSECSEQTTG---ECTPVLEQFLTIKDSSTSNEEEELDDEH----GNHDPDNDYEDK  116

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDP-TPKEESPSNCKVGVKRNGSGGAF  729
                             + K DWL+S QLWNQ   DP  PKEE                  
Sbjct  117   ----------------NMKSDWLKSVQLWNQP--DPLLPKEE------------------  140

Query  730   HPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHR  909
                      GT    V T+      +   +   GG  +K E E    RKQRRCWS +LHR
Sbjct  141   ---------GTQEKMVDTVVKKDESMKKEAMANGGERRKREAEKDGGRKQRRCWSSQLHR  191

Query  910   RFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             RFL ALQ LGG HVATPKQI+ELMK+DGLTNDEVKSHLQKYRLHTRRP+ ++ NN
Sbjct  192   RFLNALQHLGGPHVATPKQIKELMKIDGLTNDEVKSHLQKYRLHTRRPSQTVSNN  246



>ref|XP_004135112.1| PREDICTED: uncharacterized protein LOC101203539 [Cucumis sativus]
 gb|KGN52051.1| hypothetical protein Csa_5G608390 [Cucumis sativus]
Length=356

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 164/345 (48%), Positives = 201/345 (58%), Gaps = 63/345 (18%)
 Frame = +1

Query  235   YIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTSS  414
             Y +AL+ ER+KIQVFQRELPLCLELVT+AI++ +QQLSG              S +++  
Sbjct  19    YADALDRERQKIQVFQRELPLCLELVTRAIDSCRQQLSGV-------------STESSEH  65

Query  415   DDDEGPVLEEFIPLKRASSLSQDE-EDDEQQSPKSANHRTdddddddnnnngdssdsskd  591
                + PVLEEFIP+ +    S  E E+DEQ  P                           
Sbjct  66    TSSDRPVLEEFIPINKPCVNSHFEIEEDEQSKPGKIE-----------------------  102

Query  592   gkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKRE--------  747
                  + DWL+SAQLWNQS  DP P  E  +   V VK NG GGAF PF++         
Sbjct  103   ---LGRSDWLKSAQLWNQS-PDP-PLTEDVAKEVVEVKNNGGGGAFQPFEKTTPLKTESA  157

Query  748   ----KSAGTSSPAVQTLDsttagvgngsggggg----gskkeeketQSQRKQRRCWSPEL  903
                 ++AG+S P   T+        + +G         +K+E+KE+Q+QRKQRRCWS EL
Sbjct  158   VVVGRTAGSSFPEATTISIPETTTSSTAGTASKCGGGTAKREDKESQTQRKQRRCWSSEL  217

Query  904   HRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT-PSIRNNgs  1080
             HRRF+ ALQQLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLH+RRPT  +++++GS
Sbjct  218   HRRFVHALQQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHSRRPTNTAMQDSGS  277

Query  1081  qqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
                  QFVVVG IWVPPP            G     NGIYAPVAT
Sbjct  278   SSAHQQFVVVGSIWVPPPPPPKYTVATTEKGR----NGIYAPVAT  318



>ref|XP_006395625.1| hypothetical protein EUTSA_v10004475mg [Eutrema salsugineum]
 gb|ESQ32911.1| hypothetical protein EUTSA_v10004475mg [Eutrema salsugineum]
Length=359

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 171/353 (48%), Positives = 212/353 (60%), Gaps = 38/353 (11%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             NY +K  RC EYIEALEEERRKI VFQRELPLCLELVTQAIEAYK+++SGTTTE NL  G
Sbjct  10    NYNQKRERCSEYIEALEEERRKINVFQRELPLCLELVTQAIEAYKKEISGTTTE-NL-YG  67

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QSECSEQTT    + GPVL+ FIP+K +S+ +++EE++  +     +   +D D +D   
Sbjct  68    QSECSEQTTG---ECGPVLDLFIPIKHSSTSTEEEEEEVDEDDDDEHEFHEDIDFNDK--  122

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQ---SFTDPTPKEESPSNCKVGVKRNGSGGAFH  732
                          + K +WL+S QLWNQ     ++   + E  +   V V +   GG   
Sbjct  123   -------------NMKSEWLKSVQLWNQPDAVLSNKLERLEKETETIVEVIKGKDGGV--  167

Query  733   PFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRR  912
                      +  P      +   G G+         K +    + QRKQRRCWS ELHRR
Sbjct  168   ---------SQQPPCYETSNGKYGEGSDGEKKDQPQKDDGGGGRGQRKQRRCWSQELHRR  218

Query  913   FLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqg  1092
             FL AL+QLGG HVATPKQIRELMK+DGLTNDEVKSHLQKYRLHTRRP+ +  NN    Q 
Sbjct  219   FLNALKQLGGPHVATPKQIRELMKIDGLTNDEVKSHLQKYRLHTRRPSQTTPNN-RNSQT  277

Query  1093  pqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAP-VATTPKQTQQNRTI  1248
               FVVVGG+WVP      + A    S E  T+ GIY P V+  P  +  +RTI
Sbjct  278   QHFVVVGGLWVPQAAANHSTANAVVSAE--TTTGIYGPMVSPLPCHSNFDRTI  328



>ref|XP_010502461.1| PREDICTED: uncharacterized protein LOC104779778 isoform X2 [Camelina 
sativa]
Length=349

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 162/338 (48%), Positives = 194/338 (57%), Gaps = 48/338 (14%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N+  K  RC EYIEALEEERRKI VFQRELPLCLELVTQAIEAYK+++SGTTTE NL  G
Sbjct  10    NHNHKRERCSEYIEALEEERRKINVFQRELPLCLELVTQAIEAYKREISGTTTE-NL-YG  67

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QSECSEQTT    + G VL+ FIP+ R SS S +E DD+    +  +H T+ D +D    
Sbjct  68    QSECSEQTTG---ECGRVLDLFIPI-RHSSTSVEEVDDKDDDDEHESHETNIDFNDK---  120

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                          + K DWL+S QLWNQS       +   SN +    +N         K
Sbjct  121   -------------NMKSDWLKSVQLWNQS-------DAVVSNNRQDCLQNKPETLVKDLK  160

Query  742   REKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQ  921
             R       +  ++                   S     + + QRK RRCWS ELHRRFL 
Sbjct  161   RNDGEEGKNNNIKL--------------SVTSSSGGGSDGRGQRKNRRCWSQELHRRFLN  206

Query  922   ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqf  1101
             +L+QLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRP+ +   N    Q   F
Sbjct  207   SLKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHARRPSQTTPTN-GNSQNQHF  265

Query  1102  vvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
             VVVGGIWV         +    +  A T+ GIY P+ +
Sbjct  266   VVVGGIWV----PQTTHSTANAAASAETTTGIYGPMVS  299



>ref|XP_010514200.1| PREDICTED: uncharacterized protein LOC104790195 [Camelina sativa]
Length=350

 Score =   228 bits (580),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 200/345 (58%), Gaps = 61/345 (18%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N+  K  RC EYIEALEEERRKI VFQRELPLCLELVTQAIEAYK+++SGTTTE NL  G
Sbjct  10    NHNHKRERCSEYIEALEEERRKINVFQRELPLCLELVTQAIEAYKREISGTTTE-NL-YG  67

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QSECSEQTT    + G VL+ FIP+ R SS S +E DD+    +  +H T+ D +D    
Sbjct  68    QSECSEQTTG---ECGRVLDLFIPI-RHSSTSVEEVDDKDDDDEHESHETNIDFNDK---  120

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQS-FTDPTPKEESPSN-----CKVGVKRN-GSG  720
                          + K DWL+S QLWNQS       +++   N      K  +KRN G  
Sbjct  121   -------------NMKSDWLKSVQLWNQSDAVVSNNRQDCLQNKPETLVKAVLKRNDGEE  167

Query  721   GAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPE  900
             G  +  K   ++ +   +                             + QRK RRCWS E
Sbjct  168   GKNNNIKLSVTSSSGGGSDG---------------------------RGQRKNRRCWSQE  200

Query  901   LHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgs  1080
             LHRRFL AL+QLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRP+ +  NN  
Sbjct  201   LHRRFLNALKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHARRPSQTTPNN-G  259

Query  1081  qqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
               Q   FVVVGGIWVP    + A A         T+ GIY P+ +
Sbjct  260   NSQNQHFVVVGGIWVPQTNQSTANAV----ASVETTTGIYGPMVS  300



>ref|XP_008799311.1| PREDICTED: probable transcription factor GLK2 isoform X1 [Phoenix 
dactylifera]
Length=348

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 161/340 (47%), Positives = 197/340 (58%), Gaps = 54/340 (16%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             E+ RRC EY+EALEEERRKIQVF RELPLCL+LVT+AIE+ + Q+               
Sbjct  5     ERARRCHEYVEALEEERRKIQVFPRELPLCLQLVTEAIESIRVQMG--------------  50

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDD--EQQSPKSANHRTdddddddnnnn  564
              SE+T +    +GPVLEEFIPLK  SS  ++E+    E    +S N              
Sbjct  51    SSEETVT----DGPVLEEFIPLKPTSSSIEEEKGGSMEMDQERSDN--------------  92

Query  565   gdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKR  744
                           K DWLRS QLW+Q      PK E P    + V     GGAF PF R
Sbjct  93    --------------KPDWLRSVQLWSQDPDHSLPKAEPPKK-PIAVNAKKIGGAFRPFDR  137

Query  745   EKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQA  924
             EK          +  +  +    G G  G   K +E ++Q  RK RRCWSP+LHR+F+ A
Sbjct  138   EKHVPAPV---PSAAAPASSTTVGGGSSGEKEKDKEGQSQPHRKARRCWSPDLHRQFIHA  194

Query  925   LQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN-gsqqqgpqf  1101
             LQQLGGSH ATPKQIRELMKVD LTNDEVKSHLQKYRLH+RRP+P+++++  S    PQ+
Sbjct  195   LQQLGGSHAATPKQIRELMKVDDLTNDEVKSHLQKYRLHSRRPSPAVQSSGTSSPPTPQY  254

Query  1102  vvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTP  1221
             VVVG IWV PP+YAAA            + GIYAPVA+ P
Sbjct  255   VVVGEIWVRPPDYAAAAVATAAQPANG-AGGIYAPVASLP  293



>ref|XP_009383634.1| PREDICTED: uncharacterized protein LOC103971360 [Musa acuminata 
subsp. malaccensis]
Length=361

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 164/347 (47%), Positives = 207/347 (60%), Gaps = 49/347 (14%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++   +  C +Y+ ALEEER+KIQVFQRELPLCL++VT AI++ ++Q++G          
Sbjct  2     DFSATLPSCGDYVRALEEERKKIQVFQRELPLCLQIVTHAIDSARRQMNG----------  51

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
                     T S+D  GP+LEEFIPLK +SS S+D   D     KS +  T          
Sbjct  52    ------HATMSED--GPILEEFIPLKPSSSSSEDRSVDGAAK-KSGSAATR---------  93

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                           +K DWLRS QLWNQ   D   K E P+   + V     GGAFHPF+
Sbjct  94    ------------ADEKPDWLRSVQLWNQE-ADAFGKVEPPTK-PIAVNARRIGGAFHPFE  139

Query  742   REKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQ  921
             REK      PA  +  +T+   G G  G GG  K++E ++Q  RK RRCWSPELH+RFL 
Sbjct  140   REKHVAAPIPASSS--TTSGKGGVGGSGVGGEEKEKEGQSQPHRKARRCWSPELHQRFLH  197

Query  922   ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIR---NNgsqqqg  1092
             AL+QLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRP+ ++    +N +    
Sbjct  198   ALKQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHNRRPSTAVHSSSSNTTNPPI  257

Query  1093  pqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTPKQTQ  1233
             PQFVVV GIWVPPP+Y  A  P       A   G++AP A+ P  ++
Sbjct  258   PQFVVVSGIWVPPPDYTVAAPPADAPCTPAV--GVFAPAASLPSDSR  302



>emb|CDY50179.1| BnaC08g15800D [Brassica napus]
Length=346

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 147/295 (50%), Positives = 180/295 (61%), Gaps = 55/295 (19%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ +Y +K  RC +YIEALEEERRKI VFQRELPLCL+LVTQAIEA K++L GT TE N+
Sbjct  6     SNMDYKQKQERCGQYIEALEEERRKIHVFQRELPLCLDLVTQAIEACKRELPGTATE-NM  64

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTddddddd  552
               GQSECSEQTT    +  PVLE+F+ +K +S+ +++EE D++      NH  D+D +D 
Sbjct  65    -YGQSECSEQTTG---ECRPVLEQFLTIKDSSTSNEEEELDDEH----GNHDPDNDSEDK  116

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDP-TPKEESPSNCKVGVKRNGSGGAF  729
                             + K DWL+S QLWNQ   DP  PKEE                  
Sbjct  117   ----------------NMKSDWLKSVQLWNQP--DPLLPKEER-----------------  141

Query  730   HPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHR  909
                       T    V T+      +   +   GG  +K E E    RKQRRCWS +LHR
Sbjct  142   ----------TQEKMVDTVVKKDESMKKEAMANGGERRKREAEKDGGRKQRRCWSSQLHR  191

Query  910   RFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             RFL ALQ LGG HVATPKQI+ELMKVDGLTNDEVKSHLQKYRLHTRRP+ ++ NN
Sbjct  192   RFLNALQHLGGPHVATPKQIKELMKVDGLTNDEVKSHLQKYRLHTRRPSQTVPNN  246



>gb|EYU40864.1| hypothetical protein MIMGU_mgv1a022733mg [Erythranthe guttata]
Length=299

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 136/286 (48%), Positives = 164/286 (57%), Gaps = 76/286 (27%)
 Frame = +1

Query  217   MRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECS  396
             M++C +YI ALEEER KIQVFQR+LPLCL+LVTQAIE  KQQL+   + CN        S
Sbjct  1     MQKCNDYIHALEEERSKIQVFQRDLPLCLDLVTQAIETCKQQLTHEKSGCN--------S  52

Query  397   EQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdss  576
             EQT  S+DD  PVLEEF+P+KRA+    D++ D+ +  ++  +   +             
Sbjct  53    EQT--SNDDVVPVLEEFMPIKRAADSDSDQDQDQSEEIRNIGNFDIN-------------  97

Query  577   dsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREKSA  756
                     SKK DWL+S QLWNQ+  DP  K++SP    V              +RE+  
Sbjct  98    --------SKKSDWLKSVQLWNQT-PDPPSKQDSPRKSDVV-----------ELRRERKE  137

Query  757   GTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQL  936
             G S                                   RK RRCWSPELHRRFLQA+QQL
Sbjct  138   GQSQ---------------------------------NRKARRCWSPELHRRFLQAIQQL  164

Query  937   GGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             GG HV TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+ +I NN
Sbjct  165   GGGHVGTPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSTTIHNN  210



>ref|XP_010425231.1| PREDICTED: uncharacterized protein LOC104710349 [Camelina sativa]
Length=348

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 195/338 (58%), Gaps = 49/338 (14%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N+  K  RC EYIEALEEERRKI VFQRELPLCLELVTQAIEAYK+++SGTTTE NL  G
Sbjct  10    NHNHKRERCSEYIEALEEERRKINVFQRELPLCLELVTQAIEAYKREISGTTTE-NL-YG  67

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QSECSEQTT    + G VL+ FIP++ +S+  ++ +D +    +S  H T+ D +D    
Sbjct  68    QSECSEQTTG---ECGRVLDLFIPIRHSSTSVEEVDDKDDDEHES--HETNIDFNDK---  119

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                          + K DWL+S QLWNQS       +   SN +    +N         K
Sbjct  120   -------------NMKSDWLKSVQLWNQS-------DAVVSNNRQDCLQNKPETLVKVLK  159

Query  742   REKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQ  921
             R       +  ++                   S     + + QRK RRCWS ELHRRFL 
Sbjct  160   RNDGEEGKNNNIKL--------------SVTSSSGGGSDGRGQRKNRRCWSQELHRRFLN  205

Query  922   ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqf  1101
              L+QLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRP+ +  NN    Q   F
Sbjct  206   TLKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHARRPSQTTPNN-GNSQNQHF  264

Query  1102  vvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
             VVVGGIWVP    + A A         T+ GIY P+ +
Sbjct  265   VVVGGIWVPQTNQSTANAV----ASVETTTGIYGPMVS  298



>emb|CDX81535.1| BnaC02g18390D [Brassica napus]
Length=343

 Score =   225 bits (573),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 178/295 (60%), Gaps = 49/295 (17%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             +Y +KM+RC EY+EALEEE++KIQVFQRELPLCLELVTQAIEA +++LS T+T       
Sbjct  4     DYAQKMQRCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIEACRKELSSTSTT------  57

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
               +CSEQTTS     GPVLEEFIP K+       EE+ E +SP                 
Sbjct  58    SEQCSEQTTSVSG--GPVLEEFIPTKKI------EENGEHESP-----------------  92

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                + +   +    KK DWLRS QLWN     P+P     SN +   +  G         
Sbjct  93    ---TPEEIGNNVDKKKSDWLRSVQLWN-----PSPDTNEVSNPE---RVVGKKAKVKKRP  141

Query  742   REKSAGTSSPAVQTLDsttagvgngsggg-------gggskkeeketQSQRKQRRCWSPE  900
                 A  S+PAV+ + S  A   + +               +++ ++Q++RKQRRCWSPE
Sbjct  142   AAVKAVASAPAVKVVASAPATTTSSTTETCGVGKGGEEHLHQQQSQSQTRRKQRRCWSPE  201

Query  901   LHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSI  1065
             LHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLHTRRP  ++
Sbjct  202   LHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLHTRRPATTV  256



>emb|CDX95998.1| BnaA07g27330D [Brassica napus]
Length=359

 Score =   225 bits (574),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 154/299 (52%), Positives = 183/299 (61%), Gaps = 46/299 (15%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
              ++  KM+RC EY+EAL+EE++KIQVFQRELPLCLELVTQAIEA K++LS T+T      
Sbjct  8     VDHAHKMQRCHEYVEALKEEQKKIQVFQRELPLCLELVTQAIEACKKELSVTSTT-----  62

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
                + SEQT S     GPVLEEFIP+K+    S +EE+ E +SP+  +    D       
Sbjct  63    -SEQYSEQTASVCG--GPVLEEFIPIKK----SNNEENGEHESPREVDKSDVD-------  108

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDP-TPKEESPSNCKVGVKRNGSG-GAFH  732
                           SKK DWLRSA LWN    DP      +     V VK N    G F 
Sbjct  109   --------------SKKSDWLRSAHLWNHHSQDPDMTVVVAKKARVVEVKPNSHNRGGFQ  154

Query  733   PFKREK----SAGTSSPAVQTLDs-------ttagvgngsggggggskkeeketQSQRKQ  879
             PF++EK    S     PAV+           +T  VG     G    +K++ +TQ+QRKQ
Sbjct  155   PFQKEKKRVFSETDLHPAVKATTPAPATTTCSTTEVGGADKAGEEQIQKQQLQTQTQRKQ  214

Query  880   RRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             RRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLHTRRP 
Sbjct  215   RRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLHTRRPA  273



>ref|XP_010502460.1| PREDICTED: uncharacterized protein LOC104779778 isoform X1 [Camelina 
sativa]
Length=349

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 193/338 (57%), Gaps = 48/338 (14%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N+  K   C EYIEALEEERRKI VFQRELPLCLELVTQAIEAYK+++SGTTTE NL  G
Sbjct  10    NHNHKREICSEYIEALEEERRKINVFQRELPLCLELVTQAIEAYKREISGTTTE-NL-YG  67

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QSECSEQTT    + G VL+ FIP+ R SS S +E DD+    +  +H T+ D +D    
Sbjct  68    QSECSEQTTG---ECGRVLDLFIPI-RHSSTSVEEVDDKDDDDEHESHETNIDFNDK---  120

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFK  741
                          + K DWL+S QLWNQS       +   SN +    +N         K
Sbjct  121   -------------NMKSDWLKSVQLWNQS-------DAVVSNNRQDCLQNKPETLVKDLK  160

Query  742   REKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQ  921
             R       +  ++                   S     + + QRK RRCWS ELHRRFL 
Sbjct  161   RNDGEEGKNNNIKL--------------SVTSSSGGGSDGRGQRKNRRCWSQELHRRFLN  206

Query  922   ALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqf  1101
             +L+QLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRP+ +   N    Q   F
Sbjct  207   SLKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHARRPSQTTPTN-GNSQNQHF  265

Query  1102  vvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
             VVVGGIWV         +    +  A T+ GIY P+ +
Sbjct  266   VVVGGIWV----PQTTHSTANAAASAETTTGIYGPMVS  299



>ref|XP_009393569.1| PREDICTED: transcription factor LUX-like [Musa acuminata subsp. 
malaccensis]
Length=354

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 151/349 (43%), Positives = 190/349 (54%), Gaps = 65/349 (19%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             ++++ C +YI ALEEER+KI+VFQRELPLCL+LVT AIE+ +QQ+S      N       
Sbjct  5     DRVQSCHDYIRALEEERKKIEVFQRELPLCLKLVTHAIESVRQQMSDGERVSN-------  57

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
                         GPVLEEFIPLK +            +SP S                  
Sbjct  58    ------------GPVLEEFIPLKPSF-----------KSPSSG-----------------  77

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREK  750
                 +      +K DWLRS QLWNQ   D + K E P    + V     GGAF PF+REK
Sbjct  78    --AVAAAIGSDRKPDWLRSVQLWNQE-PDTSLKVEPPKK-PIAVSAKRIGGAFQPFEREK  133

Query  751   ------------SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWS  894
                         ++ T+S   +            S GG    K++E + QS RK RRCWS
Sbjct  134   LVVPPPASRAVAASSTNSAGGRGEGGGCGDSDGSSSGGEKEEKEKEGQFQSHRKTRRCWS  193

Query  895   PELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             P+LHRRFL ALQQLGGSH ATPKQIR+LMKVDGLTNDE+KSHLQKYRLHTRRP+P+++++
Sbjct  194   PDLHRRFLNALQQLGGSHAATPKQIRDLMKVDGLTNDEIKSHLQKYRLHTRRPSPAVQSS  253

Query  1075  gsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTP  1221
                      +V    +      A A A  P +G  A +NGIYAPVA+ P
Sbjct  254   SHPAPQFVLLVPPPDY--AAAAAVAAAAQPGNGACAPTNGIYAPVASLP  300



>ref|XP_008446559.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor LUX [Cucumis 
melo]
Length=355

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 200/342 (58%), Gaps = 61/342 (18%)
 Frame = +1

Query  235   YIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTSS  414
             Y +AL+ ER+KIQVFQRELPLCLELVT+AI++ +QQLSG              S +++  
Sbjct  19    YADALDRERQKIQVFQRELPLCLELVTRAIDSCRQQLSGV-------------STESSEH  65

Query  415   DDDEGPVLEEFIPLKRASSLSQDE-EDDEQQSPKSANHRTdddddddnnnngdssdsskd  591
                + PVLEEFIP+ +    S  E E+DEQ  P                           
Sbjct  66    TSSDRPVLEEFIPINKPCVNSHFEIEEDEQSKPGKIEL----------------------  103

Query  592   gkVSKKQDWLRSAQLWNQS----FTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREKSAG  759
                  + DWL+SAQLWNQS     T+   KE + S  +V   +NG GGAF PF++     
Sbjct  104   ----GRSDWLKSAQLWNQSSDPPITEDVAKETTSSVVEV---KNGGGGAFQPFEKTTPLK  156

Query  760   TSSPAVQTLDs---------ttagvgngsggggggskkeeketQSQRKQRRCWSPELHRR  912
             T +  V    +         T++     S  GGG +K+E+KE+QSQRKQRRCWS ELHRR
Sbjct  157   TETAVVVGKTTGSPPIPEATTSSTAETASKCGGGTTKREDKESQSQRKQRRCWSSELHRR  216

Query  913   FLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS-IRNNgsqqq  1089
             F+ ALQQLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRPT S ++++GS   
Sbjct  217   FVHALQQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHARRPTNSAMQDSGSSSA  276

Query  1090  gpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
               QFVVVG IWVPPP            G     NGIYAPVAT
Sbjct  277   PQQFVVVGSIWVPPPPPPKYTVATTAKGR----NGIYAPVAT  314



>ref|XP_004954868.1| PREDICTED: uncharacterized protein LOC101769398 [Setaria italica]
Length=490

 Score =   228 bits (580),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 169/402 (42%), Positives = 216/402 (54%), Gaps = 63/402 (16%)
 Frame = +1

Query  151   ISISAMLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEA  330
             I+ +A  I +  P  S  Y  + RRC EY+ ALEEERRKIQVF+RELPLCL+LVTQ IE 
Sbjct  81    ITSAAQEIEMDPPLPSPQYAHR-RRCSEYLLALEEERRKIQVFKRELPLCLQLVTQTIEG  139

Query  331   YKQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSP  510
              K Q+ G  +E  ++               D GPVLEEF+PLK + SLS DE +    + 
Sbjct  140   MKSQMHGVGSEGTVS---------------DHGPVLEEFMPLKPSLSLSSDEHESADDA-  183

Query  511   KSANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSN-  687
              +A +     +     +   S  +  +  +    DWL+S QLW+Q   +P  +  SP   
Sbjct  184   -AATNDVGKKEKAAETHGRQSPPTEANKAMP---DWLQSVQLWSQ---EPQQQPSSPRKE  236

Query  688   --CK-VGVKRNGSGGAFHPFKREK----------SAGTSSPAVQTLDsttagvgngsggg  828
               CK V +    +G AF PF +EK          +A +S+    + D             
Sbjct  237   LLCKPVALNTRKAGDAFQPFVKEKRAEMPASPTTAAASSAVVGDSCDKVATDTSEKHSDK  296

Query  829   gggskkeeketQSQ----------RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIREL  978
                   ++    S+          RK RRCW+PELHRRFLQALQQLGGSHVATP QIREL
Sbjct  297   EMNKDAKDMGKYSKDKEGQSQAPNRKPRRCWAPELHRRFLQALQQLGGSHVATPTQIREL  356

Query  979   MKVDGLTNDEVKSHLQKYRLHTRRPTPSI----RNNgsqqqgpqfvvvggIWV-------  1125
             MKVDGLTNDEVKSHLQKYRLHTRRP  +      +  + Q  PQFVVVGGIWV       
Sbjct  357   MKVDGLTNDEVKSHLQKYRLHTRRPNSTTVVQSTSTSAAQPAPQFVVVGGIWVPPAEYAT  416

Query  1126  ---pppeyaaamapppTSGEAA-TSNGIYAPVATTPKQTQQN  1239
                     AAA +    +G+A+ T+N +YAPVAT P  T+Q 
Sbjct  417   AAAAASAAAAAQSQVQLAGDASGTANTVYAPVATLPSGTRQG  458



>ref|XP_002875280.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51539.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=354

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 161/350 (46%), Positives = 198/350 (57%), Gaps = 51/350 (15%)
 Frame = +1

Query  178   IHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTT  357
             I + +   NY +K  RC E+IEALEEERRKI VFQRE PLCLELVTQAIEAYK+++SGTT
Sbjct  2     IKNLSTMKNYNQKRERCCEFIEALEEERRKINVFQREFPLCLELVTQAIEAYKREISGTT  61

Query  358   TECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdd  537
             T  NL  GQSECSEQTT    + G +L+ FIP+K +S+  ++ +D +    +  +H TD 
Sbjct  62    TN-NL-YGQSECSEQTTG---ECGRILDLFIPIKHSSTSIEEVDDKDHDDEEHESHETDI  116

Query  538   dddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESP---SNCKVGVKR  708
             D DD                 + K +WL+S QLWNQS    + +++     +   V +  
Sbjct  117   DFDDK----------------NMKSEWLKSVQLWNQSDIVVSNRQDCSQEKTETLVELIN  160

Query  709   NGSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRC  888
                  A      EK+    SPA                    G        + QRK RRC
Sbjct  161   INDEAA------EKNNNIESPAT-----------------TSGGSGRGSGRRGQRKHRRC  197

Query  889   WSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIR  1068
             WS ELH  FL AL+QLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRP+ +  
Sbjct  198   WSQELHTHFLSALKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHARRPSQTTP  257

Query  1069  NNgsqqqgpqfvvvggIWV-pppeyaaamapppTSGEAATSNGIYAPVAT  1215
             NN    Q   FVVVGGIW+       A       SGE  T+ GIY P+ +
Sbjct  258   NN-KNSQTQHFVVVGGIWIPQTNHSTANAVNALASGE--TTTGIYGPMVS  304



>ref|XP_009105417.1| PREDICTED: uncharacterized protein LOC103831280 [Brassica rapa]
Length=359

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 182/299 (61%), Gaps = 46/299 (15%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
              ++  KM+RC EY+EAL+EE++KIQVFQRELPLCLELVTQAIEA K++LS T+T      
Sbjct  8     VDHAHKMQRCHEYVEALKEEQKKIQVFQRELPLCLELVTQAIEACKKELSVTSTT-----  62

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
                + SEQT S     GPVLEEFIP+K+    S +EE+ E +SP+  +    D       
Sbjct  63    -SEQYSEQTASVCG--GPVLEEFIPIKK----SNNEENREHESPREVDKSDVD-------  108

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDP-TPKEESPSNCKVGVKRNGSG-GAFH  732
                           SKK DWLRSA LWN    DP      +     V VK N    G F 
Sbjct  109   --------------SKKSDWLRSAHLWNHHSQDPDMTVVVAKKARVVEVKPNSHNRGGFQ  154

Query  733   PFKREK----SAGTSSPAVQTLDs-------ttagvgngsggggggskkeeketQSQRKQ  879
             PF++EK    S     PAV+           +T  VG     G    +K++ +TQ+QRKQ
Sbjct  155   PFQKEKKRVFSETDLHPAVKATTPAPATTTCSTTEVGGADKAGEEQIQKQQLQTQTQRKQ  214

Query  880   RRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             RRCWSPELHRRFL ALQQLGGSH ATPKQIR+ MKVDGLTNDEVKSHLQKYRLHTRRP 
Sbjct  215   RRCWSPELHRRFLHALQQLGGSHAATPKQIRDHMKVDGLTNDEVKSHLQKYRLHTRRPA  273



>ref|XP_006292736.1| hypothetical protein CARUB_v10018983mg [Capsella rubella]
 gb|EOA25634.1| hypothetical protein CARUB_v10018983mg [Capsella rubella]
Length=350

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 199/331 (60%), Gaps = 47/331 (14%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             +EYIEALE ERRKI VFQRELPLCLELVT+AIEAYK+++SGTTTE NL  GQSECSEQTT
Sbjct  15    REYIEALEVERRKINVFQRELPLCLELVTRAIEAYKREISGTTTE-NL-YGQSECSEQTT  72

Query  409   SSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdssk  588
                 + G VL+ FIPL R SS S +E DD+       +H+ D    + + +  D      
Sbjct  73    G---ECGRVLDLFIPL-RHSSTSVEEVDDKDVDDDEDDHQHDSHVTETDIDFSDK-----  123

Query  589   dgkVSKKQDWLRSAQLWNQSFTDPTPKEE-SPSNCKVGVK-RNGSGGAFHPFKREKSAGT  762
                 + K DWL+S QLWNQS    + ++E S  N K  V+  N +GG     +  K+  T
Sbjct  124   ----NMKSDWLKSVQLWNQSDAVVSKRQECSQDNTKSQVEVLNKNGG-----EERKNNNT  174

Query  763   SSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGG  942
               P                      + +     + QRK RRCWS ELHRRFL AL+QLGG
Sbjct  175   KLP---------------------ENTRNGDHGRGQRKNRRCWSQELHRRFLNALKQLGG  213

Query  943   SHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfvvvggIW  1122
              HVATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRP+ +  NN    Q   FVVVGGIW
Sbjct  214   PHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHARRPSQTTPNN-RDSQTQHFVVVGGIW  272

Query  1123  VpppeyaaamapppTSGEAATSNGIYAPVAT  1215
             VP   ++       +   A T+ GIY P+ +
Sbjct  273   VPQTNHSTGNTIVAS---AKTTPGIYGPMVS  300



>gb|KFK35065.1| hypothetical protein AALP_AA5G230700 [Arabis alpina]
Length=357

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 156/302 (52%), Positives = 188/302 (62%), Gaps = 48/302 (16%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI-  378
             NY +K  RC EYIEALEEERRKI VFQRELPLCLELVTQAIEAYK+++S TT E   NI 
Sbjct  3     NYNQKRERCCEYIEALEEERRKINVFQRELPLCLELVTQAIEAYKKEISETTME---NIC  59

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
             GQSECSEQTT    + GPVL+ FIP+K  S+  ++E +++    +  +H TD D +D   
Sbjct  60    GQSECSEQTTG---ECGPVLDLFIPIKHCSTSIEEENEEDDDDDEHESHETDIDFNDK--  114

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-----VKRNGSGG  723
                           S K +WL+  QLWNQ  T  + KE S    ++G     +KRN  G 
Sbjct  115   --------------SMKSEWLKYVQLWNQPDTVLSDKEGSQH--EIGRVVEAIKRN-DGA  157

Query  724   AFH-----PFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRC  888
             AFH         EK+    SP               +GG      +++   + QRKQRRC
Sbjct  158   AFHQTPCSETSNEKNEEGKSPTT------------INGGDQKKEAEKDYGRRGQRKQRRC  205

Query  889   WSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIR  1068
             WS ELHRRFL AL+QLGG HVATPKQIRELMK+DGLTNDEVKSHLQKYRLHTRRP+ +  
Sbjct  206   WSQELHRRFLNALKQLGGPHVATPKQIRELMKIDGLTNDEVKSHLQKYRLHTRRPSQTTP  265

Query  1069  NN  1074
             NN
Sbjct  266   NN  267



>ref|XP_009114112.1| PREDICTED: uncharacterized protein LOC103839360 isoform X1 [Brassica 
rapa]
 ref|XP_009114113.1| PREDICTED: uncharacterized protein LOC103839360 isoform X2 [Brassica 
rapa]
Length=367

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 205/355 (58%), Gaps = 37/355 (10%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             NY EK  RC EYI+ALEEERRKI VFQRELPLCLELVTQAIE YK+++S  T E NL  G
Sbjct  10    NYNEKRVRCCEYIKALEEERRKINVFQRELPLCLELVTQAIETYKKEISEATME-NL-CG  67

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QSECSEQTT    + G +L+ F P+K +S+  + EE++     +  ++ T  D DD    
Sbjct  68    QSECSEQTTG---ECGGILDLFRPIKHSSTSLEGEEEEVDADDEHESNETGLDCDDK---  121

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPK----EESPSNCKVGVKRNGSGGAF  729
                          + K +WL+S QLWNQ  +  + K    ++        +  N +G   
Sbjct  122   -------------NMKSEWLKSVQLWNQPDSVLSKKLERSQQETETVVEAINGNDNGTTS  168

Query  730   H-PFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELH  906
             H P   E S G S       D + A +                    +RK RRCWS ELH
Sbjct  169   HQPPCYETSNGKSGD-----DKSQASISGRQKMEAEKDISGGSGGIGRRKHRRCWSHELH  223

Query  907   RRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqq  1086
             RRFL  L+QLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  +I  N    
Sbjct  224   RRFLNTLKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPGQTIP-NKRDS  282

Query  1087  qgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPV-ATTPKQTQQNRTI  1248
             Q   FVVVGGIWV  P+ + + A   T+GE  T+ GIY P+ A  P Q+   RTI
Sbjct  283   QTQHFVVVGGIWV--PQASHSTANAATAGE--TTIGIYGPLQAEWPSQSNFGRTI  333



>ref|XP_003572723.1| PREDICTED: uncharacterized protein LOC100841245 [Brachypodium 
distachyon]
Length=396

 Score =   219 bits (558),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 165/373 (44%), Positives = 201/373 (54%), Gaps = 60/373 (16%)
 Frame = +1

Query  184   DPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTE  363
             DPA+ T      RR ++Y+ ALEEERRKI VFQRELPLCL+LVTQ IE  K Q+      
Sbjct  8     DPASDTR-----RRFRDYLLALEEERRKIHVFQRELPLCLDLVTQTIEGMKSQMDAV---  59

Query  364   CNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSL-SQDEEDDEQQSPKSANHRTddd  540
                 +G    SE+T S   D GPVLEEFIPLK + SL S +EE     +P ++  + + +
Sbjct  60    ----VG----SEETVS---DHGPVLEEFIPLKPSLSLCSSEEESTHAVAPVNSPKKDESE  108

Query  541   ddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK-VGVKRNGS  717
                        +            DWL+S QLW+Q      P +E P  CK V +    +
Sbjct  109   RARPPTPETKKAMP----------DWLQSVQLWSQEPQQSCPNKELP--CKPVALNATKT  156

Query  718   GGAFHPFKREKSA------------------GTSSPAVQTLDsttagvgngsggggggsk  843
              GAFHPF++EK A                  G S     T D+  A              
Sbjct  157   RGAFHPFEKEKRAEPELPASSTTAAASSAVVGDSCGDKATSDTEVAHEKIKDTNKDMEKD  216

Query  844   ke---eketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVK  1014
              +     + Q  RK RRCW+PELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVK
Sbjct  217   SKEGQSSQQQHNRKARRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVK  276

Query  1015  SHLQKYRLH-TRRPTPSIRNNgsqqqgpqfvvvgg---IWVpppeyaaamapppTSGEAA  1182
             SHLQKYRLH TRRP+ ++  + +  Q      V     IWVPP EYAAA A    +  + 
Sbjct  277   SHLQKYRLHTTRRPSSTVAQSNNAAQAAAPQFVVVGSCIWVPPQEYAAAAAQQQANNNSP  336

Query  1183  TSNGIYAPVATTP  1221
                 +YAPVAT P
Sbjct  337   AV--VYAPVATMP  347



>emb|CDY04180.1| BnaA09g19580D [Brassica napus]
Length=337

 Score =   217 bits (552),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 167/355 (47%), Positives = 204/355 (57%), Gaps = 58/355 (16%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             NY EK  RC EYI+ALEEERRKI VFQRELPLCLELVTQAIE YK+++S  T E NL  G
Sbjct  10    NYNEKRVRCCEYIKALEEERRKINVFQRELPLCLELVTQAIETYKKEISEATME-NL-CG  67

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             QSECSEQTT    + G +L+ F P+K +S+  + EE++     +  ++ T  D DD    
Sbjct  68    QSECSEQTTG---ECGGILDLFRPIKHSSTSLEGEEEEVDADDEHESNETGLDCDDK---  121

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPK----EESPSNCKVGVKRNGSGGAF  729
                          + K +WL+S QLWNQ  +  + K    ++        +  N +G   
Sbjct  122   -------------NMKSEWLKSVQLWNQPDSVLSKKLERSQQETETVVEAINGNDNGTTS  168

Query  730   H-PFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELH  906
             H P   E S G S                           ++K    +RK RRCWS ELH
Sbjct  169   HQPPCYETSNGKSG--------------------------DDKSQARRRKHRRCWSHELH  202

Query  907   RRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqq  1086
             RRFL  L+QLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  +I  N    
Sbjct  203   RRFLNTLKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPGQTI-PNKRDS  261

Query  1087  qgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPV-ATTPKQTQQNRTI  1248
             Q   FVVVGGIWV  P+ + + A   T+GE  T+ GIY P+ A  P Q+   RTI
Sbjct  262   QTQHFVVVGGIWV--PQASHSTANAATAGE--TTIGIYGPLQAEWPSQSNFGRTI  312



>gb|EMT22828.1| Two-component response regulator ARR2 [Aegilops tauschii]
Length=402

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 167/406 (41%), Positives = 216/406 (53%), Gaps = 64/406 (16%)
 Frame = +1

Query  166   MLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQL  345
             M + +  P A  +     RR Q+Y+ ALEEERRKI VFQRELPLCL+LVTQ IE  K Q+
Sbjct  1     MEMEMEVPPAQADCDGARRRLQDYLLALEEERRKIHVFQRELPLCLDLVTQTIEGMKSQM  60

Query  346   SGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANH  525
              G              SE+T S  D  GPVLEEFIPLK + SLS  +++       ++NH
Sbjct  61    GGA------------ASEETVS--DHGGPVLEEFIPLKPSLSLSSSDDE-------TSNH  99

Query  526   RTdddddddnnnngdssdsskdgkVSKKQDWLRSAQL--WNQSFTDPTPKEESPSNCK-V  696
                    +        +  +K        DWL+SAQL  W++     + ++  P  C+ V
Sbjct  100   HAAAPVSNAKAETPPPTPETKKAM----PDWLQSAQLSTWSEPQQSSSLQKVLP--CRPV  153

Query  697   GVKRNGSGGAFHPFKREK-------SAGTSSPAVQTL----------Dsttagvgngsgg  825
              +    +GGAFHPF++EK       ++ T++PA   L          D+      +    
Sbjct  154   ALNATRTGGAFHPFEKEKQPEPELPASSTTAPASSALVGDSGDKATSDTEVHDKDSKDVT  213

Query  826   ggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTND  1005
                  K +E  +Q  RK RRCW+PELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTND
Sbjct  214   EKDTDKDKEGHSQPNRKPRRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTND  273

Query  1006  EVKSHLQKYRLHT-RRPTPSIRNNgsqqqgpqfv---vvggIWV-----pppeyaaamap  1158
             EVKSHLQKYRLHT RRP+ + ++  +    P      V   IWV          AAA A 
Sbjct  274   EVKSHLQKYRLHTSRRPSSTAQSGATAATQPAPQFFVVGSCIWVPQQEYAAAAAAAAAAA  333

Query  1159  ppTSGEAATSNGIYAPVATTP--------KQTQQNRTIPFSGEKGG  1272
               T+    ++N +YA  AT P        KQ+ +    P SG+ GG
Sbjct  334   DATNVAPGSANQVYARTATLPSGLKPHLEKQSSRQSEGPRSGDTGG  379



>ref|XP_010495195.1| PREDICTED: transcription activator GLK1-like isoform X1 [Camelina 
sativa]
Length=344

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 146/305 (48%), Positives = 173/305 (57%), Gaps = 75/305 (25%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ +Y +K  RC +YIEALEEERRKI VFQRELPLCL+LVTQAIEA K+++   TTE   
Sbjct  6     SNMDYNQKRERCGQYIEALEEERRKIHVFQRELPLCLDLVTQAIEACKREMPEMTTE---  62

Query  373   NI-GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
             N+ GQ ECSEQTT    + GPVLE+F+ +K  SS S +E DDE       NH  D+D +D
Sbjct  63    NVYGQPECSEQTTG---ECGPVLEQFLTIK-DSSTSNEELDDEH-----GNHDPDNDSED  113

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKV-GVKRNG----  714
                              + K DWL+S QLWNQ      PKEE      +  VKR+     
Sbjct  114   K----------------NTKSDWLKSVQLWNQP-DQLLPKEEQLQKEMMETVKRDHENLR  156

Query  715   -----SGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQ  879
                  +GG     + EK  G                                     RKQ
Sbjct  157   KDPMVNGGEGRKREAEKDVGGG-----------------------------------RKQ  181

Query  880   RRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP  1059
             RRCWS +LHRRFL ALQ LGG HVATPKQIRELMK+DGLTNDEVKSHLQKYRLHTRRP  
Sbjct  182   RRCWSSQLHRRFLNALQHLGGPHVATPKQIRELMKIDGLTNDEVKSHLQKYRLHTRRPRQ  241

Query  1060  SIRNN  1074
             ++ NN
Sbjct  242   TVPNN  246



>emb|CDY38609.1| BnaC06g30320D [Brassica napus]
Length=361

 Score =   216 bits (549),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 205/353 (58%), Gaps = 53/353 (15%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
              ++  KM+RC EY EAL+EE++KIQVFQRELPLCLELVTQAIEA K++LS T+T      
Sbjct  8     VDHAHKMQRCHEYAEALKEEQKKIQVFQRELPLCLELVTQAIEACKKELSVTSTT-----  62

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
                  SEQT S     GPVLEEFI +K+    S +EE+ E +SP+       D       
Sbjct  63    -SERYSEQTASVCG--GPVLEEFIQIKK----SNNEENGEHESPREVEKSDVD-------  108

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSG-GAFHP  735
                           SKK DWLRS  LWN S    T    +     V VK N    G F P
Sbjct  109   --------------SKKSDWLRSTHLWNHSQDPDTTVVVAKKARVVEVKPNSHNRGGFQP  154

Query  736   FKREK----SAGTSSPAVQTLDs---------ttagvgngsggggggskkeeketQSQRK  876
             F++E+    S     PAV+             +T  VG     G    +K++ +TQ+QRK
Sbjct  155   FQKEQKRVFSETDLHPAVKATTPAPAPATTTCSTTEVGGVDKAGEEQVQKQQLQTQTQRK  214

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             QRRCWSPELHRRFL ALQQLGGSHVATPKQIR+ MKVDGLTNDEVKSHLQKYRLHTRRP 
Sbjct  215   QRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLHTRRPA  274

Query  1057  PSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
              +  N     Q PQ VVVGGIWVP P+   + +    +      +G+YAPV +
Sbjct  275   TAQGNG--NSQQPQLVVVGGIWVPSPQDFPSPSDVANN----KGDGVYAPVTS  321



>ref|XP_010495201.1| PREDICTED: transcription activator GLK1-like isoform X2 [Camelina 
sativa]
Length=342

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 171/304 (56%), Gaps = 75/304 (25%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ +Y +K  RC +YIEALEEERRKI VFQRELPLCL+LVTQAIEA K+++   TTE   
Sbjct  6     SNMDYNQKRERCGQYIEALEEERRKIHVFQRELPLCLDLVTQAIEACKREMPEMTTE---  62

Query  373   NI-GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
             N+ GQ ECSEQTT    + GPVLE+F+ +K  SS S +E DDE       NH  D+D +D
Sbjct  63    NVYGQPECSEQTTG---ECGPVLEQFLTIK-DSSTSNEELDDEH-----GNHDPDNDSED  113

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNG-----  714
                              + K DWL+S QLWNQ   D    +E        VKR+      
Sbjct  114   K----------------NTKSDWLKSVQLWNQP--DQLLPKELQKEMMETVKRDHENLRK  155

Query  715   ----SGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQR  882
                 +GG     + EK  G                                     RKQR
Sbjct  156   DPMVNGGEGRKREAEKDVGGG-----------------------------------RKQR  180

Query  883   RCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             RCWS +LHRRFL ALQ LGG HVATPKQIRELMK+DGLTNDEVKSHLQKYRLHTRRP  +
Sbjct  181   RCWSSQLHRRFLNALQHLGGPHVATPKQIRELMKIDGLTNDEVKSHLQKYRLHTRRPRQT  240

Query  1063  IRNN  1074
             + NN
Sbjct  241   VPNN  244



>ref|NP_001046702.1| Os02g0325600 [Oryza sativa Japonica Group]
 dbj|BAD15692.1| myb family transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAF08616.1| Os02g0325600 [Oryza sativa Japonica Group]
 dbj|BAG95241.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89081.1| unnamed protein product [Oryza sativa Japonica Group]
Length=412

 Score =   216 bits (551),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 169/376 (45%), Positives = 202/376 (54%), Gaps = 61/376 (16%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             RRC+EY+ ALEEERRKIQVFQRELPLC +LVTQ IE  + Q+    +E            
Sbjct  13    RRCREYLLALEEERRKIQVFQRELPLCFDLVTQTIEGMRSQMDAAGSE------------  60

Query  400   QTTSSDDDEGPVLEEFIPLK----RASSLSQDEEDDEQQSPKSANHRTdddddddnnnng  567
               T SD    PVLEEFIPLK     +SS  +    D  +S K     T +          
Sbjct  61    -ETVSDQGPPPVLEEFIPLKPSLSLSSSEEESTHADAAKSGKKEEAETSERHSSPPPPPP  119

Query  568   dssdsskdgkVSKKQDWLRSAQLWNQ------SFTDPTPKEESPSNCK-VGVKRNGSGGA  726
             ++   +         DWL+S QLW+Q      S   PTP ++ P  CK V +    +GGA
Sbjct  120   EAKKVTP--------DWLQSVQLWSQEEPQQPSSPSPTPTKDLP--CKPVALNARKAGGA  169

Query  727   FHPFKREKSA----------------GTSSPAVQTLDsttagvgngsggggggskkeeke  858
             F PF++EK A                G S       D+      +         K +E +
Sbjct  170   FQPFEKEKRAELPASSTTAAASSTVVGDSGDKPTDDDTEKHMETDKDNDKDAKDKDKEGQ  229

Query  859   tQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRL  1038
             +Q  RK RRCW+PELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRL
Sbjct  230   SQPHRKPRRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRL  289

Query  1039  HTRRPT----PSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppT-------SGEAAT  1185
             HTRRP+     S          PQFVVVG IWVPPPEYAAA A           +  + +
Sbjct  290   HTRRPSSTGQSSAAAGVPAPPAPQFVVVGSIWVPPPEYAAAAAAQQHVQLAAAGNNASGS  349

Query  1186  SNGIYAPVATTPKQTQ  1233
             +N +YAPVA  P   Q
Sbjct  350   ANPVYAPVAMLPAGLQ  365



>dbj|BAJ92842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 162/388 (42%), Positives = 211/388 (54%), Gaps = 59/388 (15%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             RR ++Y+ ALEEERRKI VFQRELPLCL+LVTQ IE  K Q+ G              SE
Sbjct  14    RRLRDYLLALEEERRKIHVFQRELPLCLDLVTQTIEGMKSQMGGA------------ASE  61

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
             +T S  D +GPVLEEFIPLK + S S  +++    +P   ++   +          ++  
Sbjct  62    ETVS--DHDGPVLEEFIPLKPSLSPSSSDDETSTHAPAPVSNAKAETPPPTPTPTPETKK  119

Query  580   sskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK-VGVKRNGSGGAFHPFKREK--  750
             +          DWL+SAQL   S    +   +    C+ V +    +GGAFHPF++EK  
Sbjct  120   AMP--------DWLQSAQLLTWSEPQQSSSLQKVLPCRPVALNATRTGGAFHPFEKEKQP  171

Query  751   -----SAGTSSPAVQTL-----------DsttagvgngsggggggskkeeketQSQRKQR  882
                  ++ T++PA   L                     +        KE + +Q  RK R
Sbjct  172   EAELPASSTTAPASSALVGDSGDKATSDTEVHDKDSKDATEKDTDKDKEGQSSQPNRKPR  231

Query  883   RCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHT-RRPTP  1059
             RCW+PELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHT RRP+ 
Sbjct  232   RCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTSRRPSS  291

Query  1060  SIRNNgsqqqgpqf----vvvggIWVpppeyaaamapppTSGEA-----ATSNGIYAPVA  1212
             + +++G+           VV   IWVP  EYAAA A    + +A      ++N +YAP A
Sbjct  292   TAQSSGAATTTQPAPQFFVVGSCIWVPQQEYAAAAAAAAAATDATNVAPGSANKVYAPTA  351

Query  1213  TTP--------KQTQQNRTIPFSGEKGG  1272
             T P        +Q+ +    P SG+ GG
Sbjct  352   TLPSGVKPHSKEQSSRRSEGPMSGDTGG  379



>emb|CDY39188.1| BnaC09g21560D [Brassica napus]
Length=348

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 168/358 (47%), Positives = 207/358 (58%), Gaps = 46/358 (13%)
 Frame = +1

Query  178   IHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTT  357
             I+  +   NY EK  RC EYI+ALEEERRKI VFQRELPLCLELVTQAIE YK+++S  T
Sbjct  2     INSLSNMKNYNEKRVRCCEYIKALEEERRKINVFQRELPLCLELVTQAIETYKKEISEPT  61

Query  358   TECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdd  537
              E NL  GQSECSEQTT    + G +L+ F P+K +S+  + EE++     +  ++ T  
Sbjct  62    ME-NL-CGQSECSEQTTG---ECGGILDLFRPIKHSSTSLEGEEEEVDVDDEHESNETGL  116

Query  538   dddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGS  717
             D DD                 + K +WL+S QLWNQ  +  + K E        V    +
Sbjct  117   DCDDK----------------NMKSEWLKSVQLWNQPDSVLSNKLERSQQETETVVEAIN  160

Query  718   GGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSP  897
             G            GT+    Q +++     G   G GG            +RK RRCWS 
Sbjct  161   GN---------DNGTTISGRQKMEAEKDISGGSGGSGG----------IGRRKHRRCWSH  201

Query  898   ELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNg  1077
             ELHRRFL  L+QLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  +I  N 
Sbjct  202   ELHRRFLNTLKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPGQTI-PNK  260

Query  1078  sqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATT-PKQTQQNRTI  1248
                Q   FVVVGGIWV  P+ + + A   T+GE  T+ GIY P+ +  P Q+   RTI
Sbjct  261   RDSQTQHFVVVGGIWV--PQASHSTANAATAGE--TTIGIYGPLQSEWPSQSNFGRTI  314



>emb|CDY51129.1| BnaA07g37120D [Brassica napus]
Length=320

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 150/344 (44%), Positives = 192/344 (56%), Gaps = 68/344 (20%)
 Frame = +1

Query  196   STNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLN  375
             + +Y  K +RC++YIEAL EE++KIQVF+R+LPLCL LVTQAIE+Y+++LS  +   ++ 
Sbjct  7     NMDYTLKKKRCEDYIEALVEEQQKIQVFKRDLPLCLSLVTQAIESYRKELSEFSRSEHI-  65

Query  376   IGQSECSEQTTS---SDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTddddd  546
               Q E SE+TTS     D    + EEF+P+K    +  DE ++                 
Sbjct  66    --QPEGSERTTSECEGRDGCIALCEEFVPIKSCERVKDDEAENNIDK-------------  110

Query  547   ddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGA  726
                                KK +WL   QLWNQS  DP   E+  +NC           A
Sbjct  111   -------------------KKSEWL---QLWNQS-PDPQSIEDQTTNC----------DA  137

Query  727   FHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELH  906
             F PF++ K A  S P      + TA       GG     +++K+ Q  RKQRRCWS ELH
Sbjct  138   FQPFQKGKLA-YSQPLKAITPTPTASSSTAETGGNKKEMEQQKQLQMHRKQRRCWSSELH  196

Query  907   RRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TPSIRNNgsq  1083
             RRFL ALQ+LGGSHVATPKQIR+LM+VDGLTNDEVKSHLQKYRLHTRRP TP++ N    
Sbjct  197   RRFLHALQKLGGSHVATPKQIRDLMQVDGLTNDEVKSHLQKYRLHTRRPATPTLTNGCEN  256

Query  1084  qqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
              Q  Q +VV GIWV                + A +N +YAPVA 
Sbjct  257   PQQQQLIVVEGIWV--------------PSKDAVNNRVYAPVAV  286



>ref|XP_010476326.1| PREDICTED: transcription activator GLK1-like [Camelina sativa]
Length=348

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 143/296 (48%), Positives = 173/296 (58%), Gaps = 53/296 (18%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ +Y +K  RC +YIEALEEERRKI VFQRELPLCL+LVTQAIEA K+++   TTE   
Sbjct  6     SNMDYNQKRERCGQYIEALEEERRKIHVFQRELPLCLDLVTQAIEACKREMPEMTTE---  62

Query  373   NI-GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
             N+ GQ ECSEQTT    + GPVLE+F+ +K +S+   +EE+DE+   +  NH  D+D +D
Sbjct  63    NVYGQPECSEQTTG---ECGPVLEQFLTIKDSST--SNEEEDEELDDEHGNHDPDNDSED  117

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPT-PKEESPSNCKVGVKRNGSGGA  726
                              + K DWL+S QLWNQ   DP  PKEE                 
Sbjct  118   K----------------NTKSDWLKSVQLWNQP--DPLLPKEERLQQ-----------EM  148

Query  727   FHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELH  906
                 KR+       P V   +          G                RKQRRCWS +LH
Sbjct  149   METVKRDHENMRKDPMVNGGEGRKREAEKDVG--------------GGRKQRRCWSSQLH  194

Query  907   RRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             RRFL ALQ LGG HVATPKQIRELMK+DGLTNDEVKSHLQKYRLHTRRP  ++ NN
Sbjct  195   RRFLNALQHLGGPHVATPKQIRELMKIDGLTNDEVKSHLQKYRLHTRRPRQTVPNN  250



>ref|XP_009413646.1| PREDICTED: transcription factor LUX-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 155/354 (44%), Positives = 193/354 (55%), Gaps = 60/354 (17%)
 Frame = +1

Query  214   KMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSEC  393
             + RR  +YI AL+EER+KI+VFQRELPLCL+LVTQAIE+ + +            G+ E 
Sbjct  6     RARRYHDYIRALKEERKKIEVFQRELPLCLQLVTQAIESVRHR-----------AGEEEG  54

Query  394   SEQTTSSDDDEGPVLEEFIPLKRA--SSLSQDEEDDEQQSPKSANHRTdddddddnnnng  567
                       EGPVLEEFIPLK +  S+LS++E+ + ++S  +                 
Sbjct  55    VY--------EGPVLEEFIPLKPSPTSTLSEEEKGETRKSAAAIG---------------  91

Query  568   dssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKRE  747
                         +K +WLRS QLWNQ   D   K E P    + V     GGAF PF RE
Sbjct  92    ----------WDRKPEWLRSVQLWNQE-PDTDLKVEPPKK-PIAVSLKKIGGAFQPFDRE  139

Query  748   K----------SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQ--RKQRRCW  891
             K          +   SS A         G      G   G + +EKE QSQ  RK RRCW
Sbjct  140   KHVAPPAVVAVAPPASSTAGGGDGKGGGGGCADVDGSRSGGRDKEKEGQSQPHRKARRCW  199

Query  892   SPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRN  1071
             SPELHRRFL ALQ+LGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP++++
Sbjct  200   SPELHRRFLHALQRLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPTVQS  259

Query  1072  NgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTPKQTQ  1233
             + S    P       +           A  P +G  A  + IYAP+A+ P  ++
Sbjct  260   SSSSTSSPPATQFVLVGGILVSPPDYAAASPGNGAYAPPDSIYAPLASVPSDSK  313



>ref|XP_009403982.1| PREDICTED: probable transcription factor GLK2 [Musa acuminata 
subsp. malaccensis]
Length=340

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 147/333 (44%), Positives = 184/333 (55%), Gaps = 54/333 (16%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             RC + I ALEEERRKI+ FQRELPLCL+LVT+AIE  ++Q+ G     N           
Sbjct  10    RCHDCIRALEEERRKIEAFQRELPLCLQLVTRAIECVREQM-GDDESVN-----------  57

Query  403   TTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssds  582
                    + PVLEEFIPLK   SL+    +   ++ K+A                     
Sbjct  58    -------DAPVLEEFIPLK--PSLASTSSEGSGEAKKAA---------------------  87

Query  583   skdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREKSAGT  762
                G++  K DWLRS QLW+Q   D   K E P    + V    +GGAF PF+REK A T
Sbjct  88    -MVGRLETKPDWLRSVQLWDQQ-PDTVLKVEPPKK-PMAVSLKKTGGAFQPFEREKHATT  144

Query  763   SSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGG  942
                A     + T   G G    GG  +K+E+++   RK RRCWSPELHR FL AL++LGG
Sbjct  145   PPAATAAASNFTTSRGGGDSSRGGEMEKKEEQSPVHRKARRCWSPELHRLFLHALERLGG  204

Query  943   SHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfvvvggIW  1122
             SHVATPKQIRE+M+VDGLTNDEVKSHLQKYRLHTRRP P+ +++                
Sbjct  205   SHVATPKQIREMMEVDGLTNDEVKSHLQKYRLHTRRPNPADQSS---------SSRPQFV  255

Query  1123  VpppeyaaamapppTSGEAATSNGIYAPVATTP  1221
             +         +PP  +G  A  NGIYAPVA+ P
Sbjct  256   LVGGLVVPPASPPGGNGACAPPNGIYAPVASRP  288



>ref|NP_563926.1| protein HRS1 [Arabidopsis thaliana]
 gb|AAG09552.1|AC011810_11 Unknown Protein [Arabidopsis thaliana]
 gb|AAK32923.1|AF367336_1 At1g13300/T6J4_6 [Arabidopsis thaliana]
 gb|AAM70574.1| At1g13300/T6J4_6 [Arabidopsis thaliana]
 gb|AEE28996.1| myb-like transcription factor family protein [Arabidopsis thaliana]
Length=344

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 144/302 (48%), Positives = 174/302 (58%), Gaps = 68/302 (23%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ +Y +K  RC +YIEALEEERRKI VFQRELPLCL+LVTQAIEA K++L   TTE N+
Sbjct  6     SNMDYNQKRERCGQYIEALEEERRKIHVFQRELPLCLDLVTQAIEACKRELPEMTTE-NM  64

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTddddddd  552
               GQ ECSEQTT    + GPVLE+F+ +K +S  + +EE+DE+   +  NH  D+D +D 
Sbjct  65    -YGQPECSEQTTG---ECGPVLEQFLTIKDSS--TSNEEEDEEFDDEHGNHDPDNDSEDK  118

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGS-----  717
                             + K DWL+S QLWNQ      PKEE     +  + R+ S     
Sbjct  119   ----------------NTKSDWLKSVQLWNQPDHPLLPKEERLQ--QETMTRDESMRKDP  160

Query  718   ---GGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRC  888
                GG     + EK  G                                     RKQRRC
Sbjct  161   MVNGGEGRKREAEKDGGGG-----------------------------------RKQRRC  185

Query  889   WSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIR  1068
             WS +LHRRFL ALQ LGG HVATPKQIRE MKVDGLTNDEVKSHLQKYRLHTRRP  ++ 
Sbjct  186   WSSQLHRRFLNALQHLGGPHVATPKQIREFMKVDGLTNDEVKSHLQKYRLHTRRPRQTVP  245

Query  1069  NN  1074
             NN
Sbjct  246   NN  247



>ref|XP_010458781.1| PREDICTED: transcription activator GLK1-like [Camelina sativa]
Length=349

 Score =   209 bits (533),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 141/308 (46%), Positives = 174/308 (56%), Gaps = 78/308 (25%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ +Y +K  RC +YIEALEEERRKI VFQRELPLCL+LVTQAIEA K+++   TTE   
Sbjct  6     SNMDYNQKRERCGQYIEALEEERRKIHVFQRELPLCLDLVTQAIEACKREMPEMTTE---  62

Query  373   NI-GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
             N+ GQ ECSEQTT    + GPVLE+F+ +K +S+     E++E+   +  NH  D+D +D
Sbjct  63    NVYGQPECSEQTTG---ECGPVLEQFLTIKDSST---SNEEEEELDDEHGNHDPDNDSED  116

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPT-PKEE------------SPSNC  690
                              + K DWL+S QLWNQ   DP  PKEE               N 
Sbjct  117   K----------------NTKSDWLKSVQLWNQP--DPLLPKEERLQQEMMETVKSDHENM  158

Query  691   KVGVKRNGSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQ  870
             +     NG+ G     +++   G                                     
Sbjct  159   RKDPMVNGAEGRKREAEKDVGGG-------------------------------------  181

Query  871   RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             RKQRRCWS +LHRRFL ALQ LGG HVATPKQIRELMK+DGLTNDEVKSHLQKYRLHTRR
Sbjct  182   RKQRRCWSSQLHRRFLNALQHLGGPHVATPKQIRELMKIDGLTNDEVKSHLQKYRLHTRR  241

Query  1051  PTPSIRNN  1074
             P  ++ NN
Sbjct  242   PRQTVPNN  249



>gb|EAZ27297.1| hypothetical protein OsJ_11233 [Oryza sativa Japonica Group]
Length=399

 Score =   210 bits (535),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 165/370 (45%), Positives = 197/370 (53%), Gaps = 62/370 (17%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             RRC+EY+ ALEEERRKIQVFQRELPLC +LVTQ IE  + Q+    +E            
Sbjct  13    RRCREYLLALEEERRKIQVFQRELPLCFDLVTQTIEGMRSQMDAAGSE------------  60

Query  400   QTTSSDDDEGPVLEEFIPLK----RASSLSQDEEDDEQQSPKSANHRTdddddddnnnng  567
               T SD    PVLEEFIPLK     +SS  +    D  +S K     T +          
Sbjct  61    -ETVSDQGPPPVLEEFIPLKPSLSLSSSEEESTHADAAKSGKKEEAETSERHSSPPPPPP  119

Query  568   dssdsskdgkVSKKQDWLRSAQLWNQSFTDPT-PKEESPSNCKVGVKRNGSGGAFHPFKR  744
             ++   +         DWL+S QLW+Q   +P  P   SP+  K       +GGAF PF++
Sbjct  120   EAKKVTP--------DWLQSVQLWSQE--EPQQPSSPSPTPTK-------AGGAFQPFEK  162

Query  745   EKSA----------------GTSSPAVQTLDsttagvgngsggggggskkeeketQSQRK  876
             EK A                G S       D+      +         K +E ++Q  RK
Sbjct  163   EKRAELPASSTTAAASSTVVGDSGDKPTDDDTEKHMETDKDNDKDAKDKDKEGQSQPHRK  222

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
              RRCW+PELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+
Sbjct  223   PRRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPS  282

Query  1057  ----PSIRNNgsqqqgpqfvvvggIWVpppeyaaamapppT-------SGEAATSNGIYA  1203
                  S          PQFVVVG IWV PPEYAAA A           +  + ++N +YA
Sbjct  283   STGQSSAAAGVPAPPAPQFVVVGSIWVTPPEYAAAAAAQQHVQLAAAGNNASGSANPVYA  342

Query  1204  PVATTPKQTQ  1233
             PVA  P   Q
Sbjct  343   PVAMLPAGLQ  352



>gb|AAM62792.1| unknown [Arabidopsis thaliana]
Length=351

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 163/346 (47%), Positives = 201/346 (58%), Gaps = 54/346 (16%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N  +K  +C EYIEALEEERRKI VFQRELPLC+ELVTQAIEAYK+++SGT+T+ NL  G
Sbjct  3     NDNQKREKCCEYIEALEEERRKINVFQRELPLCVELVTQAIEAYKREISGTSTD-NL-YG  60

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRAS-SLSQDEEDDEQQSPKSANHRTdddddddnn  558
             QSECSEQTT    + G +L+ FIP+K +S S+ ++ +D +    +  +H TD D DD   
Sbjct  61    QSECSEQTTG---ECGRILDLFIPIKHSSTSIEEEVDDKDDDDEEHQSHETDIDFDDK--  115

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-----VKRNGSGG  723
                           + K +WL+S QLWNQS    +   +  S  K       +K N    
Sbjct  116   --------------NMKSEWLKSVQLWNQSDAVVSNNRQDRSQEKTETLVELIKINDEAA  161

Query  724   AFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPEL  903
                    +K+    SP V T D               G        + QRK RRCWS EL
Sbjct  162   -------KKNNNIKSP-VTTSD---------------GGSGGGGGRRGQRKNRRCWSQEL  198

Query  904   HRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsq  1083
             HRRFL AL+QLGG HVATPKQIR++MKVDGLTNDEVKSHLQKYRLH RRP+ +  NN   
Sbjct  199   HRRFLNALKQLGGPHVATPKQIRDIMKVDGLTNDEVKSHLQKYRLHARRPSQTTPNN-RN  257

Query  1084  qqgpqfvvvggIWV-pppeyaaamapppTSGEAATSNGIYAPVATT  1218
              Q   FVVVGGIWV       A       SGE  T+ GIY P+ ++
Sbjct  258   SQTQHFVVVGGIWVPQTNHSTANAVNAVASGE--TTTGIYGPMVSS  301



>ref|XP_010556381.1| PREDICTED: two-component response regulator ARR18-like [Tarenaya 
hassleriana]
Length=352

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 177/296 (60%), Gaps = 42/296 (14%)
 Frame = +1

Query  196   STNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLN  375
             + +Y +  +R  EYIEAL+EERRKI VFQRELPLCLELVTQAIEA K++ S T    N  
Sbjct  7     NMDYSQNHKRFGEYIEALQEERRKILVFQRELPLCLELVTQAIEACKRETSDTMENMN--  64

Query  376   IGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddn  555
              GQSECSEQ+T   D  G VLEEFIP+K + S + D++DDE++    A    D D+ DD+
Sbjct  65    -GQSECSEQSTG--DCGGLVLEEFIPIKPSFSSAHDDDDDEEEEEDEAEEEEDSDEHDDD  121

Query  556   nnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHP  735
                            + K DWL+S QLWNQ  T P  +        V VK NG       
Sbjct  122   K--------------NPKSDWLKSVQLWNQPDTIPIEERSREKETVVEVKNNG-------  160

Query  736   FKREKS----AGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPEL  903
                EKS        +PA  T D    G  N +    G           +RKQRRCWS +L
Sbjct  161   VMCEKSNVDVESRKTPA--TADGGGGGRKNEAVKDAG----------GKRKQRRCWSQDL  208

Query  904   HRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRN  1071
             HRRFL ALQQLGG+ VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+ +  N
Sbjct  209   HRRFLNALQQLGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSQTAGN  264



>ref|XP_009103752.1| PREDICTED: uncharacterized protein LOC103829805 [Brassica rapa]
Length=336

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 186/335 (56%), Gaps = 63/335 (19%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             RC+EYIEAL EE++KIQVF+R+LPLCL LVTQAIE+Y+++LS  +   ++   Q E SE+
Sbjct  27    RCEEYIEALVEEQKKIQVFKRDLPLCLSLVTQAIESYRKELSEFSRSEHI---QPEGSER  83

Query  403   TTS---SDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngds  573
             TTS     D    + EEF+P+K    +  DE ++                          
Sbjct  84    TTSECEGRDGCIALCEEFVPIKSCERVKDDEAENNIDK----------------------  121

Query  574   sdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREKS  753
                       KK +WL   QLWNQS  DP P E+  +     VK N        F++ K 
Sbjct  122   ----------KKSEWL---QLWNQS-PDPQPIEDQTTTVVAAVKENCDA-----FQKGKL  162

Query  754   AGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQ  933
             A  S P      + TA       GG     +++K+ Q  RKQRRCWS ELHRRFL ALQ+
Sbjct  163   A-YSQPLKAITPTPTASSSTAETGGNKKEMEQQKQLQMHRKQRRCWSSELHRRFLHALQK  221

Query  934   LGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TPSIRNNgsqqqgpqfvvv  1110
             LGGSHVATPKQIR+LM+VDGLTNDEVKSHLQKYRLHTRRP TP++ N     Q  Q +VV
Sbjct  222   LGGSHVATPKQIRDLMQVDGLTNDEVKSHLQKYRLHTRRPATPTLTNGCENPQQQQLIVV  281

Query  1111  ggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
              GIWV                + A +N +YAPVA 
Sbjct  282   EGIWV--------------PSKDAVNNRVYAPVAV  302



>ref|NP_566778.1| myb-like transcription factor family protein [Arabidopsis thaliana]
 dbj|BAA95766.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77068.1| myb-like transcription factor family protein [Arabidopsis thaliana]
Length=357

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 162/346 (47%), Positives = 200/346 (58%), Gaps = 55/346 (16%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N  +K  +C EYIEALEEERRKI VFQRELPLC+ELVTQAIEAYK+++SGT+T+ NL  G
Sbjct  10    NDNQKREKCCEYIEALEEERRKINVFQRELPLCVELVTQAIEAYKREISGTSTD-NL-YG  67

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRAS-SLSQDEEDDEQQSPKSANHRTdddddddnn  558
             QSECSEQTT    + G +L+ FIP+K +S S+ ++ +D +    +  +H TD D DD   
Sbjct  68    QSECSEQTTG---ECGRILDLFIPIKHSSTSIEEEVDDKDDDDEEHQSHETDIDFDDK--  122

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVG-----VKRNGSGG  723
                           + K +WL+S QLWNQS    +   +  S  K       +K N    
Sbjct  123   --------------NMKSEWLKSVQLWNQSDAVVSNNRQDRSQEKTETLVELIKINDEAA  168

Query  724   AFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPEL  903
                    +K+    SP V T D               G        + QRK RRCWS EL
Sbjct  169   -------KKNNNIKSP-VTTSD---------------GGSGGGGGRRGQRKNRRCWSQEL  205

Query  904   HRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsq  1083
             HRRFL AL+QLGG HVATPKQIR++MKVDGLTNDEVKSHLQKYRLH RRP+ +  NN   
Sbjct  206   HRRFLNALKQLGGPHVATPKQIRDIMKVDGLTNDEVKSHLQKYRLHARRPSQTTPNN-RN  264

Query  1084  qqgpqfvvvggIWV-pppeyaaamapppTSGEAATSNGIYAPVATT  1218
              Q   FVVVGGIWV       A       SGE   + GIY P+ ++
Sbjct  265   SQTQHFVVVGGIWVPQTNHSTANAVNAVASGE---TTGIYGPMVSS  307



>ref|XP_006833539.1| hypothetical protein AMTR_s00093p00110710 [Amborella trichopoda]
 gb|ERM98817.1| hypothetical protein AMTR_s00093p00110710 [Amborella trichopoda]
Length=334

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 135/274 (49%), Positives = 159/274 (58%), Gaps = 48/274 (18%)
 Frame = +1

Query  238   IEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTSSD  417
             +EALEEE+RKIQVFQRELPLCL LVTQAI   ++QL  +  E     G  E     TS +
Sbjct  1     MEALEEEKRKIQVFQRELPLCLHLVTQAINTCREQLELSNEEVPARSGYGE-----TSGE  55

Query  418   DDEGPVLEEFIPLKRASS-LSQDEEDDEQQSPKSANHRTdddddddnnnngdssdsskdg  594
             D   P  EEF PLKR++S  +Q    ++++ P+  N                        
Sbjct  56    D---PPFEEFFPLKRSTSETTQAPAGEKKRKPEDQN------------------------  88

Query  595   kVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREKSAGTSSPA  774
                 K DWLRS QLWN S  DP+  E++  N K+G K+    GAF PF RE+     +  
Sbjct  89    ---DKPDWLRSVQLWN-SDADPSRNEDAGLNPKLGTKKQR--GAFQPFSREREGRAEA--  140

Query  775   VQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVA  954
                     +G GN         ++ EKE Q  RK RRCWSPELHRRFL ALQQLGGSH A
Sbjct  141   -------VSGSGNERVKVREKEREREKEGQPNRKSRRCWSPELHRRFLHALQQLGGSHTA  193

Query  955   TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             TPKQIRELMKVDGLTNDEVKSHLQKYRLHTR P 
Sbjct  194   TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRTPA  227



>ref|XP_006417135.1| hypothetical protein EUTSA_v10008054mg [Eutrema salsugineum]
 gb|ESQ35488.1| hypothetical protein EUTSA_v10008054mg [Eutrema salsugineum]
Length=352

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 143/299 (48%), Positives = 167/299 (56%), Gaps = 68/299 (23%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ NY +K  RC +YIEALEEERRKI VFQRELPLCL+LVTQAIEA K+++  TT E   
Sbjct  6     SNMNYNQKRERCGQYIEALEEERRKIHVFQRELPLCLDLVTQAIEACKREVPETTVENAY  65

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTddddddd  552
               GQ ECSEQTT    + GPVLE+F+ +K  SS S +EE +E+       H   D D D 
Sbjct  66    --GQPECSEQTTG---ECGPVLEQFLTIK-DSSTSNEEEQEEEDDELDDEHGNHDPDKDS  119

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSN---CKVGVKRN----  711
              +              + K DWL+S QLWNQ   DP   +E  S     +  V R+    
Sbjct  120   EDK-------------NMKSDWLKSVQLWNQ--PDPLLLKEERSQREMMETVVNRDESMR  164

Query  712   ----GSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQ  879
                  SGG     + EK  G                                     RKQ
Sbjct  165   KDPATSGGDGRKREAEKDGGG------------------------------------RKQ  188

Query  880   RRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             RRCWS +LHRRFL ALQ LGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+
Sbjct  189   RRCWSSQLHRRFLNALQHLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPS  247



>ref|XP_010926496.1| PREDICTED: uncharacterized protein LOC105048754 isoform X2 [Elaeis 
guineensis]
Length=231

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 134/276 (49%), Positives = 156/276 (57%), Gaps = 49/276 (18%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
              ++ E+ RR QEY+EALEEERRKI+VFQRELPLCL+LVTQAIE  +           + I
Sbjct  1     MDFAERARRYQEYVEALEEERRKIEVFQRELPLCLQLVTQAIEGIR-----------IQI  49

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
             G SE  E  T     +GPVLEEFIPLK  SS  ++E+    +  +  +            
Sbjct  50    GSSE--EMVT-----DGPVLEEFIPLKPTSSSIEEEKGGLMEIEQERS------------  90

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPF  738
                            KK DWLRS QLWNQ      PK E P    + V    S GAFHPF
Sbjct  91    --------------EKKPDWLRSVQLWNQETDHSLPKGEPPKK-PIAVNAKKSSGAFHPF  135

Query  739   KREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFL  918
             +REK               ++    G GGGG   K +E ++Q  RK RRCWSPELH RFL
Sbjct  136   EREKHVPAVPAGAAA----SSSTVGGGGGGGEKEKDKEGQSQPPRKARRCWSPELHCRFL  191

Query  919   QALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  1026
               L QLGGSH ATPKQIRELMKVDGLTNDEVKSHLQ
Sbjct  192   HVLDQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQ  227



>ref|XP_010044289.1| PREDICTED: uncharacterized protein LOC104433298 [Eucalyptus grandis]
Length=375

 Score =   205 bits (521),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 167/354 (47%), Positives = 201/354 (57%), Gaps = 40/354 (11%)
 Frame = +1

Query  205   YPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLS--GTTTECNLNI  378
             YPE+ R    Y+EALEEERRKIQVF+RELPLCLELV QAIE  KQQLS  G ++ECN   
Sbjct  3     YPERTR---SYVEALEEERRKIQVFERELPLCLELVIQAIERCKQQLSVQGHSSECN---  56

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
                  SEQT+    D+G VLE FIPLK   S       D+ +          D D D + 
Sbjct  57    -----SEQTSM---DDGRVLEVFIPLKGPYS------GDDDEDDACEEEGDGDGDGDGDV  102

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEE-------SPSNCKVGVKRN--  711
             ++    D   D    +K DWLRSAQLWN +  DP P  E        P + +V    N  
Sbjct  103   HHSSRDDKGGDDNAMEKSDWLRSAQLWNPN-PDPIPHREVQDPPPPPPPSKEVAAVANHL  161

Query  712   --GSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQ-SQRKQR  882
                  GAF PF+  ++   S+   Q      +   + +      +       Q +QRKQR
Sbjct  162   KSHESGAFRPFRIGEN--NSTKKKQPPGRAASPAPDAAACSTAETASGRTSKQAAQRKQR  219

Query  883   RCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             RCWS ELHR FL ALQQLGG  VATPKQIRE+MKVDGLTNDEVKSHLQKYRLH RRP+P+
Sbjct  220   RCWSTELHRGFLHALQQLGGPDVATPKQIREVMKVDGLTNDEVKSHLQKYRLHARRPSPN  279

Query  1063  IRNNgsqqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVATTPK  1224
               NN +  Q PQF+VVGGIW+ PP + A           A SN +YAPV   P+
Sbjct  280   GHNN-ANAQAPQFLVVGGIWMQPPGFPAVATGKLPL--EAASNRVYAPVTMLPQ  330



>emb|CDY16075.1| BnaC08g40480D [Brassica napus]
Length=349

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 143/306 (47%), Positives = 173/306 (57%), Gaps = 71/306 (23%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
              + +Y +K  RC +Y+EALEEERRKI VFQRELPLCL+LVTQAIEA K++L     + NL
Sbjct  6     GNMDYNQKRERCGQYMEALEEERRKIHVFQRELPLCLDLVTQAIEACKRELPEMAID-NL  64

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTddddddd  552
               GQSECSEQTT   +    VLE+F+ +K  S+ +++EE DE+   +   H  D+D +D 
Sbjct  65    -YGQSECSEQTTG--ECRPVVLEQFLTIKDLSTSNEEEEKDEEFDDEHGTHDPDNDSEDK  121

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPT-PKEE--SPSNCKVGVKRNGS--  717
                             + K DWL+S QLWNQ   DP  PKEE   P   +  VK + S  
Sbjct  122   ----------------NMKSDWLKSVQLWNQP--DPLLPKEERLQPKMIETVVKIDESMR  163

Query  718   -------GGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRK  876
                    GG     + +K  G                                     RK
Sbjct  164   KDLMVNGGGEGRRKEADKDGG-------------------------------------RK  186

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             QRRCWS +LHRRFL ALQ LGG HVATPKQIRE MKVDGLTNDEVKSHLQKYRLHTRRP+
Sbjct  187   QRRCWSSQLHRRFLNALQHLGGPHVATPKQIREFMKVDGLTNDEVKSHLQKYRLHTRRPS  246

Query  1057  PSIRNN  1074
              +I NN
Sbjct  247   QTIPNN  252



>gb|KDO70083.1| hypothetical protein CISIN_1g016585mg [Citrus sinensis]
Length=331

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 178/289 (62%), Gaps = 39/289 (13%)
 Frame = +1

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQS---PKSANHRTddddddd  552
             QSECSEQT+S    +GP+LEEFIP+KR+SS   ++ D++ +    P + N+  + + + D
Sbjct  4     QSECSEQTSS----DGPILEEFIPIKRSSSHDDNDNDNDDRHSNRPTTTNNNREKEKNSD  59

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK---VGVKRNGSGG  723
                              KK DWLRS QLWNQS  DP PKEE     K   V VKRNGSGG
Sbjct  60    K----------------KKSDWLRSVQLWNQS-PDPQPKEEEVVPRKATVVEVKRNGSGG  102

Query  724   AFHPFKREKSA---------GTSSPAVQTLDsttagvgngsggggggskkeeketQSQRK  876
             AF PF REK           G  +  V T  + ++      G G    K ++KE Q QRK
Sbjct  103   AFQPFHREKCGEKKDQQQRLGKVNTPVPTA-AASSTTDTAVGKGEKNDKDKDKEGQPQRK  161

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             QRR WSPELHRRFL ALQQLGGSH ATPKQIRELM VDGLTNDEVKSHLQKYRLHTRRP+
Sbjct  162   QRRSWSPELHRRFLHALQQLGGSHAATPKQIRELMNVDGLTNDEVKSHLQKYRLHTRRPS  221

Query  1057  PSIRNNgsqqqgpqfvvvggIWVpp-peyaaamapppTSGEAATSNGIY  1200
             P++ N     Q PQFVVVGGIWV      A A   P  +G  ATSNGIY
Sbjct  222   PAMHNG-GNPQAPQFVVVGGIWVQAPDYAAVAAKAPGEAGSIATSNGIY  269



>ref|XP_010554240.1| PREDICTED: two-component response regulator-like APRR2 [Tarenaya 
hassleriana]
Length=260

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 159/294 (54%), Gaps = 57/294 (19%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
              +Y  K +   E IE LEEERRKI VFQRE PLCLELVTQ IEA K+++SGT    N+N 
Sbjct  8     VDYTRKRQTRGECIETLEEERRKILVFQREFPLCLELVTQTIEACKREMSGTAAADNMN-  66

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
              Q ECSEQT        P+LEEF+P+KR+SS       DE  S +S N RTDD       
Sbjct  67    SQWECSEQTNGEYGR--PILEEFMPIKRSSS------GDEHGSHRS-NGRTDDS------  111

Query  559   nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEE--SPSNCKVGVKRNGSGGAFH  732
                             K DWL+S QLWNQ   D   KEE        VGV+RNG      
Sbjct  112   --------------DTKSDWLKSVQLWNQP--DQPTKEERLQEKETVVGVERNG------  149

Query  733   PFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRR  912
                        +P  +T+              G            +RKQRR WS +LHRR
Sbjct  150   ------KENRKTPETETIGGGDGMKNEAEKDVGV-----------KRKQRRYWSRDLHRR  192

Query  913   FLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             FL ALQQLGG+H ATPKQIR +MKV GLTND+VKSHLQKYRLHTR P+  +  N
Sbjct  193   FLNALQQLGGAHAATPKQIRGIMKVGGLTNDQVKSHLQKYRLHTRGPSQVLTTN  246



>ref|XP_008799313.1| PREDICTED: uncharacterized protein LOC103713999 isoform X3 [Phoenix 
dactylifera]
Length=239

 Score =   198 bits (503),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 158/286 (55%), Gaps = 52/286 (18%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
              +  E+ RRC EY+EALEEERRKIQVF RELPLCL+LVT+AIE+ + Q+           
Sbjct  1     MDLAERARRCHEYVEALEEERRKIQVFPRELPLCLQLVTEAIESIRVQMGS---------  51

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDD--EQQSPKSANHRTddddddd  552
                  SE+T +    +GPVLEEFIPLK  SS  ++E+    E    +S N          
Sbjct  52    -----SEETVT----DGPVLEEFIPLKPTSSSIEEEKGGSMEMDQERSDN----------  92

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFH  732
                               K DWLRS QLW+Q      PK E P    + V     GGAF 
Sbjct  93    ------------------KPDWLRSVQLWSQDPDHSLPKAEPPKK-PIAVNAKKIGGAFR  133

Query  733   PFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRR  912
             PF REK      P+        +    G G  G   K +E ++Q  RK RRCWSP+LHR+
Sbjct  134   PFDREKHVPAPVPSAAA---PASSTTVGGGSSGEKEKDKEGQSQPHRKARRCWSPDLHRQ  190

Query  913   FLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             F+ ALQQLGGSH ATPKQIRELMKVD LTNDEVKSHLQ  ++  +R
Sbjct  191   FIHALQQLGGSHAATPKQIRELMKVDDLTNDEVKSHLQDSKISNQR  236



>ref|XP_006303753.1| hypothetical protein CARUB_v10011925mg [Capsella rubella]
 gb|EOA36651.1| hypothetical protein CARUB_v10011925mg [Capsella rubella]
Length=344

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 139/296 (47%), Positives = 174/296 (59%), Gaps = 57/296 (19%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ +Y +K  RC +YIEALEEERRKI VFQRELPLCL+LVTQAIEA K+++   TTE   
Sbjct  6     SNMDYNQKRERCGQYIEALEEERRKIHVFQRELPLCLDLVTQAIEACKREIPEMTTE---  62

Query  373   NI-GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
             N+ GQ ECSEQTT    + GPVLE+F+ +K  SS S +EED+E    +  NH  D  D +
Sbjct  63    NVYGQPECSEQTTG---ECGPVLEQFLTIK-DSSTSNEEEDEELMDDEHGNHDPDITDSE  118

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDP-TPKEESPSNCKVGVKRNGSGGA  726
             D                + K DWL+S QLWNQ   DP  PKEE                 
Sbjct  119   DK---------------NTKSDWLKSVQLWNQP--DPLLPKEERLQQ-------------  148

Query  727   FHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELH  906
                              +T+++              G +  ++E + ++++R CWS +LH
Sbjct  149   -----------------ETMETMKRDESMRKDPMMNGGEGRKREAEGRKQRR-CWSSQLH  190

Query  907   RRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             RRFL ALQ LGG HVATPKQIRE MKVDGLTNDEVKSHLQKYRLHTRRP  ++ NN
Sbjct  191   RRFLNALQHLGGPHVATPKQIREFMKVDGLTNDEVKSHLQKYRLHTRRPRQTVSNN  246



>ref|XP_008799314.1| PREDICTED: uncharacterized protein LOC103713999 isoform X4 [Phoenix 
dactylifera]
Length=229

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 154/278 (55%), Gaps = 52/278 (19%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
              +  E+ RRC EY+EALEEERRKIQVF RELPLCL+LVT+AIE+ + Q+           
Sbjct  1     MDLAERARRCHEYVEALEEERRKIQVFPRELPLCLQLVTEAIESIRVQMGS---------  51

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDD--EQQSPKSANHRTddddddd  552
                  SE+T +    +GPVLEEFIPLK  SS  ++E+    E    +S N          
Sbjct  52    -----SEETVT----DGPVLEEFIPLKPTSSSIEEEKGGSMEMDQERSDN----------  92

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFH  732
                               K DWLRS QLW+Q      PK E P    + V     GGAF 
Sbjct  93    ------------------KPDWLRSVQLWSQDPDHSLPKAEPPKK-PIAVNAKKIGGAFR  133

Query  733   PFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRR  912
             PF REK      P+        +    G G  G   K +E ++Q  RK RRCWSP+LHR+
Sbjct  134   PFDREKHVPAPVPSAAA---PASSTTVGGGSSGEKEKDKEGQSQPHRKARRCWSPDLHRQ  190

Query  913   FLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  1026
             F+ ALQQLGGSH ATPKQIRELMKVD LTNDEVKSHLQ
Sbjct  191   FIHALQQLGGSHAATPKQIRELMKVDDLTNDEVKSHLQ  228



>ref|XP_006417134.1| hypothetical protein EUTSA_v10008054mg [Eutrema salsugineum]
 gb|ESQ35487.1| hypothetical protein EUTSA_v10008054mg [Eutrema salsugineum]
Length=351

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 142/299 (47%), Positives = 166/299 (56%), Gaps = 69/299 (23%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ NY +K  RC +YIEALEEERRKI VFQRELPLCL+LVTQAIEA K+++  TT E   
Sbjct  6     SNMNYNQKRERCGQYIEALEEERRKIHVFQRELPLCLDLVTQAIEACKREVPETTVENAY  65

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTddddddd  552
               GQ ECSEQTT    + GPVLE+F+ +K  SS S +EE +E+       H   D D D 
Sbjct  66    --GQPECSEQTTG---ECGPVLEQFLTIK-DSSTSNEEEQEEEDDELDDEHGNHDPDKDS  119

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSN---CKVGVKRN----  711
              +              + K DWL+S QLWNQ   DP   +E  S     +  V R+    
Sbjct  120   EDK-------------NMKSDWLKSVQLWNQ--PDPLLLKEERSQREMMETVVNRDESMR  164

Query  712   ----GSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQ  879
                  SGG     + EK  G                                     RKQ
Sbjct  165   KDPATSGGDGRKREAEKDGGG------------------------------------RKQ  188

Query  880   RRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             RRCWS +LHRRFL ALQ LGG H ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+
Sbjct  189   RRCWSSQLHRRFLNALQHLGGPH-ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPS  246



>emb|CDY20522.1| BnaC07g11890D [Brassica napus]
Length=330

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 152/344 (44%), Positives = 194/344 (56%), Gaps = 59/344 (17%)
 Frame = +1

Query  196   STNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLN  375
             + +Y  K +RC+EYIEALEEE++KIQVF+RELPLCL LVTQAIE+Y ++LS  +   ++ 
Sbjct  7     NMDYTLKKKRCEEYIEALEEEQKKIQVFKRELPLCLSLVTQAIESYWKELSEFSRSEHI-  65

Query  376   IGQSECSEQTTSSDDDEGPVL---EEFIPLKRASSLSQDEEDDEQQSPKSANHRTddddd  546
               QSE SE+TTS  +     +   EEF+P+K    +  DE ++                 
Sbjct  66    --QSEGSERTTSEFEGRDGCIALSEEFVPIKSCERVKDDEAENNVDK-------------  110

Query  547   ddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGA  726
                                KK +WL   QLWNQS  DP P E+  +   V  + N + GA
Sbjct  111   -------------------KKSEWL---QLWNQS-PDPQPIEDQTTTV-VAAEVNENCGA  146

Query  727   FHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELH  906
             F PF++ K A  S P      +  A       GG     +++K+ Q  RKQRRCWS ELH
Sbjct  147   FQPFQKGKLA-YSQPLKAITPTPKASSSTAETGGNKKEMEQQKQLQMHRKQRRCWSSELH  205

Query  907   RRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP-TPSIRNNgsq  1083
             RRFL ALQ+LGGSH ATPKQIR+LM+VDGLTNDEVKSHLQKYRLHTRRP TP++ N    
Sbjct  206   RRFLHALQRLGGSHAATPKQIRDLMQVDGLTNDEVKSHLQKYRLHTRRPATPTLTNGCES  265

Query  1084  qqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
              Q  Q +VV GIWV                +   +N +YAPVA 
Sbjct  266   PQQQQLIVVEGIWV--------------PSKDGVNNRVYAPVAV  295



>ref|XP_008799312.1| PREDICTED: uncharacterized protein LOC103713999 isoform X2 [Phoenix 
dactylifera]
Length=272

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 154/278 (55%), Gaps = 52/278 (19%)
 Frame = +1

Query  199   TNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI  378
              +  E+ RRC EY+EALEEERRKIQVF RELPLCL+LVT+AIE+ + Q+           
Sbjct  1     MDLAERARRCHEYVEALEEERRKIQVFPRELPLCLQLVTEAIESIRVQMG----------  50

Query  379   GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDD--EQQSPKSANHRTddddddd  552
                  SE+T +    +GPVLEEFIPLK  SS  ++E+    E    +S N          
Sbjct  51    ----SSEETVT----DGPVLEEFIPLKPTSSSIEEEKGGSMEMDQERSDN----------  92

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFH  732
                               K DWLRS QLW+Q      PK E P    + V     GGAF 
Sbjct  93    ------------------KPDWLRSVQLWSQDPDHSLPKAEPPKK-PIAVNAKKIGGAFR  133

Query  733   PFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRR  912
             PF REK      P+        +    G G  G   K +E ++Q  RK RRCWSP+LHR+
Sbjct  134   PFDREKHVPAPVPSAAA---PASSTTVGGGSSGEKEKDKEGQSQPHRKARRCWSPDLHRQ  190

Query  913   FLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  1026
             F+ ALQQLGGSH ATPKQIRELMKVD LTNDEVKSHLQ
Sbjct  191   FIHALQQLGGSHAATPKQIRELMKVDDLTNDEVKSHLQ  228



>ref|XP_004171557.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101203539 
[Cucumis sativus]
Length=311

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 154/337 (46%), Positives = 181/337 (54%), Gaps = 92/337 (27%)
 Frame = +1

Query  235   YIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTSS  414
             Y +AL+ ER+KIQVFQRELPLCLELVT+AI++ +QQLSG +TE             ++  
Sbjct  19    YADALDRERQKIQVFQRELPLCLELVTRAIDSCRQQLSGVSTE-------------SSEH  65

Query  415   DDDEGPVLEEFIPLKRASSLSQDE-EDDEQQSPKSANHRTdddddddnnnngdssdsskd  591
                + PVLEEFIP+ +    S  E E+DEQ  P                           
Sbjct  66    TSSDRPVLEEFIPINKPCVNSHFEIEEDEQSKPGKIE-----------------------  102

Query  592   gkVSKKQDWLRSAQLWNQSFTDPTPKE---ESPSNCKVGVKR-----NGSGGAFHPFKRE  747
                  + DWL+SAQLWNQS  DP   E   +     +  V+R     NG G A    KRE
Sbjct  103   ---LGRSDWLKSAQLWNQS-PDPPLTEVRIQFQFRKRQQVRRREPLLNGGGTA----KRE  154

Query  748   KSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQAL  927
                                                KE+Q+QRKQRRCWS ELHRRF+ AL
Sbjct  155   D----------------------------------KESQTQRKQRRCWSSELHRRFVHAL  180

Query  928   QQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT-PSIRNNgsqqqgpqfv  1104
             QQLGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLH RRPT  +++++GS     QFV
Sbjct  181   QQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHLRRPTNTAMQDSGSSSAHQQFV  240

Query  1105  vvggIWVpppeyaaamapppTSGEAATSNGIYAPVAT  1215
             VVG IWVPPP            G     NGIYAPVAT
Sbjct  241   VVGSIWVPPPPPPKYTVATTEKGR----NGIYAPVAT  273



>emb|CDY19382.1| BnaC05g08910D [Brassica napus]
Length=340

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 139/287 (48%), Positives = 176/287 (61%), Gaps = 59/287 (21%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI-GQSECSE  399
             RC +YIEALEEERRKI VFQRELPLCL+LVTQAIE  K++++ T T+   N+ GQSECSE
Sbjct  7     RCGQYIEALEEERRKILVFQRELPLCLDLVTQAIERCKKEITETATD---NVYGQSECSE  63

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
             QTT       PVLE+F+ +K +S+ +++E ++E +  +  NH  ++D +D          
Sbjct  64    QTTGQCT---PVLEQFLTIKDSSTFNEEEVEEEFEDEQ-GNHDPENDSEDKIM-------  112

Query  580   sskdgkVSKKQDWLRSAQLWNQSFTDPT-PKEE-SPSNCKVGVKRNGSGGAFHPFKREKS  753
                      K DWL+S QLWNQ   DP  PKEE S    +  VKR+ S        RE +
Sbjct  113   ---------KSDWLKSVQLWNQP--DPLLPKEEQSQQMMETVVKRDES-------MREDA  154

Query  754   AGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQ  933
                ++   +                           +++RKQRRCWS +LHRRFL ALQ 
Sbjct  155   NAMANSGERR------------------------RRETERKQRRCWSSQLHRRFLNALQH  190

Query  934   LGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             LGG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+ ++ NN
Sbjct  191   LGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSQTVPNN  237



>ref|NP_001136626.1| uncharacterized protein LOC100216751 [Zea mays]
 gb|ACF82295.1| unknown [Zea mays]
Length=459

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 151/338 (45%), Positives = 186/338 (55%), Gaps = 68/338 (20%)
 Frame = +1

Query  205   YPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQ  384
             + ++ RR ++Y+ ALEEERRKIQVFQRELPLCL+LVTQ IE  +  +       ++ +G 
Sbjct  12    HADRRRRFRDYLLALEEERRKIQVFQRELPLCLDLVTQTIEGMRSHMD------SVVVG-  64

Query  385   SECSEQTTSSDDDEGPVLEEFIPLK---RASSLSQDEEDDEQQSPKSANHR-----Tddd  540
                SE+T S  D  GPVLEEF+PLK    +SS SQ    DE  S     HR     T +D
Sbjct  65    ---SEETVS--DHGGPVLEEFMPLKPTTLSSSSSQPHYQDEHDSAHYLEHRRGSAATAND  119

Query  541   ddddnnnngdssdsskdgkVSKKQ-----------DWLRSAQLWNQ----SFTDPTPKEE  675
               D + +     D       S +            DWL+S QLW+     S + P  ++E
Sbjct  120   VVDADKDGEAVGDLETAAASSSRPLPHPETKKAMPDWLQSVQLWSNQQQPSASPPQHQDE  179

Query  676   SPSNCKVGVKRNGS---GGAFHPFKREK------------------SAGTSS--------  768
                 C+  V  N     GGAF PF++EK                  +A +S+        
Sbjct  180   LLLPCRP-VALNACRKPGGAFQPFEKEKKKKDKEEKQRAELELPLPAAASSAVVGDSCDR  238

Query  769   PAVQTLDsttagvgngsggggggskkeeketQSQ---RKQRRCWSPELHRRFLQALQQLG  939
               V   D+ TA     S   GG  K+ +  +QSQ   RK RRCW+PELHRRFLQALQQLG
Sbjct  239   AGVTDTDTDTAENNKASSNKGGNDKEAQLSSQSQAPSRKARRCWAPELHRRFLQALQQLG  298

Query  940   GSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             GSHVATPKQIRELM VDGLTNDEVKSHLQKYRLHTRRP
Sbjct  299   GSHVATPKQIRELMNVDGLTNDEVKSHLQKYRLHTRRP  336



>gb|AFW56037.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=459

 Score =   198 bits (503),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 152/338 (45%), Positives = 184/338 (54%), Gaps = 68/338 (20%)
 Frame = +1

Query  205   YPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQ  384
             + ++ RR ++Y+ ALEEERRKIQVFQRELPLCL+LVTQ IE  +  +       ++ +G 
Sbjct  12    HADRRRRFRDYLLALEEERRKIQVFQRELPLCLDLVTQTIEGMRSHMD------SVVVG-  64

Query  385   SECSEQTTSSDDDEGPVLEEFIPLK---RASSLSQDEEDDEQQSPKSANHR-----Tddd  540
                SE+T S  D  GPVLEEF+PLK    +SS SQ    DE  S     HR     T +D
Sbjct  65    ---SEETVS--DHGGPVLEEFMPLKPTTLSSSSSQPHYQDEHDSAHYLEHRRGSAATAND  119

Query  541   ddddnnnngdssdsskdgkVSKKQ-----------DWLRSAQLWNQ----SFTDPTPKEE  675
               D + +     D       S +            DWL+S QLW+     S + P  ++E
Sbjct  120   VVDADKDGEAVGDLETAAASSSRPLPHPETKKAMPDWLQSVQLWSNQQQPSASPPQHQDE  179

Query  676   SPSNCKVGVKRNGS---GGAFHPFKREKS-----------------AGTSSPAV------  777
                 C+  V  N     GGAF PF++EK                  A  SS  V      
Sbjct  180   LLLPCRP-VALNACRKPGGAFQPFEKEKKKKDKEEKQRAELELPLPAAASSAVVGDSCDR  238

Query  778   ---QTLDsttagvgngsggggggskkeeketQSQ---RKQRRCWSPELHRRFLQALQQLG  939
                   D+ TA     S   GG  K+ +  +QSQ   RK RRCW+PELHRRFLQALQQLG
Sbjct  239   AGATDTDTDTAENNKASSNKGGNDKEAQLSSQSQAPSRKARRCWAPELHRRFLQALQQLG  298

Query  940   GSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             GSHVATPKQIRELM VDGLTNDEVKSHLQKYRLHTRRP
Sbjct  299   GSHVATPKQIRELMNVDGLTNDEVKSHLQKYRLHTRRP  336



>ref|XP_002889999.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66258.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 172/295 (58%), Gaps = 52/295 (18%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             ++ +Y +K  RC +YIEALEEERRKI VFQRELPLCL+LVTQAIEA K+++   TT+   
Sbjct  6     SNMDYNQKRERCGKYIEALEEERRKIHVFQRELPLCLDLVTQAIEACKREIPEMTTD---  62

Query  373   NI-GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
             N+ GQ ECSEQTT    + GPVLE+F+ +K +S  + +EE DE+   +  NH  D+  +D
Sbjct  63    NVYGQPECSEQTTG---ECGPVLEQFLTIKDSS--TSNEEVDEEFDDEHGNHDPDNGSED  117

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAF  729
                              + K DWL+S QLWNQ                            
Sbjct  118   K----------------NTKSDWLKSVQLWNQ--------------------------PD  135

Query  730   HPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHR  909
             H   +E+     +    T D +       +G  G   + E+     ++++R CWS +LHR
Sbjct  136   HLLPKEERLQQETMETVTRDESMRKDPMVNGCEGRKREAEKDGGGGRKQRR-CWSSQLHR  194

Query  910   RFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             RFL ALQ LGG HVATPKQIRELMKVDGLTNDEVKSHLQK+RLHTRRP  ++ NN
Sbjct  195   RFLNALQHLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKFRLHTRRPRQTVPNN  249



>emb|CDX97993.1| BnaA06g07440D [Brassica napus]
Length=345

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 176/286 (62%), Gaps = 61/286 (21%)
 Frame = +1

Query  226   CQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI-GQSECSEQ  402
             C +YI+ALEEERRKI VFQRELPLCL+LVTQAIE  K++++ T T+   N+ GQSECSEQ
Sbjct  15    CGQYIKALEEERRKILVFQRELPLCLDLVTQAIERCKKEITETATD---NVYGQSECSEQ  71

Query  403   TTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssds  582
             TT       PVLE+F+ +K +S+ +++E ++E +  +  NH  ++D +D+          
Sbjct  72    TTGQCT---PVLEQFLTIKDSSTFNEEEVEEEFEDEQ-GNHDPENDSEDN----------  117

Query  583   skdgkVSKKQDWLRSAQLWNQSFTDPT-PKEE-SPSNCKVGVKRNGSGGAFHPFKREKSA  756
                   + K DWL+S QLWNQ   DP  PKEE S    +  VKR+ S        RE + 
Sbjct  118   ------NMKSDWLKSVQLWNQP--DPLLPKEEQSQQMMETVVKRDES-------MREDAM  162

Query  757   GTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQL  936
               S    +                           +++RKQRRCWS +LHRRFL ALQ L
Sbjct  163   ANSGERRRR--------------------------ETERKQRRCWSSQLHRRFLNALQHL  196

Query  937   GGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             GG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+ ++ NN
Sbjct  197   GGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSQTVPNN  242



>gb|KEH43449.1| myb-like transcription factor family protein [Medicago truncatula]
Length=253

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 151/248 (61%), Gaps = 33/248 (13%)
 Frame = +1

Query  232  EYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTS  411
            +YI+ALE+ERRKIQVF +ELPL LELVTQAIEA +QQLSGTTTE NLN GQSECSEQTTS
Sbjct  10   DYIQALEQERRKIQVFPKELPLSLELVTQAIEACRQQLSGTTTEYNLN-GQSECSEQTTS  68

Query  412  SDDDEGPVLEEFIPL-KRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdssk  588
            +D   GPVLEEFIP+ KRASS SQ+  DD +   +  +H+      D+            
Sbjct  69   TD---GPVLEEFIPIKKRASSYSQEVFDDVEDYDQHFHHKQQKLSLDNK-----------  114

Query  589  dgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNC--KVGVKRNG-SGGAFHPFKREKSAG  759
                 KK DWLRS QLWN   +DP+ +E+        + +KRNG  GGAFHPF +E    
Sbjct  115  -----KKSDWLRSVQLWN---SDPSSEEDVTKKAVPVLELKRNGCGGGAFHPFHKEDRVN  166

Query  760  TSSPAV------QTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQ  921
             ++  +       +           +        ++  E + +RKQRRCWS ELH+RFL+
Sbjct  167  NTTSELLSKGQPSSTGVAAVSSNAATVTSNNVENRKRDEKEEKRKQRRCWSQELHKRFLK  226

Query  922  ALQQLGGS  945
            ALQQLGG+
Sbjct  227  ALQQLGGA  234



>ref|XP_009148528.1| PREDICTED: uncharacterized protein LOC103871943, partial [Brassica 
rapa]
Length=353

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 173/286 (60%), Gaps = 61/286 (21%)
 Frame = +1

Query  226   CQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNI-GQSECSEQ  402
             C +YIEALEEERRKI VFQRELPLCL+LVTQAIE   ++++ T T+   N+ GQSECSEQ
Sbjct  15    CGQYIEALEEERRKILVFQRELPLCLDLVTQAIERCTKEITETATD---NVYGQSECSEQ  71

Query  403   TTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssds  582
             TT       PVLE+F+ +K +S  +++E ++E +  +  NH  ++D +D           
Sbjct  72    TTGQCT---PVLEQFLTIKDSSPFNEEEVEEEFEDEQ-GNHDPENDSEDK----------  117

Query  583   skdgkVSKKQDWLRSAQLWNQSFTDPT-PKEE-SPSNCKVGVKRNGSGGAFHPFKREKSA  756
                   + K DWL+S QLWNQ   DP  PKEE S    +  VKR+ S        RE + 
Sbjct  118   ------NMKSDWLKSVQLWNQP--DPLLPKEEQSQQMMETVVKRDES-------MREDAM  162

Query  757   GTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQL  936
               S    +                           +++RKQRRCWS +LHRRFL ALQ L
Sbjct  163   ANSGERRRR--------------------------ETERKQRRCWSSQLHRRFLNALQHL  196

Query  937   GGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             GG HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+ ++ NN
Sbjct  197   GGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSQTVPNN  242



>ref|XP_010533191.1| PREDICTED: probable transcription factor GLK2 [Tarenaya hassleriana]
Length=443

 Score =   193 bits (490),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 125/327 (38%), Positives = 162/327 (50%), Gaps = 98/327 (30%)
 Frame = +1

Query  217   MRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECS  396
             M++ ++++  LEEER KI  F+RELPLC++L+T A+E YKQQL      C  N G +  +
Sbjct  33    MQKLEDFLSRLEEERLKIDAFKRELPLCMQLLTNAVEVYKQQLQA----CRANGGNNHGA  88

Query  397   EQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdss  576
                        PVLEEFIPL+ + + + ++ D+                           
Sbjct  89    R----------PVLEEFIPLRSSDNNNHEKADN---------------------------  111

Query  577   dsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPS-----NCKVGVK-----------R  708
                       K  W+ +AQLWNQ+  D T    + S     +  +GV            R
Sbjct  112   ----------KAGWMTNAQLWNQTAADETKPHVAISAKGDTDITLGVAASPKLGLDAKPR  161

Query  709   NGSGGAFHPFKREKSA----------------------GTSSPAVQT-------LDstta  801
             NG  GAF PF +E+S                           P +Q        L+ + A
Sbjct  162   NG--GAFLPFSKERSLPELALSNSADNVETEDVQRVSDSGGKPVIQQNKGQNGHLNDSQA  219

Query  802   gvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELM  981
              +   +    G S       Q+ RK RRCWSP+LHRRF+QALQ LGGS VATPKQIRELM
Sbjct  220   TIETNNANLNGASSTSGGAAQTNRKARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELM  279

Query  982   KVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             KVDGLTNDEVKSHLQKYRLHTRRP+PS
Sbjct  280   KVDGLTNDEVKSHLQKYRLHTRRPSPS  306



>gb|EMS62450.1| Two-component response regulator ARR1 [Triticum urartu]
Length=378

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 168/294 (57%), Gaps = 52/294 (18%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             RR ++Y+ ALEEERRKI VFQRELPLCL+LVTQ IE  K Q+ G              SE
Sbjct  17    RRLRDYLLALEEERRKIHVFQRELPLCLDLVTQTIEGMKSQMGGA------------ASE  64

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
             +T S  D  GPVLEEFIPLK + SLS  +++       ++ H       +        + 
Sbjct  65    ETVS--DHGGPVLEEFIPLKPSLSLSSSDDE-------TSTHAAVAPVSNAKAETPPPTP  115

Query  580   sskdgkVSKKQDWLRSAQL---WNQSFTDPTPKEESPSNCK-VGVKRNGSGGAFHPFKRE  747
              +K        DWL+SAQL   W++     + ++  P  C+ V +    +GGAFHPF++E
Sbjct  116   ETKKAM----PDWLQSAQLSSAWSEPQQSSSLQKVLP--CRPVALNATRTGGAFHPFEKE  169

Query  748   K-------SAGTSSPAVQTL----------DsttagvgngsggggggskkeeketQSQ--  870
             K       ++ T++PA   L          D+      +         K ++KE QSQ  
Sbjct  170   KQPEPELPASSTTAPASSALVGDSGDKATSDTEVHDKDSKDATEKDTDKDKDKEGQSQPP  229

Query  871   --RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  1026
               RK RRCW+PELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ
Sbjct  230   NNRKPRRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  283



>ref|XP_009129087.1| PREDICTED: rho GTPase-activating protein gacGG-like [Brassica 
rapa]
Length=422

 Score =   190 bits (483),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 129/303 (43%), Positives = 163/303 (54%), Gaps = 73/303 (24%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             ++ ++ +  LE+ER KI  F+RELPLC++L+  A+E Y+QQL       N N  QS  + 
Sbjct  34    QKLEDLLSRLEQERLKIDAFKRELPLCMQLLGNAVEVYRQQLEAYRENSN-NSNQSVVAR  92

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
                       PVLEEFIPL+               +P+  N                   
Sbjct  93    ----------PVLEEFIPLRN--------------TPEKEN-------------------  109

Query  580   sskdgkVSKKQDWLRSAQLWNQSFT-----DPT----PKEESPSNCKVG---VKRNGSGG  723
                    +K  +W+ +AQLW+Q  T     DPT    PK+E  S+ K+G   VK+   GG
Sbjct  110   -------NKGNNWMTTAQLWSQPETKPKNIDPTTDQSPKDELASSPKLGHFDVKQRNGGG  162

Query  724   AFHPFKREKS---------AGTSSPAVQ-TLDsttagvgngsggggggskkeeketQSQR  873
             AF PF +EK+             SPA + T D    G    +G     +      +QS R
Sbjct  163   AFLPFSKEKTLPELALSTEVKRVSPANEHTNDHDCNGESMINGSNNNNNNNSSTTSQSNR  222

Query  874   KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             K RRCWSP+LHRRF+QALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP
Sbjct  223   KARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  282

Query  1054  TPS  1062
             +PS
Sbjct  283   SPS  285



>ref|NP_001131917.2| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACF80541.2| unknown [Zea mays]
 gb|AFW56043.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04329.1| G2-like transcription factor, partial [Zea mays]
Length=453

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 147/336 (44%), Positives = 177/336 (53%), Gaps = 66/336 (20%)
 Frame = +1

Query  205   YPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQ  384
             + ++  R ++Y+ ALEEERRKIQVFQRELPLCL+LVTQ IE  +  +          +G 
Sbjct  12    HADRRLRFRDYLLALEEERRKIQVFQRELPLCLDLVTQTIEGMRSHMDSVV------VG-  64

Query  385   SECSEQTTSSDDDEGPVLEEFIPLKRAS---SLSQDEEDDEQQSPKSANHRTdddddddn  555
                SE+T S  D  GPVLEEF+PLK  +   S SQ +  D+  S     HR       ++
Sbjct  65    ---SEETVS--DHGGPVLEEFMPLKPTTLSSSSSQPQSQDDHDSAHYLEHRRAAAATAND  119

Query  556   n--------------nngdssdsskdgkVSKKQ--DWLRSAQLWNQ----SFTDPTPKEE  675
                                SS        +KK   DWL+S QLW+     S + P  ++E
Sbjct  120   VVDADKDDEALGDPETAAASSSRPLPHPETKKAMPDWLQSVQLWSNQQQPSVSPPQHQDE  179

Query  676   SPSNCKVGVKRNG---SGGAFHPFKREKS-----------------AGTSSPAVQ-----  780
                 C+  V  N    SGGAF PF++EK                  A  SS  V      
Sbjct  180   LLLPCR-PVALNACRKSGGAFQPFEKEKKKEDKEEKQRAELELPLPAAASSAVVGDSCDR  238

Query  781   --TLDsttagvgngsggggggskkeeketQSQ---RKQRRCWSPELHRRFLQALQQLGGS  945
                 D+ T    N       G K +E +  SQ   RK RRCW+PELHRRFLQALQQLGGS
Sbjct  239   AGATDTDTDTAENNKASSTKGGKDKEAQLSSQAPSRKARRCWAPELHRRFLQALQQLGGS  298

Query  946   HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             HVATPKQIRELM VDGLTNDEVKSHLQKYRLHTRRP
Sbjct  299   HVATPKQIRELMNVDGLTNDEVKSHLQKYRLHTRRP  334



>ref|XP_011086148.1| PREDICTED: probable transcription factor GLK2 [Sesamum indicum]
Length=463

 Score =   189 bits (481),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 123/322 (38%), Positives = 156/322 (48%), Gaps = 85/322 (26%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             E+ ++ +E++  LEEER KI  F+RELPLC++L+T A+EA +QQL            QS+
Sbjct  31    EQTQKLEEFLARLEEERLKIDAFKRELPLCMQLLTNAVEASRQQL------------QSQ  78

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
              + Q   +     PVLEEFIPLK  +S    E +    +   AN                
Sbjct  79    RTNQAAGAR----PVLEEFIPLKNTTSSDPTENEGNNIAADKAN----------------  118

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEE----SPSNCKVGVKRNG-----SGG  723
                            W+ SAQLWNQ   +  P +     SP   ++ +  NG      GG
Sbjct  119   ---------------WMTSAQLWNQESEEAKPPQSPLTTSPQETEIKLALNGKQRMNGGG  163

Query  724   AFHPFK-----------------------------REKSAGTSSPAVQTLDsttagvgng  816
             AFHPF                              ++ S+ TSS    +           
Sbjct  164   AFHPFSSKDRVSSSPCGEAFPELALASSHKEEMEDKKNSSETSSRRDNSAGKCGNNSVAD  223

Query  817   sggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGL  996
                      +    TQ+ RK RRCWSP+LHRRF+ AL  LGGS VATPKQIRELMKVDGL
Sbjct  224   QKEQVSSGTQANTTTQTHRKARRCWSPDLHRRFVNALHMLGGSQVATPKQIRELMKVDGL  283

Query  997   TNDEVKSHLQKYRLHTRRPTPS  1062
             TNDEVKSHLQKYRLHTRRP+PS
Sbjct  284   TNDEVKSHLQKYRLHTRRPSPS  305



>ref|XP_006291183.1| hypothetical protein CARUB_v10017308mg [Capsella rubella]
 gb|EOA24081.1| hypothetical protein CARUB_v10017308mg [Capsella rubella]
Length=429

 Score =   188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 131/337 (39%), Positives = 173/337 (51%), Gaps = 93/337 (28%)
 Frame = +1

Query  154   SISAMLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAY  333
             S S +L +  D   S    +K+   ++ +  LE+ER KI  F+RELPLC++L+  A+E Y
Sbjct  15    SYSMLLKSFGDNFQSDQTTQKL---EDLLSRLEQERLKIDAFKRELPLCMQLLNNAVEVY  71

Query  334   KQQLSGTTTECNLNIGQSECSEQTTSSDDDEG----PVLEEFIPLKRASSLSQDEEDDEQ  501
             KQQL                + +  S+++++G    PVLEEFIPL+              
Sbjct  72    KQQLE---------------AYRPNSNNNNQGVPTRPVLEEFIPLRN-------------  103

Query  502   QSPKSANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDP-------  660
             Q  KS N                           K  +W+ +AQLW+QS T P       
Sbjct  104   QPEKSNN---------------------------KGSNWMTTAQLWSQSETKPKNIDSTD  136

Query  661   --TPKEESPSNCKVG----VKRNGSGGAFHPFKREKSAGTSSPAVQTL------------  786
                PK+E  S+ K+G     +RNGSG AF PF +E+S    + + + +            
Sbjct  137   QSLPKDEIASSPKLGHFDSKQRNGSG-AFLPFSKEQSLPELALSTEVIKRVSPTREHTNG  195

Query  787   -----DsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHV  951
                  +S      N +      +      +QS RK RRCWSP+LHRRF+QALQ LGGS V
Sbjct  196   QDGNDESMINNDNNNNNNHSNSNGVSSTTSQSNRKARRCWSPDLHRRFVQALQMLGGSQV  255

Query  952   ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS
Sbjct  256   ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPS  292



>ref|XP_006395699.1| hypothetical protein EUTSA_v10004257mg [Eutrema salsugineum]
 gb|ESQ32985.1| hypothetical protein EUTSA_v10004257mg [Eutrema salsugineum]
Length=433

 Score =   188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 125/310 (40%), Positives = 161/310 (52%), Gaps = 77/310 (25%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             ++ ++ +  LE+ER KI  F+RELPLC++L+  A+E YKQQL     E       +  + 
Sbjct  34    QKLEDLLSRLEQERLKIDAFKRELPLCMQLLNNAVEVYKQQL-----EAYRANSNNNNNN  88

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
             Q+ ++     PVLEEFIPL+              Q P+ AN+                  
Sbjct  89    QSVATI----PVLEEFIPLRN-------------QVPEKANN------------------  113

Query  580   sskdgkVSKKQDWLRSAQLWNQSFTDP---------TPKEE---SPSNCKVGVKRNGSGG  723
                     K  +W+ +AQLW+Q  T P         +PK+E   SP       K+  SGG
Sbjct  114   --------KGNNWMTTAQLWSQPETKPKNIDQTTDQSPKDELASSPRLRHFDAKQRNSGG  165

Query  724   AFHPFKREKS---------AGTSSPAVQ--------TLDsttagvgngsggggggskkee  852
             AF PF +E+S             SPA +        T+ +      N +      +    
Sbjct  166   AFLPFSKEQSLPELALSTEVKRVSPANEHTNDGNDETMINNGNNNNNNNHNITNSNGVSS  225

Query  853   ketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKY  1032
                QS RK RRCWSP+LHRRF+QALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQKY
Sbjct  226   TTNQSNRKARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKY  285

Query  1033  RLHTRRPTPS  1062
             RLHTRRP+PS
Sbjct  286   RLHTRRPSPS  295



>ref|XP_009152171.1| PREDICTED: transcription repressor KAN1 [Brassica rapa]
Length=423

 Score =   188 bits (477),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 123/309 (40%), Positives = 156/309 (50%), Gaps = 85/309 (28%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             ++ ++ +  LE+ER KI  F+RELPLC++L+  A+E YKQQL       N    QS  + 
Sbjct  34    QKLEDLLSRLEQERLKIDAFKRELPLCMQLLNNAVEVYKQQLEAYLANNN---NQSVVTR  90

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
                       PVLEEFIPL+                P+ AN                   
Sbjct  91    ----------PVLEEFIPLRN--------------QPEKAN-------------------  107

Query  580   sskdgkVSKKQDWLRSAQLWNQSFTDP---------TPKEESPSNCKVG---VKRNGSGG  723
                        +W+ +AQLW+Q  T P         +PK+E  S+ K+G    K+  SGG
Sbjct  108   -----------NWMTTAQLWSQPETKPKSIDQTTDQSPKDELASSPKLGHVDAKQRNSGG  156

Query  724   AFHPFKREKS---------AGTSSPAVQTLDsttagvgngsggggggskkee-------k  855
             AFHPF +E+              SP  +  +         + G    +            
Sbjct  157   AFHPFTKEQHLPELALSTEVKRFSPTNEHTNDHGNDESIINSGKNNNNNINSNSNGVSST  216

Query  856   etQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYR  1035
              +QS RK RRCWSP+LHRRF+QALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYR
Sbjct  217   TSQSNRKARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYR  276

Query  1036  LHTRRPTPS  1062
             LHTRRP+PS
Sbjct  277   LHTRRPSPS  285



>emb|CDY02988.1| BnaC07g22390D [Brassica napus]
Length=423

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 123/309 (40%), Positives = 155/309 (50%), Gaps = 85/309 (28%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             ++ ++ +  LE+ER KI  F+RELPLC++L+  A+E YKQQL       N    QS  + 
Sbjct  34    QKLEDLLSRLEQERLKIDAFKRELPLCMQLLNNAVEVYKQQLEAYRANNN---NQSVVTR  90

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
                       PVLEEFIPL+                P+ AN                   
Sbjct  91    ----------PVLEEFIPLRN--------------QPEKAN-------------------  107

Query  580   sskdgkVSKKQDWLRSAQLWNQSFTDP---------TPKEESPSNCKVG---VKRNGSGG  723
                        +W+ +AQLW+Q  T P         +PK+E  S+ K+G    K+   GG
Sbjct  108   -----------NWMTTAQLWSQPETKPKSIDQTTDQSPKDELASSPKLGHVDAKQRNGGG  156

Query  724   AFHPFKREK--------------SAGTSSPAVQTLDsttagvgngsggggggskkee--k  855
             AFHPF +E+              S     P     D +    G  +      +       
Sbjct  157   AFHPFSKEQHLPELALSTEVKRFSPTNEHPNDHGNDESIINSGKNNNNNINSNSNGVSST  216

Query  856   etQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYR  1035
              +QS RK RRCWSP+LHRRF+QALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYR
Sbjct  217   TSQSNRKARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYR  276

Query  1036  LHTRRPTPS  1062
             LHTRRP+PS
Sbjct  277   LHTRRPSPS  285



>emb|CDY51214.1| BnaA06g39930D [Brassica napus]
Length=423

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 128/331 (39%), Positives = 162/331 (49%), Gaps = 88/331 (27%)
 Frame = +1

Query  154   SISAMLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAY  333
             S S +L +  D   S    +K+   ++ +  LE+ER KI  F+RELPLC++L+  A+E Y
Sbjct  15    SYSMLLKSFGDNFQSDQTTQKL---EDLLSRLEQERLKIDAFKRELPLCMQLLNNAVEVY  71

Query  334   KQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPK  513
             KQQL       N    QS  +           PVLEEFIPL+                P+
Sbjct  72    KQQLEAYLANNN---NQSVVTR----------PVLEEFIPLRN--------------QPE  104

Query  514   SANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDP---------TP  666
              AN                              +W+ +AQLW+Q  T P         +P
Sbjct  105   KAN------------------------------NWMTTAQLWSQPETKPKSIDQTTDQSP  134

Query  667   KEESPSNCKVG---VKRNGSGGAFHPFKREKS---------AGTSSPAVQTLDsttagvg  810
             K+E  S+ K+G    K+   GGAFHPF +E+              SP  +  +       
Sbjct  135   KDELASSPKLGHVDAKQRNGGGAFHPFTKEQHLPELALSTEVKRFSPTNEHTNDHGNDES  194

Query  811   -------ngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQI  969
                    N +      +       QS RK RRCWSP+LHRRF+QALQ LGGS VATPKQI
Sbjct  195   IINSGKKNNNNINSNSNGVSSTTNQSNRKARRCWSPDLHRRFVQALQMLGGSQVATPKQI  254

Query  970   RELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             RELMKVDGLTNDEVKSHLQKYRLHTRRP+PS
Sbjct  255   RELMKVDGLTNDEVKSHLQKYRLHTRRPSPS  285



>ref|NP_027544.1| homeodomain-like superfamily protein [Arabidopsis thaliana]
 gb|AAL31188.1| At2g03500/T4M8.7 [Arabidopsis thaliana]
 gb|AAD17450.2| expressed protein [Arabidopsis thaliana]
 gb|AAM91460.1| At2g03500/T4M8.7 [Arabidopsis thaliana]
 dbj|BAD95340.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC05707.1| homeodomain-like superfamily protein [Arabidopsis thaliana]
Length=432

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 126/314 (40%), Positives = 160/314 (51%), Gaps = 85/314 (27%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
              + ++ +  LE+ER KI  F+RELPLC++L+  A+E YKQQL       N N  QS  + 
Sbjct  34    HKLEDLLSRLEQERLKIDAFKRELPLCMQLLNNAVEVYKQQLEAYRANSN-NNNQSVGTR  92

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
                       PVLEEFIPL+                P+  N+                  
Sbjct  93    ----------PVLEEFIPLR--------------NQPEKTNN------------------  110

Query  580   sskdgkVSKKQDWLRSAQLWNQSFTDP----------TPKEESPSNCKVG----VKRNGS  717
                     K  +W+ +AQLW+QS T P           PK+E  S+ K+G     +RNGS
Sbjct  111   --------KGSNWMTTAQLWSQSETKPKNIDSTTDQSLPKDEINSSPKLGHFDAKQRNGS  162

Query  718   GGAFHPFKREKS---------AGTSSPAVQ----------TLDsttagvgngsggggggs  840
             G AF PF +E+S             SP  +          ++ +      N +      +
Sbjct  163   G-AFLPFSKEQSLPELALSTEVKRVSPTNEHTNGQDGNDESMINNDNNYNNNNNNNSNSN  221

Query  841   kkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSH  1020
                   +QS RK RRCWSP+LHRRF+QALQ LGGS VATPKQIRELMKVDGLTNDEVKSH
Sbjct  222   GVSSTTSQSNRKARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSH  281

Query  1021  LQKYRLHTRRPTPS  1062
             LQKYRLHTRRP+PS
Sbjct  282   LQKYRLHTRRPSPS  295



>gb|KFK33518.1| hypothetical protein AALP_AA5G023500 [Arabis alpina]
Length=412

 Score =   185 bits (469),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 123/312 (39%), Positives = 158/312 (51%), Gaps = 83/312 (27%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             ++ ++ +  LE+ER KI  F+RELPLC++L+  A+E YKQQL       N N  QS  + 
Sbjct  17    QKLEDLLSLLEQERLKIDAFKRELPLCMQLLNNAVEVYKQQLEAYRANSNNN--QSLATR  74

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
                       PVLEEFIPL+                P+ AN                   
Sbjct  75    ----------PVLEEFIPLRN--------------QPEKAN-------------------  91

Query  580   sskdgkVSKKQDWLRSAQLWNQ---------SFTDPT-PKEESPSNCKVG---VKRNGSG  720
                    +K  +W+ +AQLW+Q         S TD + PK+E  S+ K+G    K+   G
Sbjct  92    -------NKGSNWMTTAQLWSQPEIKPKNIDSATDHSLPKDEIASSPKLGHFDAKQRNGG  144

Query  721   GAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggsk------------------k  846
             GAF PF +E+S    + + +    +          G   +                    
Sbjct  145   GAFLPFSKEQSLPELALSTEVKRVSLTNEHTNDHDGNDENMINNGNNNNNNNNNSNSNGV  204

Query  847   eeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  1026
                 +QS RK RRCWSP+LHRRF+QALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQ
Sbjct  205   SSTTSQSNRKARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQ  264

Query  1027  KYRLHTRRPTPS  1062
             KYRLHTRRP+PS
Sbjct  265   KYRLHTRRPSPS  276



>ref|XP_008792133.1| PREDICTED: probable transcription factor GLK2 [Phoenix dactylifera]
Length=463

 Score =   185 bits (470),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 130/328 (40%), Positives = 164/328 (50%), Gaps = 96/328 (29%)
 Frame = +1

Query  208   PEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQS  387
             P++ ++ QE++  LEEER KI+ F+RELPLC++L+  A+E Y+QQL              
Sbjct  27    PDQTQKIQEFLARLEEERLKIEAFKRELPLCMQLLNNAVETYRQQL--------------  72

Query  388   ECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnng  567
                 +T  ++    PVLEEFIPLK AS       D  +++P +                 
Sbjct  73    ----ETYQTNQAPRPVLEEFIPLKHASI------DGSEKAPNAP----------------  106

Query  568   dssdsskdgkVSKKQDWLRSAQLW--------NQSFTDPTPKEE------SPSNCKVGVK  705
                        S+K  W+ SAQLW        NQ    P  KE       SP       +
Sbjct  107   -----------SEKASWMVSAQLWSAANDATRNQPMAAPPLKETEHAFDVSPKLALDTKQ  155

Query  706   RNGSGGAFHPFKREKSAG--------------TSSPAVQT---------------LDstt  798
             RNG  GAF PF +EK+ G              +S  AV+                 D+  
Sbjct  156   RNG--GAFLPFSKEKNKGMGSASRGLPELALASSEKAVEEKQSCVEMDGGSIGARRDNGG  213

Query  799   agvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIREL  978
              G     G GG    + +   Q+ RK RRCWSP+LHRRF+ ALQ LGGS VATPKQIREL
Sbjct  214   KGGAAEQGKGGSNPTEGQPAPQTHRKARRCWSPDLHRRFVNALQILGGSQVATPKQIREL  273

Query  979   MKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             MKVDGLTNDEVKSHLQKYRLHTRRP P+
Sbjct  274   MKVDGLTNDEVKSHLQKYRLHTRRPIPA  301



>emb|CBI28136.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   184 bits (466),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 124/318 (39%), Positives = 175/318 (55%), Gaps = 78/318 (25%)
 Frame = +1

Query  208   PEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQS  387
             P++ ++ ++++  LEEER KI+VF+RELPLC++L+T A+EA +QQL              
Sbjct  27    PDQTQKLEDFLARLEEERLKIEVFKRELPLCMQLLTDAVEASRQQL--------------  72

Query  388   ECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnng  567
                 Q+  ++    P LEEFIPLK ++          + S K++N               
Sbjct  73    ----QSYRANQGARPFLEEFIPLKHSTP---------KGSEKTSN---------------  104

Query  568   dssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK---VGV---------KRN  711
                       +S K +W+ SAQLW+ +  D T ++ + ++ K   +G           + 
Sbjct  105   ----------MSDKANWMTSAQLWSPA-GDETKQQSTLTSSKEPDIGFTVSPKLGFDNKQ  153

Query  712   GSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCW  891
              +GGAF PF +E+++   SP ++  +                +      TQ+ RK RRCW
Sbjct  154   RNGGAFLPFSKERNS-CPSPNLRNCE------------AQTTAAAPTANTQTHRKARRCW  200

Query  892   SPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRN  1071
             SP+LHRRF+ ALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS + 
Sbjct  201   SPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPSPQA  260

Query  1072  NgsqqqgpqfvvvggIWV  1125
              G+       V +GGIWV
Sbjct  261   TGAAAPQLVVVGLGGIWV  278



>gb|KFK35079.1| myb family transcription factor [Arabis alpina]
Length=356

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 132/301 (44%), Positives = 170/301 (56%), Gaps = 34/301 (11%)
 Frame = +1

Query  178   IHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTT  357
             I + +   NY  K  RC EYIEALEEERRKI VF RELPLCL+LVTQAIEAYK+++S TT
Sbjct  2     IKNLSNMKNYNAKRERCCEYIEALEEERRKINVFYRELPLCLKLVTQAIEAYKKEISETT  61

Query  358   TECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdd  537
             T+ NL   +SEC E TT    +  PVL+ FIP+K  S  S +EED+     +  +H T  
Sbjct  62    TK-NL-YKRSECLEGTTG---ECRPVLDLFIPIKH-SPTSTEEEDEVDDDDEHKSHETLT  115

Query  538   dddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQ--SFTDPTPKEESPSNCKVGVKRN  711
               DD                 + K +WL+S QLWNQ  +       E S    +  V+  
Sbjct  116   CFDDK----------------NMKSEWLKSVQLWNQPEAVLSNNNSECSKEETETVVEII  159

Query  712   GSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCW  891
                 + +     K+    SPA  +          G G      K      + +RK++R W
Sbjct  160   KGAASRYETSNGKNYNVKSPATSS---------GGGGQKKEADKAGIHSGKGRRKEKRIW  210

Query  892   SPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRN  1071
             S EL +RFL AL+QLGG H ATPKQI+ELMKVDGLT+D++KSHLQKYR+HTRR + +  N
Sbjct  211   SQELQKRFLNALKQLGGPH-ATPKQIKELMKVDGLTSDQIKSHLQKYRMHTRRSSQTNPN  269

Query  1072  N  1074
             N
Sbjct  270   N  270



>ref|XP_002875207.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51466.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=432

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 122/315 (39%), Positives = 158/315 (50%), Gaps = 87/315 (28%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             ++ ++ +  LE+ER KI  F+RELPLC++L+  A+E YK+QL       + N  QS  + 
Sbjct  34    QKLEDLLSRLEQERLKIDAFKRELPLCMQLLNNAVEVYKRQLEAYRANSD-NNNQSVATR  92

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
                       PVLEEFIPL+                P+  N                   
Sbjct  93    ----------PVLEEFIPLR--------------NQPEKTN-------------------  109

Query  580   sskdgkVSKKQDWLRSAQLWNQSFTDP----------TPKEESPSNCKVG----VKRNGS  717
                     K  +W+ +AQLW+QS T P           PK+E  S+ K+G     +RNGS
Sbjct  110   --------KGSNWMTTAQLWSQSETKPKNIDSTTDQSLPKDEIISSPKLGHFDAKQRNGS  161

Query  718   GGAFHPFKREKSA--------------------GTSSPAVQTLDsttagvgngsgggggg  837
             G AF PF +E+S                     G        +++      N +      
Sbjct  162   G-AFLPFSKEQSLPELALSTEVKRVSPTNEHTNGQDGNDESMINNDNNNNNNNNNNNSNS  220

Query  838   skkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKS  1017
             +      +QS RK RRCWSP+LHRRF+QALQ LGGS VATPKQIRELMKVDGLTNDEVKS
Sbjct  221   NGVSSTTSQSNRKARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKS  280

Query  1018  HLQKYRLHTRRPTPS  1062
             HLQKYRLHTRRP+P+
Sbjct  281   HLQKYRLHTRRPSPN  295



>ref|XP_003609208.1| Two-component response regulator ARR14 [Medicago truncatula]
 gb|AES91405.1| myb-like transcription factor family protein [Medicago truncatula]
Length=434

 Score =   180 bits (456),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 156/318 (49%), Gaps = 84/318 (26%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             + +E++  LEEER KI  F+RELPLC++L+T A+EA KQQL                  Q
Sbjct  32    KLEEFVSRLEEERLKIDAFKRELPLCMQLLTNAMEASKQQL------------------Q  73

Query  403   TTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssds  582
                S+    P+LEEFIP+K+ +S    E        K+ N+                   
Sbjct  74    AFRSNQGAKPILEEFIPVKQLTSSETLE--------KTTNNN------------------  107

Query  583   skdgkVSKKQDWLRSAQLWNQSFTDPT------PKEESPSNCKVGVK---RNGSGGAFHP  735
                  V    +W+ SAQLW+Q+    T       KE + +N  +G     ++ +GGAF P
Sbjct  108   -----VCDMANWMTSAQLWSQTSELGTKQQQNSTKENNDNNNNIGFNISPKHRNGGAFLP  162

Query  736   FKREKSA----GTSSPAV----------------------QTLDsttagvgngsgggggg  837
             F +E++     G   P +                       + +                
Sbjct  163   FSKERNNSSCQGQGLPELALASTQKEEDKKHVGEAEKGKTNSGNEVDNQGKGSPVASSQT  222

Query  838   skkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKS  1017
                     Q+ RK RRCWSP+LHRRF+ ALQ LGGS VATPKQIRELMKVDGLTNDEVKS
Sbjct  223   QTTSNNSNQTHRKARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKS  282

Query  1018  HLQKYRLHTRRPTPSIRN  1071
             HLQKYRLHTRRP+PS +N
Sbjct  283   HLQKYRLHTRRPSPSAQN  300



>ref|XP_009371414.1| PREDICTED: uncharacterized protein LOC103960659 [Pyrus x bretschneideri]
Length=463

 Score =   180 bits (457),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 134/352 (38%), Positives = 174/352 (49%), Gaps = 98/352 (28%)
 Frame = +1

Query  151   ISISAMLITIHDPAASTNYPE-KMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIE  327
             IS S +L +  D  AS  + + + ++ +E++  LEEER KI  F+RELPL ++L+T A+E
Sbjct  9     ISYSMLLKSFADLQASHLHDQPQTQKLEEFLSRLEEERLKIDAFKRELPLSMQLLTTAVE  68

Query  328   AYKQQLSGTTTECNLNI-GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQ  504
             A +QQL    T    NI GQ+              PVLEEFIPLK ++S    E  ++  
Sbjct  69    ASRQQLQAYRTN---NIQGQTR-------------PVLEEFIPLKHSTS----EGSEKPT  108

Query  505   SPKSANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEES--  678
             +P                              S K +W+ SAQLW+Q+ TD  P   S  
Sbjct  109   NP-----------------------------TSDKANWMTSAQLWSQA-TDHNPSATSKP  138

Query  679   -------PSNCKVGVK------------RNGSGGAFHPFKREKS-----------AGTSS  768
                    P    +G              R+  GGAF PF +++S           A   +
Sbjct  139   QSTITSGPKEADIGFSVSPKLGLDTKQPRSYGGGAFLPFSKDRSPTLRPLPELALASPEN  198

Query  769   PAVQTLDsttagvgngsggggggskkeeketQSQ--------------RKQRRCWSPELH  906
              A   L+       N S    G   ++   ++ Q              RK RRCWSP+LH
Sbjct  199   KAEIILEDHHENGNNNSSSAAGNCNEQGNNSEGQNGQTTTAAAAAQTHRKARRCWSPDLH  258

Query  907   RRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             RRF+ ALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS
Sbjct  259   RRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPS  310



>gb|EYU33937.1| hypothetical protein MIMGU_mgv1a005248mg [Erythranthe guttata]
Length=492

 Score =   180 bits (457),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 122/333 (37%), Positives = 166/333 (50%), Gaps = 95/333 (29%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             ++ ++ +E++  LEEER KI  F+RELPLC++L+T A+EA +QQL               
Sbjct  32    QQTQKIEEFLARLEEERLKIDAFKRELPLCMQLLTNAMEASRQQL---------------  76

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
                Q+  ++ +E P+LE+FIPLK  S+ S +    ++++  SA+                
Sbjct  77    ---QSQRTNQEERPILEQFIPLKNTSNNSCNNNISDKEANLSAD----------------  117

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQ---------SFTDPTPKE-------ESPSNCKVGV  702
                         K +W+ SAQLWNQ           T P P         +  ++ K+G 
Sbjct  118   ------------KANWMTSAQLWNQESGEEEEEEEETKPPPSPLRTILPPQEITDFKLGF  165

Query  703   KR------NGSGGAFHPF-----------------------KREKSAGTSSPAVQTL---  786
                     NG GGAF PF                       +  K++ +SS  V+ +   
Sbjct  166   TNEGKKVINGGGGAFLPFSSSSSMNCGEGFPELALANSSRNEEMKNSSSSSEVVKNICRR  225

Query  787   -DsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPK  963
              +S              G       +Q+ RK RRCWSP+LHRRF+ AL  LGGS VATPK
Sbjct  226   ENSVAVVGSEREQVVVSGGAAASNGSQTNRKARRCWSPDLHRRFVNALHMLGGSQVATPK  285

Query  964   QIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             QIRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS
Sbjct  286   QIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPS  318



>gb|KFK33519.1| hypothetical protein AALP_AA5G023500 [Arabis alpina]
Length=411

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 124/312 (40%), Positives = 156/312 (50%), Gaps = 84/312 (27%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             ++ ++ +  LE+ER KI  F+RELPLC++L+  A+E YKQQL       N N  QS  + 
Sbjct  17    QKLEDLLSLLEQERLKIDAFKRELPLCMQLLNNAVEVYKQQLEAYRANSNNN--QSLATR  74

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
                       PVLEEFIPL+                P+ AN                   
Sbjct  75    ----------PVLEEFIPLRN--------------QPEKAN-------------------  91

Query  580   sskdgkVSKKQDWLRSAQLWNQ---------SFTDPT-PKEESPSNCKVG---VKRNGSG  720
                    +K  +W+ +AQLW+Q         S TD + PK+E  S+ K+G    K+   G
Sbjct  92    -------NKGSNWMTTAQLWSQPEIKPKNIDSATDHSLPKDEIASSPKLGHFDAKQRNGG  144

Query  721   GAFHPFKREKSA-----GTSSPAVQTLDsttagvgngsggg-------------gggskk  846
             GAF PF +E+S       T    V   +  T                          +  
Sbjct  145   GAFLPFSKEQSLPELALSTEVKRVSLTNEHTNDHDGNDENMINNGNNNNNNNNNSNSNGV  204

Query  847   eeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  1026
                 +QS RK RRCWSP+LHRRF+QALQ LGGS  ATPKQIRELMKVDGLTNDEVKSHLQ
Sbjct  205   SSTTSQSNRKARRCWSPDLHRRFVQALQMLGGSQ-ATPKQIRELMKVDGLTNDEVKSHLQ  263

Query  1027  KYRLHTRRPTPS  1062
             KYRLHTRRP+PS
Sbjct  264   KYRLHTRRPSPS  275



>ref|XP_006852953.1| hypothetical protein AMTR_s00033p00241280 [Amborella trichopoda]
 gb|ERN14420.1| hypothetical protein AMTR_s00033p00241280 [Amborella trichopoda]
Length=386

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 132/332 (40%), Positives = 169/332 (51%), Gaps = 77/332 (23%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N  +++ R +E +  LEEERRKI VF+RELPLC+ L+  AI+  K+Q      +C L   
Sbjct  41    NGVDRVVRIEELVACLEEERRKIDVFKRELPLCMLLLNDAIDDLKEQ----ARQCRL---  93

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
                            GPVLEEFIP+K+A    Q+E ++E ++ +                
Sbjct  94    --------------RGPVLEEFIPIKKA----QEERENEAKAERDCKD------------  123

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEE------SPSN-----------C  690
                            K +W+ SAQLW+ +  +   K+E      +PS             
Sbjct  124   ---------------KMNWMSSAQLWSDNSDNSEEKKEKLDEYEAPSEELQKTDFGEKAY  168

Query  691   KVGVKRNGSGGAFHPFKREKSAGT-----SSPAVQTLDsttagvgngsggggggskkeek  855
              +G  RN SGGAF P     +         +  V    S       G     G  +    
Sbjct  169   TIGRYRN-SGGAFVPLNGNGNGNGLVRKEENDIVDLSLSNGGIKELGHVSPKGSCRGNAG  227

Query  856   etQS--QRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQK  1029
              +QS  QRK RRCWSPELHRRF+ ALQQLGGS VATPKQIRELMKVDGLTNDEVKSHLQK
Sbjct  228   SSQSALQRKARRCWSPELHRRFVNALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQK  287

Query  1030  YRLHTRRPTPSIRNNgsqqqgpqfvvvggIWV  1125
             YRLHTRRP  S+ +  S QQ P  V++  +WV
Sbjct  288   YRLHTRRPNVSVSSANSNQQNPPLVLLSNLWV  319



>ref|XP_010425142.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 29 [Camelina sativa]
Length=428

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 127/333 (38%), Positives = 163/333 (49%), Gaps = 85/333 (26%)
 Frame = +1

Query  154   SISAMLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAY  333
             S S +L +  D   S    +K+   ++ +  L++ER KI  F+RELPLC++L+  A+E Y
Sbjct  15    SYSMLLKSFGDNFQSNQTTQKL---EDLLSRLDQERLKIDAFKRELPLCMQLLNNAVEVY  71

Query  334   KQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPK  513
             KQQL       N N  QS  +           PVLEEFIPL+                P+
Sbjct  72    KQQLEAYRANSN-NNNQSVPTR----------PVLEEFIPLRN--------------QPE  106

Query  514   SANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDP----------T  663
               N                           K  +W+ +AQLW++S T P           
Sbjct  107   KPN--------------------------IKGNNWMTTAQLWSESETKPKNIDSTADQSL  140

Query  664   PKEESPSNCKVG----VKRNGSGGAFHPFKREKS---------AGTSSPAVQTLDsttag  804
              K+E  S+ K+G     +RNG+G AF PF +E S             SP  +  +     
Sbjct  141   HKDEIASSPKLGHFDAKQRNGNG-AFLPFSKEHSLPELALSTEVKRVSPTSEHTNGHDGN  199

Query  805   vgngsggggggskk-------eeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPK  963
               +        +             +QS RK RRCWSP+LHRRF+QALQ LGGS VATPK
Sbjct  200   DESMINNDTNNNNNNSNTNGVSSTTSQSNRKARRCWSPDLHRRFVQALQMLGGSQVATPK  259

Query  964   QIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             QIRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS
Sbjct  260   QIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPS  292



>ref|XP_008463337.1| PREDICTED: transcription activator GLK1-like [Cucumis melo]
Length=447

 Score =   177 bits (450),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 118/319 (37%), Positives = 164/319 (51%), Gaps = 78/319 (24%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ +   + Q+++  LEEER KI VF+RELPLC++L+T A+E  ++QL    T       
Sbjct  32    DHDQSYDKLQDFVSRLEEERLKIDVFKRELPLCMQLLTNAVETSRRQLQACKT-------  84

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
                  E   ++     P+LEEF+PLK  S+ ++DE     ++P                 
Sbjct  85    ----MEAAAAAAAPTEPILEEFMPLKN-STPAEDE-----KTP-----------------  117

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPS----------------NCK  693
                          S K +W+ S QLW+Q+  D   K++S S                N +
Sbjct  118   ----------TITSDKANWMTSVQLWSQA-GDVISKQQSESTDDHSKLQDCNNNKDNNLE  166

Query  694   VGVKRNGSGGAFHPFKREKSAGTSSPAVQTLDs----------------ttagvgngsgg  825
                +R  + GAF PF +++S+G ++  ++ L+                         S  
Sbjct  167   TCSQRINNSGAFVPFNKDRSSGPAA-KMELLEKGEKKNCSDNNSNIDGGVVMAAEQRSEN  225

Query  826   ggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTND  1005
             G   +      TQ+ RK RRCWSP+LHRRF+ ALQ LGGS VATPKQIRELMKVDGLTND
Sbjct  226   GAAEAGSAPTTTQTHRKARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTND  285

Query  1006  EVKSHLQKYRLHTRRPTPS  1062
             EVKSHLQKYRLHTRRP P+
Sbjct  286   EVKSHLQKYRLHTRRPGPT  304



>ref|XP_010502362.1| PREDICTED: myb-like protein J isoform X1 [Camelina sativa]
 ref|XP_010502363.1| PREDICTED: myb-like protein J isoform X2 [Camelina sativa]
Length=428

 Score =   177 bits (448),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 130/335 (39%), Positives = 165/335 (49%), Gaps = 89/335 (27%)
 Frame = +1

Query  154   SISAMLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAY  333
             S S +L +  D   S    +K+   ++ +  L++ER KI  F+RELPLC++L+  A+E Y
Sbjct  15    SYSMLLKSFGDNFQSNQTTQKL---EDLLSRLDQERLKIDAFKRELPLCMQLLNNAVEVY  71

Query  334   KQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPK  513
             KQQL       N N  QS  +           PVLEEFIPL+                P+
Sbjct  72    KQQLEAYRANSN-NNNQSVPTR----------PVLEEFIPLR--------------NQPE  106

Query  514   SANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDP----------T  663
               N                           K  +W+ +AQLW++S T P           
Sbjct  107   KPN--------------------------IKGNNWMTTAQLWSESETKPKNIDSTADQSL  140

Query  664   PKEESPSNCKVG----VKRNGSGGAFHPFKREKSAGTSSPAVQTL---------------  786
              K+E  S+ K G     +RNG+G AF PF +E S      A+ TL               
Sbjct  141   HKDEIASSPKRGHFDAKQRNGNG-AFLPFSKEHSL--PELALSTLVKRVSPTSEHTNGRD  197

Query  787   ---DsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVAT  957
                +S      N +      +      +QS RK RRCWSP+LHRRF+QALQ LGGS VAT
Sbjct  198   GNDESMINNDTNNNNNNSNNNGVSSTTSQSNRKARRCWSPDLHRRFVQALQMLGGSQVAT  257

Query  958   PKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             PKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS
Sbjct  258   PKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPS  292



>ref|XP_010914965.1| PREDICTED: probable transcription factor GLK2 [Elaeis guineensis]
Length=463

 Score =   177 bits (450),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 121/327 (37%), Positives = 159/327 (49%), Gaps = 94/327 (29%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             ++ ++ QE++  LEEER KI+ F+RELPLC++L+  A+E Y+QQL               
Sbjct  28    DQTQKIQEFLAHLEEERLKIEAFKRELPLCMQLLNNAVETYRQQL---------------  72

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
                +T  ++    PVLEEFIPLK  S       D  +++P +                  
Sbjct  73    ---ETYQTNQAPRPVLEEFIPLKHTSV------DGSEKAPNAP-----------------  106

Query  571   ssdsskdgkVSKKQDWLRSAQLW--------NQSFTDPTPKEESPSNCKVGVK-----RN  711
                       S+K  W+ SAQLW        NQ      P +E+     V  K     + 
Sbjct  107   ----------SEKASWMVSAQLWSPANVATRNQQPLSAAPLKETEHAFDVSPKLALDTKQ  156

Query  712   GSGGAFHPFKRE--KSAGTSSPAVQTL----------------------------Dstta  801
              +GGAF PF +E  K  G++S  +  L                            +    
Sbjct  157   RNGGAFLPFSKEKNKGMGSASRELPELALASSEKAVEEKKSCVEMDGGSIGMRRDNGGKG  216

Query  802   gvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELM  981
             G       G   + + +   Q+ RK RRCWSP+LHRRF+ ALQ LGGS VATPKQIRELM
Sbjct  217   GGAEQGKSGSNPATEGQPAPQTHRKARRCWSPDLHRRFVNALQILGGSQVATPKQIRELM  276

Query  982   KVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             KVDGLTNDEVKSHLQKYRLHTRRP P+
Sbjct  277   KVDGLTNDEVKSHLQKYRLHTRRPIPA  303



>gb|KHN39723.1| Two-component response regulator ARR18 [Glycine soja]
Length=462

 Score =   177 bits (450),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 163/338 (48%), Gaps = 103/338 (30%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             ++  + +E++  LEEER KI  F+RELPLC++L+T A+EA +QQL               
Sbjct  30    DQTHKLEEFLSRLEEERVKIDAFKRELPLCMQLLTNAVEASRQQL---------------  74

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
                Q   S+    PVLEEF+P+K  +S        ++ + K++N                
Sbjct  75    ---QAFRSNQGTRPVLEEFMPIKHPNS--------QESTEKTSN----------------  107

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQSF--TDPTPKEESPSN-CKVGV---------KRNG  714
                      +S K +W+ SAQLW+Q+   T P     SP N   +G           ++ 
Sbjct  108   ---------ISDKANWMTSAQLWSQASEGTKPQSTITSPKNGADMGFSVSPNPALDNKHR  158

Query  715   SGGAFHPF-------------------------------------KRE---KSAGTSSPA  774
             +GGAF PF                                     KRE   K +G+    
Sbjct  159   NGGAFLPFSKERNSCQGLRDLPEVALASSEKEMEKKCELESEKCSKRENSGKGSGSCEGV  218

Query  775   VQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVA  954
             V    S +      +      +       Q+ RK RRCWSP+LHRRF+ ALQ LGGS VA
Sbjct  219   VDQGKSASVASEAQTTNTTITTTTNNTTGQTHRKARRCWSPDLHRRFVNALQMLGGSQVA  278

Query  955   TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIR  1068
             TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS++
Sbjct  279   TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPSLQ  316



>ref|XP_009381734.1| PREDICTED: uncharacterized protein LOC103969817 [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 184/365 (50%), Gaps = 81/365 (22%)
 Frame = +1

Query  214   KMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSEC  393
             + +RCQ+ I ALEEER+KI+ FQRELPLCL LVT+AIE+ +  + G   + N        
Sbjct  6     RAQRCQDCIRALEEERKKIKAFQRELPLCLHLVTRAIESVRHVM-GDDEKVN--------  56

Query  394   SEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngds  573
                        GPV EE IP      +S+   + ++ +   +  +               
Sbjct  57    ----------HGPVTEELIP-----PMSEQRSEAKKSAAVGSEMK---------------  86

Query  574   sdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREK-  750
                            LRS QL NQ   D  P+ E P    V + +   G AF PF+R+K 
Sbjct  87    ---------------LRSVQLRNQE-PDTVPRMEPPKKPIVAISKK-IGSAFQPFQRQKY  129

Query  751   -------SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHR  909
                    SA T+ PA    D                 +      Q  RK RR WSPELHR
Sbjct  130   VVPPPASSAATAIPATTDGDGGRDYGSKEGNREKKEEQL-----QPHRKARRSWSPELHR  184

Query  910   RFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIR--NNgsq  1083
              FL AL QLGGS VATPKQIRELMKVDGLT DEVKSHLQKYRLH RR +P+++  +NGS 
Sbjct  185   CFLHALHQLGGSDVATPKQIRELMKVDGLTIDEVKSHLQKYRLHGRRRSPAVQCSSNGSL  244

Query  1084  qqgpqfvvvggIWVpppeyaaamapppTSGEA-----ATSNGIYAPVATTP-----KQTQ  1233
                PQ V+VGGI VP P+Y  A A    + +      A SNG+YAPVA+ P     +Q Q
Sbjct  245   AVSPQVVLVGGIVVPSPDYNMADAAVAAAAQPANGARAPSNGMYAPVASHPSDSRYRQKQ  304

Query  1234  QNRTI  1248
               R+I
Sbjct  305   PQRSI  309



>ref|XP_002965982.1| hypothetical protein SELMODRAFT_66160, partial [Selaginella moellendorffii]
 gb|EFJ33402.1| hypothetical protein SELMODRAFT_66160, partial [Selaginella moellendorffii]
Length=267

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 112/296 (38%), Positives = 146/296 (49%), Gaps = 73/296 (25%)
 Frame = +1

Query  238   IEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTSSD  417
             + ALE ERRKI+ F+RELPLC++++T+   +Y+ +           IG    + ++ S  
Sbjct  1     VTALEGERRKIEAFKRELPLCMDIITEGNCSYRDE----------AIGHDSVTAKSDS--  48

Query  418   DDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdsskdgk  597
                  VLEEFIP K   +L + + D++   P                             
Sbjct  49    -----VLEEFIPPK---TLEESKRDEKACDPDL---------------------------  73

Query  598   VSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREKSAGTSSPAV  777
                K  W+   QLW+++    T  E    +   G+  N SGGAF PF R   +    P +
Sbjct  74    --DKPSWMAQVQLWSEAKQIKTQVEIYSKHAVPGIFAN-SGGAFSPFVRAAPSTEEKPGL  130

Query  778   -----------------------QTLDsttagvgngsggggggskkeeketQSQRKQRRC  888
                                    +T  +        +      +   + E+ SQRK RRC
Sbjct  131   RSTSDAGLTLSSSESSPRSGVVEETRPTVEKRTVEATTPAARSTTSSQFESNSQRKARRC  190

Query  889   WSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             WSPELHRRFL ALQQLGGSHVATPKQIRE+MKVDGLTNDEVKSHLQKYRLHTRRPT
Sbjct  191   WSPELHRRFLNALQQLGGSHVATPKQIREIMKVDGLTNDEVKSHLQKYRLHTRRPT  246



>ref|XP_003524007.1| PREDICTED: transcription factor LUX-like [Glycine max]
Length=462

 Score =   174 bits (442),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 121/338 (36%), Positives = 162/338 (48%), Gaps = 103/338 (30%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             ++  + +E++  LEEER KI  F+RELPLC++L+T A+EA +QQL               
Sbjct  30    DQTHKLEEFLSRLEEERVKIDAFKRELPLCMQLLTNAVEASRQQL---------------  74

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
                Q   S+    PV EEF+P+K  +S        ++ + K++N                
Sbjct  75    ---QAFRSNQGTRPVREEFMPIKHPNS--------QESTEKTSN----------------  107

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQSF--TDPTPKEESPSN-CKVGV---------KRNG  714
                      +S K +W+ SAQLW+Q+   T P     SP N   +G           ++ 
Sbjct  108   ---------ISDKANWMTSAQLWSQASEGTKPQSTITSPKNGADMGFSVSPNPALDNKHR  158

Query  715   SGGAFHPF-------------------------------------KRE---KSAGTSSPA  774
             +GGAF PF                                     KRE   K +G+    
Sbjct  159   NGGAFLPFSKERNSCQGLRDLPEVALASSEKEMEKKCELESEKCSKRENSGKGSGSCEGV  218

Query  775   VQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVA  954
             V    S +      +      +       Q+ RK RRCWSP+LHRRF+ ALQ LGGS VA
Sbjct  219   VDQGKSASVASEAQTTNTTITTTTNNTTGQTHRKARRCWSPDLHRRFVNALQMLGGSQVA  278

Query  955   TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIR  1068
             TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS++
Sbjct  279   TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPSLQ  316



>ref|XP_003528276.1| PREDICTED: uncharacterized protein LOC100809196 [Glycine max]
 gb|KHN23993.1| Two-component response regulator-like APRR2 [Glycine soja]
Length=467

 Score =   174 bits (441),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 122/334 (37%), Positives = 160/334 (48%), Gaps = 102/334 (31%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             + +E++  LEEER KI  F+RELPLC++L+T A+EA +QQL                  Q
Sbjct  35    KLEEFLSRLEEERVKIDAFKRELPLCMQLLTNAVEASRQQL------------------Q  76

Query  403   TTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssds  582
                S+    PVLEEF+P+ +         + ++ + K++N                    
Sbjct  77    AFRSNQGTRPVLEEFMPILK-------HPNSQESAEKTSN--------------------  109

Query  583   skdgkVSKKQDWLRSAQLWNQSF--TDP------TPKEESPSNCKVGVK-----RNGSGG  723
                  +S K +W+ SAQLW+Q+   T P       PKE +     V  K     ++ +GG
Sbjct  110   -----ISDKANWMTSAQLWSQASEGTKPQSTITSLPKEGADIGFSVSPKLALDNKHRNGG  164

Query  724   AFHPF--------------------------------------KREKSA-GTSSPAVQTL  786
             AF PF                                      KRE    G S   V   
Sbjct  165   AFLPFSKERNSCQGLRGLPELALASPEKEIEENKCELEAEKCSKRENPGKGGSCEGVNVD  224

Query  787   DsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQ  966
                +A V + +      +       Q+ RK RRCWSP+LHRRF+ ALQ LGGS VATPKQ
Sbjct  225   QGKSASVASEAQTANTTTTTTNTSGQTHRKARRCWSPDLHRRFVNALQMLGGSQVATPKQ  284

Query  967   IRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIR  1068
             IRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS+ 
Sbjct  285   IRELMKVDGLTNDEVKSHLQKYRLHTRRPSPSLH  318



>gb|KGN65397.1| hypothetical protein Csa_1G408200 [Cucumis sativus]
Length=454

 Score =   171 bits (434),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 114/322 (35%), Positives = 158/322 (49%), Gaps = 79/322 (25%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ +   + Q+++  LEEER KI VF+RELPLC++L+T A+E  ++QL    T       
Sbjct  32    DHDQSYDKLQDFVSRLEEERLKIDVFKRELPLCMQLLTNAVETSRRQLQACKT-------  84

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
                  E   +      P+LEEF+PLK  S+ ++DE+                        
Sbjct  85    ----MEAAAAVGAPTEPILEEFMPLKN-STPAEDEK------------------------  115

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSN------------------  687
                          S K +W+ S QLW+Q+      + ES  +                  
Sbjct  116   --------PTTITSDKANWMTSVQLWSQAGDVSKQQSESTDDHSKLQDRNNNNNNNNKDN  167

Query  688   -CKVGVKRNGSGGAFHPFKREKSAGTS--------------SPAVQTLDsttagvgngsg  822
               +   +R  + GAF PF +++S+G +              S    ++D     +     
Sbjct  168   NLETCSQRINNNGAFVPFNKDRSSGPAAKMELLEKGEKKNCSDNNSSIDGGVVVMAAEQR  227

Query  823   gggggskkee--ketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGL  996
                G ++       TQ+ RK RRCWSP+LHRRF+ ALQ LGGS VATPKQIRELMKVDGL
Sbjct  228   SENGAAEVGSGPTTTQTHRKARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGL  287

Query  997   TNDEVKSHLQKYRLHTRRPTPS  1062
             TNDEVKSHLQKYRLHTRRP P+
Sbjct  288   TNDEVKSHLQKYRLHTRRPGPT  309



>ref|XP_009403477.1| PREDICTED: uncharacterized protein LOC103987021 [Musa acuminata 
subsp. malaccensis]
Length=454

 Score =   171 bits (432),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 119/324 (37%), Positives = 152/324 (47%), Gaps = 96/324 (30%)
 Frame = +1

Query  208   PEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQS  387
             P++ ++ Q+++  LEEER KI  F+RELPLC++L+  AIE YKQQL              
Sbjct  27    PDQTQKIQDFLARLEEERHKIDAFKRELPLCMQLLNNAIECYKQQL--------------  72

Query  388   ECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnng  567
                 +T  ++    PVLEEFIPLK  +    D++                          
Sbjct  73    ----ETYQTNQGPRPVLEEFIPLKHMNMDGSDKDPSAH----------------------  106

Query  568   dssdsskdgkVSKKQDWLRSAQLWNQSFTD------PTPKEE------SPSNCKVGVKRN  711
                        S+K  W+ SAQLW+           P PKE       SP       +RN
Sbjct  107   -----------SEKASWMVSAQLWSPPVDAAKQQPVPPPKETEQAFDVSPKLSLDTKQRN  155

Query  712   GSGGAFHPFKREK--SAGTSSPAVQTLDsttagvgngsgg--------------------  825
             G  GAF PF +EK  +A ++S A+  L   +                             
Sbjct  156   G--GAFLPFSKEKSKAARSASRALSELALASPEKVVVEDKKCVELENGGVITRRENGTGG  213

Query  826   ---------ggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIREL  978
                          ++ +     + RK RRCWSP+LHRRF+ ALQ LGGS VATPKQIREL
Sbjct  214   GGAEHGKGGSSSATEGQAAAPPTHRKARRCWSPDLHRRFVNALQILGGSQVATPKQIREL  273

Query  979   MKVDGLTNDEVKSHLQKYRLHTRR  1050
             MKVDGLTNDEVKSHLQKYRLHTRR
Sbjct  274   MKVDGLTNDEVKSHLQKYRLHTRR  297



>ref|XP_003591795.1| Two-component response regulator ARR2 [Medicago truncatula]
Length=307

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 114/274 (42%), Positives = 153/274 (56%), Gaps = 33/274 (12%)
 Frame = +1

Query  442   EFIPLK-RASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdsskdgkVSKKQDW  618
             +FIP+K RASS SQ+  DD +   +  +H+      D+                 KK DW
Sbjct  5     KFIPIKKRASSYSQEVFDDVEDYDQHFHHKQQKLSLDNK----------------KKSDW  48

Query  619   LRSAQLWNQSFTDPTPKEESPSNC--KVGVKRNG-SGGAFHPFKREKSAGTSSPAV----  777
             LRS QLWN   +DP+ +E+        + +KRNG  GGAFHPF +E     ++  +    
Sbjct  49    LRSVQLWN---SDPSSEEDVTKKAVPVLELKRNGCGGGAFHPFHKEDRVNNTTSELLSKG  105

Query  778   --QTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHV  951
                +           +        ++  E + +RKQRRCWS ELH+RFL+ALQQLGG+  
Sbjct  106   QPSSTGVAAVSSNAATVTSNNVENRKRDEKEEKRKQRRCWSQELHKRFLKALQQLGGADC  165

Query  952   ATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgsqqqgpqfvvvggIWVpp  1131
             ATPKQIRE+M VDGLTNDEVKSHLQKYRLHTRRP+ +   + + Q    FV+VG I+V  
Sbjct  166   ATPKQIREVMNVDGLTNDEVKSHLQKYRLHTRRPSSTNNESANSQTAAPFVLVGNIFV-Q  224

Query  1132  peyaaamapppTSGE---AATSNGIYAPVATTPK  1224
              +    +A   T+GE       +GIYAPVAT P+
Sbjct  225   QQEYGGVASSTTTGEMTKVVAPSGIYAPVATHPQ  258



>ref|XP_009774094.1| PREDICTED: two-component response regulator-like APRR2 [Nicotiana 
sylvestris]
Length=398

 Score =   165 bits (418),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 121/338 (36%), Positives = 159/338 (47%), Gaps = 110/338 (33%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQ---QLSGTTTECNL  372
             N P+K+ +  EYI  LE+E RKI  F+RELPL + LV  AI A +    Q   + TE   
Sbjct  33    NVPDKLFQIDEYISRLEDEMRKIDAFKRELPLSVLLVKDAIVALRAESVQYKKSRTE---  89

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTddddddd  552
                                PVLEEFIPLK++S+     ED++ +  K  ++         
Sbjct  90    -------------------PVLEEFIPLKKSSN-----EDNKAEVTKDKDNSR-------  118

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWN--QSFTDPTPKEESPSNCKVGVKRNGS---  717
                              +K  W+ S QLWN  Q+  + + K++S S  K+     G+   
Sbjct  119   -----------------EKMSWMSSVQLWNGDQNTDEASNKQQSKSELKIRSPEEGNSSV  161

Query  718   -------------GGAFHPFK----------------------------------REKSA  756
                          G AF PFK                                  RE+++
Sbjct  162   TEDRFQSCKTLNMGKAFSPFKGYSGFSVTTVRKDDKDELPGVPGLSLHTPGIIKLREETS  221

Query  757   GTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQL  936
             G +S      + +  G+ + +            + Q+ RKQRRCWSPELHRRF+ ALQQL
Sbjct  222   GLNSKH----NGSRGGLSSVASSQSNIRNGSLSQQQAARKQRRCWSPELHRRFVDALQQL  277

Query  937   GGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             GGS VATPKQIRELM+VDGLTNDEVKSHLQKYRLHTRR
Sbjct  278   GGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLHTRR  315



>ref|XP_010107986.1| Two-component response regulator [Morus notabilis]
 gb|EXC17386.1| Two-component response regulator [Morus notabilis]
Length=390

 Score =   164 bits (416),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 125/339 (37%), Positives = 168/339 (50%), Gaps = 83/339 (24%)
 Frame = +1

Query  151   ISISAMLI--TIHD----PAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELV  312
             + I+A  +  TI D     +A  N  E+  +  ++ + LE+E RKI  F+RELPLC+ L+
Sbjct  10    LDITATFVPRTIGDFLREVSAIGNASERASKLDDFGKRLEDEMRKIDAFKRELPLCMLLL  69

Query  313   TQAIEAYKQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEED  492
               AIEA K++               +C+ Q         PVLEEFIPLK+      D E+
Sbjct  70    NDAIEALKKE-------------SLQCATQNAQ------PVLEEFIPLKK------DCEE  104

Query  493   DEQQSPKSANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKE  672
              E+      N+   D+D +                   K++W+ S QLWN    D  PK+
Sbjct  105   HEELDKNIDNNEKKDNDCNK-----------------DKKNWMSSVQLWNTD--DDDPKK  145

Query  673   ESPSNCKVGVK----------RNGSGGAFHPF-------KREK-----------SAGTSS  768
              S +  K+  K             +  AF P+       K EK           + G  +
Sbjct  146   NSKTQTKINEKGYPLETEDPFHKRAFVAFKPYSAFPVVRKEEKKEFSVHGLSLLTPGLKN  205

Query  769   PAVQTL-----DsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQ  933
             P  +++      ++   V +         +    + QS RKQRRCWSPELHRRF+ ALQQ
Sbjct  206   PKEESVCGAQRSNSGRAVSSSPSNAQSNLRTGSAQQQSARKQRRCWSPELHRRFVSALQQ  265

Query  934   LGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             LGGS VATPKQIRELM+VDGLTNDEVKSHLQKYRLHTRR
Sbjct  266   LGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLHTRR  304



>gb|EMT03587.1| Two-component response regulator ARR18 [Aegilops tauschii]
Length=403

 Score =   165 bits (417),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 119/317 (38%), Positives = 150/317 (47%), Gaps = 85/317 (27%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             ++ QE++  L++ER KI  F+RELPLC++L+ QA+EAY+QQL               C  
Sbjct  48    QKLQEFLARLDDERLKIDAFKRELPLCMQLLNQAMEAYRQQLEA-------------CQM  94

Query  400   QTTSSDDDEGP-VLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdss  576
              +        P VLEEFIPLK   ++  D  +      K+A +                 
Sbjct  95    GSHGGAAARAPLVLEEFIPLK---NIGIDAAE------KAAGNAP---------------  130

Query  577   dsskdgkVSKKQDWLRSAQLWN------QSFTDP-TPKEES-------PSNCKVGVKRNG  714
                     S+K +W+ SAQLWN       +   P TPKE S       P    +      
Sbjct  131   --------SEKANWMVSAQLWNGPAAGDAAAKGPQTPKERSEHPLDTSPMLGALDGGGGN  182

Query  715   SGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeket-----------  861
               GAF PF +EK+    S A+  L    A     +             +           
Sbjct  183   GVGAFLPFTKEKACMAESAALPELGLAPAEKDREADRKPYHDDSGSSGSVVSRRDVGAPP  242

Query  862   --------------QSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLT  999
                           Q+ RK RRCWSPELHRRF+ ALQ LGG+ VATPKQIRELMKVDGLT
Sbjct  243   TSTAPEGQSVPPPPQTNRKARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLT  302

Query  1000  NDEVKSHLQKYRLHTRR  1050
             NDEVKSHLQKYRLHTRR
Sbjct  303   NDEVKSHLQKYRLHTRR  319



>ref|XP_010941843.1| PREDICTED: uncharacterized protein LOC105059999 isoform X1 [Elaeis 
guineensis]
Length=387

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 122/330 (37%), Positives = 164/330 (50%), Gaps = 101/330 (31%)
 Frame = +1

Query  214   KMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSEC  393
             +M + +E +++LEEERRKI+ F+RELPLC+ L+   I+  K++L     +C ++ G +  
Sbjct  36    RMAKVEECVKSLEEERRKIEAFKRELPLCMHLIGDVIQGLKEELE----QCRMD-GYAMS  90

Query  394   SEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngds  573
                        G VLEEF+P+K     S+ EE+D  +                       
Sbjct  91    -----------GNVLEEFMPIK-----SKFEEEDRVK-----------------------  111

Query  574   sdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK-VGVKRNG------------  714
                  +     K +W+ SAQLW+ +++D   K+ +P++ K +  KR G            
Sbjct  112   ----FEDDTKDKMNWMSSAQLWSDNYSDEK-KDSTPTDEKRIAEKRVGEPDHETSSLESR  166

Query  715   ---SGGAFHPF-----------KREKSA---------------GTSSPAVQTLDsttagv  807
                 GGAF PF           K EK A                 S PAV T D   + V
Sbjct  167   GRSGGGAFVPFKGLSALAANARKEEKPAVGLPDLFLLSPGIKDSRSVPAV-TDDHRGSDV  225

Query  808   gngsgg---------ggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATP  960
              + +             G       + Q+QRK RRCWSPELHRRF+ ALQ LGG+ VATP
Sbjct  226   ISKATVRAPAPSPLAAAGAHLSLHAQQQTQRKPRRCWSPELHRRFVAALQHLGGAQVATP  285

Query  961   KQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             KQIRELMKVDGLTNDEVKSHLQKYRLHTR+
Sbjct  286   KQIRELMKVDGLTNDEVKSHLQKYRLHTRK  315



>emb|CDM82058.1| unnamed protein product [Triticum aestivum]
Length=472

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 119/317 (38%), Positives = 150/317 (47%), Gaps = 85/317 (27%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             ++ QE++  L++ER KI  F+RELPLC++L+ QA+EAY+QQL               C  
Sbjct  48    QKLQEFLARLDDERLKIDAFKRELPLCMQLLNQAMEAYRQQLEA-------------CQM  94

Query  400   QTTSSDDDEGP-VLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdss  576
              +        P VLEEFIPLK   ++  D  +      K+A +                 
Sbjct  95    GSHGGAAARAPLVLEEFIPLK---NIGIDAAE------KAAGNAP---------------  130

Query  577   dsskdgkVSKKQDWLRSAQLWN------QSFTDP-TPKEES-------PSNCKVGVKRNG  714
                     S+K +W+ SAQLWN       +   P TPKE S       P    +      
Sbjct  131   --------SEKANWMVSAQLWNGPAAGDAAAKGPQTPKERSEHPLDTSPMLGGLDGGGGN  182

Query  715   SGGAFHPFKREKSAGTSSPAVQTLDsttagvgngs-------------------------  819
               GAF PF +EK+    S A+  L    A     +                         
Sbjct  183   GVGAFLPFTKEKACMAESAALPELGLAPAEKDREADRKPYHDDGGSNGTVVSRRDVGAPP  242

Query  820   ggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLT  999
                    +      Q+ RK RRCWSPELHRRF+ ALQ LGG+ VATPKQIRELMKVDGLT
Sbjct  243   TSTAPEGQSVPPAPQTNRKARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLT  302

Query  1000  NDEVKSHLQKYRLHTRR  1050
             NDEVKSHLQKYRLHTRR
Sbjct  303   NDEVKSHLQKYRLHTRR  319



>gb|ABK95245.1| unknown [Populus trichocarpa]
Length=406

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 118/323 (37%), Positives = 156/323 (48%), Gaps = 91/323 (28%)
 Frame = +1

Query  214   KMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSEC  393
             K+ +   +I+ LEEE+RKI  F+RELPLC+ L+  AI+  +++L        + +G S+ 
Sbjct  44    KVLKVDGFIKDLEEEKRKIDAFKRELPLCMLLLNDAIQVLREEL--------MQLGASK-  94

Query  394   SEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngds  573
                      ++ PVLEEFIPLK+  ++    E+D     K +                  
Sbjct  95    ---------NQQPVLEEFIPLKK--NIDDHHENDGLIEEKDSK-----------------  126

Query  574   sdsskdgkVSKKQDWLRSAQLWNQSFTDPT------PKEESPSNCKVGVKRNGSGG----  723
                        K++W+ S QLWN     P+      PK+      K   K N  G     
Sbjct  127   ----------DKKNWMSSVQLWNADDHHPSTDYLFDPKQNLKLESKTNKKGNQYGNEDAF  176

Query  724   ----------AFHPFK--------REK----SAGTSSPAVQTLDsttagvgngsgggggg  837
                        F PFK         EK    S   S+P +++L   +   G+ S      
Sbjct  177   QAGIGRTAARTFMPFKACSGLSSKEEKLPVPSLSLSTPGIKSLKEESNSTGSRSSCSRSV  236

Query  838   skke------------eketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELM  981
             S               + + Q+ RKQRRCWSPELHRRF+ ALQQLGGS  ATPKQIRELM
Sbjct  237   STISGPNSDSNLRNGPQSQQQTARKQRRCWSPELHRRFVNALQQLGGSQAATPKQIRELM  296

Query  982   KVDGLTNDEVKSHLQKYRLHTRR  1050
             +VDGLTNDEVKSHLQKYRLHTRR
Sbjct  297   QVDGLTNDEVKSHLQKYRLHTRR  319



>ref|XP_002457252.1| hypothetical protein SORBIDRAFT_03g004090 [Sorghum bicolor]
 gb|EES02372.1| hypothetical protein SORBIDRAFT_03g004090 [Sorghum bicolor]
Length=502

 Score =   165 bits (417),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 122/331 (37%), Positives = 151/331 (46%), Gaps = 99/331 (30%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             ++ +E++  LEEE  KI  F+RELPLC++L+  A+E+Y+QQL              E  +
Sbjct  51    QKLREFLARLEEEWLKIDAFKRELPLCMQLLNHAMESYRQQL--------------EAYQ  96

Query  400   QTTSSDDDEGP-VLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdss  576
               +       P VLEEF+PLK           D   + K  N                  
Sbjct  97    MGSLQGAPARPLVLEEFMPLKNIGI-------DAAAADKMGN------------------  131

Query  577   dsskdgkVSKKQDWLRSAQLWNQSFTDP----------TPKEES----------PSNCKV  696
                     S+K  W+ SAQLWN                TPKE S            +   
Sbjct  132   ------PPSEKASWMESAQLWNGPAAATAADMAAKGPQTPKESSEHPLPIDTLCAHDAAA  185

Query  697   GVKRNGSGGAFHPFKREKSA----GTSSPAVQTL--------------------------  786
               +RNG GGAF PF ++K+A    G + P +                             
Sbjct  186   AGQRNG-GGAFLPFAKDKTASAAEGAALPELALAPADKDAGDAERKPYLDASSNNGVLGA  244

Query  787   --DsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATP  960
               D    GV  G+    G         Q+ RK RRCWSPELHRRF+ ALQ LGG+ VATP
Sbjct  245   RRDVVQNGVKPGTNAPEGQQAAATPPPQTHRKARRCWSPELHRRFVNALQILGGAQVATP  304

Query  961   KQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  1053
             KQIRELMKVDGLTNDEVKSHLQKYRLHTRRP
Sbjct  305   KQIRELMKVDGLTNDEVKSHLQKYRLHTRRP  335



>gb|EPS59369.1| hypothetical protein M569_15439, partial [Genlisea aurea]
Length=269

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 109/295 (37%), Positives = 134/295 (45%), Gaps = 76/295 (26%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             + +E++  LEEER KI  F+RELPLC+ L+T A+EA KQQ+                   
Sbjct  1     KLEEFVALLEEERLKIDAFKRELPLCMHLLTNAMEATKQQIQAHKAR-------------  47

Query  403   TTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssds  582
                      PVLEEF+                  SPK++                     
Sbjct  48    --------SPVLEEFL------------------SPKNST-------------------E  62

Query  583   skdgkVSKKQDWLRSAQLWNQSFTD---------PTPKEESPSNCKVGVKRNGSGGAFHP  735
             ++    S   +W+ SAQLW     D         P+    S    K  +      GAFHP
Sbjct  63    TEKIIPSDSSNWMTSAQLWRNDDDDETKDQKCKRPSSSSSSSQEIKFNLNTKQRMGAFHP  122

Query  736   FKREKSAGTSSPAV--------QTLDsttagvgngsggggggskkeeketQSQRKQRRCW  891
             F   K+ G   P +           D                 +  +    SQRK RRCW
Sbjct  123   FG-SKTKGDGFPELALASSSHPDDHDDDADDHDVNERKTNQNPESNKNPGSSQRKARRCW  181

Query  892   SPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
             SP+LHRRF+ AL  LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+
Sbjct  182   SPDLHRRFVNALHMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPS  236



>ref|XP_009625720.1| PREDICTED: two-component response regulator-like APRR2 [Nicotiana 
tomentosiformis]
Length=398

 Score =   162 bits (411),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 118/335 (35%), Positives = 156/335 (47%), Gaps = 104/335 (31%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N P+K+ +  +YI  LE+E RKI  F+RELPL + LV  AI A + +             
Sbjct  33    NVPDKLAQINDYISRLEDEMRKIDAFKRELPLSVLLVKDAIVALRAE-------------  79

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
               +C +  T       PVLEEFIPLK++S+     ED++ +  K  +             
Sbjct  80    SVQCRKSRTE------PVLEEFIPLKKSSN-----EDNKAEVTKDKDSS-----------  117

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWN--QSFTDPTPKEESPSNCKVGVKRNGS------  717
                           +K  W+ S QLWN  Q+  +   K+ S    K+     G+      
Sbjct  118   -------------REKMSWMSSVQLWNSDQTTDEANNKQRSKLELKIRSPEEGNSSVTED  164

Query  718   ----------GGAFHPFK----------------------------------REKSAGTS  765
                       G AF PFK                                  RE+++G +
Sbjct  165   RFQSCKTLNMGKAFSPFKGYSGFSVTTVKKDDKDELPGVPGLSLHTPGIIKLREETSGLN  224

Query  766   SPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGS  945
             S      + +  G+ + +            + Q+ RKQRRCWSPELHRRF+ ALQQLGGS
Sbjct  225   SKH----NGSRGGLSSVASSQSNIRNGSLSQQQAARKQRRCWSPELHRRFVDALQQLGGS  280

Query  946   HVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
              VATPKQIRELM+VDGLTNDEVKSHLQKYRLHTRR
Sbjct  281   QVATPKQIRELMQVDGLTNDEVKSHLQKYRLHTRR  315



>ref|XP_011096177.1| PREDICTED: uncharacterized protein LOC105175439 [Sesamum indicum]
Length=368

 Score =   162 bits (409),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 113/309 (37%), Positives = 147/309 (48%), Gaps = 73/309 (24%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             E  ++ Q+++  LEEER KI  F+RELPLC++L+  A+EA +Q+L    T          
Sbjct  22    EGTQKLQDFVARLEEERFKIDAFKRELPLCVQLLAYAVEASRQELKSQRT----------  71

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
                    +  +  PVLEEFIPLK  S     E    + S   AN                
Sbjct  72    -------NQLEARPVLEEFIPLKDTSWPEVKENAAGKASADKAN----------------  108

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRN-GSGGAFHPF---  738
                            W+ SAQLWNQ         E+ +   + VK+   + G F P    
Sbjct  109   ---------------WMTSAQLWNQETEGKYSPIETDTELALTVKQGISAAGGFLPSPQK  153

Query  739   --KREKSAGTSSP-----------------AVQTLDsttagvgngsggggggskk--eek  855
               +   S G + P                 +++T+  +      G+       +      
Sbjct  154   SDRNSSSCGAAFPELALSSSHKEETVNTRNSLETISRSENSGEFGNSSVAEKERVRGTAT  213

Query  856   etQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYR  1035
              TQ+ RK RRCWSP+LHRRF+ AL  LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYR
Sbjct  214   TTQTHRKPRRCWSPDLHRRFVHALHMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYR  273

Query  1036  LHTRRPTPS  1062
             LHTR  +PS
Sbjct  274   LHTRSLSPS  282



>ref|XP_010999925.1| PREDICTED: uncharacterized protein LOC105107622 [Populus euphratica]
Length=406

 Score =   162 bits (410),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 122/336 (36%), Positives = 159/336 (47%), Gaps = 97/336 (29%)
 Frame = +1

Query  175   TIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGT  354
              I DPA       K+ +   +I+ LEEE+RKI  F+RELPLC+ L+  AI+  +++L   
Sbjct  37    VIGDPAV------KVLKVDGFIKDLEEEKRKIDAFKRELPLCMLLLNDAIQVLREEL---  87

Query  355   TTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTd  534
                  +  G S+          ++ PVLEEFIPLK+  ++    E+D     K +     
Sbjct  88    -----MQRGASK----------NQQPVLEEFIPLKK--NIDDHHENDVLIEEKDSK----  126

Query  535   ddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPT------PKEESPSNCKV  696
                                     K++W+ S QLWN     P+      PK+      K 
Sbjct  127   -----------------------DKKNWMSSVQLWNADDHHPSTDYLFDPKQNLKLESKT  163

Query  697   GVKRNGSGG--------------AFHPF--------KREK----SAGTSSPAVQTLDstt  798
               K N  G                F PF        K EK    S   S+P +++L   +
Sbjct  164   NKKGNQYGNEDAFQACIGRTAARTFMPFTACTGLSSKEEKLPVPSLSLSTPGIKSLKEES  223

Query  799   agvgngsggggggskke------------eketQSQRKQRRCWSPELHRRFLQALQQLGG  942
                G+ S      S               + + Q+ RKQRRCWSPELHRRF+ ALQQLGG
Sbjct  224   NSTGSRSSCSRSVSTISGPNSESNLRNGPQSQQQTARKQRRCWSPELHRRFVNALQQLGG  283

Query  943   SHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             S  ATPKQIRELM+VDGLTNDEVKSHLQKYRLHTRR
Sbjct  284   SQAATPKQIRELMQVDGLTNDEVKSHLQKYRLHTRR  319



>gb|KHG11040.1| putative transcription factor GLK1 [Gossypium arboreum]
Length=408

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/322 (36%), Positives = 154/322 (48%), Gaps = 75/322 (23%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N  +K+ +   +++ LEEE +KI  F+RELPLC+ L+  AI   K++             
Sbjct  33    NVSDKVSKLDAFVKGLEEEMKKIDAFKRELPLCMLLLNDAILVLKEE-------------  79

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
              ++C  +         PVLEEFIPLK     +  EED    + K      +D +++    
Sbjct  80    STQCMARNVE------PVLEEFIPLKNKEEDNHSEEDGSLITTKKEEDCNNDCNNN----  129

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWN--QSFTDPTPKEESPSNCKVGVKRNGSGG-AFH  732
                            K++W+ S QLWN    +  P  K ++  N +   K  G GG  F 
Sbjct  130   -------------KDKKNWMSSVQLWNIDDDYCSPDHKLDTKRNDEDPCKSRGGGGRGFM  176

Query  733   PFKREKSAGT---------------SSPAVQTLDsttagvgngsggggggskkeeke---  858
             PFK                      S+P ++ L   ++  G+ S      +         
Sbjct  177   PFKANLGFAVRKEDKQEVPVHGLTLSTPGIKNLKEESSSTGSRSSCSRAVTFSATNARTS  236

Query  859   ------------------tQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMK  984
                                QS RKQRRCWSPELHRRF++ALQQLGGS VATPKQIRELM+
Sbjct  237   FRSAPPVGLSNHLQQHQQQQSGRKQRRCWSPELHRRFVKALQQLGGSQVATPKQIRELMQ  296

Query  985   VDGLTNDEVKSHLQKYRLHTRR  1050
             VDGLTNDEVKSHLQKYRLHTRR
Sbjct  297   VDGLTNDEVKSHLQKYRLHTRR  318



>ref|XP_004290315.1| PREDICTED: uncharacterized protein LOC101303079 [Fragaria vesca 
subsp. vesca]
Length=419

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 119/330 (36%), Positives = 158/330 (48%), Gaps = 94/330 (28%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N  E++ +   +++ LEEE RKI  F+RELPLC+ L+  AI+A K+              
Sbjct  33    NVTERLSKLDNFVKRLEEEMRKIDAFKRELPLCMFLLNDAIQALKED-------------  79

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
               +C++          PVLEEFIPLK+         D ++++ +  NH+ + D       
Sbjct  80    AMQCAKPNVQ------PVLEEFIPLKK---------DCDKKTGEPNNHKKEKDSR-----  119

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWN-QSFTDPTP------KEESPSNCKVGVKRNG--  714
                            K++W+ S QLWN  ++  PT       K+ S  + K    RNG  
Sbjct  120   --------------DKKNWMSSVQLWNTDNYHHPTSDFPCDRKQGSDIDSKRNEARNGVA  165

Query  715   ------------SGGAFHPFK-------------REKSA---------GTSSPAVQTLDs  792
                          G AF PFK             +E  A         G  +P  ++  S
Sbjct  166   NEDPFQTCRDRNGGRAFVPFKAYPAFSVPAVKEDKEDLAVHGLSLLTPGIKNPKEESASS  225

Query  793   ttagvgngsggggggskkeeketQSQ----RKQRRCWSPELHRRFLQALQQLGGSHVATP  960
              +      +      + +       Q    RKQRRCWSPELHRRF+ ALQQLGGS VATP
Sbjct  226   GSRSTCGRAVSFSAANVQSNMRISPQQPTSRKQRRCWSPELHRRFVNALQQLGGSQVATP  285

Query  961   KQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             KQIRELM+VDGLTNDEVKSHLQKYRLHTRR
Sbjct  286   KQIRELMQVDGLTNDEVKSHLQKYRLHTRR  315



>ref|XP_006338223.1| PREDICTED: uncharacterized protein LOC102591830 [Solanum tuberosum]
Length=365

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 114/326 (35%), Positives = 157/326 (48%), Gaps = 85/326 (26%)
 Frame = +1

Query  157   ISAMLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYK  336
             IS +L  +   +A  +  +K+ +  +++  LEEE RK + F+RELP+C+ L+  AIE  K
Sbjct  21    ISDVLTEV---SAMDDISKKLTKLNQFLVPLEEELRKTEAFKRELPMCMLLLKDAIERLK  77

Query  337   QQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKS  516
                                +E     + D+ PV+EEFIPLK+ +S       DE    K 
Sbjct  78    -------------------AEALLYKEKDKSPVMEEFIPLKKGNS-------DESGRVKK  111

Query  517   ANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWN-----QSFTDPTPKEES-  678
             +N                         +S K++W+ SAQLW+     +S      +E++ 
Sbjct  112   SND------------------------LSDKKNWMSSAQLWSTPVQYESLKSSGVEEKAR  147

Query  679   -----PSNCKVGVKRNGSGGAFHPFKREK-SAGTSSPAVQTLDsttagvgngsggggggs  840
                     CK+  +R    GAF PF+ +    G +  AV+ L  + A        G    
Sbjct  148   EKQYQLGACKLKNER----GAFLPFQGQALKEGKNGLAVKDLSLSMAVTVGEGEKGQKPI  203

Query  841   kkeeketQS----------------QRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIR  972
                 K                     RKQRRCWSPELHRRF+ AL QLGG+ VATPKQIR
Sbjct  204   DVSVKRENGPSNSNGCGVFSQDKSQHRKQRRCWSPELHRRFVDALHQLGGAQVATPKQIR  263

Query  973   ELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             ++M+VDGLTNDEVKSHLQKYRLH RR
Sbjct  264   DIMQVDGLTNDEVKSHLQKYRLHVRR  289



>ref|XP_011092742.1| PREDICTED: uncharacterized protein LOC105172852 [Sesamum indicum]
Length=400

 Score =   160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 118/334 (35%), Positives = 157/334 (47%), Gaps = 89/334 (27%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             EK+ +   Y+  L++E +KI  F+RELPLC+ L+  AI   K++L              +
Sbjct  40    EKVLKLDRYVSRLQDEMKKIDAFKRELPLCMLLLNDAIATVKEELM-------------Q  86

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
             C +          PVLEEFIPLK+ S+  + +E +E    K   +               
Sbjct  87    CKKSNAE------PVLEEFIPLKKNSAGEEKDETNEGGKEKEIVNN--------------  126

Query  571   ssdsskdgkVSKKQDWLRSAQLWN--QSFTDPTPKEESPSNCKVGV-------------K  705
                       S+K +W+ S QLWN   ++    PK +S    K  V             K
Sbjct  127   ----------SEKMNWMSSVQLWNSDNNYNLSDPKLDSNKKRKEEVINRPAMDDLFPSSK  176

Query  706   RNGSGGAFHPFK--------------REKSAGTSSPAVQTLDsttagvg-----------  810
                 G AF PFK              R++  G  S +++T +   +              
Sbjct  177   NRARGRAFAPFKGCPNFPVVPMGKEGRDELPGAPSLSLRTPEINNSKDEIYCSGLSSKSS  236

Query  811   ----ngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIREL  978
                   S    G S  +    Q+ RKQRRCWSPELHRRF+ ALQ LGG+  ATPKQIREL
Sbjct  237   SSRSGSSSATNGQSSLKTVHQQTARKQRRCWSPELHRRFVNALQHLGGAQAATPKQIREL  296

Query  979   MKVDGLTNDEVKSHLQKYRLHTRR--PTPSIRNN  1074
             M+VDGLTNDEVKSHLQKYRLHTR+  PT +I  N
Sbjct  297   MQVDGLTNDEVKSHLQKYRLHTRKVPPTTNISTN  330



>ref|XP_002441840.1| hypothetical protein SORBIDRAFT_08g003180 [Sorghum bicolor]
 gb|EES15678.1| hypothetical protein SORBIDRAFT_08g003180 [Sorghum bicolor]
Length=462

 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 125/321 (39%), Positives = 160/321 (50%), Gaps = 78/321 (24%)
 Frame = +1

Query  262   RKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLE  441
             RKI+VFQRELPLCL+LVTQ IE  +  +       ++ +G    SE+ T SD   GPVLE
Sbjct  33    RKIRVFQRELPLCLDLVTQTIEEMRSHMD------SVVVG----SEEETVSDHGGGPVLE  82

Query  442   EFIPLK------------------------RASSLSQDEEDDEQQS--PKSANHRTdddd  543
             EF+PLK                        RA+ +  D++ +++ S  P++A        
Sbjct  83    EFMPLKPTLSSSSSEDDDDDEHDSSRHHQHRAAGVGDDDKKNDEASGDPETAAALASSRR  142

Query  544   dddnnnngdssdsskdgkVSKKQDWLRSAQLWNQ---SFTDPTPKEESPSNCKVGVKRNG  714
                       +            DWL+S QLW+           ++E    C+  V  N 
Sbjct  143   PLLPQPETKKAMP----------DWLQSVQLWSNQQQPPPQQQHQDELLLPCRP-VALNA  191

Query  715   ---SGGAFHPFKREKS----------------------AGTS--SPAVQTLDsttagvgn  813
                 GGAF PF+++K                        G S    A    D+ TA   N
Sbjct  192   YRKPGGAFQPFEKDKDKEKQRGELPLPASSSAAASSAVVGDSCCDRAGGATDTDTAENTN  251

Query  814   gsggggggskkeeketQSQRKQRR-CWSPELHRRFLQALQQLGGSHVATPKQIRELMKVD  990
                  GG  K+ +  +Q+  ++ R CW+PELHRRFLQALQQLGGSH ATPKQIRELMKVD
Sbjct  252   KLSIKGGKDKEAQSSSQAPGRKPRRCWAPELHRRFLQALQQLGGSHAATPKQIRELMKVD  311

Query  991   GLTNDEVKSHLQKYRLHTRRP  1053
             GLTNDEVKSHLQKYRLHTRRP
Sbjct  312   GLTNDEVKSHLQKYRLHTRRP  332



>ref|XP_009345969.1| PREDICTED: uncharacterized protein LOC103937746 [Pyrus x bretschneideri]
 ref|XP_009345970.1| PREDICTED: uncharacterized protein LOC103937747 [Pyrus x bretschneideri]
Length=396

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 155/332 (47%), Gaps = 95/332 (29%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N  EK+ +  ++++ LE+E RKI  F+RELPLC+ L+  AI A K+              
Sbjct  33    NVSEKLSKLDDFVKRLEDEMRKIDAFKRELPLCMFLLNDAIRALKED-------------  79

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
               +C+           PVLEEFIP+K+         D ++    S N+   + D      
Sbjct  80    AMQCAAPKVQ------PVLEEFIPMKK---------DCDKNKGGSGNNNKKEKDSR----  120

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK-------------VGV  702
                            K++W+ S QLWN       P  +SP + K              GV
Sbjct  121   --------------DKKNWMSSVQLWNTDNFHQHPSGDSPYDRKRVSEIDSKRNEAENGV  166

Query  703   K--------RNGSGG-AFHPFK------------REK-----------SAGTSSPAVQTL  786
                      RN +GG AF PFK             EK           + G  +P  ++ 
Sbjct  167   ANEDPFQTCRNRTGGRAFMPFKGYPAFSVTPLRLEEKEELPVHGLSLLTPGIKNPKEEST  226

Query  787   DsttagvgngsggggggskkeeketQSQ----RKQRRCWSPELHRRFLQALQQLGGSHVA  954
              S +      S      + +    T  Q    RKQRRCWSPELHRRF+ ALQQLGGS VA
Sbjct  227   SSGSRSTCGRSVSFSTANTQSNMRTPPQQPTSRKQRRCWSPELHRRFVNALQQLGGSQVA  286

Query  955   TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             TPKQIRELM+VDGLTNDEVKSHLQKYRLHTRR
Sbjct  287   TPKQIRELMQVDGLTNDEVKSHLQKYRLHTRR  318



>ref|XP_002313089.1| hypothetical protein POPTR_0009s10980g [Populus trichocarpa]
 gb|EEE87044.1| hypothetical protein POPTR_0009s10980g [Populus trichocarpa]
Length=406

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 117/323 (36%), Positives = 154/323 (48%), Gaps = 91/323 (28%)
 Frame = +1

Query  214   KMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSEC  393
             K+ +   +I+ LEEE+RKI  F+RELPLC+ L+  AI+  +++         +  G S+ 
Sbjct  44    KVLKVDGFIKDLEEEKRKIDAFKRELPLCMLLLNDAIQVLREE--------PMQRGASK-  94

Query  394   SEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngds  573
                      ++ PVLEEFIPLK+  ++    E+D     K +                  
Sbjct  95    ---------NQQPVLEEFIPLKK--NIDDHHENDGLIEEKDSK-----------------  126

Query  574   sdsskdgkVSKKQDWLRSAQLWNQSFTDPT------PKEESPSNCKVGVKRNGSGG----  723
                        K++W+ S QLWN     P+      PK+      K   K N  G     
Sbjct  127   ----------DKKNWMSSVQLWNADDHHPSTDYLFDPKQNLKLESKTNKKGNQYGNEDAF  176

Query  724   ----------AFHPFK--------REK----SAGTSSPAVQTLDsttagvgngsgggggg  837
                        F PFK         EK    S   S+P +++L   +   G+ S      
Sbjct  177   QAGIGRTAARTFMPFKACSGLSSKEEKLPVPSLSLSTPGIKSLKEESNSTGSRSSCSRSV  236

Query  838   skke------------eketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELM  981
             S               + + Q+ RKQRRCWSPELHRRF+ ALQQLGGS  ATPKQIRELM
Sbjct  237   STISGPNSDSNLRNGPQSQQQTARKQRRCWSPELHRRFVNALQQLGGSQAATPKQIRELM  296

Query  982   KVDGLTNDEVKSHLQKYRLHTRR  1050
             +VDGLTNDEVKSHLQKYRLHTRR
Sbjct  297   QVDGLTNDEVKSHLQKYRLHTRR  319



>ref|XP_009394712.1| PREDICTED: uncharacterized protein LOC103980151 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=308

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 118/284 (42%), Positives = 152/284 (54%), Gaps = 61/284 (21%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             E  RR  E I AL+EERRK++ F RELPLCL L+ Q IE+YKQ +               
Sbjct  5     EYARRFGELIVALDEERRKMEAFHRELPLCLHLINQTIESYKQLM---------------  49

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
              S +T S +      ++EFIPL+  S  S+D+         + +H               
Sbjct  50    VSAETLSHE----LAVKEFIPLRPRSVSSEDD---------TIHH---------------  81

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGS-GGAFHPFKRE  747
                          Q+W+RS QL  Q   DP PK   P    + +K   + G A +  K E
Sbjct  82    -------------QEWIRSTQLVAQE-QDPLPKTVHPQK-PIAIKAKMTWGDAQYLDKEE  126

Query  748   KSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQAL  927
             + A + S A Q  D+  A    G+G GG   KK+++ +Q +RK +R WS ELH+RFL AL
Sbjct  127   EIAPSESLACQ--DTEVASGEEGNGDGGKKKKKKKERSQPERKVKRYWSEELHKRFLHAL  184

Query  928   QQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP  1059
             +QLGG H ATPK IR+LMKVDGLTNDEVKSHLQKYRLH RR  P
Sbjct  185   EQLGGCHAATPKLIRKLMKVDGLTNDEVKSHLQKYRLHARRSCP  228



>ref|XP_004288067.1| PREDICTED: uncharacterized protein LOC101304222 [Fragaria vesca 
subsp. vesca]
Length=367

 Score =   155 bits (393),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 159/326 (49%), Gaps = 80/326 (25%)
 Frame = +1

Query  154   SISAMLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAY  333
             +IS  L  +   +A  +  ++  +  EY + LE+E RKI+VF+RELPLC+ ++  AIE  
Sbjct  15    TISEFLFQL---SAVKDGADRSSKLAEYRKRLEDEMRKIEVFKRELPLCMVILKDAIERL  71

Query  334   KQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPK  513
             K+++              +C E      +D   V+EEFIP+K+        + DE +   
Sbjct  72    KEEVM-------------QCGEV-----EDRTVVVEEFIPMKK--------KKDENEGVV  105

Query  514   SANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLW----NQSFTDPTPKEES-  678
             S                            S  + W+ S QLW    + S ++   + E  
Sbjct  106   SEKEN------------------------SDMKSWMSSVQLWSTNVDHSKSELNLRNEED  141

Query  679   ----PSNCKVGVKRNGSGGAFHPFK----REKSAGTSSPAVQTL--------------Ds  792
                 P N     K+   GGAF PFK    +E +  +  P++  +               S
Sbjct  142   DRSVPENPIEMSKKRSRGGAFVPFKGNYVKEGNEVSEVPSLSLMTPMCEVGGSNNGNSKS  201

Query  793   ttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIR  972
             +  G    S        ++  + Q  RKQRRCWSPELHRRF+ ALQQLGGS VATPKQIR
Sbjct  202   SARGGSGLSLVKLQIEAQQLSQQQCFRKQRRCWSPELHRRFVDALQQLGGSQVATPKQIR  261

Query  973   ELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             ELM+VDGLTNDEVKSHLQKYRLH R+
Sbjct  262   ELMQVDGLTNDEVKSHLQKYRLHVRK  287



>ref|XP_004233639.1| PREDICTED: putative two-component response regulator ARR13 [Solanum 
lycopersicum]
Length=371

 Score =   155 bits (393),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 116/332 (35%), Positives = 155/332 (47%), Gaps = 91/332 (27%)
 Frame = +1

Query  157   ISAMLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYK  336
             IS +L  +   +A  +  +K+++  +++  LEEE  KI+ F+RELPLC+ L+  AIE  K
Sbjct  21    ISDVLTEV---SAMDDISKKLKKLNQFLVPLEEELTKIEAFKRELPLCMLLLKHAIERLK  77

Query  337   QQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVL-EEFIPLKRASSLSQDEEDDEQQSPK  513
                                +E     + D+ PV+ EEFIPLK+ +S       DE    K
Sbjct  78    -------------------AEALLYKEKDKSPVMMEEFIPLKKGNS-------DEIGRVK  111

Query  514   SANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWN-----QSFT--------  654
              +N                         +S K++W+ SAQLW+     +SF         
Sbjct  112   KSN------------------------DLSDKKNWMSSAQLWSTPVQYESFNLQNLKRSG  147

Query  655   ---DPTPKEESPSNCKVGVKRNGSGGAFHPFKREK-SAGTSSPAVQTLDsttagvgngsg  822
                    K+     CK+  +R    GAF PF+R+         AV+ L  + A       
Sbjct  148   VEDKAKEKQYQLGACKLTSER----GAFLPFQRQALKVDKKCLAVKDLSLSMAVTVGEGE  203

Query  823   gggggskkeeketQS----------------QRKQRRCWSPELHRRFLQALQQLGGSHVA  954
                       K                    QRKQRRCWSPELHRRF+ AL QLGG  VA
Sbjct  204   NRENPIDVSVKRENGPSNSNGCDGFSHDKSLQRKQRRCWSPELHRRFVDALHQLGGPQVA  263

Query  955   TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             TPKQIR++M+VDGLTNDEVKSHLQKYRLH RR
Sbjct  264   TPKQIRDIMQVDGLTNDEVKSHLQKYRLHVRR  295



>ref|XP_009416802.1| PREDICTED: protein PHR1-LIKE 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 139/297 (47%), Gaps = 103/297 (35%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             + +E + +LEEERRKI  F+RELPLC+ L+T  IE  K++L               C  Q
Sbjct  36    KLEESVRSLEEERRKIDAFKRELPLCMLLLTDVIEGLKKELE-------------RCRGQ  82

Query  403   TTSSDDDEGPVLEEFIPLKR------ASSLSQDEEDDEQQSPKSANHRTdddddddnnnn  564
               ++        EEFIP++R         L  D ED                        
Sbjct  83    KLAN------AFEEFIPIRRKCEEEAGVKLEADYED------------------------  112

Query  565   gdssdsskdgkVSKKQDWLRSAQLW------NQSFTDPTPKEESPS--NCKVG-------  699
                           K++W+ SAQLW      N    D +  +E     +C  G       
Sbjct  113   --------------KKNWMSSAQLWGVNSSENNDEDDKSITDERNGRPDCDAGKESLNLE  158

Query  700   VKRNGSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQ  879
              K   +GGAF  FK     G S+ A++                     KEE   Q+ RK 
Sbjct  159   SKNRSAGGAFVQFK-----GISALAMKP--------------------KEEVLQQAPRKA  193

Query  880   RRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             RRCWSPELHRRF+ AL QLGG  VATPKQIRELMKVDGLTNDEVKSH+QKYRLH+R+
Sbjct  194   RRCWSPELHRRFVLALHQLGGVRVATPKQIRELMKVDGLTNDEVKSHMQKYRLHSRK  250



>ref|XP_009394713.1| PREDICTED: probable transcription factor GLK2 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=303

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 118/283 (42%), Positives = 151/283 (53%), Gaps = 64/283 (23%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             E  RR  E I AL+EERRK++ F RELPLCL L+ Q IE+YKQ +               
Sbjct  5     EYARRFGELIVALDEERRKMEAFHRELPLCLHLINQTIESYKQLM---------------  49

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
              S +T S +      ++EFIPL+  S  S+D+         + +H               
Sbjct  50    VSAETLSHE----LAVKEFIPLRPRSVSSEDD---------TIHH---------------  81

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRNGSGGAFHPFKREK  750
                          Q+W+RS QL  Q   DP PK  +P   K    +   G A +  K E+
Sbjct  82    -------------QEWIRSTQLVAQE-QDPLPK--TPIAIKA---KMTWGDAQYLDKEEE  122

Query  751   SAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQ  930
              A + S A Q  D+  A    G+G GG   KK+++ +Q +RK +R WS ELH+RFL AL+
Sbjct  123   IAPSESLACQ--DTEVASGEEGNGDGGKKKKKKKERSQPERKVKRYWSEELHKRFLHALE  180

Query  931   QLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTP  1059
             QLGG H ATPK IR+LMKVDGLTNDEVKSHLQKYRLH RR  P
Sbjct  181   QLGGCHAATPKLIRKLMKVDGLTNDEVKSHLQKYRLHARRSCP  223



>ref|XP_008339250.1| PREDICTED: uncharacterized protein LOC103402287 [Malus domestica]
Length=392

 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 150/328 (46%), Gaps = 91/328 (28%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N  E+M +  +++  LE+E RKI  F+RELPLC+ L+  AI A K++             
Sbjct  33    NVSERMSKLDDFVNRLEDEMRKIDAFKRELPLCMFLLNDAIRALKEE-------------  79

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
                 + Q T+ D    PVLEEFIP+K     ++    +  +  K +              
Sbjct  80    ----AMQCTAPDIQ--PVLEEFIPMKNDCGKNKGGSSNNNKKEKDSR-------------  120

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK----VGVKRNGS----  717
                            K++W+ S QLWN       P  + P + K    +  KRN +    
Sbjct  121   --------------DKKNWMSSVQLWNTDNYQQHPSSDFPYDQKRVSEIVSKRNEAENED  166

Query  718   ----------GGAFHPFK------------REK-----------SAGTSSPAVQTLDstt  798
                       G AF PFK             EK           + G  +P  ++  S +
Sbjct  167   PFQTCRNRTGGKAFMPFKGYPAFSVTPVRLEEKEELPVRGLSLLTPGIKNPKEESTSSGS  226

Query  799   agvgngsggggggskkeeketQSQ----RKQRRCWSPELHRRFLQALQQLGGSHVATPKQ  966
                   S      + +    T  Q    RKQRRCWSPELHR F+  LQQLGGS VATPKQ
Sbjct  227   RSTCGRSTSFSTANAQSNMRTLPQQPTSRKQRRCWSPELHRTFVNTLQQLGGSQVATPKQ  286

Query  967   IRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             IRELM+VDGLTNDEVKSHLQKYRLHTRR
Sbjct  287   IRELMQVDGLTNDEVKSHLQKYRLHTRR  314



>ref|XP_011001194.1| PREDICTED: two-component response regulator-like APRR2 [Populus 
euphratica]
 ref|XP_011001195.1| PREDICTED: two-component response regulator-like APRR2 [Populus 
euphratica]
Length=421

 Score =   154 bits (389),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 155/328 (47%), Gaps = 92/328 (28%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             +   ++  LEEE+RKI  F+RELPLC+ L+  AI+  +++L     +C  +I Q      
Sbjct  55    KIDSFLNDLEEEKRKIDAFKRELPLCMLLLNDAIQVVREEL----MQCGTSINQQ-----  105

Query  403   TTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssds  582
                      PVLEEFIPLK+      D+  D+++S                         
Sbjct  106   ---------PVLEEFIPLKKKI----DDHGDDRES----------------------DGL  130

Query  583   skdgkVSKKQDWLRSAQLWNQSFTDPTP----------KEESPSNCKV----------GV  702
              K+     K+ W+ S QLW      P+           K ES +N K             
Sbjct  131   IKEKDSKDKKSWMSSVQLWITDDHHPSTDYLFDAKQNFKLESKTNKKANQYVNEDAFQAC  190

Query  703   KRNGSGGAFHPFK-------------REK----SAGTSSPAVQTLDsttagvgngsgggg  831
             K   + G F PFK             RE+    +    +P ++++   +   G+ S    
Sbjct  191   KGRTAAGTFMPFKAYPGSLRKEDDSNREELPVPALSLLTPGIKSIKEESNSTGSRSSCSR  250

Query  832   ggskke-----------eketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIREL  978
               S              + + QS RK RRCWSPELHR+F+ ALQQLGG+ VATPKQIREL
Sbjct  251   SVSTTAPNSESNLRNGPQSQQQSSRKHRRCWSPELHRQFVNALQQLGGAQVATPKQIREL  310

Query  979   MKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             M+VDGLTNDEVKSHLQKYRLHTRR  P+
Sbjct  311   MQVDGLTNDEVKSHLQKYRLHTRRVAPA  338



>ref|XP_001756771.1| predicted protein [Physcomitrella patens]
 gb|EDQ78368.1| predicted protein [Physcomitrella patens]
Length=535

 Score =   155 bits (393),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 119/325 (37%), Positives = 159/325 (49%), Gaps = 46/325 (14%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQL---SGTTTECNLNIG  381
             E +R+ ++Y+  LEEERRK++ F+RELPLC++L+  AI   K++L        +   N  
Sbjct  37    ESLRKAEDYVRTLEEERRKVEGFKRELPLCIQLLEDAIRTSKEKLLRGKDLPQQLKANSM  96

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKR-----ASSLSQDEEDDEQQSPKSANHRTddddd  546
              S   +   SS       LEEF+PLKR       S+S D E  E +S K     T+    
Sbjct  97    DSGKDQHGVSSGPGCRHTLEEFMPLKRRWERDQPSVSSDGERGEDRSSKRPAWMTEALLS  156

Query  547   ddnnnngdssd----sskdgkVSKKQ-DWLRSAQLW---------------------NQS  648
                  + +          +  VS+++  W+ S+Q+                      N  
Sbjct  157   KRTPASPEKETRLTQEHSELSVSEQEHSWVTSSQMLLGANQRPTGAFLPFIREQHGVNSF  216

Query  649   FTDPTPK------EESPSNCKVGVKRNGSGGAFHPFKREKS-AGTSSPAVQTLDsttagv  807
              + PTP+      + S S C+    + G     H  +   S  G+     QT+D   A  
Sbjct  217   LSRPTPRPAGSGADLSLSLCEPTTTQTG-----HTLRPSGSEVGSIDAGRQTVDVPVAED  271

Query  808   gngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKV  987
                   G  G+          RK RRCWSPELHR F+ AL QLGGS +ATPKQIRELMKV
Sbjct  272   MGVISNGTSGAGSSSVGGNPSRKARRCWSPELHRLFVNALHQLGGSQIATPKQIRELMKV  331

Query  988   DGLTNDEVKSHLQKYRLHTRRPTPS  1062
             DGLTNDEVKSHLQKYRLHTRRP+ S
Sbjct  332   DGLTNDEVKSHLQKYRLHTRRPSSS  356



>ref|XP_009408601.1| PREDICTED: uncharacterized protein LOC103990992 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 113/322 (35%), Positives = 150/322 (47%), Gaps = 101/322 (31%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             R +E I++LEEE+RKI+ F+RELPLC+ L+++ IE   +++      C            
Sbjct  33    RLEESIKSLEEEKRKIEAFKRELPLCMLLLSEVIEGLNKEIQ----RCR-----------  77

Query  403   TTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssds  582
                  D  G V EEFIP+K     S+ EED   ++                         
Sbjct  78    ----GDRFGCVFEEFIPMK-----SKVEEDGRVKA-------------------------  103

Query  583   skdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSN----------------CKVGVKRNG  714
               +     K++W+ SAQLW+ + +D    +++ +N                CK    RNG
Sbjct  104   --ETDCKDKKNWMSSAQLWSDNHSDNDDDDKAHANIISEEDGGYHRNFFSECK---NRNG  158

Query  715   SGGAFHPFKREKSAGTSS-----------------PAVQT-------------LDsttag  804
              GGAF PFKR  S   SS                 PA++              +    + 
Sbjct  159   -GGAFVPFKRLSSFAASSKEEEKPPPALPDLSLQSPAIENTPGLVTCAAEDHRVGGCDSK  217

Query  805   vgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMK  984
                 +      +       Q  RK RRCWS ELHRRF+ A+QQLGG+ VATPKQIRE MK
Sbjct  218   AVYEASESSPATANTHLNVQPPRKARRCWSQELHRRFVLAIQQLGGAQVATPKQIREQMK  277

Query  985   VDGLTNDEVKSHLQKYRLHTRR  1050
             VDGLTNDEVKSHLQKYRLH RR
Sbjct  278   VDGLTNDEVKSHLQKYRLHARR  299



>ref|XP_011039217.1| PREDICTED: probable transcription factor KAN3 [Populus euphratica]
Length=351

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 111/312 (36%), Positives = 145/312 (46%), Gaps = 97/312 (31%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             +K+ +  +Y+E LE+ERRKI  F+RELPLC+ L+ +AI   K++               +
Sbjct  31    QKLPKLYDYVERLEDERRKIDAFKRELPLCMLLLNEAIARLKEE-------------AMQ  77

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
             CSE            L +FIPLK  SS  +D  D                          
Sbjct  78    CSE------------LNDFIPLKGNSS--EDGND--------------------------  97

Query  571   ssdsskdgkVSKKQDWLRSAQLWN----------QSFTDPTPKEESP---SNCKVGVK--  705
                         K++W+ S QLWN           S ++P  K E     S C+  V+  
Sbjct  98    ------------KKNWMSSVQLWNTNNHLDCKKQDSKSEPKQKSEEDDDRSTCENPVQLG  145

Query  706   -RNGSGGAFHPFK-----------REKSAGTSSPAVQTLDsttagvg-----ngsggggg  834
               +  GGAF PFK            EK   +    +  ++S             +     
Sbjct  146   NHSNKGGAFVPFKALSGFEGSKRKEEKEVVSQVTGLSPMNSVPDLSSCNWTRKSNNCSNQ  205

Query  835   gskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVK  1014
                  + + Q+ RKQRRCWSPELHRRF+ ALQQLGG  VATPKQIRE M+VDGLTNDEVK
Sbjct  206   TKILSKSQQQAYRKQRRCWSPELHRRFVDALQQLGGCQVATPKQIREHMQVDGLTNDEVK  265

Query  1015  SHLQKYRLHTRR  1050
             SHLQKYRLH R+
Sbjct  266   SHLQKYRLHLRK  277



>gb|EYU42654.1| hypothetical protein MIMGU_mgv1a008635mg [Erythranthe guttata]
Length=344

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/307 (34%), Positives = 151/307 (49%), Gaps = 77/307 (25%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N PEK+ + ++Y+  L++E +KI  F+RELPLC+ L+  AI   K++L     +C  +I 
Sbjct  38    NSPEKISKLEDYVSRLDDEMKKIDAFKRELPLCMLLLNDAIAKIKEEL----IQCRNSIT  93

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
             +               P++EEFIPLK++    +D++ D                      
Sbjct  94    E---------------PIIEEFIPLKKSLPKKEDDKIDSVD-------------------  119

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK-VGVKRNGS----GGA  726
                            K +W+ S QLWN   +D  P  E+      V + ++G+    G A
Sbjct  120   ---------------KMNWMSSVQLWN---SDNHPNTENKKKWGGVDLIKSGNNRTEGRA  161

Query  727   FHPFKR---EKSAGTSSPAVQT-------------LDsttagvgngsggggggskkeeke  858
             F  FKR     +   ++P ++                S++    + +      + K +  
Sbjct  162   FSSFKRCADLPALSLATPEIKNSKKEEICSSDFSPKSSSSRSGSSSATNTDQSNSKSKLP  221

Query  859   tQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRL  1038
              Q+ RKQRRCWSPELHRRF+ AL+ LGG   ATPKQIR+LM+V GLTNDEVKSHLQKYRL
Sbjct  222   NQTSRKQRRCWSPELHRRFISALEHLGGPQSATPKQIRDLMQVHGLTNDEVKSHLQKYRL  281

Query  1039  HTRRPTP  1059
               R+  P
Sbjct  282   LARKLAP  288



>gb|KHG07947.1| Two-component response regulator ARR18 -like protein [Gossypium 
arboreum]
Length=392

 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 112/321 (35%), Positives = 146/321 (45%), Gaps = 95/321 (30%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             +K+ +   +++ LEEE RKI  F+RELPL + L+  AI A K++              ++
Sbjct  36    DKVSKLDSFVKRLEEEMRKIDGFKRELPLSMLLLNDAILALKEE-------------STQ  82

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
             C  +         PVLEEFIPLK     + +  DDE++                      
Sbjct  83    CVRRRNVE-----PVLEEFIPLKNNRKENNNHSDDEEED---------------------  116

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRN--------GSGGA  726
                         K++W+ S QLWN    D      S  + K+  KRN        G    
Sbjct  117   ----------DSKKNWMSSVQLWNTEDDD-----HSSIDDKLDTKRNHGDPFKNRGKVRG  161

Query  727   FHPF---------KREK-----------SAGTSSPAVQTLDsttagvgngsggggggskk  846
             F PF         K EK           + G  +P V+   +      + +        +
Sbjct  162   FMPFKANLSFAVKKEEKREIPIHGLTILTPGIKNPKVELGFTEWRMSRSRAASCSSLKGQ  221

Query  847   eeketQSQ-------------RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKV  987
                 ++ Q             RKQRRCWS ELHRRF+ ALQQLGGS VATPKQIRELM+V
Sbjct  222   VNYRSELQPLSDHQQQQQQATRKQRRCWSSELHRRFVNALQQLGGSQVATPKQIRELMQV  281

Query  988   DGLTNDEVKSHLQKYRLHTRR  1050
             DGLTNDEVKSHLQKYRLHTRR
Sbjct  282   DGLTNDEVKSHLQKYRLHTRR  302



>ref|XP_002960068.1| hypothetical protein SELMODRAFT_402040 [Selaginella moellendorffii]
 gb|EFJ37607.1| hypothetical protein SELMODRAFT_402040 [Selaginella moellendorffii]
Length=396

 Score =   151 bits (381),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 149/300 (50%), Gaps = 65/300 (22%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             RR ++Y++AL++ER+KI+ F+RELP C+ L+ QAI++ +  L  +               
Sbjct  33    RRMEDYLQALQQERQKIEAFKRELPCCMNLLDQAIQSTRGCLDESYK-------------  79

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
               T  +++  P LE F+  +    L + + + E       +HR  ++             
Sbjct  80    --TEMEEENPPKLELFLENRSGFRLGKPKSEAE-------DHRDFEERPS----------  120

Query  580   sskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRN---GSGGAFHPFKREK  750
                    + KQ+W++ A      F   +P+E+     +  ++ +      GAF PF R+K
Sbjct  121   -------TPKQNWMQLA-----CFPSQSPREDEEFETRKALRSSTASADSGAFAPFVRDK  168

Query  751   S-----AGTSSPAVQTLDsttagvgngsggggggskkeeketQ-------------SQRK  876
                      SS    +L+    G     G        E    Q              QRK
Sbjct  169   KWDQAELCLSSSICLSLEQKKTGFIKFQGNESNLPLVELSLQQMPSSGICSNSTLHQQRK  228

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
              RRCWSPELHRRF+ ALQQLGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP 
Sbjct  229   ARRCWSPELHRRFVNALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPA  288



>ref|XP_002984071.1| hypothetical protein SELMODRAFT_423260 [Selaginella moellendorffii]
 gb|EFJ15083.1| hypothetical protein SELMODRAFT_423260 [Selaginella moellendorffii]
Length=396

 Score =   150 bits (380),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 149/300 (50%), Gaps = 65/300 (22%)
 Frame = +1

Query  220   RRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSE  399
             RR ++Y++AL++ER+KI+ F+RELP C+ L+ QAI++ +  L  +               
Sbjct  33    RRMEDYLQALQQERQKIEAFKRELPCCMNLLEQAIQSTRGCLDESYK-------------  79

Query  400   QTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssd  579
               T  +++  P LE F+  +    L + + + E       +HR  ++             
Sbjct  80    --TEMEEENPPKLELFLENRSGFLLGKPKSEAE-------DHRDFEERPS----------  120

Query  580   sskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRN---GSGGAFHPFKREK  750
                    + KQ+W++ A      F   +P+E+     +  ++ +      GAF PF R+K
Sbjct  121   -------TPKQNWMQLA-----CFPSQSPREDGEFETRKALRSSTASADSGAFAPFVRDK  168

Query  751   S-----AGTSSPAVQTLDsttagvgngsggggggskkeeketQ-------------SQRK  876
                      SS    +L+    G     G        E    Q              QRK
Sbjct  169   KWDQAELCLSSSICLSLEQKKTGFIKFQGSESNLPLVELSLQQMPSSGICSNSTLHQQRK  228

Query  877   QRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPT  1056
              RRCWSPELHRRF+ ALQQLGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP 
Sbjct  229   ARRCWSPELHRRFVNALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPA  288



>ref|XP_006829666.1| hypothetical protein AMTR_s00122p00127250 [Amborella trichopoda]
 gb|ERM97082.1| hypothetical protein AMTR_s00122p00127250 [Amborella trichopoda]
Length=382

 Score =   149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 137/272 (50%), Gaps = 83/272 (31%)
 Frame = +1

Query  322   IEAYKQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQ  501
             +EA +QQL+              CSE T SS     PVLEEFIP+KR+SS   +  +   
Sbjct  1     MEASRQQLAS-------------CSELTRSSSK---PVLEEFIPIKRSSSEGSETTN---  41

Query  502   QSPKSANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLW-NQSFTDPTPKEES  678
                                              S K +W+ SAQLW +QSF    P  + 
Sbjct  42    -------------------------------MTSDKANWMTSAQLWSDQSF----PSSQK  66

Query  679   PSNCKVGVKRNGSGGAFHPFKREKSA------------------------GTSSPAVQTL  786
             P+    G +RNG  GAF PF +++ +                          +S A +  
Sbjct  67    PAFN--GKQRNG--GAFLPFSKDRESRKTLSDLALASTEKEEIESPKFTEHEASGANKMK  122

Query  787   DsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQ  966
             ++     G G GG      K     Q+QRK RRCWSP+LHRRF+ ALQQLGGS VATPKQ
Sbjct  123   ENYNQVQGGGGGGLEREENKGSSGGQTQRKARRCWSPDLHRRFVSALQQLGGSQVATPKQ  182

Query  967   IRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             IRELMKVDGLTNDEVKSHLQKYRLHTRRP+P+
Sbjct  183   IRELMKVDGLTNDEVKSHLQKYRLHTRRPSPT  214



>ref|XP_010263747.1| PREDICTED: uncharacterized protein LOC104601936 [Nelumbo nucifera]
Length=402

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 118/329 (36%), Positives = 155/329 (47%), Gaps = 105/329 (32%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             +  +Y++ LEEE +KI+ F+RELPLC+ L+  AI + K++      +C            
Sbjct  40    KLDDYVKRLEEEMKKIEAFKRELPLCMLLLNDAIVSLKEE----GMQC------------  83

Query  403   TTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssds  582
             TTS   +  PV+EEFIPLKR S       D++ ++ K    R                  
Sbjct  84    TTS---NVRPVMEEFIPLKRNS-------DEDVRAKKEKESR------------------  115

Query  583   skdgkVSKKQDWLRSAQLWNQS---------------------FTDPTPKEESPSNCKVG  699
                     K++W+ SAQLW+ S                      T+P      P N    
Sbjct  116   -------DKKNWMSSAQLWSSSGYSNQDTSYDRNQKSVVDGKEVTEPE-DHSVPENPFQS  167

Query  700   VKRNGSGGAFHPFKREKSAGTS-----------------SPAVQT---------------  783
              K    GGAF PFK      T+                 +P ++T               
Sbjct  168   CKYRSRGGAFMPFKGYTGFPTTPLKEDKEVLPVPALSLFTPGIKTPRHEPNPSCLNSKNS  227

Query  784   LDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPK  963
             L +      +        +  ++++ Q+ RKQRRCWSPELHRRF+ ALQQLGGS VATPK
Sbjct  228   LGNRAFASPSTKPQSNLQTATQQQQQQTSRKQRRCWSPELHRRFVSALQQLGGSQVATPK  287

Query  964   QIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             QIRELMKVDGLTNDEVKSHLQKYRLHTRR
Sbjct  288   QIRELMKVDGLTNDEVKSHLQKYRLHTRR  316



>ref|XP_011099213.1| PREDICTED: uncharacterized protein LOC105177678 isoform X1 [Sesamum 
indicum]
Length=360

 Score =   148 bits (373),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 137/311 (44%), Gaps = 80/311 (26%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ +K  +   Y+ +LEEE RK+  F+RELP C++L+  AIE  K+              
Sbjct  39    DFSKKSSKLDFYVHSLEEEMRKVDAFKRELPHCMQLLRDAIETLKK--------------  84

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
                  E       + GPV+EEFIPLK  S                               
Sbjct  85    -----ESLRWKGREMGPVMEEFIPLKGDS-------------------------------  108

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWN--------QSFTDPTPKEESPSNCKVGVKRNG-  714
                   +      S+K++W+ S QLW+         S      + +      +  +  G 
Sbjct  109   -EGGGRAKLSTDFSEKKNWMSSVQLWSTPVHYENQDSVLSLRSRHQEEEGSGIDSQFQGC  167

Query  715   -----SGGAFHPFKREKSA--------------GTSSPAVQTLDsttagvgngsgggggg  837
                  SGGAF PFK+                  G  S ++   +                
Sbjct  168   NNIKNSGGAFLPFKKAPGLSIKEQKRDSASAVNGGLSLSIPVAELELESESPDLISVKEP  227

Query  838   skkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKS  1017
             S     + Q QRKQRRCWSPELH+RF+ ALQ LGG+  ATPKQIRELMKVDGLTNDEVKS
Sbjct  228   SAFLRPQLQ-QRKQRRCWSPELHKRFVDALQHLGGAQTATPKQIRELMKVDGLTNDEVKS  286

Query  1018  HLQKYRLHTRR  1050
             HLQKYRLH R+
Sbjct  287   HLQKYRLHIRK  297



>emb|CDY71874.1| BnaAnng39110D, partial [Brassica napus]
Length=361

 Score =   147 bits (372),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 109/266 (41%), Positives = 136/266 (51%), Gaps = 73/266 (27%)
 Frame = +1

Query  319   AIEAYKQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDE  498
             ++E Y+QQL       N N  QS  +           PVLEEFIPL+     +Q E+++ 
Sbjct  4     SVEVYRQQLEAYRENSN-NSNQSVVAR----------PVLEEFIPLR-----NQPEKEN-  46

Query  499   QQSPKSANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDP------  660
                                               +K  +W+ +AQLW+Q  T P      
Sbjct  47    ----------------------------------NKGNNWMTTAQLWSQPETKPKNIDPT  72

Query  661   ---TPKEESPSNCKVG---VKRNGSGGAFHPFKREKS---------AGTSSPAVQ-TLDs  792
                +PK+E  S+ K+G   VK+   GGAF PF +EK+             SPA + T D 
Sbjct  73    TDQSPKDELASSPKLGHFDVKQRNGGGAFLPFSKEKTLPELALSTEVKRVSPANEHTNDH  132

Query  793   ttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIR  972
                G    +G     +      +QS RK RRCWSP+LHRRF+QALQ LGGS VATPKQIR
Sbjct  133   DCNGESIINGSNNNNNNNSSTTSQSNRKARRCWSPDLHRRFVQALQMLGGSQVATPKQIR  192

Query  973   ELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             ELMKVDGLTNDEVKSHLQKYRLHTRR
Sbjct  193   ELMKVDGLTNDEVKSHLQKYRLHTRR  218



>ref|XP_009622698.1| PREDICTED: uncharacterized protein LOC104114057 [Nicotiana tomentosiformis]
Length=379

 Score =   147 bits (370),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 112/330 (34%), Positives = 151/330 (46%), Gaps = 90/330 (27%)
 Frame = +1

Query  175   TIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGT  354
              + + +A  +  +K+ +   ++ +LEEE +KI+ F+RELPLC+ L+  AIE  K+     
Sbjct  24    VLTEVSAIDDISKKLSKLNHFVLSLEEELKKIEAFKRELPLCMVLLKDAIERLKE-----  78

Query  355   TTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTd  534
                           E        + PV+EEFIPLK  S        +E    K +N    
Sbjct  79    --------------EALQYKGKGKRPVMEEFIPLKSNS--------NESGRVKMSND---  113

Query  535   ddddddnnnngdssdsskdgkVSKKQDWLRSAQLWN-----------------QSFTDPT  663
                                  +S K+ W+ SAQLW+                 Q  +   
Sbjct  114   ---------------------ISDKKKWMSSAQLWSTPVHYESIDLGKQGQFLQLKSSGV  152

Query  664   PKEESPSNCKVGV-KRNGSGGAFHPF--------KREK------------SAGTSSPAVQ  780
                +  +  K+G+ K     GAF PF        K EK            + G       
Sbjct  153   EGRDRENEFKLGIYKLKNDRGAFMPFQENSVRSVKDEKNGKPVNDLSLCMAVGEREEGPN  212

Query  781   TLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATP  960
              +D +      G    G  S   + ++Q QRKQRRCWSPELHRRF+ AL QLGG  VATP
Sbjct  213   PVDVSVKIDNGGGRSNGCSSNFLQDKSQ-QRKQRRCWSPELHRRFVDALHQLGGPQVATP  271

Query  961   KQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             KQIRE+M+VDGLTNDEVKSHLQK+RLH RR
Sbjct  272   KQIREIMQVDGLTNDEVKSHLQKFRLHVRR  301



>ref|XP_001773715.1| predicted protein [Physcomitrella patens]
 gb|EDQ61472.1| predicted protein [Physcomitrella patens]
Length=515

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 119/351 (34%), Positives = 159/351 (45%), Gaps = 104/351 (30%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             +++++   ++ AL+EER KI+ F+RELPLC++L+ +AIE    ++     +C+       
Sbjct  36    DEIQKIAAHLRALQEERGKIEAFKRELPLCMQLLDEAIETAINKV--MVDQCS-----PT  88

Query  391   CSEQTTSSD----DDEGP----VLEEFIPLK-------RASSLSQDEEDDEQQSPKSANH  525
              S QT+  D    D E P    VLE F+PLK       +      D  ++ QQ       
Sbjct  89    ASLQTSVLDAQDSDYERPKRTLVLENFMPLKRRWEKQLKEKIFQNDAGNNSQQ-------  141

Query  526   RTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNC---KV  696
                                 +D  V  +  W++  QLW +       ++ SPS     +V
Sbjct  142   -------------------HEDKVVIGRPAWMKETQLWTKQSESIDYEKASPSRGSRRQV  182

Query  697   GVK-----------------RNGSGGAFHPFKREK----------SAGTSSPA-------  774
               K                 ++  GGAF PF REK          S G +S A       
Sbjct  183   EFKCSEQDRPLTSSRLLLNSKDRQGGAFVPFNREKQLPSPPFSSQSTGPASDAAGFSTSS  242

Query  775   -----------VQTLD--------sttagvgngsggggggskkeeketQSQRKQRRCWSP  897
                        +++ D               +         +      Q QRK RRCWSP
Sbjct  243   AVRTPSRMGHTIESFDIGRVNGNVHVRDHSSDARNSIDHSVQTRTGANQPQRKARRCWSP  302

Query  898   ELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             ELHRRF+ ALQQLGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR
Sbjct  303   ELHRRFVSALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  353



>ref|XP_002310743.1| hypothetical protein POPTR_0007s11470g [Populus trichocarpa]
 gb|EEE91193.1| hypothetical protein POPTR_0007s11470g [Populus trichocarpa]
Length=351

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/312 (35%), Positives = 145/312 (46%), Gaps = 97/312 (31%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             +K+ +  +Y+E LE+ERRKI  F+RELPLC+ L+ +AI   K++               +
Sbjct  31    QKLTKLYDYVERLEDERRKIDAFKRELPLCMLLLNEAIARLKEE-------------AMQ  77

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
             CSE            L + IPLK  S+  +D  D                          
Sbjct  78    CSE------------LNDLIPLKGNSN--EDGND--------------------------  97

Query  571   ssdsskdgkVSKKQDWLRSAQLWN----------QSFTDPTPKEESP---SNCKVGVK--  705
                         K++W+ S QLWN           S ++P  K E     S C+  V+  
Sbjct  98    ------------KKNWMSSVQLWNTNNHLDCKKQDSKSEPKQKSEEDDDRSTCENPVQLG  145

Query  706   -RNGSGGAFHPFK----------REKSAGTS-----SPAVQTLDsttag-vgngsggggg  834
               +  G AF PFK          +E+    S     SP     D ++       +     
Sbjct  146   DHSNKGEAFVPFKALSGFEGSKRKEEKEVVSQVTGLSPMTPVPDLSSCNWTRKSNNCSNQ  205

Query  835   gskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVK  1014
                  + + Q+ RKQRRCWSPELHRRF+ ALQQLGG  VATPKQIRE M+VDGLTNDEVK
Sbjct  206   TKILSKSQQQAYRKQRRCWSPELHRRFVDALQQLGGCQVATPKQIREHMQVDGLTNDEVK  265

Query  1015  SHLQKYRLHTRR  1050
             SHLQKYRLH R+
Sbjct  266   SHLQKYRLHLRK  277



>ref|XP_009416801.1| PREDICTED: uncharacterized protein LOC103997346 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=375

 Score =   145 bits (366),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 111/328 (34%), Positives = 142/328 (43%), Gaps = 112/328 (34%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             + +E + +LEEERRKI  F+RELPLC+ L+T  IE  K++L               C  Q
Sbjct  36    KLEESVRSLEEERRKIDAFKRELPLCMLLLTDVIEGLKKELE-------------RCRGQ  82

Query  403   TTSSDDDEGPVLEEFIPLKR------ASSLSQDEEDDEQQSPKSANHRTdddddddnnnn  564
               ++        EEFIP++R         L  D ED                        
Sbjct  83    KLAN------AFEEFIPIRRKCEEEAGVKLEADYED------------------------  112

Query  565   gdssdsskdgkVSKKQDWLRSAQLW-----------NQSFTDPTPKEESPSNCKVG----  699
                           K++W+ SAQLW           ++S TD   +     +C  G    
Sbjct  113   --------------KKNWMSSAQLWGVNSSENNDEDDKSITD---ERNGRPDCDAGKESL  155

Query  700   ---VKRNGSGGAFHPFKREKSAGTS--------------SPAVQTLDsttagvgngsg--  822
                 K   +GGAF  FK   +                  SPAV++     + V       
Sbjct  156   NLESKNRSAGGAFVQFKGISALAMKPKEEVKPLPDLSLRSPAVKSNSCPVSAVTEHQAGG  215

Query  823   ------------gggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQ  966
                            G     +   Q+ RK RRCWSPELHRRF+ AL QLGG  VATPKQ
Sbjct  216   GSGSKGVVRAPPAMIGAHLSLQVLQQAPRKARRCWSPELHRRFVLALHQLGGVRVATPKQ  275

Query  967   IRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             IRELMKVDGLTNDEVKSH+QKYRLH+R+
Sbjct  276   IRELMKVDGLTNDEVKSHMQKYRLHSRK  303



>gb|EYU42653.1| hypothetical protein MIMGU_mgv1a008635mg [Erythranthe guttata]
Length=367

 Score =   145 bits (366),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 148/311 (48%), Gaps = 62/311 (20%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N PEK+ + ++Y+  L++E +KI  F+RELPLC+ L+      +  Q    T   N    
Sbjct  38    NSPEKISKLEDYVSRLDDEMKKIDAFKRELPLCMLLLNDGEFLFFLQFPHFTPHRNFFFS  97

Query  382   QSECS----EQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
              +  +    E     +    P++EEFIPLK++    +D++ D                  
Sbjct  98    IAAIAKIKEELIQCRNSITEPIIEEFIPLKKSLPKKEDDKIDSVD---------------  142

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK-VGVKRNGS---  717
                                K +W+ S QLWN   +D  P  E+      V + ++G+   
Sbjct  143   -------------------KMNWMSSVQLWN---SDNHPNTENKKKWGGVDLIKSGNNRT  180

Query  718   -GGAFHPFKR---EKSAGTSSPAVQT-------------LDsttagvgngsggggggskk  846
              G AF  FKR     +   ++P ++                S++    + +      + K
Sbjct  181   EGRAFSSFKRCADLPALSLATPEIKNSKKEEICSSDFSPKSSSSRSGSSSATNTDQSNSK  240

Query  847   eeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQ  1026
              +   Q+ RKQRRCWSPELHRRF+ AL+ LGG   ATPKQIR+LM+V GLTNDEVKSHLQ
Sbjct  241   SKLPNQTSRKQRRCWSPELHRRFISALEHLGGPQSATPKQIRDLMQVHGLTNDEVKSHLQ  300

Query  1027  KYRLHTRRPTP  1059
             KYRL  R+  P
Sbjct  301   KYRLLARKLAP  311



>emb|CDY70722.1| BnaAnng34750D [Brassica napus]
Length=307

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 107/170 (63%), Gaps = 22/170 (13%)
 Frame = +1

Query  619   LRSAQLWNQSFTDP---------TPKEESPSNCKVG---VKRNGSGGAFHPFKREKS---  753
             + +AQLW+Q  T P         +PK+E  S+ K+G   VK+   GGAF PF +EK+   
Sbjct  1     MTTAQLWSQPETKPKNIDLTTDQSPKDELASSPKLGHFDVKQRNGGGAFLPFSKEKTLPE  60

Query  754   ------AGTSSPAVQ-TLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRR  912
                       SPA + T D    G    +G     +      +QS RK RRCWSP+LHRR
Sbjct  61    LALSTEVKRVSPANEHTNDHDCNGESIINGSNNNNNNNSSTTSQSNRKARRCWSPDLHRR  120

Query  913   FLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             F+QALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS
Sbjct  121   FVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPS  170



>gb|ABF70013.1| myb DNA-binding domain-containing protein [Musa acuminata]
Length=375

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 113/326 (35%), Positives = 142/326 (44%), Gaps = 108/326 (33%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             + +E + +LEEERRKI  F+RELPLC+ L+T  IE  K++L               C  Q
Sbjct  36    KLEESVRSLEEERRKIDAFKRELPLCMLLLTDVIEGLKKELE-------------RCRGQ  82

Query  403   TTSSDDDEGPVLEEFIPLKR------ASSLSQDEEDDEQQSPKSANHRTdddddddnnnn  564
               ++        EEFIP++R         L  D ED                        
Sbjct  83    KLAN------AFEEFIPIRRKCEEEAGVKLEADYED------------------------  112

Query  565   gdssdsskdgkVSKKQDWLRSAQLW-----------NQSFTD-----PTPKEESPSNCKV  696
                           K++W+ SAQLW           ++S TD     P    E  S   +
Sbjct  113   --------------KKNWMSSAQLWSVNSSENNDEDDKSITDERNGRPDCDAEKES-LNL  157

Query  697   GVKRNGSGGAFHPFKREKSAGTS--------------SPAVQTLDsttagvgngsg----  822
               K   +GGAF  FK   +                  SPAV++     + V         
Sbjct  158   ESKNLSAGGAFVQFKGISALAMKPKEEVKPLPDLSLRSPAVKSNSCPVSAVTEHQAGGVS  217

Query  823   ----------gggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIR  972
                          G     +   Q+ RK RRCWSPELHRRF+ AL QLGG  VATPKQIR
Sbjct  218   GSKGVGRAPPAMTGAHLSLQVMQQTPRKARRCWSPELHRRFVLALYQLGGVRVATPKQIR  277

Query  973   ELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             ELMKVDGLTNDEVKSHLQKYRLH+R+
Sbjct  278   ELMKVDGLTNDEVKSHLQKYRLHSRK  303



>ref|XP_008792589.1| PREDICTED: uncharacterized protein LOC103709147 [Phoenix dactylifera]
Length=386

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 141/319 (44%), Gaps = 96/319 (30%)
 Frame = +1

Query  262   RKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLE  441
             RKI+ F+RELPL + LV   I+  K++L     +C  +     C             VL 
Sbjct  53    RKIEAFKRELPLSMHLVCDVIQGLKEELE----QCGGDRYAKSCH------------VLS  96

Query  442   EFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdsskdgkVSKKQDWL  621
             EF+P+K     S+ EE+   +                            +     K +W+
Sbjct  97    EFMPVK-----SKFEEEGRVK---------------------------LEDDTKDKMNWM  124

Query  622   RSAQLWNQSFTDPTPKEESPSNCKVGVKRNG---------------SGGAFHPF------  738
              SAQLW+ +++D      +    ++  KR G                GGAF PF      
Sbjct  125   SSAQLWSDNYSDENKNNATDDEKRIAEKRGGEADCETSSLESKGRSGGGAFVPFKGLSAL  184

Query  739   -----KREK---------------SAGTSSPAVQT------LDsttagvgngsggggggs  840
                  K +K               +A    PAV        L S  A          G  
Sbjct  185   AENPMKEDKLAVALPDLSLLSPGITASRPVPAVTEDHRGGGLISKVAVRSPAPAPAVGAH  244

Query  841   kkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSH  1020
                + + QS RK RRCWSPELHRRF+ ALQQLGG+ VATPKQIRELMKVDGLTNDEVKSH
Sbjct  245   LSLQAQQQSPRKARRCWSPELHRRFVSALQQLGGAQVATPKQIRELMKVDGLTNDEVKSH  304

Query  1021  LQKYRLHTRR-PTPSIRNN  1074
             LQKYRLHTRR P  S   N
Sbjct  305   LQKYRLHTRRVPNASAATN  323



>gb|KFK36001.1| hypothetical protein AALP_AA4G064900 [Arabis alpina]
Length=306

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 108/295 (37%), Positives = 138/295 (47%), Gaps = 92/295 (31%)
 Frame = +1

Query  214   KMRRCQEYIEALEEERRKIQVFQR-ELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             KM    E+I+ LEEE+RKIQ   + ELPLCLE++  AI   K++      +C +N     
Sbjct  18    KMMNVAEHIKKLEEEKRKIQDHHKLELPLCLEILNNAISCLKEE----NKKCLVN-----  68

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
                      DD  P+L++FI L +       EEDDE    K                   
Sbjct  69    ---------DDTKPLLKDFISLDKTIG----EEDDEVIKEK-------------------  96

Query  571   ssdsskdgkVSKKQDWLRSAQLWNQSFTD-----------PTPKEESPSNCKVGVKRNGS  717
                        K Q W  +  + NQ F +           PTPK E+      G+   G 
Sbjct  97    -----------KFQQWKANDHILNQRFLERNEEKSSMLLIPTPKVET------GL---GL  136

Query  718   GGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSP  897
             G A    +R+  A +S  ++                          + Q+ RKQRRCW+P
Sbjct  137   GLASSSIRRKDIASSSFTSM-------------------AQPPAFLQQQALRKQRRCWTP  177

Query  898   ELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             ELHRRF+ ALQQLGG  VATPKQIRE M+ +GLTNDEVKSHLQKYRLH RRP  S
Sbjct  178   ELHRRFVDALQQLGGPGVATPKQIREHMQEEGLTNDEVKSHLQKYRLHIRRPNNS  232



>emb|CAN83122.1| hypothetical protein VITISV_044371 [Vitis vinifera]
Length=382

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 150/328 (46%), Gaps = 104/328 (32%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             EK+ +  +Y++ LE+E RKI  F+RELPLC+ L+  AI   +++               +
Sbjct  32    EKLSKLDDYVKGLEDEMRKIDGFKRELPLCMLLLNDAILRLREE-------------AMQ  78

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
             C+E       + G V EEFIPLK  S     E D+  +  K +                 
Sbjct  79    CTES------EGGHVTEEFIPLKGRS-----EGDEGAEMGKDS-----------------  110

Query  571   ssdsskdgkVSKKQDWLRSAQLWN----------QSFTDPTPKEESPSN---------CK  693
                       S K+ W+  AQLW+          +S  +   + E  +N         C 
Sbjct  111   ----------SDKRSWMSXAQLWSCNRSSDNNNKKSVLEFQQRNEEDNNSGSENPIRPCS  160

Query  694   VGVKRNGSGGAFHPFKREKS------------AGTS--SPAVQTLDsttagvgngsgggg  831
              G +     GAF PFK                AG S  +P V+ +D   +    G+ G  
Sbjct  161   YGNR----AGAFVPFKVSSGFPAKGDKEVVPVAGLSLMTPMVE-VDPNNSNSKCGNSGET  215

Query  832   ggskkeeketQSQR---------------KQRRCWSPELHRRFLQALQQLGGSHVATPKQ  966
             G        T S R               KQRRCWSPELHRRF+ ALQQLGGS  ATPKQ
Sbjct  216   GSGSVSTLLTDSMRLQCKSQQQPPQQGIRKQRRCWSPELHRRFVNALQQLGGSQAATPKQ  275

Query  967   IRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             IRELM+V+GLTNDEVKSHLQKYRLH RR
Sbjct  276   IRELMQVEGLTNDEVKSHLQKYRLHVRR  303



>ref|XP_002264629.2| PREDICTED: uncharacterized protein LOC100243049 isoform X1 [Vitis 
vinifera]
Length=386

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 150/328 (46%), Gaps = 104/328 (32%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             EK+ +  +Y++ LE+E RKI  F+RELPLC+ L+  AI   +++               +
Sbjct  36    EKLSKLDDYVKGLEDEMRKIDGFKRELPLCMLLLNDAILRLREE-------------AMQ  82

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
             C+E       + G V EEFIPLK  S     E D+  +  K +                 
Sbjct  83    CTES------EGGHVTEEFIPLKGRS-----EGDEGAEMGKDS-----------------  114

Query  571   ssdsskdgkVSKKQDWLRSAQLWN----------QSFTDPTPKEESPSN---------CK  693
                       S K+ W+  AQLW+          +S  +   + E  +N         C 
Sbjct  115   ----------SDKRSWMSCAQLWSCNRSSDNNNKKSVLEFQQRNEEDNNSGSENPIRPCS  164

Query  694   VGVKRNGSGGAFHPFKREKS------------AGTS--SPAVQTLDsttagvgngsgggg  831
              G +     GAF PFK                AG S  +P V+ +D   +    G+ G  
Sbjct  165   YGNR----AGAFVPFKVSSGFPAKGDKEVVPVAGLSLMTPMVE-VDPNNSNSKCGNSGET  219

Query  832   ggskkeeketQSQR---------------KQRRCWSPELHRRFLQALQQLGGSHVATPKQ  966
             G        T S R               KQRRCWSPELHRRF+ ALQQLGGS  ATPKQ
Sbjct  220   GSGSVSTLLTDSMRLQCKSQQQPPQQGIRKQRRCWSPELHRRFVNALQQLGGSQAATPKQ  279

Query  967   IRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             IRELM+V+GLTNDEVKSHLQKYRLH RR
Sbjct  280   IRELMQVEGLTNDEVKSHLQKYRLHVRR  307



>emb|CBI23283.3| unnamed protein product [Vitis vinifera]
Length=382

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 150/328 (46%), Gaps = 104/328 (32%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             EK+ +  +Y++ LE+E RKI  F+RELPLC+ L+  AI   +++               +
Sbjct  32    EKLSKLDDYVKGLEDEMRKIDGFKRELPLCMLLLNDAILRLREE-------------AMQ  78

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
             C+E       + G V EEFIPLK  S     E D+  +  K +                 
Sbjct  79    CTES------EGGHVTEEFIPLKGRS-----EGDEGAEMGKDS-----------------  110

Query  571   ssdsskdgkVSKKQDWLRSAQLWN----------QSFTDPTPKEESPSN---------CK  693
                       S K+ W+  AQLW+          +S  +   + E  +N         C 
Sbjct  111   ----------SDKRSWMSCAQLWSCNRSSDNNNKKSVLEFQQRNEEDNNSGSENPIRPCS  160

Query  694   VGVKRNGSGGAFHPFKREKS------------AGTS--SPAVQTLDsttagvgngsgggg  831
              G +     GAF PFK                AG S  +P V+ +D   +    G+ G  
Sbjct  161   YGNR----AGAFVPFKVSSGFPAKGDKEVVPVAGLSLMTPMVE-VDPNNSNSKCGNSGET  215

Query  832   ggskkeeketQSQR---------------KQRRCWSPELHRRFLQALQQLGGSHVATPKQ  966
             G        T S R               KQRRCWSPELHRRF+ ALQQLGGS  ATPKQ
Sbjct  216   GSGSVSTLLTDSMRLQCKSQQQPPQQGIRKQRRCWSPELHRRFVNALQQLGGSQAATPKQ  275

Query  967   IRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             IRELM+V+GLTNDEVKSHLQKYRLH RR
Sbjct  276   IRELMQVEGLTNDEVKSHLQKYRLHVRR  303



>ref|XP_010518594.1| PREDICTED: transcription factor LUX-like, partial [Camelina sativa]
Length=367

 Score =   142 bits (358),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 107/281 (38%), Positives = 132/281 (47%), Gaps = 82/281 (29%)
 Frame = +1

Query  310   VTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEE  489
             +  A+E YKQQL       N N  QS  +           PVLEEFIPL+          
Sbjct  3     LNNAVEFYKQQLEAYRANSN-NNNQSVPTR----------PVLEEFIPLR----------  41

Query  490   DDEQQSPKSANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDP---  660
                   P+  N                           K  +W+ + QLW++S T P   
Sbjct  42    ----NQPEKPN--------------------------IKGNNWMTTTQLWSESETKPKNI  71

Query  661   -------TPKEESPSNCKVG----VKRNGSGGAFHPFKREKS---------AGTSSPAVQ  780
                      K+E  S+ K+G     +RNG+G AF PF +E S             SP  +
Sbjct  72    DSTADQSLHKDEIASSPKLGHFDAKQRNGNG-AFLPFSKEHSLPELALSTEVKRVSPTSE  130

Query  781   TLDsttagvgng-------sggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLG  939
               +       +        +      +      +QS RK RRCWSP+LHRRF+QALQ LG
Sbjct  131   HTNGHDGNDESMINNDTNNNNNNSNNNGVSSTTSQSNRKARRCWSPDLHRRFVQALQMLG  190

Query  940   GSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             GS VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP+PS
Sbjct  191   GSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPSPS  231



>ref|XP_006601003.1| PREDICTED: two-component response regulator-like APRR2-like isoform 
X2 [Glycine max]
 gb|KHN25525.1| Myb family transcription factor APL [Glycine soja]
Length=356

 Score =   141 bits (356),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 110/318 (35%), Positives = 146/318 (46%), Gaps = 77/318 (24%)
 Frame = +1

Query  175   TIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGT  354
              + D A S +   +M   ++ ++ LE+E++KI+ F+RELPLC+ LV  AI   K+++ G 
Sbjct  20    ILGDIAKSKDGSRRMATIEDLVKRLEDEKKKIEAFKRELPLCMILVNDAISKLKEEIKGG  79

Query  355   TTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTd  534
                                   DE  V+EE + L + +S               AN    
Sbjct  80    VRM------------------KDEA-VVEELMKLMKTNS--------------EANGSLM  106

Query  535   ddddddnnnngdssdsskdgkVSKKQDWLRSAQLWN----------QSFTDPTPKEE---  675
                ++                 S  ++W+ S QLWN            F    P E+   
Sbjct  107   IVGNES----------------SDTKNWMNSVQLWNVETKQRNEEGDLFVPSNPIEQKND  150

Query  676   -SPSNCKVGVKRNGSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkee  852
              + S  K  +K N          +  S G  SPAV  L+      G G G     +   E
Sbjct  151   TNKSVSKTVMKDN------KKMSQVPSLGLMSPAVLELNHRKTESGYGHGSSMIITSSVE  204

Query  853   ketQSQ--------RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDE  1008
              +   Q        RKQRRCWSP+LHRRF+ ALQQLGG  VATPKQIRELM+V GLTNDE
Sbjct  205   IKGHHQSQQPQQNPRKQRRCWSPDLHRRFVDALQQLGGPQVATPKQIRELMQVVGLTNDE  264

Query  1009  VKSHLQKYRLHTRRPTPS  1062
             VKSHLQKYRLH +RP  S
Sbjct  265   VKSHLQKYRLHFKRPQGS  282



>ref|XP_003528384.1| PREDICTED: probable transcription factor KAN3-like [Glycine max]
 gb|KHN24368.1| Two-component response regulator ARR10 [Glycine soja]
Length=367

 Score =   140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 115/320 (36%), Positives = 144/320 (45%), Gaps = 89/320 (28%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N   K+    +++  L+ E  KIQ F+RELPLC+ L+  AI A K +             
Sbjct  35    NASVKVSLLDDFVHRLQLELAKIQAFKRELPLCMFLLNDAISALKVE-------------  81

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
                 SE+  +   +  PVLEEFIPLK+       E D  ++S K    R           
Sbjct  82    ----SEKCMACKSE--PVLEEFIPLKK-------ECDQREESEKEKECR-----------  117

Query  562   ngdssdsskdgkVSKKQDWLRSAQLWN-------------------QSFTDPTPKEESPS  684
                            K+ W+ S QLWN                       D   +EE  S
Sbjct  118   --------------DKKSWMSSFQLWNTDDKADINNNAYECDKKQNYGVEDKNNREERKS  163

Query  685   NCK----VGVKRNGSGGAFHPF------KREK--------SAGTSSPAVQTLDsttagvg  810
               K     G  RNG  G   PF      K  K        S  T   AV+      +G  
Sbjct  164   VAKDLFQYGGIRNGEKGFVMPFSTYPASKEVKEDCVFNGLSLQTPGTAVKNT-REGSGCR  222

Query  811   ngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVD  990
               S      +    ++ QS RKQRRCWSPELH RF++AL++LGGS   TPKQIRELM+VD
Sbjct  223   TSSCRVVSSAPSPLRQPQSGRKQRRCWSPELHSRFVKALEELGGSQATTPKQIRELMRVD  282

Query  991   GLTNDEVKSHLQKYRLHTRR  1050
             GLTNDEVKSHLQKYRLHT+R
Sbjct  283   GLTNDEVKSHLQKYRLHTQR  302



>ref|XP_009388926.1| PREDICTED: two-component response regulator-like APRR2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388928.1| PREDICTED: two-component response regulator-like APRR2 [Musa 
acuminata subsp. malaccensis]
Length=366

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 105/321 (33%), Positives = 149/321 (46%), Gaps = 92/321 (29%)
 Frame = +1

Query  223   RCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQ  402
             R +  I++LEEE+RKI+ F+RELPLC+ L+++ IE  ++++      C+   G+S     
Sbjct  41    RLEASIKSLEEEKRKIEAFRRELPLCMRLLSEVIEELRREID----RCH---GESF----  89

Query  403   TTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssds  582
                     G ++EEFIP+K  S +  D     +   K                       
Sbjct  90    --------GCIVEEFIPIK--SKVGDDGGIKVESDCKD----------------------  117

Query  583   skdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGV-------------KRNGSGG  723
                     K +W+ S QLW+ ++ +    +++ +  K GV             K   SG 
Sbjct  118   --------KMNWMSSVQLWSDNYIENNDDDKAIAKEKDGVVDRRQEEQSNLECKNRRSGA  169

Query  724   AFHPFK-----------------------REKSAGTSSPAVQT---LDsttagvgngsgg  825
             A   FK                        + +   S+P V T   +D            
Sbjct  170   ALSLFKGLPPLAARSMTEDKPTASLPELSLQSAVIKSNPDVVTPVTVDHRGGSAKGARKS  229

Query  826   ggggskkeeketQSQ--RKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLT  999
                       ++Q Q  RK+RRCWS ELHRRF+ A++QLGG+ VATPKQIRELMKV+GLT
Sbjct  230   PELFRATLSVQSQQQPPRKERRCWSQELHRRFVLAIEQLGGTQVATPKQIRELMKVEGLT  289

Query  1000  NDEVKSHLQKYRLHTRRPTPS  1062
             NDEVKSHLQKYRLH R+ T S
Sbjct  290   NDEVKSHLQKYRLHARKMTTS  310



>ref|XP_010652653.1| PREDICTED: uncharacterized protein LOC100243049 isoform X2 [Vitis 
vinifera]
Length=385

 Score =   138 bits (348),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 150/328 (46%), Gaps = 105/328 (32%)
 Frame = +1

Query  211   EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
             EK+ +  +Y++ LE+E RKI  F+RELPLC+ L+  AI   +++               +
Sbjct  36    EKLSKLDDYVKGLEDEMRKIDGFKRELPLCMLLLNDAILRLREE-------------AMQ  82

Query  391   CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
             C+E       + G V EEFIPLK  S     E D+  +  K +                 
Sbjct  83    CTES------EGGHVTEEFIPLKGRS-----EGDEGAEMGKDS-----------------  114

Query  571   ssdsskdgkVSKKQDWLRSAQLWN----------QSFTDPTPKEESPSN---------CK  693
                       S K+ W+  AQLW+          +S  +   + E  +N         C 
Sbjct  115   ----------SDKRSWMSCAQLWSCNRSSDNNNKKSVLEFQQRNEEDNNSGSENPIRPCS  164

Query  694   VGVKRNGSGGAFHPFKREKS------------AGTS--SPAVQTLDsttagvgngsgggg  831
              G +     GAF PFK                AG S  +P V+ +D   +    G+ G  
Sbjct  165   YGNR----AGAFVPFKVSSGFPAKGDKEVVPVAGLSLMTPMVE-VDPNNSNSKCGNSGET  219

Query  832   ggskkeeketQSQR---------------KQRRCWSPELHRRFLQALQQLGGSHVATPKQ  966
             G        T S R               KQRRCWSPELHRRF+ ALQQLGGS  ATPKQ
Sbjct  220   GSGSVSTLLTDSMRLQCKSQQQPPQQGIRKQRRCWSPELHRRFVNALQQLGGSQ-ATPKQ  278

Query  967   IRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             IRELM+V+GLTNDEVKSHLQKYRLH RR
Sbjct  279   IRELMQVEGLTNDEVKSHLQKYRLHVRR  306



>ref|XP_009381136.1| PREDICTED: probable transcription factor GLK2 [Musa acuminata 
subsp. malaccensis]
Length=399

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 118/223 (53%), Gaps = 20/223 (9%)
 Frame = +1

Query  601   SKKQDWLRSAQLWN------QSFTDPTPKE-ESPSNCKVGVKRNGSGGAFHPFKREKSAG  759
             S K +W+ SAQLW+      +    P PKE +      +   +  SGGAF PF REKS G
Sbjct  86    SDKANWMVSAQLWSPPDDAAKQQAAPPPKEADVIPKLALDTTKQRSGGAFLPFSREKSRG  145

Query  760   TSSPAVQTLDsttag-------------vgngsggggggskkeeketQSQRKQRRCWSPE  900
               + + + +                        G G     +      + RK RRCWSP+
Sbjct  146   AHATSAEKVVEEEKKCAELENEIVNTGRHSAADGHGNTADGQAAAAPPTHRKARRCWSPD  205

Query  901   LHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNNgs  1080
             LHRRF+ ALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRP P+      
Sbjct  206   LHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPIPAPHAAAG  265

Query  1081  qqqgpqfvvvggIWVpppeyaaamapppTSGEAATSNGIYAPV  1209
                 PQ VV+GGIWVPP    +A      +  A      Y+PV
Sbjct  266   AGAPPQLVVLGGIWVPPEYATSAGPAMYGAHAAPVPREFYSPV  308


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 5/82 (6%)
 Frame = +1

Query  193  ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
            A+   PE+ ++ QE++  LEEER KI+VF+RELPLC++L+  AIE YKQQL        +
Sbjct  22   AAGAQPEQNQKIQEFLARLEEERHKIEVFKRELPLCMQLLNNAIEIYKQQLQERVPLKYM  81

Query  373  NIGQSE-----CSEQTTSSDDD  423
            N+  S+      S Q  S  DD
Sbjct  82   NVDGSDKANWMVSAQLWSPPDD  103



>ref|XP_009397289.1| PREDICTED: uncharacterized protein LOC103982178 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=360

 Score =   135 bits (341),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 107/334 (32%), Positives = 142/334 (43%), Gaps = 105/334 (31%)
 Frame = +1

Query  193   ASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNL  372
             A+T    +  R  E I+ LEEE+RKI+ FQRELPLC+ L+ + I+  K++       C  
Sbjct  30    AATESAGRAARLVESIKILEEEKRKIEAFQRELPLCMHLLGEVIDGLKKETERCGGGCF-  88

Query  373   NIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTddddddd  552
                               G VL+E +P++     S+ EED E +                
Sbjct  89    ------------------GRVLQELLPVE-----SRVEEDGEVK----------------  109

Query  553   nnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCKVGVKRN-------  711
                            V  K +W+ SAQLW+ ++ +     E+      G K+        
Sbjct  110   ---------------VDDKMNWMSSAQLWSDNYGENDISHENHEVMICGKKKEELFVIFF  154

Query  712   -----------------------------GSGGAFHPFKREKSAGTSS----PAVQTLD-  789
                                          G  GAF PF+   +   SS    PA    D 
Sbjct  155   LLTWIFHFWSRQEGRRQGKENLFLECKSPGGDGAFLPFEALSTVSASSEEKKPAAALPDR  214

Query  790   ---------sttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGG  942
                         A   + +     G    + + Q  RK RRCWS ELHRRF  A+QQLGG
Sbjct  215   RGCGRGPKSVGRAPESSPAPATVCGRLGFQSQHQPSRKARRCWSQELHRRFTVAIQQLGG  274

Query  943   SHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHT  1044
             + VATPKQIRE+MKV+GLTNDEVKSHLQKYRLH 
Sbjct  275   AQVATPKQIREVMKVEGLTNDEVKSHLQKYRLHA  308



>emb|CDP02468.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   135 bits (341),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 110/341 (32%), Positives = 154/341 (45%), Gaps = 96/341 (28%)
 Frame = +1

Query  154   SISAMLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAY  333
             SIS +L  +   +   + P K+ +  +Y+  LE+E +KI  F+RELPLC+ L+  AI   
Sbjct  22    SISDLLAEV---SMIPDIPLKLSKLNDYVCVLEQEMKKIDGFRRELPLCMLLLNDAIWKL  78

Query  334   KQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPK  513
             K+++        + + + E           E  V+EEF+PLK  S     + +DE+   K
Sbjct  79    KEEV--------VKLKKREV----------ETVVMEEFMPLKGNS-----DREDERPKRK  115

Query  514   SANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNCK  693
             SA+                          + K+ W+ SAQLW    T P   E   S+  
Sbjct  116   SADW-------------------------TDKKTWMSSAQLW----TTPIQYENERSD--  144

Query  694   VGVKR-----------NGSGGAFHPFKREKSA-------------------GTSSPAVQT  783
              G  R              GGAF PFK+   A                     S PA+  
Sbjct  145   -GAARWSLSDQARSFNKKLGGAFLPFKKPGGAVVTKTEEEEEEEDYPLNGLSLSMPALAE  203

Query  784   LDsttagvgngsggggggskkeeketQSQ--------RKQRRCWSPELHRRFLQALQQLG  939
             + S       G   G          ++          +KQRRCWS +LH+ F++AL +LG
Sbjct  204   VGSDDLTNSKGKHVGVASDDGTGVLSEGGSSSQTTQGKKQRRCWSHDLHQNFVKALFELG  263

Query  940   GSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPS  1062
             G+  ATPK IRE+M+VDGLTNDEVKSHLQKYRLH R+  PS
Sbjct  264   GAQAATPKHIREIMQVDGLTNDEVKSHLQKYRLHIRKLMPS  304



>ref|XP_007155959.1| hypothetical protein PHAVU_003G246900g [Phaseolus vulgaris]
 gb|ESW27953.1| hypothetical protein PHAVU_003G246900g [Phaseolus vulgaris]
Length=361

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 101/306 (33%), Positives = 134/306 (44%), Gaps = 89/306 (29%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             +++++ LE+E+RKI  F+RELPLC+ LV  AI   K++++G                   
Sbjct  38    EDFLQKLEDEKRKIDSFKRELPLCMLLVNDAITKLKEEINGGVRM---------------  82

Query  409   SSDDDEGPVLEEFIPLKRASS-----LSQDEEDDEQQSPKSANHRTdddddddnnnngds  573
                  E PV+EE+IPL + +S     LS D E                            
Sbjct  83    ----HEEPVVEEYIPLMKTNSEGSETLSMDTER---------------------------  111

Query  574   sdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSNC----------------KVGVK  705
                      S  ++W+ S +LWN    +  P+ E    C                   + 
Sbjct  112   ---------SNMKNWINSVRLWN---VESKPRNEEDGRCVPNNPNQAQNETNKSRGAPLA  159

Query  706   RNGSGGAFHPFKREK-------SAGTSSPAVQTLDsttagvgngsggggggskkeeketQ  864
              NG+         E        S G   P  +  +  T             S + + E  
Sbjct  160   LNGNNRVSKTVMSEDKGVSQIPSLGLMRPVFELNNRKTESGNEHGSSLITSSSEIKCEAP  219

Query  865   SQRKQRR---CWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYR  1035
              Q+  R+   CWSPELHRRF+ ALQQLGG  VATPKQIRELM+V GLTNDEVKSHLQKYR
Sbjct  220   PQQNPRKQRRCWSPELHRRFVDALQQLGGPQVATPKQIRELMQVVGLTNDEVKSHLQKYR  279

Query  1036  LHTRRP  1053
             LH RRP
Sbjct  280   LHFRRP  285



>ref|XP_011099214.1| PREDICTED: uncharacterized protein LOC105177678 isoform X2 [Sesamum 
indicum]
Length=318

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 133/309 (43%), Gaps = 92/309 (30%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             ++ +K  +   Y+ +LEEE RK+  F+RELP C++L+  AIE  K+              
Sbjct  39    DFSKKSSKLDFYVHSLEEEMRKVDAFKRELPHCMQLLRDAIETLKK--------------  84

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRAS------SLSQDEEDDEQQSPKSANHRTdddd  543
                  E       + GPV+EEFIPLK  S       LS D                    
Sbjct  85    -----ESLRWKGREMGPVMEEFIPLKGDSEGGGRAKLSTD--------------------  119

Query  544   dddnnnngdssdsskdgkVSKKQDWLRSAQLW-------NQ-SFTDPTPKEESPSNCKVG  699
                                S+K++W+ S QLW       NQ S      + +      + 
Sbjct  120   ------------------FSEKKNWMSSVQLWSTPVHYENQDSVLSLRSRHQEEEGSGID  161

Query  700   VKRNG------SGGAFHPFKREKSA--------------GTSSPAVQTLDsttagvgngs  819
              +  G      SGGAF PFK+                  G  S ++   +          
Sbjct  162   SQFQGCNNIKNSGGAFLPFKKAPGLSIKEQKRDSASAVNGGLSLSIPVAELELESESPDL  221

Query  820   ggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLT  999
                   S     + Q QRKQRRCWSPELH+RF+ ALQ LGG+  ATPKQIRELMKVDGLT
Sbjct  222   ISVKEPSAFLRPQLQ-QRKQRRCWSPELHKRFVDALQHLGGAQTATPKQIRELMKVDGLT  280

Query  1000  NDEVKSHLQ  1026
             NDEVKSHLQ
Sbjct  281   NDEVKSHLQ  289



>ref|XP_007153166.1| hypothetical protein PHAVU_003G012400g [Phaseolus vulgaris]
 gb|ESW25160.1| hypothetical protein PHAVU_003G012400g [Phaseolus vulgaris]
Length=325

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 137/284 (48%), Gaps = 69/284 (24%)
 Frame = +1

Query  229   QEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTT  408
             Q+++  LE E  KIQ F+RELPLC+ L+  AI A K +L+   T       +SE      
Sbjct  43    QDFLSRLELELLKIQPFKRELPLCMFLLNDAISALKVELAKCRT------FKSE------  90

Query  409   SSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdssk  588
                    PVLEEFIPLK+  S  +++                                  
Sbjct  91    -------PVLEEFIPLKKEESEKEEKC---------------------------------  110

Query  589   dgkVSKKQDWLRSAQLWNQSFTDPTPK------EESPSNCKVGVKRNGSGGAFHPFK---  741
                  +K DW  S QLWN    +   +      E+ P   K   + +   G   P     
Sbjct  111   ----REKNDWGSSFQLWNSDDDEACNRSNAYRLEQKPKKIKGEERESVKRGFVMPLSTYL  166

Query  742   -REKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWSPELHRRFL  918
               ++    S  ++QT      G G+ +      +       QS RKQRRCWSPELH RF+
Sbjct  167   ATDEECVVSGLSLQT--PAREGCGSKTSRVVSSATSPLMLPQSGRKQRRCWSPELHHRFV  224

Query  919   QALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             +AL++LGGS  ATPKQIRELM+VDGLTNDEVKSHLQKYRLHTRR
Sbjct  225   KALEELGGSQ-ATPKQIRELMRVDGLTNDEVKSHLQKYRLHTRR  267



>ref|XP_010526733.1| PREDICTED: uncharacterized protein LOC104804217 [Tarenaya hassleriana]
Length=354

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 137/292 (47%), Gaps = 54/292 (18%)
 Frame = +1

Query  178   IHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTT  357
             +H+ +   + P  +     +++ LEEERRKI VF+RELPLC+ L+ +AI   K++     
Sbjct  29    LHEVSQINDCPSALSEIHGFVDRLEEERRKIDVFKRELPLCMLLLNEAIGRLKEE----A  84

Query  358   TECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdd  537
             T C    G     E +    DD G            + +  D+++               
Sbjct  85    TRC-AEAGDGSAVEGSNRKFDDGG-----------GAKVENDKKN---------------  117

Query  538   dddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEES-PSNCKVGVKRNG  714
                                 +S  Q W+ ++    QS  +   ++ S P N         
Sbjct  118   -------------------WMSSAQLWISNSDSQMQSRNEEEEEDRSAPPNPSPSCNFAN  158

Query  715   SGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRCWS  894
              GG F PF R    G+  P   TL    + +            K   + Q +++QRR WS
Sbjct  159   KGGEFPPFSR--LYGSCHPPPLTLMPPASVMVVNCRVDRHQPSKPSNQNQ-KKEQRRRWS  215

Query  895   PELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR  1050
             PELHR+F+ ALQ+LGGS VATPKQIRELM+V GLTNDEVKSHLQKYR+H R+
Sbjct  216   PELHRKFIDALQRLGGSKVATPKQIRELMQVQGLTNDEVKSHLQKYRIHVRK  267



>ref|XP_010249933.1| PREDICTED: transcription factor LUX-like [Nelumbo nucifera]
Length=457

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  862   QSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH  1041
             Q+ RK RRCWSP+LHRRF+ ALQ LGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH
Sbjct  241   QTHRKARRCWSPDLHRRFVNALQILGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH  300

Query  1042  TRRPTPS  1062
             TRRP+PS
Sbjct  301   TRRPSPS  307


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 96/209 (46%), Gaps = 71/209 (34%)
 Frame = +1

Query  205  YPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQ  384
            + ++ +  +E +  LEEER KI   +RELPLC++L+T A+EA +QQL             
Sbjct  23   FGDQTQNLEEILSRLEEERIKIDGLKRELPLCMQLLTNAMEALRQQL-------------  69

Query  385  SECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnn  564
                 QT  ++    PVLEEFIPLK + S         + S K+A+              
Sbjct  70   -----QTYRTNQGPRPVLEEFIPLKHSGS---------EGSEKAAS--------------  101

Query  565  gdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEE---------------SPSNCKVG  699
                       +S+K  W+ +AQLW+QS +D   KE+               SP      
Sbjct  102  -----------ISEKVSWMTTAQLWSQS-SDGINKEQATVASAKEGDHCFSVSPKLALDN  149

Query  700  VKRNGSGGAFHPFKREKSAGTSSPAVQTL  786
             +RN  GGAF PF +EKS+  ++P +  L
Sbjct  150  KQRN--GGAFLPFSKEKSS-CATPTLSVL  175



>ref|XP_007156835.1| hypothetical protein PHAVU_002G021400g [Phaseolus vulgaris]
 gb|ESW28829.1| hypothetical protein PHAVU_002G021400g [Phaseolus vulgaris]
Length=397

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 98/300 (33%), Positives = 139/300 (46%), Gaps = 64/300 (21%)
 Frame = +1

Query  190   AASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECN  369
             +A+ +  +K+     +++ LE+E RK++ F+RELPLC+ L+  AI   K+          
Sbjct  73    SANRDKRDKVATLDGFVQRLEDELRKVEAFKRELPLCMLLLNDAIARLKE----------  122

Query  370   LNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddd  549
                      E+   S   + P  EEF+P K  S   ++E                     
Sbjct  123   ---------EKGKCSISQDPPTSEEFMPPKTISGGKENER--------------------  153

Query  550   dnnnngdssdsskdgkVSKKQDWLRSAQLWN-------QSFTDPTPKEESPSNCKVGVKR  708
                               +K++W+ SAQLW+          +D +  E          ++
Sbjct  154   -----------------CEKKNWMSSAQLWSTQKIKSRNEESDRSVPENPIDGNSCAPRK  196

Query  709   NGSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQSQRKQRRC  888
              GS           S  + S +      T++G            +  +   Q+ RKQRRC
Sbjct  197   EGSQIPSFSLMGHASELSHSNSKSVCGDTSSGSSLLRVEVQSQPQPPQHMQQNPRKQRRC  256

Query  889   WSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLHTRR-PTPSI  1065
             WSPELHRRF+ ALQQLGG+ VATPKQIRELM+V+ LTNDEVKSHLQKYRLH RR P  S+
Sbjct  257   WSPELHRRFVDALQQLGGAQVATPKQIRELMQVESLTNDEVKSHLQKYRLHVRRFPVSSV  316



>ref|XP_010540320.1| PREDICTED: probable transcription factor KAN3 isoform X2 [Tarenaya 
hassleriana]
Length=406

 Score =   130 bits (328),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 103/340 (30%), Positives = 156/340 (46%), Gaps = 73/340 (21%)
 Frame = +1

Query  178   IHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTT  357
             + + +A  +  E++ + +++++  E E +KI  F+RELPLC+ L+  AI   K+      
Sbjct  25    LKEVSAIGDVSERVSKLEDFVKEFEGEMKKIDGFKRELPLCMLLLNDAISFLKE------  78

Query  358   TECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdd  537
                          E    S  + GPVLEEFIPLK+ +   + ++DDE+   +     +  
Sbjct  79    -------------ETKKFSARNVGPVLEEFIPLKKRNREEEQDKDDEETEDEEEKGNS--  123

Query  538   dddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEESPSN----CKVGVK  705
                        +    +D +  +K +W+ S QLW   +    P     S+    C+V  K
Sbjct  124   -----------TKWIKRDKETREKTNWVSSFQLWKPDYYTSNPVNRKYSDHRITCRVESK  172

Query  706   RN----GSGGAFHPF--------------------------------KREKSAGTSSPAV  777
             RN     +G +  PF                                  ++  G+S   V
Sbjct  173   RNEENLTNGSSSRPFLPCKGFESFSSRNGEEEISSAQRLSLLSPAMKNGKEETGSSLGLV  232

Query  778   QTLDsttagvgngsggggggskkeeketQSQRKQRR-CWSPELHRRFLQALQQLGGSHVA  954
              +L   ++                   +Q   +++R CWSP+LHR FL ALQ+LGG  VA
Sbjct  233   ASLSLPSSAPEVNLNAQSVIRLPPPSLSQQTSRKQRRCWSPDLHRSFLNALQELGGPQVA  292

Query  955   TPKQIRELMKVDGLTNDEVKSHLQKYRLHTRRPTPSIRNN  1074
             TPKQIRELM+V+GLTNDEVKSHLQKYRLH R+  P   N+
Sbjct  293   TPKQIRELMQVEGLTNDEVKSHLQKYRLHARKLHPGNSNS  332



>gb|KCW86362.1| hypothetical protein EUGRSUZ_B03044 [Eucalyptus grandis]
Length=262

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 111/266 (42%), Positives = 134/266 (50%), Gaps = 37/266 (14%)
 Frame = +1

Query  205  YPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLS--GTTTECNLNI  378
            YPE+ R    Y+EALEEERRKIQVF+RELPLCLELV QAIE  KQQLS  G ++ECN   
Sbjct  3    YPERTR---SYVEALEEERRKIQVFERELPLCLELVIQAIERCKQQLSVQGHSSECN---  56

Query  379  GQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnn  558
                 SEQT+    D+G VLE FIPLK   S       D+ +          D D D + 
Sbjct  57   -----SEQTSM---DDGRVLEVFIPLKGPYS------GDDDEDDACEEEGDGDGDGDGDV  102

Query  559  nngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEE-------SPSNCKVGVKRN--  711
            ++    D   D    +K DWLRSAQLWN +  DP P  E        P + +V    N  
Sbjct  103  HHSSRDDKGGDDNAMEKSDWLRSAQLWNPN-PDPIPHREVQDPPPPPPPSKEVAAVANHL  161

Query  712  --GSGGAFHPFKREKSAGTSSPAVQTLDsttagvgngsggggggskkeeketQ-SQRKQR  882
                 GAF PF+       S+   Q      +   + +      +       Q +QRKQR
Sbjct  162  KSHESGAFRPFR--IGENNSTKKKQPPGRAASPAPDAAACSTAETASGRTSKQAAQRKQR  219

Query  883  RCWSPELHRRFLQALQQLGGSHVATP  960
            RCWS ELHR FL ALQQLGG     P
Sbjct  220  RCWSTELHRGFLHALQQLGGPDGLCP  245



>ref|XP_003555716.1| PREDICTED: uncharacterized protein LOC100809323 isoform X1 [Glycine 
max]
 ref|XP_006605466.1| PREDICTED: uncharacterized protein LOC100809323 isoform X2 [Glycine 
max]
 gb|KHM98998.1| Two-component response regulator ARR10 [Glycine soja]
Length=368

 Score =   129 bits (325),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 141/320 (44%), Gaps = 89/320 (28%)
 Frame = +1

Query  202   NYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIG  381
             N   K+    +++  LE E  KIQ F+RELPLC+ L+  AI A K +             
Sbjct  35    NASHKVSLLDDFVHRLELELAKIQAFKRELPLCMFLLNDAISALKVE-------------  81

Query  382   QSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnn  561
                 SE+  +   +  PV EEFIPLK+       E D  ++  K    R           
Sbjct  82    ----SEKCRACKSE--PVFEEFIPLKK-------ECDQRKEIEKEKECR-----------  117

Query  562   ngdssdsskdgkVSKKQDWLRSAQLW-------------------NQSFTDPTPKEESPS  684
                            K++W+ S QLW                   N    +    E+  S
Sbjct  118   --------------DKKNWMSSFQLWNNDDKADNNNNAYECDKKHNYRVENKNNGEKRKS  163

Query  685   NCK----VGVKRNGSGGAFHPF------KREK--------SAGTSSPAVQTLDsttagvg  810
               K     G  RNG  G   PF      K EK        S  T   AV++    +    
Sbjct  164   VTKDLFQYGRIRNGEKGFVIPFSSYPATKEEKEDCVANGLSLQTPGTAVKSTREGSGCRT  223

Query  811   ngsggggggskkeeketQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVD  990
             +    G        +   S+++ RRCWSPELH RF++AL+ LGGS  ATPKQIRELM+VD
Sbjct  224   SSCRVGSSAPSPLHQPQSSRKQ-RRCWSPELHSRFIKALEVLGGSQAATPKQIRELMRVD  282

Query  991   GLTNDEVKSHLQKYRLHTRR  1050
             GLTNDEVKSHLQKYRLHT+R
Sbjct  283   GLTNDEVKSHLQKYRLHTQR  302



>ref|XP_009397728.1| PREDICTED: probable transcription factor KAN3 [Musa acuminata 
subsp. malaccensis]
Length=359

 Score =   129 bits (324),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 134/304 (44%), Gaps = 92/304 (30%)
 Frame = +1

Query  262   RKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLE  441
             RKI+ F+RE+P+C+ L+ + IE  +           + I +  C        +  G V E
Sbjct  53    RKIEAFRREVPICMRLLREVIERLR-----------MEIERCRC--------ESFGHVFE  93

Query  442   EFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngdssdsskdgkVSKKQDWL  621
             EF+PLK     S+ E+D   +                                  K +W+
Sbjct  94    EFMPLK-----SKVEDDGGVKVETDCR---------------------------DKMNWM  121

Query  622   RSAQLWNQSFTDPTPKEESPSNCKVGV-------------KRNGSGGAFHPFKREK----  750
              S QLW+ ++++   +E+  SN + G              K   SG  F PFK       
Sbjct  122   SSVQLWSDNYSENDDEEKIVSNEQDGAVDHRQGKGKSLECKSRSSGVEFLPFKALSPLAA  181

Query  751   --------------SAGTSSPAV-QTLDsttagvg---------ngsggggggskkeeke  858
                                SPA+ +TLD  T               +      +   +  
Sbjct  182   SSEEEEEKPASALPELSLQSPAINRTLDLVTPVALGDHRGFGGFRKATEWVPATLGLQSR  241

Query  859   tQSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRL  1038
              Q  RK RRCWS ELHRRF+ A+QQLGG+ VATPKQIRELMKVDGLTNDEVKSHLQKYRL
Sbjct  242   LQPPRKARRCWSQELHRRFVLAIQQLGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRL  301

Query  1039  HTRR  1050
             HT R
Sbjct  302   HTER  305



>ref|XP_009766395.1| PREDICTED: uncharacterized protein LOC104217775 [Nicotiana sylvestris]
Length=421

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  862   QSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH  1041
             Q  RK RRCWSP+LHRRF+ ALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLH
Sbjct  223   QQHRKARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH  282

Query  1042  TRRPTPS  1062
             TRRP+PS
Sbjct  283   TRRPSPS  289


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 68/143 (48%), Gaps = 47/143 (33%)
 Frame = +1

Query  211  EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
            ++ +  +E++  LEEER KI  F+RELPLC++L+T A+EA +QQL               
Sbjct  30   DQTQNLEEFVARLEEERVKIDAFKRELPLCMQLLTNAMEASRQQL---------------  74

Query  391  CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
               Q+   +    PVLEEFIPLK  +++    E++E+    + +H               
Sbjct  75   ---QSYRENQGRKPVLEEFIPLKNNNAIG---EENEKTIANTTDH---------------  113

Query  571  ssdsskdgkVSKKQDWLRSAQLW  639
                        K +W+ SAQLW
Sbjct  114  -----------NKANWMTSAQLW  125



>ref|XP_010254263.1| PREDICTED: probable transcription factor GLK2 [Nelumbo nucifera]
Length=455

 Score =   130 bits (327),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  862   QSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH  1041
             Q+ RK RRCWSP+LHRRF+ ALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLH
Sbjct  244   QTHRKARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH  303

Query  1042  TRRPTPS  1062
             TRRP+PS
Sbjct  304   TRRPSPS  310


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/205 (30%), Positives = 94/205 (46%), Gaps = 65/205 (32%)
 Frame = +1

Query  211  EKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAYKQQLSGTTTECNLNIGQSE  390
            ++ ++ +E++  LEEER KI  F+RELPLC++L+T A+EA +QQL               
Sbjct  28   DQTQKLEEFLYRLEEERLKIDAFKRELPLCMQLLTNAMEASRQQL---------------  72

Query  391  CSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPKSANHRTdddddddnnnngd  570
               QT  ++    PVLEEFIPLK ++S    ++  E+ S                     
Sbjct  73   ---QTYRTNQVSRPVLEEFIPLKHSAS----DQGLEKAS---------------------  104

Query  571  ssdsskdgkVSKKQDWLRSAQLWNQS--------FTDPTPKEESPSNCKVGVK-----RN  711
                      S+   W+ +AQLW+QS         T  + KE       V  K     + 
Sbjct  105  --------TASEMASWMTTAQLWSQSSDGSKQQPATAASAKEVGDQCFSVSPKLALDSKQ  156

Query  712  GSGGAFHPFKREKSAGTSSPAVQTL  786
             +GGAF PF +E++   +SP ++ L
Sbjct  157  RNGGAFLPFSKERNT-CASPTLRGL  180



>ref|XP_010049950.1| PREDICTED: transcription factor LUX isoform X2 [Eucalyptus grandis]
 gb|KCW82779.1| hypothetical protein EUGRSUZ_C04155 [Eucalyptus grandis]
Length=479

 Score =   130 bits (327),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  862   QSQRKQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH  1041
             Q+ RK RRCWSP+LHRRF+ ALQ LGGS VATPKQIRELMKVDGLTNDEVKSHLQKYRLH
Sbjct  251   QTHRKARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH  310

Query  1042  TRRPTPS  1062
             TRRP+PS
Sbjct  311   TRRPSPS  317


 Score = 89.7 bits (221),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 68/222 (31%), Positives = 104/222 (47%), Gaps = 67/222 (30%)
 Frame = +1

Query  154  SISAMLITIHDPAASTNYPEKMRRCQEYIEALEEERRKIQVFQRELPLCLELVTQAIEAY  333
            S S +L +  D  A+    ++ ++ +E++  LEEER KI  F+RELPLC++L+T A+E  
Sbjct  15   SYSMLLKSFGDHHAA----DQTQKLEEFLARLEEERLKIDAFKRELPLCMQLLTNAVEVS  70

Query  334  KQQLSGTTTECNLNIGQSECSEQTTSSDDDEGPVLEEFIPLKRASSLSQDEEDDEQQSPK  513
            KQQL                  Q   ++    PVLEEFIPLK +SS         + S K
Sbjct  71   KQQL------------------QAYRANSGPRPVLEEFIPLKNSSS---------EGSEK  103

Query  514  SANHRTdddddddnnnngdssdsskdgkVSKKQDWLRSAQLWNQSFTDPTPKEES--PSN  687
            + N                         +S K  W+ SAQLW+Q+  D   K++S  P  
Sbjct  104  TPN-------------------------LSDKATWMTSAQLWSQTSNDNPNKQQSLAPKE  138

Query  688  CKVGV---------KRNGSGGAFHPFKREKSAGTSSPAVQTL  786
              +G           ++ +GGAF PF +E++    SP+++ L
Sbjct  139  TDIGFNVSPKFSLENKSRNGGAFLPFSKERNGSCPSPSLRAL  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4149190095066